3WT3A

New crystal form of a hyperthermophilic endocellulase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
270
Chain Sequence
b'KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQEVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase A
publication title A new crystal form of a hyperthermophilic endocellulase
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 72
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wt3A00
4HKWA 1REDA 3WXPA 3VHNA 3ZSEA 1XYNA 3O7OA 3B7MA 2NQYA 3AMHA 3AMMA 3RI8A 3VZLA 3VGIA 3WP4A 3MFAA 1XXNA 1IGOA 5K7PA 3WQ0A 3WQ1A 3B5LB 1BCXA 2BW8A 2D98A 1W2UA 4NPRA 1UU6A 3MF9A 3WR0A 3LB9A 3WT3A 2VUJA 1HIXA 1OA3A 2VG9A 4XQ4A 4S2HA 2DCZA 4HK9A 1M4WA 2B46X 3VL8A 1UKRA 3AMQA 3AKTA 3VLBB 1QH6A 1PVXA 1REEA 3HD8B 3M4FA 1AXKA 3WX5A 1XYOA 2DCYA 1XNCA 2C1FA 2DFBA 2VULA 1BK1A 4XPVA 2DCJA 1H1AA 1UU5A 3VHOA 3EXUA 2BWAA 1H0BA 1OLRA 2QZ2A 1C5HA 4S2FA 2JEMA 1H8VA 1BVVA 3VZKA 2DCKA 3WP5A 3VZJA 4XQWA 3WQ7A 2DFCA 4XQDA 1REFA 3VHPA 1XNBA 3WY6A 4S2DA 2JENA 1OLQA 1YNAA 3WP6A 3MFCA 4HKOA 1T6GC 1H4HA 2F6BA 1KS4A 1XNDA 1XNKA 3LGRA 1XYPA 1OA4A 2BVVA 2NLRA 3AKPA 3AKSA 4IXLA 3VZOA 4HK8A 1UU4A 5K9YA 1ENXA 1KS5A 3AMNA 5EJ3A 3AKQA 3AKRA 2D97A 2VGDA 1C5IA 1F5JA 4H7MA 2QZ3A 2B42B 2Z79A 2JICA 3VZMA 1TE1B 4HKLA 3AMPA 1OA2A 3RI9A 1NLRA 2BWCA 1QH7A 3VL9A 1H4GA 3MF6A 2B45X 4S2GA 5HXVA 1HV1A 3VZNA 1HV0A 3WP3A
chains in the Genus database with same CATH superfamily
3LD8A 5D8AA 2OQ6A 2X5IA 3PMEA 2JJ6A 2ZBJA 2ZEWA 3HT1A 3LKJA 4A3ZA 2A3WA 1SFNA 1DDLA 1YIPA 4XDOA 4YGBA 5JOXA 3RS6A 3MW3A 3LIHA 3ZIWA 1RMU2 4LBQB 2DBNA 4CDUA 3WQ0A 5BNQA 1FOD1 2JX9A 2OVUA 4GMP0 4MZUA 4OHXA 1NX9A 3TYJA 2BUKA 1HB4A 2PN5A 5T5LA 1QIQA 4NPRA 2XJQA 3K3OA 1HN1A 1JYVA 3SEPA 2ZGRA 5JIAA 2WZEA 4MGKE 2EIGA 2ZMNA 3PVEA 5E89A 5A1FA 1NCQB 2DCZA 3MDPA 5J09A 1M4WA 1XJAA 2MPFA 4MG2A 1QQP3 4AAXA 1UKRA 5FPBA 3JCIA 1RUE2 1LHVA 3BU7A 3AB0A 2Y26A 3M4FA 2PHFA 5LY2A 4CVUA 1YQ5A 5DAQA 4LO8A 2Q0AA 1MS1A 3AYEA 2ENRA 3H1WA 1Z0HA 3V0AB 2W1WA 2VW2A 3ZR6A 4PIZA 4CEWA 2VAUA 2GU9A 2VUAA 5CADA 1D2SA 4WVMB 1JI6A 2WQZC 1H0BA 5A70A 4YFWA 1DQ0A 3NNGA 1ZREA 2XB6C 5IJRA 1Y7BA 1PK6C 1OVSA 2PHWA 4Q4V1 2YZ4A 5CEHA 4GB31 3AFGA 4BLIA 2QQUA 4Q1RA 3VV1A 3VD7A 5JOYA 4OUMA 1J84A 4Y20B 3UETA 4CCJA 2A3YA 2WZPP 3QH6A 4N53B 3WZ1A 5CKNA 1T6GC 2CNAA 3M8LA 4IDZA 3WNKA 1EYBA 2V5YA 1F8VA 5DAPA 4AFBA 3WOGA 3N9MA 2ZGPA 3O12A 4IGOA 4IXLA 4NIHA 1R1ZA 4XFGA 3CO2A 2B4KA 4EN6B 1S1AA 4QPIA 3E6DA 1N3PA 4H14A 2G1MA 1GP5A 1OQ1A 3AMNA 4CCLA 1H8TA 3ZYFA 1NUKA 1KDMA 4NN0A 4OHVA 3WF2A 4PHZA 3BCWA 3GZTB 2W95A 4KGGA 3SH5A 3UESA 2QZ3A 1AL21 4ES8A 1LOFA 3KT7A 3VD3A 4BQWA 2RDNA 4IV3B 2JG8A 1OFNA 3EQEA 4QQLA 3TAYA 2WQ8A 1RVF1 4TSVA 2R0HA 2ZZJA 5J48A 4YVSA 5KC6A 3M3QA 2ZKLA 4FFFA 3IZOA 4LKEA 2Q8OA 2JG9C 5AVAA 3THPA 1YWKA 1AR81 2DUQA 2VMHA 4MGZE 4QHZA 5FYZA 3K46A 4DFSA 2FCTA 4D8MA 3MYXA 2XH6A 1XE7A 3TWIA 4LORA 2WABA 4IEUA 2UY8A 3ILFA 5KXBA 4RR3B 3PDQA 2QQPA 4LOTA 1AR91 5A3LA 1I6XA 1MPXA 5EJZB 4Q4X1 2VBDA 1ZBE2 2JE7A 1RUC3 1JYCA 3HT2A 4ZU4A 2P3KA 3FE5A 1R1A3 3VGIA 3I59B 2RS31 5LASA 1N1YA 4H55A 2RS53 5CB7A 1GKBA 2ZHLA 2ZHKA 5B4NA 4I02A 5KHJA 4NIGA 2EIEA 3B5LB 1UOJA 3H3LA 3ZFEB 3CZJA 4IEYA 1OPOA 4LBOA 1WA6X 2GNMA 2WNEA 3PTRB 1PNFA 2LUWA 1NY71 4X8NA 5FZ6A 2BRTA 4QM9A 5D2AA 2BGOA 4H7LA 1O8PA 2VG9A 1RUH1 3N9OA 3VHRA 2WC2A 1C28A 3JD73 2ZGLA 1YI7A 1QJY2 4GH4B 4PDWC 2Y8KA 1NQDA 2KR2A 4LE3A 4RGAA 3VBFC 2LM3A 4BXFA 4AEJA 1SPPB 1O8SA 4HANA 2EVXA 5A7WB 4F83A 3NNLA 1PVC1 2AEYA 3ZIXA 2TEPA 2WA3A 3CIHA 2ADDA 2LALA 2VOVA 2VXJA 2DYCA 4O65A 1WA4A 1PZ9A 1V6NA 5FZOA 1K5MA 2V4VA 4LHKA 1YQ6A 3MIFA 3ZYPA 4XBLA 1JZ3A 5FCCA 1RXGA 3NJVA 2QNKA 1RUC2 1MS0A 4RS5A 1R1A2 3ILRA 4P9GA 4N43C 1WLTA 1WW7A 2RS52 3PHMA 4QU1A 3R05A 4QX0A 5SV5A 3H42B 2QZ2A 3U14A 4LOSA 4XIOA 3JQXA 3S57A 4INDA 1UYYA 4TN7A 4AI9A 2OZ6A 3H9AA 3VBSB 4XQWA 3KVAA 2DFCA 4UBHA 5IW0A 3BVCA 2PQSA 1V6KA 5C4WA 2FDGA 4XIKA 4Q0SA 5FPVA 2K0GA 3P1IA 4HT1T 3H0OA 3JD72 2KXLA 3WCRA 3W21A 1NA1C 3GYDA 4UW6A 4YG0A 1OF4A 3VDAA 3HN3A 3B02A 1OSGA 1XNKA 5EV7A 3TBDA 1MS5A 3N9QA 5EJ1B 2GZWA 