The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
92
|
sequence length |
244
|
structure length |
244
|
Chain Sequence |
MKAKEIIEFIETFAPKDLAIEGDNIGLQVGDNLDKEIKKLGIALDPSLSVIKKAEKEGVDFLFTHHPLLKDPIRNFTGVIYKKLKILMENDIILYSAHTNLDICKNGLNDALAELYNLENPKPLYDNGLGRVGIFKGSFEEFLEITKKYIHKNPIVVKSKEVDDNFKLAVLSGYGLSQSSIKYVAEKADVYLSGDLTHHSKILAEELGLVVVDATHYSTEVFGLKKFKEFLSSNLDLEIISLDF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Metal binding protein
|
molecule keywords |
Putative GTP cyclohydrolase 1 type 2
|
publication title |
A possible iron delivery function of the dinuclear iron center of HcgD in [Fe]-hydrogenase cofactor biosynthesis
pubmed doi rcsb |
source organism |
Methanocaldococcus jannaschii
|
total genus |
92
|
structure length |
244
|
sequence length |
244
|
chains with identical sequence |
B, C, D, E, F, G, H, I, J, K, L
|
ec nomenclature | |
pdb deposition date | 2014-03-13 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 | NIF3 (NGG1p interacting factor 3)-like | ||
Alpha Beta | 3-Layer(aba) Sandwich | Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 | NIF3 (NGG1p interacting factor 3)-like |
#chains in the Genus database with same CATH superfamily 3WSG A; 2YYB A; 1NMO A; 4IWM A; 2FYW A; 4IWG A; 3WSD A; 3WSI A; 3WSE A; 3WSF A; 3WSH A; 1NMP A; #chains in the Genus database with same CATH topology 4IHG A; 2AM1 A; 2AM2 A; 2WTZ A; 3ZM5 A; 4QF5 A; 4C13 A; 3L31 A; 3WSE A; 1E8C A; 4C12 A; 4CVL A; 2IU9 A; 1KO7 A; 1KNX A; 1NMP A; 3WSG A; 3WSI A; 4QDI A; 4E79 A; 1NMO A; 2YYB A; 4CVM A; 2XJA A; 4IWG A; 3PMO A; 1GG4 A; 3WSH A; 3ZL8 A; 2IUA A; 4IHH A; 4CVK A; 3L2B A; 4IWM A; 2FYW A; 3EH0 A; 2IU8 A; 3EEQ A; 2IOJ A; 4ZIY A; 4E75 A; 3WSD A; 3ZM6 A; 4IHF A; 4BUB A; 3WSF A; #chains in the Genus database with same CATH homology 3WSG A; 2YYB A; 1NMO A; 4IWM A; 2FYW A; 4IWG A; 3WSD A; 3WSI A; 3WSE A; 3WSF A; 3WSH A; 1NMP A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...