3WSGA

Reduced hcgd from methanocaldococcus jannaschii with citrate
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
248
structure length
248
Chain Sequence
EVVNMKAKEIIEFIETFAPKDLAIEGDNIGLQVGDNLDKEIKKLGIALDPSLSVIKKAEKEGVDFLFTHHPLLKDPIRNFTGVIYKKLKILMENDIILYSAHTNLDICKNGLNDALAELYNLENPKPLYDNGLGRVGIFKGSFEEFLEITKKYIHKNPIVVKSKEVDDNFKLAVLSGYGLSQSSIKYVAEKADVYLSGDLTHHSKILAEELGLVVVDATHYSTEVFGLKKFKEFLSSNLDLEIISLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative GTP cyclohydrolase 1 type 2
publication title A possible iron delivery function of the dinuclear iron center of HcgD in [Fe]-hydrogenase cofactor biosynthesis
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 89
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 3wsgA01
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 3wsgA02
3WSFA 1NMPA 4IWMA 3WSDA 3WSIA 2FYWA 3WSHA 3WSEA 4IWGA 3WSGA 1NMOA 2YYBA
chains in the Genus database with same CATH superfamily
4IHHA 3L31A 4QF5A 2IOJA 3EEQA 3WSHA 4CVMA 4IHGA 4E75A 2IU9A 3EH0A 2YYBA 2IU8A 4IHFA 1E8CA 4ZIYA 2IUAA 3WSDA 4C12A 1GG4A 3WSEA 4IWGA 2XJAA 3WSFA 1NMPA 2AM1A 4IWMA 4E79A 1NMOA 4C13A 1KO7A 3PMOA 4CVKA 4CVLA 1KNXA 3ZL8A 3ZM5A 2FYWA 4BUBA 2WTZA 4QDIA 3WSGA 3L2BA 3ZM6A 3WSIA 2AM2A
chains in the Genus database with same CATH topology
3WSFA 1NMPA 4IWMA 3WSDA 3WSIA 2FYWA 3WSHA 3WSEA 4IWGA 3WSGA 1NMOA 2YYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WSF A;  1NMP A;  4IWM A;  3WSD A;  3WSI A;  2FYW A;  3WSH A;  3WSE A;  4IWG A;  3WSG A;  1NMO A;  2YYB A; 
#chains in the Genus database with same CATH topology
 4IHH A;  3L31 A;  4QF5 A;  2IOJ A;  3EEQ A;  3WSH A;  4CVM A;  4IHG A;  4E75 A;  2IU9 A;  3EH0 A;  2YYB A;  2IU8 A;  4IHF A;  1E8C A;  4ZIY A;  2IUA A;  3WSD A;  4C12 A;  1GG4 A;  3WSE A;  4IWG A;  2XJA A;  3WSF A;  1NMP A;  2AM1 A;  4IWM A;  4E79 A;  1NMO A;  4C13 A;  1KO7 A;  3PMO A;  4CVK A;  4CVL A;  1KNX A;  3ZL8 A;  3ZM5 A;  2FYW A;  4BUB A;  2WTZ A;  4QDI A;  3WSG A;  3L2B A;  3ZM6 A;  3WSI A;  2AM2 A; 
#chains in the Genus database with same CATH homology
 3WSF A;  1NMP A;  4IWM A;  3WSD A;  3WSI A;  2FYW A;  3WSH A;  3WSE A;  4IWG A;  3WSG A;  1NMO A;  2YYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...