3WD5A 1W6PA 4I0BA 4LBKA 1RUI1 4XVHA 4YW3A 5FYUA 1F31A 2ATFA 2WAAA 4Q1PA 3ZFGB 1BXHA 3E6CC 3RZKA 2D3SA 3FMGA 5GZGA 1WCDJ 2AYHA 5A6YA 3SKJE 3PUHA 3N7JA 4KWKA 3VDDA 1H9WA 2P3IA 3ES4A 1H6XA 3U1XA 5F1RA 4LKDA 5FO7B 2WFF1 5FZCA 4EN0A 5FO8B 5DAXA 4AI0A 3VBOC 4LJHA 4UFLA 3TEWA 5BNNC 2WN2A 2DU0A 4J1XA 3ZXDA 2FHRA 1W8TA 1TE1B 4E8CA 2VNVA 4UFKA 1BBT1 1OLME 2EXIA 2PHUA 2AGSA 3MIGA 4YW6A 3H8RA 4AI8A 3NJXA 3D0SA 3NW4A 1QH7A 2QVSB 1H4GA 2JDAA 2XJVA 4PF1A 2VH9A 4AFCA 1IG3A 4CA9A 4FO9A 5EWSA 2ZEXA 1HV1A 1UYXA 1XNAA 3ITQA 2GMEA 3MIEA 2VMEA 2B7YA 1FNZA 1GBGA 2VY0A 4K20A 4R4XA 1AXYA 3CHXA 1K3IA 4JGYA 1HJFA 3BI3A 2RR13 1UXZA 4WVVA 4GWJA 4FQZA 1X8EA 3B94A 4ASLA 3OTFA 4HSLA 3ZXKA 1CX4A 5C5TA 1DGWA 5IK4A 1UL9A 4YM3A 3S30A 3WDYA 4KBBA 5K7PA 2IXKA 4AQSA 1L7LA 3HJRA 2XQRA 4I0WB 3O1SA 2LW8A 1AR73 1VBD1 4QKNA 2LROA 2NPIA 1CZTA 3CU7A 1GWLA 4FTBA 4UW3A 3UJOA 4P9WA 1V70A 3EO6A 5F3GA 4RQPA 1D0GA 2UURA 4PLMA 2PHLA 5DXDA 4K1YA 3SCFA 4XABA 2ZHNA 3Q8EA 2BNNA 2VZPA 1G7YA 5JLVA 1W6QB 5F7UA 5ISLA 2QDRA 4BQ1A 3ZN6A 1DLLA 2BOJA 4YZ5A 3ST7A 3VLBB 1LR5A 4TZDA 3BTXA 2Y6GA 2RDRA 2ZX0A 4GZ9A 4Q4Y2 1S4CA 3T09A 4DUVA 5A7SA 2YDEA 3DPRB 1QOSA 2B9UA 3POGA 3NRUA 2RS11 4LA3A 3F95A 4MH0E 2IC1A 3NAPA 1DIWA 4XF3A 4A41A 1H30A 3O1OA 4XXAA 1ND3C 1IKPA 3HQXA 3TNPB 4QB2A 3KSCA 1QDCA 3VHOA 2EF6A 5FZ0A 2WS91 5LK7B 2LTNA 3B69A 1UOFA 5FAXA 1AR72 3PURA 2PHDA 3TEYA 4CYDA 4UW5A 2XJPA 5DZFA 3WCSA 4LQRA 1XNBA 3F2ZA 5ABJA 5AC93 1JOBA 3B3QE 1SFYA 4GA9A 5CFDB 1PMHX 1IKQA 1K45A 4AEMA 5I0DA 1W3XA 4MLOA 2OXBA 1AJOA 1OF3A 2XXZA 5FZFA 1KS4A 1LEDA 1VBC3 2JG9B 1YFXA 3I3DA 4P9XA 1I9RA 1PZ7A 1UZYA 1B35C 5C8CA 4YW2A 1UD1A 2AEZA 4L97A 4K7JA 2DVGA 3I2HA 2QQWA 3BIEA 4Z92B 1WBFA 1G8WA 4I0AA 1RHI1 1S55A 1WWYA 2AZ5A 2DUOA 1AR63 2DVBA 2GAUA 2GC2A 4IEQA 4E27A 3K77A 1LESA 2CGNA 1UY2A 2JE8A 3GBGA 1MEC3 1VBA3 1OOPC 2AC1A 1QOTA 5FK8A 4R4ZA 4DRRA 2PQQA 3D3AA 4GALA 4LXLA 5D21A 4CCEA 1DGWX 2CAUA 3B9CA 4P9LA 5LEJA 1WW6A 2HWB3 3OGJA 5LZ6A 3VBRC 3RMYA 4YVWC 5CKMA 1A6CA 5AC92 4ZXKA 1PIV1 1W05A 2HEWF 4P9JA 3VL9A 5AFBA 3FLPA 4A45A 1VPHA 3ZM8A 4XAAA 1VJ2A 4RYDA 4PDWB 5BNPC 4QX7A 4B4QA 3CEWA 2BV4A 5CIRA 4BJ0A 2E53A 3IKWA 4HKWA 4UFMA 1VBC2 4D7SA 5DMYA 1MQTB 2JB4A 3TEZA 1WW5A 2FMDA 4Y26A 1V0AA 2VZVA 1PO21 4ORFA 2OT7A 5L73A 5CAZA 5M0TA 3RI8A 3OY8B 4FQ4A 4AHZA 3M2MA 4W6XA 4DMIA 5SV8A 2VOKA 1R091 3ZDSA 1W2OA 4JAAA 4QDQA 2D3PA 1AR62 5FY9A 1TMF3 3GHMA 1JN2P 5A7OA 1UU6A 1EPZA 1HQNA 1MEC2 1VBA2 1S0CA 4FPOB 4NIAA 4CUCA 5F5CA 1TZOA 3WT3A 1W90A 3Q9OA 2WSVA 2RHPA 1UAIA 1LOBA 2WJSA 2HWB2 1RUF3 1W8NA 4XCBA 4I3PA 2C9AA 4HPKB 1UY1A 4N8MA 5K4LA 5FP9A 2WO7A 2ZGNA 3T08A 1COV1 4P9IA 1OUXA 1V9U3 3C7HA 3U0ZA 4YW7A 1JZ4A 4J1WA 4I01A 1NA1B 1MZEA 3PUAA 2YV8A 5JXHA 1X50A 5JI7A 1JU4A 4CEYC 1NAEA 4WM8C 1ZZ7A 1XSQA 5GZEA 1HN0A 2CWMA 1IS4A 2DFBA 4OLLA 4K40A 3FBYA 4R9AA 4CDQA 3LPFA 5F3CA 3KCYA 4ZHNA 1D4M2 4XF9A 4XFHA 1OLRA 2ERFA 3AC0A 3KCCA 5A6ZA 4UFHA 2NP0A 2QJVA 1IQDC 3OG2A 4RHV1 4F3JA 1WLWA 1H2NA 1QJU2 3OD0A 1VIWB 3CZUA 1LRHA 2XBO1 2X53S 5FZLA 3S5QA 5A3PA 1LOGA 3VBOB 4DEVA 3THDA 1RXFA 2YBPA 2YXSA 2ZKNA 3OBRA 5FUPA 4YFZA 1F4AA 2PHRA 1AVBA 1X33A 3A0NA 4OVEA 1RUF2 4XAEA 2IXIA 4YGDA 1LTEA 3MFCA 1GFF2 4Z8BA 5FQ0B 4HVRA 1UMZA 3MBWA 1XNDA 2P34A 3ATGA 3CNAA 1V9U2 1OA4A 3OOXA 5IFPA 2WNVA 1OC1A 3OPTA 2Q5TA 1AX2A 1SQ4A 1Y9QA 5FLJA 3CLPA 1RB8G 5A7NA 3HQRA 3T2QA 3RWKX 5FKCA 4E4HA 2IZWA 1BQPA 3A0KA 1W39A 1RUJ1 3FLTA 3QCWA 4GJYA 5I0TA 3ZX7A 1YXWA 4CXXA 3ZFFA 1VLNA 5FRAA 3Q8FA 1S0GA 4I2OA 1EV12 1NCQC 1LNSA 1YFWA 1QJX2 2VNGA 3N7LA 2Q4SA 4R52A 4EWEA 4CRQA 2ARXA 2FDJA 2JICA 1I3HA 1ZVFA 2X5IC 3AP5A 1FPN1 4L99A 2HWF1 4PBOA 1LU2A 1ZBA2 1JYIA 2HEYF 2HWC3 2F4LA 3I49A 2K46A 2ZGUA 3MIHA 3NV2A 5HI0A 4KWUA 3MW2A 1OA2A 1LGCA 3DEMA 3JBG1 4WZCA 5C5UA 3S0MA 2D5HA 2D6MA 2ARAA 2QQOA 3RZMA 2P2KA 5A1AA 4QWNA 5FY5A 4LHLA 4M3CF 5FJHA 4FXGB 3RSJA 3VBHA 2ZZQA 4JDMA 3DL3A 4XFAA 1BEV2 2ZX1A 3DXUA 1KQRA 3FUQA 3MV01 3OBTA 5ACA3 1PGL1 3FHQA 3VBUB 4XW3A 1Z78A 4KNCA 1W04A 3AP7A 2PLV3 3MPBA 2BEOA 2YFUA 1NCRA 1UIKA 3KQRA 5A7QA 3BU0A 1W3VA 3IPVB 1G6NA 5B2GB 4ZU5A 2NN8A 1KXGA 1WKYA 1NOVA 2MNGA 4MGSA 3SCGA 1NE4A 1JHNA 3JUUA 5L7OA 1J59A 1KEXA 4Y1XA 1XXNA 2YROA 5FP8A 1TG7A 4ZKTB 4LIUA 2P17A 1LHWA 2VMCA 3HEIA 4ZS2A 1NG0A 1XU1A 2K2SA 4BLJA 4CPBD 2YC2A 1W8HA 4Z2AA 3IMMA 4N53C 2WFPA 2DTYA 4H2AA 3SLIA 1ZYBA 1ND3B 3M3OA 5FMOL 4EZ4A 2EAAA 2WNUA 2WSUA 4XJ9A 3ZYGA 3PUQA 2B9VA 4ZXEA 4C1WA 2YPJA 3I2KA 2W92A 2Y6FA 4QQ2A 4CEWC 1AYM2 1JUIA 2I2SA 2VO5A 1JOPA 2CSGA 5FXZA 4V2VA 2XLGA 4IV1B 2VZSA 4MGQA 1U5YA 2GSYA 2QFEA 2VXRA 1LHUA 2WT2A 4MX3A 5I93A 3E5QA 4XUPA 5K0UA 5DDJ3 3ASIA 5ACA2 3LFMA 5FY1A 2NYYA 5FY8A 1AXKA 1VBE3 2XG3A 2PLV2 4Q8LA 4I3GA 4IERA 2ZA9A 2DVFA 2ZABA 3N3HA 3WG2A 2A73B 4BPZA 4NHXA 1GZWB 4CCKA 1SDDB 4PI2A 4HOOA 5A32B 2VQAA 4OMCA 1QJEA 1H1AA 2OS2A 3ACLA 4M0NA 4Y22B 3EXUA 4YNIA 4K6BA 2QUOA 2VU9A 4MXWB 1OD5A 1W6OA 1TME1 5FJKA 1GOGA 3MO4A 3TN91 4JZRA 4BU2A 5C3PA 2DTWA 4RR3C 4QPIC 4META 1AXZA 2VMFA 4JKLA 1REFA 1H8TC 1QKQA 3WY6A 3WNPA 3PUSA 4MXVA 2Y60A 1IZ3A 4OCTA 4BE3A 4D6RA 5HV0A 2JDMA 2R16A 2H0VA 1CESA 4DXSA 4WM7B 4E2SA 5DDJ2 4YVWB 2VMIA 3N9LA 2HWE1 2RMU3 3OCPA 3ZFEC 5LA0A 4HK8A 1MZ5A 1RL3A 1OKOA 1VBE2 1VBB2 2RV9A 4YSFA 5I0SA 4OUEA 3R4SA 4YVSC 4CUGA 3AVRA 2GNDA 4IE0A 4BH9A 5BNPB 1YQCA 3WW1A 5C8WA 3O0XA 5JSPA 4QX2A 3NNFA 3PU3A 1TQ5A 1O4ZA 4Q4W1 5LEKA 4NO4A 5HPOA 1UCXA 1UY0A 2W2IA 4XF0A 4D3WA 4EROA 1LB2A 2P3YA 2Y38A 2RM23 3HVDA 3TRSB 3BUCA 1W06A 5F2WA 3WDTA 4WBBA 3J4UH 1RUD1 3WF3A 5KXEA 5FYYA 4JDNA 3ZKYA 1ZZ9A 2GN7A 2ZHMA 4IGQA 4JGZA 4NRMA 3IWZA 1IPSA 1X36A 4P5HA 1LENA 2X09A 3AL6A 1CAXA 2UYBA 1GICA 3MLKA 4WZFA 3RJRA 4BIOA 1JHJA 4C1XA 1WUVA 3DF0A 1GU3A 1S2BA 5A3MA 1VRBA 2JB8A 1SZBA 4ZZ5A 2GH2A 1GOFA 2Z2SB 4D7TA 5F6LB 4CXYA 1NXD1 5FYSA 1JH5A 2PMWB 4Y5TA 3WDUA 4PCRA 4AK3A 1K5JA 3NV1A 3U4SA 2Y6JA 1W9FA 2IFWA 1RC6A 5EFUA 3LEIA 3PTYA 2PHXA 4CCNA 2JIGA 1RUNA 1ZX5A 2RMU2 1Q56A 4IEVA 3K75B 2VQTA 4LEJA 4CUBA 3USUA 2NQYA 1LECA 2WR9A 5FZ4A 4BQ3A 3VBSC 3I54A 4AQTA 3WQBA 2WZR3 4TXWA 2IXHA 3QH7A 4TYSA 3LE0A 3FJSA 1V6OA 3LEKA 4AEDA 3SHRA 3BN6A 4HG6B 5HCBA 4URTA 2RM22 3QACA 5HV4A 2D6OX 5CU1A 1QY4A 2OUJA 1KDKA 1Z7S2 5I8TA 1V6IA 1K5MC 4LO7A 2E6VA 3D8CA 2CGOA 3FWEA 3V0BB 4AVTA 3MLJA 4LBLA 3NQHA 2W9XA 3GGLA 4CP9A 4FPEA 3HNMA 2B46X 5CG9A 4LPLA 3MV11 5C6CA 5FUIA 3WUCA 1PVXA 5LBBA 4IEXA 5DUUA 4E2QA 2WT0A 5FZKA 2HJIA 1AX0A 1E5RA 3A23A 4NHMA 4JRLA 4ONUA 3KHCA 2ZCWA 4PLOA 4PT6A 2RJ2A 1ONAA 5B4XA 1HLCA 1SLLA 2H6CA 4CDWA 1MS3A 2Q8CA 2ZX4A 5IVVA 5KR7A 3IN9A 3MIBA 4IE7A 4UXAA 3SCHA 2E51A 1L7RA 1RMU1 3QD6A 4N7IA 2WZR2 4L11A 4QT6A 5C71A 1CD3G 2C6SA 4XJ8A 5T52A 3BTYA 4CDXA 4EZHA 3ES1A 1N3QA 1A8DA 4EV0A 3RZJA 3UKTA 5A33A 4IW3A 2ZXQA 1BVVA 2P6HA 3PLQA 4Y1VA 4BISA 1UZVA 3THCA 3J7HA 3AZYA 4XQDA 1MZFA 5D8AB 1XC6A 2X5IB 3HMYA 4FPCA 4B3NA 2VBPA 2JENA 5EZWA 5GZDA 3RYKA 2VNOA 4ZZ8A 1RTVA 2DVDA 5FUNA 1CR7A 4G9SB 1RUE1 3DKQA 1TVGA 4H3WA 4V1PA 1VB4A 2V09A 2BOIA 2GP3A 2JDHA 1XYPA 1W9SA 4A7KA 2WBKA 1CAVA 2AH2A 4CDUB 1R083 1WLDA 1XSRA 1QDOA 5A80A 2GC3A 1DYOA 3O14A 3D5OA 2H6BA 5CZKA 5K9YA 1UQXA 4NAMA 4EN8B 1KS5A 1BMV1 2VZ1A 1OMIA 1GQHA 3WDWA 1PGW2 4FFGA 2XKOA 1J3QA 3GZUC 2VM9A 4BK4A 3C7FA 4CE8A 1RUG1 1GANA 1LKNA 3L2HA 4K21A 5ANNA 5A3TA 2E7AA 3ILNA 2VTFA 5FR3A 2Y33A 3VDCA 1U0AA 2ETEA 5I0UA 4ZONA 2QKDA 3WNXA 2OPWA 4DINB 4E2GA 3I3MA 1ODMA 1HRV3 3DPRC 1QQP2 4A4AA 3LDBA 4Y1YA 1NLRA 5FIXA 3RI9A 5JDBA 3UYJA 4BA6A 4QB6A 3RWNA 1RVF3 4CEWB 2GH8A 1EP0A 5HXVA 1S0FA 3H8XA 3W59A 1HV0A 4JVAA 4LE4A 3A21A 3E5UA 2D6LX 2YG0A 1R082 2ZAAA 3HIFA 1XYNA 1WCSA 1UZZA 1BVP1 2WAOA 3KWVA 3SMHA 2W1UA 4QM8A 2MEV3 1CZSA 1PO11 5CFDC 4MYEA 5DN2A 1SLBA 4COZA 2QQLA 1JYXA 1OQDA 1H2LA 4UFIA 1KITA 5DQ0A 2VQUA 4SLIA 3IAPA 4HXCA 2XVLA 5FYBA 4DNYA 5GZCA 1ULGA 2HWD3 1S0BA 1HB2A 1HRV2 5A7PA 4DPNA 1APNA 3OYWB 3OUJA 3NKTA 4JQRA 4QPIB 2PAKA 3ZLIA 4MVTA 3J7NA 4OI2A 5JSRA 2EIBA 1H8TB 5DG2A 1QH6A 3DYPA 3ZPYA 1YYNA 2XQXA 1HXS3 1NZIA 1OBNA 4FPLA 4TLGA 1ZBE1 1PVC3 1S2KA 4F8AA 3QOPA 3SISA 5IVYA 2JG8B 1SBFA 2TUNA 1BK1A 1DU3D 4HFSA 4YVSB 1O91A 1STMA 2MEV2 1FV2A 4FP2A 2JD9A 4B29A 4UAPA 3V65A 5C8CC 5F5AA 1NKGA 3CJIA 4OQ9A 5FZIA 2W87A 3I2OA 4IUGA 3WP5A 2XKPA 1CIYA 3ROUA 3VZJA 1EUTA 2IXLA 1N3OA 1MQTC 1VAVA 2RDSA 3LA7A 2JWPA 3H7JA 4ISRA 4EN9B 3USSA 1ND2A 3AJZA 5HXMA 1QJY1 2HWD2 3OGRA 5FZGA 1V6LA 2VJXA 3AYCA 2ZTNA 3WP6A 4M0HA 2Z4FA 2J1EA 4EN7B 5C9AA 1W28A 2OUHA 2AR6A 5FLHA 2W46A 5FYMA 3O1MA 2C24A 3AKPA 3O5SA 2ADEA 1HXS2 5GLZA 1SLTA 4KWLA 5FPZA 1U5IA 1RUC1 2WZ8A 4GULA 3MZHA 3OJBA 5FZBA 1R1A1 5EJ3A 4Y4RA 3K4AA 2YU1A 2PELA 1QMJA 4XJUA 2JDUA 4YZ2A 3DCQA 2W3JA 4XUNA 1OI6A 3O0VA 1MACA 4W65A 3NWKA 2ET7A 5F5IA 4BK5A 2KD7A 1UIJA 1A3KA 3P3PA 5IWFA 4RGKA 1BZWA 2WWSA 4Y1UA 3RG0A 1CONA 1NXMA 2R32A 3GDBA 4JKMA 1YQ8A 3TOJA 4AVCA 1UOGA 2ID4A 4Q5OA 3ZSKA 1N1VA 1JS9A 2BTVC 3JD71 5FZOB 1K5MB 3B9IA 3GF6A 1OUSA 4QGLA 1C4RA 5FWEA 3O1RA 5F9TA 3BGAA 4XJWA 2RG4A 4A7ZA 4CP2A 4YRDA 4RS5B 3DN7A 5J7MA 1FAYA 4I30A 2XMLA 2YMZA 3WP3A 1X9TA 3O1UA 3BALA 4DQAA 3SH4A 1JODA 1X82A 3JU9A 4N9HA 3AMMA 5TSWA 3U11A 2WWUA 3ON7A 1U5XA 3C7GA 4GWMA 4MSVA 1YI9A 1GUIA 4KU7A 3K4DA 1AYN3 1ODNA 1PZ8A 2VNRA 4AHWA 1QWRA 2IVIB 3WQ1A 4OI4A 5FZ9A 3KS7A 5JXIA 1W2UA 2IVJA 4N7UA 3IDAA 4U2AA 1H1MA 2Y0OA 4QXHA 4Q26A 1QXPA 4XDPA 2Y34A 2ZACA 3WG3A 3AXEA 3M70A 4BM8A 5FMOS 4EWAA 4CDQC 1W6PB 4JKKA 4LBNA 5F3IA 1IG0A 3KCXA 1KJRA 2WNOA 4XXPA 4QGNA 1LOAA 4HVQA 1KD7A 1F2NA 3MHZA 1CAUA 2GNBA 5DUWA 2JD4A 1G9DA 3VDDB 3VD4A 1ZRDA 1TEIA 1WCKA 3WG4A 4KH9A 3KT4A 1YUDA 2DCYA 2PAEA 4NWVA 1XNCA 2R043 1N1SA 1PK6A 2CWSA 3KHBA 2DCTA 5EYYA 4IESA 1O6UA 3C3VA 3MGUA 5LCWL 2RS13 1Y9GA 2XJSA 2QDNA 1AYN2 2BNOA 3CKHA 3UGFA 4BOWA 1AJKA 3E1F1 3NSTA 3AYDA 3POJA 4CU6A 3ACIA 3VBUC 4M3CA 2B5HA 3VZKA 3J7LA 2W08A 2XPJA 4O9EA 4GD4A 2P6CA 2NMNA 2FDKA 1J1TA 4AE2A 2WKKA 5JVVA 4Z82A 3MPPG 1SLAA 4JGYB 5D1IA 3WQ7A 3WNMA 5DZGA 5I8SA 2R073 3GBWA 3GCWA 1SFPA 3GXUA 2VZUA 4KWJA 1LCLA 3BPSA 1W6MA 3VDBA 2NMOA 1HRI1 4BQ2A 4CU8A 2RR12 4LIVA 2FCUA 1AHSA 1GZ9A 3Q8AA 1I5PA 4Q4Y1 3WNLA 2YB7A 3BIWE 1ZNPA 3HR9A 4YZ4A 1FT9A 1C57A 2P5BA 3MEPA 4A6OA 1OKQA 2O1QA 4P08A 1J3PA 1X9PA 5C7GA 1ZRIA 3N35A 4HLTA 1POV1 3EBRA 1YHFA 1VR3A 2R042 3DYOA 4XILA 3WW3A 3AJYA 1VRH1 4MV2A 5CKQA 4IV1C 1OH3A 5JR2A 2YHJA 4RQPB 4V2WA 4F7ZA 3OGSA 4DOUA 4B1LA 1AR71 5FZAA 1MVQA 2VVDA 3G7DA 4DY5A 1FI2A 3ZN6B 3I3QA 3BYWA 2OYZA 1GZTA 2E9QA 2XDVA 5JZGA 1X8MA 3DUIA 4TLFA 4E4ZA 3HWJA 1GWKA 2C5DA 4QPYA 4YW5A 1ZM1A 1J58A 2D44A 2R072 2TBVA 4MHUA 3NAPB 1F15A 1Q8VA 2B8MA 3LIGA 5JPMB 3FX3A 5E88A 4R8HA 5FYIA 1YC61 4QGMA 2QE3A 3OGGA 3KGZA 4Q0PA 1PIV3 2A6WA 1REDA 5EQUA 3VHNA 4IEZA 4LA2A 4XUQA 4OQ8A 4Y4YA 4Q27A 2C9KA 1OD3A 2J1TA 2YGMA 3AMHA 3WW2A 3MUZ1 4A7YA 3OUIA 4HVOA 4XDQA 3KD4A 4JDOA 5DG1A 3VZLA 1RINA 2YYOA 1UO9A 4C91A 1IGOA 1PO23 4AGGA 5K0UC 2XL9A 1IQAA 4QQPA 2A75A 4QQHA 5FZ7A 5ABJB 1CIWA 4TTGA 2BW8A 3ZXJA 1OPMA 3ENRA 1ZA7A 2BGCA 3VBFA 4B8EA 2A1XA 4CTEA 2WO1A 1W9TA 2BBAA 2XJTA 2ZMLA 2ZEYA 3LB9A 4WM7C 5HBAA 1ZRRA 5K8SA 3IDBB 1QXRA 2YFZA 4RL7A 4WV8A 3AZWA 5C8CB 4K8RB 5AC91 5EPAA 4JV4A 3TB0A 1FV3A 3DECA 1GNZA 5FPAA 1ASJ1 1SG3A 4MOAA 3KQ4B 3POFA 2SLIA 3NJZA 1S0IA 1VBC1 4O9GA 2JDNA 4BMEA 4LK7A 4N43A 1DYKA 3OF1A 5C70A 2PYTA 3DGTA 1S0JA 1PMJX 1UY3A 3BTAA 3Q8BA 3URFA 1K42A 2VCCA 4J25A 2JKBA 2WYFA 3WINE 4P02B 3D82A 4CCCA 5J3UA 4GKYA 4DRVA 1UU5A 1DF0A 1AR61 2BWAA 4LMFA 1GWMA 1CPMA 1PMIA 2DWRA 5E6HA 3E97A 2Q8EA 5FDBA 3LSEA 3SITA 2VCMA 1MEC1 1VBA1 5FP4A 1KRIA 3IB3A 5IVBA 4QKFA 4A2UA 4XZPA 1RJ8A 3RZZA 3LOIA 1EAH1 3AVSA 3ZKUA 2HWB1 5LB6A 1Q8QA 3E6BA 1C8M3 3N7MA 2BP6A 4BXSV 2J42A 4AHYA 2VOWA 4COVA 3W5NA 3M7AA 4Y5Z0 1H4HA 3WHTA 2DVAA 4LTAA 1WCQA 3ZDVA 3ZR5A 1PHMA 3H1YA 1Y9MA 4IEPA 3HNYM 3BOPA 4BQYA 3I2GA 2XONA 2ZX2A 1VP6A 2D6KA 5FZ8A 5BNNA 3RNSA 3ZN4A 4XMAA 1TMF2 1MS4A 5T5PA 1C5IA 4YM0A 1D4M1 4MUVA 3LAGA 2HBTA 1NE6A 5J36A 3LDRA 4UF0A 4AZZA 1H6YA 2EXKA 4GMP3 4NOTA 1QJU1 4KGQA 3RYPA 1A8MA 4IEOA 4XMIA 5DAWA 1KGYA 2C26A 2OZJA 4LLOA 1WMEA 2XHKA 2A6ZA 4FPKA 4IEWA 2HWF3 2X8KA 4BIFA 1W8FA 5BUVA 3K2OA 5FYVA 1RUF1 1C8M2 1H9PA 2R063 3AP6A 3JBG3 4PF5A 5JXJA 1W9YA 3POWA 4CDQB 4U36A 1V9U1 5LRRA 5F5QA 4O7XA 5HCAA 2GDFA 2R7EB 3PVBB 2VD7A 5J96B 1O3SA 4FOQA 2VZQA 2VUDA 3OEAA 2SBAA 5DAVA 1GV9A 2QTWB 3I2FA 1C1LA 2BFUL 2V72A 1U12A 3ZVXA 5D8AC 3B00A 4FFHA 2VE1A 1EV11 1BLZA 1H1IA 5ANQA 2DDUA 1QJX1 2ET1A 4AG4A 4QB1A 4RD7A 2YC0A 4YARA 1XE8A 1BCXA 2ZGQA 2YBSA 3KV4A 4ITCA 4JRAA 5IYYA 1ZBA1 4IQPA 5I0RA 3WR0A 1ZZBA 2VVFA 4XJAA 3LQCA 3GZAA 1J3RA 2EA7A 4CDUC 1TNFA 1W0OA 1YJKA 2WNVB 3B01A 5JMCA 1W6NA 4QKBA 2HWF2 3J8F3 4ASKA 3KM5A 2ZOEB 1BEV1 2JECA 2XR4A 3BOWA 2R062 3ZSLA 4JX0A 1ALYA 3AKTA 1RYYA 5A3OA 1KJLA 4C90A 4XTMA 3ZFFB 3HD8B 1F35A 1GSLA 1ENRA 1MVEA 5FWJA 2KM2A 4J6GA 2XL7A 3CL1A 5L19A 1POV0 2FDIA 4FPFA 4Y1ZA 3O0WA 2Y6KA 2HH9A 3OEBA 4BWOA 1O3TA 5CG8A 3ZXLA 5FXWA 4QX8A 4OZXA 4BQ4A 1CAWA 3UKNA 4HN0A 2R30A 2Q1ZB 5HCFA 2XUEA 3ORJA 3IIAA 2HWC2 2CYFA 1ULOA 5FPXA 2JIJA 5LW9A 2HBUA 3TNQA 1DQ5A 1QOOA 1UYPA 2ARCA 3D6EA 3VBHB 4AFMA 2DV9A 3M1HA 4AEKA 1H8VA 4Q0VA 1WW4A 3MLLA 3T3YA 3DYMA 1TME3 3AZXA 1AYM1 4LKFA 1D2QA 4M00A 3EYPA 1H2MA 1NCRB 4PBPA 3VHPA 1E5SA 1Q3EA 4A6SA 3N9NA 3K3NA 3NO8A 4AW7A 1W0NA 1B35A 4W8JA 2W68A 5A32A 3J8F2 1SBDA 2HYXA 5L7OB 4KQ7A 4Y24A 4Z2WA 3N4MA 3I2DA 5ACA1 1SCRA 5H9RA 5GLTA 1JW6A 4URAA 1VALA 4LULA 4KU8A 2PLV1 2RVAA 3POIA 4JCKA 3OUHA 3D0JA 5IFTA 1JZ2A 2WNUB 2FDHA 3I2JA 3OBAA 5LK5A 2E31A 4FCAA 2E32A 3LDKA 5FLIA 3RQ0A 3EB7A 1OOPA 3U10A 1US3A 4K1ZA 4OMDA 2CAVA 5FFOC 1Q8PA 4H7MA 2XHNA 1ZZ8A 3V64A 4A42A 1JZ6A 4Q4W3 2CGPA 1XE0A 4BCUA 3VBRA 3QLQA 3LCPA 2VZOA 5CFCA 1DBNA 3PIJA 2W94A 5K0UB 1WD3A 5FYCA 2AENA 2HYKA 3T1LA 1IS5A 1URXA 1WCUA 3I97A 2I07B 2OKXA 4DZGA 2YY1A 1W8ZA 3M3IA 4GIQA 3M3CA 4EJRA 5T55A 1LOFC 2IXJA 5FZEA 4D6QA 4AVSA 1DQ4A 3RMXA 2G9FA 2JG8C 3VUOA 1I5ZA 5BNOA 3T0DA 2X10A 1Q5OA 1SMVA 2GMPA 2UY9A 5DDJ1 2O8QA 1XU2A 5APAA 2VQ0A 3VZNA 4FPGA 4UBGA 2JE9A 3WLUA 1LU1A 5IK7A 5FZHA 1VBE1 2PTMA 2FCVA 3NVCA 1VBB1 2OPKA 3R6SA 4ZY9A 1W6OB 4NMIA 2D40A 2QQIA 2Y64A 3DV8A 3MI8A 4XF4A 5GLWA 3KV6A 1FMD3 2D7FA 3WF4A 2BGPA 5FZMA 4CXWA 5CISA 1E57A 2X29A 4JHTA 4QPGA 4M01A 1H2KA 4AAPA 5IVEA 2F4PA 2WO2A 4QHBA 2GALA 3ZXFA 5JAXA 2CDPA 2FDFA 3HN1A 5BPXA 3RVHA 2R1BA 4NJ4A 4HK9A 1YFYA 3G6JB 2JDZA 1W2TA 2AREA 4QKDA 3CF6E 4PJYA 2CTVA 1JYTA 4CEYA 1UF2C 4WM8A 5LY1A 3P6BA 4FSJA 3J26N 4CP0A 1F9KA 1QF3A 1IPKA 2RMU1 3KV5A 1DQ2A 3BTZA 3H3UA 1ULCA 1CVNA 3C7OA 1D4VB 1VAMA 4YPJA 2VL4A 3D4KA 2MHFA 4JGZB 4QX1A 5FXVA 1G86A 2DCJA 2DBIA 2ZX3A 4R9CA 5C9AC 2VZRA 1CAXB 1FMD2 1FOD3 2RM21 3LOBA 1VE0A 2A3XA 1Z7S1 4S2FA 1QU0A 4RS5C 4IL7A 3K51A 2GC1A 3FLRA 4XE9A 1HW5A 1UMHA 4XC9A 3NJYA 2Q8DA 4Q8KA 1PNGA 4LBQA 5CA6A 3VKOA 4P14A 4GQ7A 3SC7X 4S2DA 5F6KA 1GP6A 2KA3A 5KHHA 2ORZA 1O5LA 3USUB 1DYPA 1OQEA 1RJ7A 4K8FA 4NVPA 4BB3A 5A1LA 2EALA 5C4WC 2VOTA 5L9BA 1F4HA 4AEDB 2FZ1A 4AL9A 4OFGA 2GC0A 1NCQA 1UX7A 2Y0IA 3APBA 1DQ1A 1O3RA 2XWBB 4QXCA 4PI0A 1MZ6A 1DG6A 4Z07A 1CWPA 2WZR1 3P3NA 4BZ4A 3N36A 2D97A 1W0PA 1WLCA 3JZVA 3HPNA 5J37A 3RZGA 4FXKB 3VN4A 5GLVA 1SLIA 2PFWA 4CP9B 2RJKA 1FOD2 5EIYB 2VPVA 3V0AA 2WT1A 4Q4V3 4O61A 2P37A 4GB33 3I2IA 3VDDC 5FO9B 5LA9A 1RUG3 1K12A 4HKLA 1XBFA 4KG8A 4WVMA 5JI9A 2L9LA 2E33A 2WLPA 3PMSA 4LK6A 3A22A 4BQXA 3T4VA 1AF9A 2CDOA 3S7IA 4CDWB 4YW1A 2W1QA 2D6PA 1OH4A 2BPA2 2XJRA 1Q8OA 5G04L 5T3NA 4CSWA 1WMXA 3ZYHA 4CDXB 1SBEA 2ZJCA 1LHNA 4XBNA 4Y20A 3X29B 5EXOA 2Q1MA 3FUOA 5A33B 3CQOA 4ASMB 1O5UA 4N53A 1N47A 4RSUA 4ARXA 1PGW1 1UPSA 3GM8A 3THTA 4EE2A 1ZA4A 3NL1A 2A5ZA 5GALA 4JGYC 1POQA 3MFAA 4HETA 1JMUB 4MHRA 5DUVA 5KBFA 1IOAA 2YU2A 5E16A 2FD8A 5BV6A 4MGTA 1BMV2 4AF9A 4BMBA 1AL23 4MO3M 5E8AA 1BKZA 3ZSJA 2QQKA 4KL1A 4KMQA 5CBLA 1OHFA 4Q4V2 5T5JA 3BKZA 1PO13 1UNBA 4GB32 1S0EA 4XHXA 3IDEA 1JXNA 1QQP1 1RUG2 1WMDA 2QCSB 1UMIA 3PL0A 1CAVB 3PVOA 3ZYBA 2FQPA 2VVEA 1AR83 4CU7A 3H7YA 5H9SA 5FMCA 3VL8A 2O8OA 3GJBA 5JSOA 4FOVA 4IV3A 1BYHA 2A6XA 3NNJA 5JPNB 1HQLA 4RFRB 3JQWA 2R1DA 3HNBM 1REEA 1GMMA 4RQPC 5JUVA 3UK9A 1AR93 1R081 4CCMA 4L9BA 4NAOA 2ZS6B 1DLCA 5C3SA 4Q4X3 2WRAA 2C1FA 4FI9A 2RS33 3FHIB 3OYWA 1ZBE3 3PVNA 4RR3A 2Y6HA 5T5OA 3OBZA 4E4DX 1C3HA 2JDKA 4D7YA 5IK5A 1QGLA 4PLNA 3NAPC 3FC0A 1O7FA 1CPNA 3ECQA 3V56A 1AL22 3KB5A 3L9JT 4P5YA 4LO5B 1PGSA 3I59A 1JBCA 1HKDA 2R6QA 2RDQA 1CGPA 1PO12 4AI3A 3T30A 2E7QA 4HZFA 1VMHA 1RVF2 5CNAA 1HRV1 1RUH3 2ZAHA 3IAQA 2JXAA 5EHDA 5FY0A 3UGGA 3ZN5A 2W5FA 4IETA 2Z5WA 3ZFEA 4OHYA 2J1UA 4DIQA 4UWDA 2BQPA 1WZXA 1AR82 1AX1A 4YG3A 2IXCA 1Y43B 4HKOA 5KC5A 1LOCA 1QJY3 3LGRA 1DHKB 2AUYA 5ABJC 2DURA 3OPWA 4ATFA 2OIIA 3AKSA 3T0BA 2E26A 5JZGC 2OA2A 4GH4A 1RGSA 1AR92 3S6PA 1SPPA 4Q4X2 1F5FA 5A7WA 4QD2A 1GZCA 1Q43A 3AKQA 4AWDA 1XB9A 2RS32 3DKWA 5FOJB 4L0PA 2MEV1 5GM0A 5KXCA 3WNOA 3UKVA 3ZMNA 1UXXX 2B42B 1EPWA 2UWCA 5EYXA 4DUXA 3RZHA 5JXGA 4NHLA 1G9FA 1NY72 1GR3A 2BZDA 4NPMA 5F32A 1KFUL 2F17A 5FREA 5IUQA 4AVAA 4QMAA 4B4PA 4COUA 4DO0A 4LKSA 2WO3A 2HWD1 1NLQA 1FATA 1RUH2 2BVBA 3BB6A 1DGRN 2BWCA 2A7AA 4JTNA 4BDVB 4FPJA 4M3CE 1AL0G 1RIRA 1LOEA 1YQ2A 4FAHA 4X6RB 5JOWA 3ZO0B 1A34A 2WA4A 4Q0UA 1QNWA 1PVC2 3VBSA 1WBLA 2QQMA 4FOYA 3FN9A 3IDCB 5J98B 1HXS1 1LJ7A 3GHNA 4LBQD 4C0HA 4QX3A 1RUI3 4QX5A 1OT5A 2RS51 4K3UA 4HONA 3ZPOA 3CJIB 4Q2FA 2NZ9A 2ZGMA 1BJQA 2BJSA 4KI5M 5FP7A 3M3EA 2EICA 2QQNA 1ND2B 2BFUS 4OZOA 5KHIA 2WFF3 5H9QA 5CYYA 2YGLA 4IE4A 1WGPA 1JUHA 4LITA 5FY7A 3ZFGA 3O1TA 3LF7A 2OX0A 3W58A 4COWA 5C9AB 4LO6B 4R9BA 4N90A 4XURA 5FPUA 1E5IA 1P8JA 5KHGA 2VUJA 3RZLA 3O1VA 1J83A 3HOBA 1BBT3 4KBZA 2OW4A 3GZEA 4FT8A 4LHSA 3AM2A 3AMQA 3UNPA 4XYXA 2VZ3A 5FK7A 3KVBA 4BYYA 3T2OA 5FYTA 1I1EA 2EIDA 1ULDA 1W2NA 1XYOA 1RUI2 1UWWA 3AXDA 4NWWA 4XFBA 4Y3OA 4YLZA 5C4WB 4RFT0 4IGPA 4RN5A 1SEFA 3NNMA 2XLFA 3K48A 3IBMA 4FFIA 3VB9A 1LEMA 2O0OA 3NMBA 2G9ZA 4AYUA 1YO8A 3T2TA 2P4EA 3T2PA 4AHXA 1NYWA 3ACHA 3ME2A 2WFF2 1C1FA 1UZ0A 4LUKA 5LATA 3H50A 3POEA 4DXRA 4AXOA 1CJPA 1VBD3 2GNTA 5L9RA 4LO4B 2UU8A 2FMYA 4X8PA 3S7EA 2WINB 3POBA 3K4ZA 4OHZA 4WVZA 1BBT2 4AFAA 1G9CA 1OLQA 1QJZA 4ZPIA 1QEXA 4OYUA 3U78A 3ZYJB 4NUBA 5IAXA 2VTXJ 2VZTA 5FZDA 5G05L 2LS6A 3A7QA 3ETQA 2I74A 4DEQA 4AGVA 3KT1A 3SEEA 4COYA 5FMDA 1HRI3 2P1BA 2VW0A 3GCXA 5FV3A 4LT5A 2G9GA 1UPIA 3JB8A 4NRPA 1ENXA 3LSDA 4Q4Y3 1W6QA 3AFKA 5ERLA 4UT5A 4FPYA 1Y4WA 2WNVC 3AKRA 4YG6A 5A3UA 1NZCA 3ALQA 1AYN1 1NLSA 1J1LA 4YWAA 2WS93 1JTZX 2LRPA 1F5JA 1POV3 3DPRA 2BNMA 2JDYA 4PIXA 2Z79A 5FBZA 4DXTA 3BPZA 1PX4A 4D0QA 4GKXA 3P5BA 4W4ZA 1G9AA 1VRH3 2W91A 3ZFFC 3J9SA 1PM7A 1VBD2 1CAUB 4XFCA 4NIIA 3J7MA 3WEZA 1MS9A 2VMGA 4Q29A 1VMFA 2ZPXA 5IAVA 4OI0A 4AR2A 5KHKA 3LA2A 4OHWA 3IM0A 5IATA 3C2UA 4ISQA 4TWTA 2D5FA 5IT6A 1CX1A 1FNYA 1GQGA 1OFSA 3AX4A 4LBJA 4OI1A 3RRDA 1WD4A 1HB1A 3MF6A 2RR11 4S2GA 1PK6B 5FBJA 2XOMA 5BY5A 4XF1A 4NHKA 2DUPA 3AP9A 3KLSA 4MADA 5KXDA 3SQOA 1W99A 3KF5A 4FOWA 3VBHC 3I3BA 1HRI2 2RS12 5CFDA 4BQ5A 3UV9A 5DUXA 1YEWA 5C3OA 2R041 2Q1FA 4FVVA 4M3CB 5KWRA 4B1MA 1RHI3 3ZXAC 5LBEA 3U07A 4D6SA 1NCRC 2VR4A 2JG9A 3I8TA 3VKMA 5FMBA 3T1MA 1D0HA 5GLUA 1T2XA 3OPZA 4YZ3A 5FY4A 1UX6A 2CY6A 2WS92 1JU3A 4P9YA 1C8NA 5L7OC 2D98A 4X6QB 1UYZA 1W6MB 2CHHA 4IE6A 1YRZA 1VRH2 4HBNA 5L36A 1ENQA 3PIGA 3CBNA 3H1MA 1W9WA 4XQ4A 4C0BA 1GLHA 3KZ4C 2WNUC 2R071 4PQ9A 4S2HA 5LBCA 4MGYE 4W50A 5F37A 1R64A 1ZRCA 5FKBA 3WF0A 5IVJA 2XWJB 3RPQA 2N7GA 3IT8A 4JC1A 1KFXL 4N9IA 5I8YA 3R4UA 4CU9A 3U4XA 3EJKA 4OUSA 1ASJ3 1RUOA 1YJLA 4Y5SA 3WX5A 1GQPA 1A78A 3WG1A 4XJZA 3ZSMA 3LEGA 2VECA 4CPBA 2JKXA 2WN3A 3ZXGA 5A3NA 3W9AA 1R093 4PDWA 5JZGB 1RHI2 5LA2A 2BDRA 2VBBA 2PHTA 3MICA 5AFEA 1DFQA 5A6QA 2K9ZA 1MQTA 1OLMA 3NV3A 2NM1A 1UY4A 4OULA 1ULFA 4AQ2A 1MS8A 3OY8A 3R0RA 4P00B 5LWBA 2R49A 2DCKA 3CDZB 4E9KA 2UWBA 3LWCA 4LLFA 3VD5A 1XPWA 2TNFA 1SHWB 2V73A 3UT0A 4EYUA 2WUHA 2WL1A 1FYUA 2GMMA 3FBMA 2Y6LA 1PIV2 2YPDA 1COV3 1EAH3 2F6BA 4CP1A 1M06G 3LZZA 4QHOA 5GKAC 2G4IA 4YM2A 4GXLA 5CFCC 1LODA 3PNAA 1DZTA 2RJLA 1UZWA 3VZOA 4AI1A 1SDWA 1XOYA 5IVFA 1VB2A 1ASJ2 4YM1A 2Z69A 1ST8A 1AUYA 1UU4A 5JWPA 4HPKA 1PO22 3GJAA 3VBFB 3WNNA 2E7TA 2J1SA 4QQOA 1GYKA 3OB8A 1IS6A 1R092 2VGDA 5BNOC 1NA1A 1ULEA 1V6MA 5F8PA 2VC9A 3H8UA 1NT0A 1MR5A 2B39A 5FZ3A 4GWNA 1PX3A 4RHV3 3WDXA 5C3RA 3U37A 4ZU7A 1D4M3 2VW1A 3JXSA 4NE9A 2XBO3 4D94A 4YZ1A 2X05A 3H3ZA 1B09A 4XTPA 3L2YA 3SNMA 1W03A 4N43B 1QJU3 1QXJA 2A6VA 2O14A 5FTTC 1YIFA 2WWJA 1G9BA 4Y33A 3ABZA 1LULA 4JGZC 1YCIA 3I3EA 4XCAA 4QPGC 3PJQA 1COV2 1EAH2 2WDBA 1O3QA 3KF3A 1SCSA 3VBOA 1N1TA 5FXXA 1CJDA 1DQ6A 2J1RA 1LGBA 4QDRA 2QQJA 3ZSEA 4L92A 1O59A 4AGRA 1ZZCA 3O7OA 2J22A 2GP5A 1RUJ3 2PA7A 3KMHA 3WP4A 1BK0A 1GNHA 3QBQA 2XJUA 5FQ0A 5IVCA 1TMF1 3WHUA 4DY3A 3MIDA 3B93A 4XETA 5H9PA 1UOBA 1VAKA 4QPWA 4ARYA 2YBKA 1WMFA 2W1SA 5LBFA 2J1VA 1IPJA 1YFUA 2A71A 1FPN3 1T6BX 3AZZA 1EV13 2W52A 1QJX3 3MF9A 1O4YA 4RHV2 5I91A 5DZEA 1HIXA 4AEDC 4M4PA 2XBO2 2ZGKA 1S2EA 1OA3A 4UFJA 4CZSA 5J1XA 1JZ8A 3NV4A 1ZBA3 2AACA 4CUAA 4G4FA 5C33A 1HQWA 3CMGA 1C8M1 2RE9A 4HL0A 3AL5A 2CL2A 2VTXA 2EXJA 4UYBA 4Q0QA 4L8QA 2C4XA 4JHZA 2QQVA 5FPLA 1DZRA 4XOGA 5GZFA 5BNNB 3S5AA 5CVRA 3LFIA 3WF1A 4UW4A 1W8UA 3GBFA 4C8DA 1BEV3 1YLLA 1U5ZA 2IUWA 3KV9A 3WSOA 4UF0B 3EHKA 4WVWA 3OD4A 3ZYRA 1DGRA 5BXXA 3AP4A 1RUJ2 1FXZA 2UWAA 2XLAA 5T54A 3VBUA 3UL2A 3DXTA 4XPVA 1Y3TA 3WV6A 2D43A 2P3JA 4ATEA 2DF7A 2ZEZA 1GNYA 3IPVA 4CDWC 1L3JA 2PAMA 1C5HA 4GMP1 3LA3A 4ZS3A 2JEMA 1FPN2 5F3EA 4XACA 3EMRA 4CDXC 3MUY1 3IIIA 1V00A 4YGEA 4B7KA 3A4UA 3JBG2 2W0XA 3IMNA 2VCAA 4XFIA 4SBVA 1YNAA 5T50A 1ND3A 1AYM3 2R061 1LGNA 2A6YA 2D3RA 2JDPA 2XVGA 4UI9L 5EP9A 2ZGSA 3VKNA 1ACCA 2BYVE 2CU5A 1O4TA 3HBKA 3T4HB 1PGL2 1OURA 3WW4A 5E1RA 3KGLA 2YC4A 4LUMA 3WVJA 3R4DB 4E4SA 4G3YC 3HQUA 4IV1A 3RYRA 5FP3A 2BERA 4MGIE 3I4IA 1OXCA 3RDIA 3INAA 2HEVF 3UGHA 1X7NA 2ZMKA 4B4RA 4CCDA 4FTEA 1D7PM 1S0DA 4QDSA 4BHPA 4FAGA 2DU1A 2HWC1 3CJXA 4NHYA 1W6NB 1IHMA 1QNYA 3ACFA 3JB4C 4JTOA 3TN93 3SXWA 2FZ2A 2WIIB 3WDVA 3PU8A 5FYHA 1JYWA 1GZWA 2ES3A 2XVKA 2FBEA 1W2AX 2VUCA 2IFRA 3LEMA 1OVPA 3AMPA 1DGLA 1DP0A 1EUUA 3AZVA 3OSDA 4Y22A 1L7QA 3RJ2X 4DXZA 1HB3A 4FPHA 4GAZA 4MXWA 2J1AA 4XUTA 3J8F1 5JR7B 4AVBA 1CZVA 2W39A 2B45X 3W20A 4A3XA 4NIDA 1XRUA 1PM4A 4Z1VA 3BODA 3Q8CA 3SH3A 4A44A 5F2SA 1CAWB 4DUWA 4LR4A 3C7EA 2HWE3 5JOZA 3WXPA 4L2NA 2CV6A 2VOXA 2E63A 1XNTA 4FBFA 3AK0A 5LRSA 3B7MA 2HKXA 4KG0A 1VBB3 5IHRA 4QXBA 4UOJA 2YUEA 4WM7A 3FHAA 3MW4A 4YVWA 1DZQA 4IV3C 3POYA 3GNEA 5JIUA 4NRQA 2G19A 3SKVA 4DB5A 4RA0A 1B35B 1CN1A 1TME2 5BNPA 1RUD3 1UW8A 5GJ6A 1QJFA 3TN92 4AVVA 4NPLA 1JYNA 3ZMOA 4QAWA 4XFFA 4XEZA 1EY2A 1QHDA 2OQ7A 2VMDA 2ORXA 5FZ1A 3VKFC 4ES9A 1JZ5A 3ZXEA 1FX5A 2D6NA 2XGXA 3HBZA 3PJYA 3GALA 3ZYIB 4YW4A 2Q30A 1Q8SA 4HN1A 3C8XA 1OOPB 2V4AA 1DCSA 1RITA 2WLQA 5DPNA 5IK8A 4XBQA 4M4RA 1SLCA 1W8WA 3W5MA 2I45A 1CQ9A 3N9PA 3E5XA 2HWE2 1SACA 4PQQA 4QU2A 3N7KA 4FP3A 4I09A 3UJQA 3VBRB 3NKGA 4EQVA 5CFCB 1ZRFA 2ARBA 2VULA 4LBMA 4Q4W2 3T0AA 3VKLA 2J7MA 4GJZA 4GWIA 5JMOA 2QBXA 1LAJA 4AI2A 1UN1A 3POSA 4NROA 3FZ3A 4IE5A 4LHNA 5BNOB 4W6YA 3ELNA 2WQ4A 4GH4C 1RUD2 4W6WA 2Z42A 1LHOA 2R0FA 1HJGA 1Z7S3 2A70A 3H8OA 4D69A 4R9DA 3RFRA 4XUOA 5C3QA 4JQTA 3CJIC 1US2A 1GP4A 3FFZA 4XZUG 3PUIA 2GN3A 1NQJA 3WUDA 2BU9A 1ND2C 4HSJA 3I7DA 5A3WA 4B7EA 3V0BA 2ZGTA 2BVVA 2NLRA 3LPGA 4QXKA 4RGGA 4EWDA 1TNRA 1VMJA 4CCOA 3RGBA 2ILMA 1GOHA 4QPGB 4AQ6A 3U75A 1JOJA 3O1PA 2HLEA 2ZGOA 4YYOA 1XQNA 1E5HA 4E8DA 1AZDA 1RMU3 4NR1A 4PIYA 1FMD1 1ZZ6A 2C0ZA 4AOCA 5L9VA 1JZ7A 2BBVA 2H0BA 1HDKA 2V5DA 1ULPA 5A6XA 2PXJA 3AYAA 1ENSA 2D93A 2IWGB 3VZMA 5BYNA 5LA1A 3FFQA 3HAGA 4XHBA 5F39A 4ET7A 5FOBB 4AFDA 2EAKA 1BHGA 1HX6A 2UYAA 2XUMA 5DABA 4CEYB 4WM8B 4LNVA 5JCTA 2W47A 2WYSA 1W8OA 3ACGA 1V6JA 3OGVA 3TEXA 3ETPA 5HCHA 3ZOIA 3VD9A 2EXHA 2VCBA 4HMZA 5AVPA 1UKGA 1RUE3 4K9SA 4DS0A 3ZFGC 3FL7A 1IS3A 4YGCA 4FTSA
chains in the Genus database with same CATH topology
5D8AA 3PMEA 2X5IA 2JJ6A 2ZBJA 3HT1A 3LKJA 2A3WA 1SFNA 1DDLA 1YIPA 4YGBA 5JOXA 3RS6A 3MW3A 3ZIWA 1RMU2 4LBQB 4CDUA 5BNQA 3WQ0A 1FOD1 2JX9A 2OVUA 4GMP0 4MZUA 4OHXA 3TYJA 2BUKA 2PN5A 5T5LA 4NPRA 2XJQA 2ZGRA 5JIAA 4MGKE 2EIGA 2ZMNA 3PVEA 5E89A 1NCQB 2DCZA 3MDPA 5J09A 1M4WA 2MPFA 1QQP3 1UKRA 3JCIA 1RUE2 1LHVA 3BU7A 3AB0A 2Y26A 3M4FA 2PHFA 4LO8A 2Q0AA 1MS1A 3AYEA 2ENRA 3H1WA 1Z0HA 3V0AB 2VW2A 4PIZA 4CEWA 2GU9A 2VUAA 5CADA 1D2SA 4WVMB 2WQZC 1H0BA 4YFWA 1DQ0A 1ZREA 2XB6C 1Y7BA 1PK6C 4Q4V1 2PHWA 2YZ4A 4GB31 3AFGA 4BLIA 4Q1RA 3VV1A 5JOYA 4OUMA 4Y20B 2A3YA 2WZPP 3QH6A 4N53B 3WZ1A 1T6GC 2CNAA 3M8LA 1EYBA 2V5YA 1F8VA 3WOGA 3O12A 2ZGPA 4IXLA 1R1ZA 4XFGA 3CO2A 4EN6B 1S1AA 4QPIA 3E6DA 1N3PA 4H14A 1OQ1A 3AMNA 1H8TA 1KDMA 4NN0A 4OHVA 3BCWA 3GZTB 4KGGA 3SH5A 2QZ3A 1AL21 4ES8A 1LOFA 3KT7A 4IV3B 2JG8A 1OFNA 3EQEA 4QQLA 3TAYA 4TSVA 1RVF1 5KC6A 2R0HA 2ZZJA 5J48A 4YVSA 3M3QA 2ZKLA 2Q8OA 2JG9C 5AVAA 3THPA 1AR81 1YWKA 2DUQA 2VMHA 4MGZE 4DFSA 3MYXA 2XH6A 1XE7A 3TWIA 4IEUA 2UY8A 3ILFA 5KXBA 4RR3B 2QQPA 1AR91 5A3LA 1I6XA 4Q4X1 1ZBE2 2JE7A 1RUC3 1JYCA 3HT2A 4ZU4A 2P3KA 3FE5A 1R1A3 3VGIA 3I59B 2RS31 1N1YA 4H55A 2RS53 5CB7A 1GKBA 2ZHLA 2ZHKA 4I02A 5KHJA 3B5LB 3ZFEB 4IEYA 1OPOA 4LBOA 2GNMA 2WNEA 4X8NA 1PNFA 2LUWA 1NY71 4QM9A 4H7LA 2VG9A 1RUH1 3VHRA 2WC2A 1C28A 3JD73 2ZGLA 1YI7A 1QJY2 4GH4B 4PDWC 4RGAA 1NQDA 4LE3A 3VBFC 2LM3A 4AEJA 4HANA 2EVXA 4F83A 1PVC1 3ZIXA 2TEPA 2WA3A 2LALA 2VOVA 2DYCA 1WA4A 1PZ9A 1V6NA 1K5MA 4LHKA 3MIFA 3ZYPA 4XBLA 5FCCA 2QNKA 1RUC2 1MS0A 4RS5A 1R1A2 3ILRA 4P9GA 4N43C 1WLTA 1WW7A 2RS52 3PHMA 3R05A 5SV5A 2QZ2A 4XIOA 3JQXA 4INDA 2OZ6A 3H9AA 3VBSB 4XQWA 2DFCA 4UBHA 1V6KA 5C4WA 4XIKA 4Q0SA 2K0GA 4HT1T 3H0OA 3JD72 2KXLA 3WCRA 1NA1C 3GYDA 4UW6A 4YG0A 3B02A 1OSGA 1XNKA 5EV7A 3TBDA 1MS5A 2GZWA 3WD5A 1W6PA 4I0BA 4LBKA 1RUI1 4YW3A 3ZFGB 1F31A 2ATFA 4Q1PA 3E6CC 1BXHA 2D3SA 3FMGA 5GZGA 1WCDJ 2AYHA 3N7JA 4KWKA 3VDDA 1H9WA 2P3IA 3ES4A 5F1RA 5FO7B 2WFF1 4EN0A 5FO8B 4AI0A 3VBOC 5BNNC 4J1XA 2DU0A 3ZXDA 2FHRA 1TE1B 1BBT1 2EXIA 2PHUA 2AGSA 3MIGA 4AI8A 3D0SA 3NW4A 1QH7A 2QVSB 1H4GA 2XJVA 4AFCA 2VH9A 4FO9A 5EWSA 1HV1A 4K20A 2GMEA 3MIEA 3WDUA 2B7YA 1FNZA 1GBGA 2VY0A 4R4XA 4EV0A 1AXYA 5FDBA 4JGYA 2RR13 4WVVA 4FQZA 1X8EA 3B94A 4ASLA 3OTFA 4HSLA 3ZXKA 1CX4A 1DGWA 5IK4A 1UL9A 4YM3A 3S30A 3WDYA 4KBBA 5K7PA 2IXKA 4AQSA 4I0WB 1AR73 1VBD1 2NPIA 4FTBA 3CU7A 4UW3A 3UJOA 4P9WA 1V70A 3EO6A 4RQPA 1D0GA 2UURA 4PLMA 2PHLA 5DXDA 4K1YA 3SCFA 2ZHNA 2BNNA 1G7YA 5JLVA 1W6QB 2QDRA 4BQ1A 3ZN6A 1DLLA 4YZ5A 3ST7A 3VLBB 1LR5A 4TZDA 2ZX0A 4Q4Y2 2YDEA 3DPRB 1QOSA 2B9UA 2RS11 4LA3A 4MH0E 2IC1A 3NAPA 1DIWA 4XF3A 1H30A 4XXAA 1ND3C 1IKPA 3HQXA 3TNPB 3KSCA 1QDCA 3VHOA 2EF6A 2WS91 5LK7B 2LTNA 3B69A 5FAXA 1AR72 2PHDA 4CYDA 4UW5A 2XJPA 5DZFA 3WCSA 1XNBA 5ABJA 5AC93 3B3QE 1SFYA 4GA9A 5CFDB 1IKQA 4AEMA 4MLOA 1AJOA 1KS4A 1LEDA 1VBC3 2JG9B 1YFXA 4P9XA 1I9RA 1PZ7A 1UZYA 1B35C 5C8CA 4YW2A 1UD1A 4L97A 4K7JA 2DVGA 4Z92B 1WBFA 1G8WA 4I0AA 1RHI1 1S55A 2AZ5A 2DUOA 1AR63 2DVBA 2GAUA 2GC2A 4IEQA 4E27A 1LESA 2CGNA 3GBGA 1MEC3 1VBA3 1OOPC 1QOTA 4R4ZA 4DRRA 2PQQA 4GALA 1DGWX 2CAUA 3B9CA 4P9LA 5LEJA 1WW6A 2HWB3 3OGJA 3VBRC 3RMYA 4YVWC 1A6CA 5AC92 4ZXKA 1PIV1 2HEWF 4P9JA 3VL9A 5AFBA 3FLPA 1VJ2A 5BNPC 4PDWB 4B4QA 3CEWA 5CIRA 4D7SA 2E53A 3IKWA 4HKWA 1VBC2 1MQTB 1WW5A 2FMDA 4Y26A 1PO21 4ORFA 5L73A 5CAZA 3RI8A 3OY8B 4FQ4A 4AHZA 3M2MA 4W6XA 4DMIA 5SV8A 2VOKA 1R091 3ZDSA 4JAAA 2D3PA 1AR62 1TMF3 3GHMA 1JN2P 1UU6A 1EPZA 1HQNA 1MEC2 1VBA2 1S0CA 4FPOB 3WT3A 3Q9OA 2WSVA 2RHPA 1UAIA 1LOBA 2WJSA 2HWB2 1RUF3 4I3PA 2C9AA 4HPKB 2ZGNA 1COV1 4P9IA 1V9U3 3U0ZA 4J1WA 4I01A 1NA1B 1MZEA 2YV8A 1X50A 5JI7A 4CEYC 4WM8C 1ZZ7A 5GZEA 2CWMA 1IS4A 2DFBA 4OLLA 4K40A 3FBYA 4R9AA 4CDQA 3KCYA 1D4M2 4XF9A 4XFHA 1OLRA 2ERFA 3KCCA 2NP0A 2QJVA 4F3JA 4RHV1 1WLWA 1H2NA 1QJU2 3OD0A 1VIWB 1LRHA 2XBO1 2X53S 1LOGA 3VBOB 2YXSA 2ZKNA 3OBRA 4YFZA 2PHRA 1AVBA 1X33A 3A0NA 4OVEA 1RUF2 4YGDA 2IXIA 1LTEA 3MFCA 1GFF2 4Z8BA 5FQ0B 4HVRA 1UMZA 1XNDA 2P34A 3ATGA 3CNAA 1V9U2 1OA4A 2WNVA 2Q5TA 1AX2A 1SQ4A 1Y9QA 5FLJA 3CLPA 1RB8G 2IZWA 1BQPA 3A0KA 1W39A 1RUJ1 3FLTA 3QCWA 5I0TA 3ZX7A 1YXWA 3ZFFA 1VLNA 5FRAA 1S0GA 4I2OA 1EV12 1NCQC 1YFWA 2VNGA 1QJX2 3N7LA 4R52A 2Q4SA 4EWEA 4CRQA 2ARXA 2JICA 1I3HA 1ZVFA 2X5IC 3AP5A 1FPN1 4L99A 2HWF1 4PBOA 1LU2A 1ZBA2 1JYIA 2HEYF 2HWC3 2ZGUA 3MIHA 3NV2A 5HI0A 3S0MA 3MW2A 1OA2A 1LGCA 3JBG1 4WZCA 2D5HA 2D6MA 2P2KA 4LHLA 4M3CF 4FXGB 3RSJA 3VBHA 2ZZQA 4JDMA 3DL3A 4XFAA 1BEV2 2ZX1A 3OBTA 1KQRA 3FUQA 5ACA3 1PGL1 3VBUB 4XW3A 1Z78A 4KNCA 3AP7A 2PLV3 3MPBA 2BEOA 1NCRA 1UIKA 3KQRA 3IPVB 5B2GB 1G6NA 4ZU5A 2NN8A 1KXGA 3SCGA 1NOVA 2MNGA 1NE4A 1JHNA 3JUUA 5L7OA 1J59A 4Y1XA 1XXNA 2YROA 4ZKTB 2P17A 1LHWA 4BLJA 1NG0A 1XU1A 2K2SA 4N53C 2WFPA 2DTYA 3SLIA 1ZYBA 1ND3B 3M3OA 5FMOL 2EAAA 2WNUA 2WSUA 4XJ9A 3ZYGA 4C1WA 2YPJA 4QQ2A 4CEWC 1AYM2 1JUIA 2I2SA 2XLGA 4IV1B 1U5YA 2GSYA 2QFEA 2VXRA 1LHUA 2WT2A 4MX3A 5I93A 3E5QA 5K0UA 5DDJ3 3ASIA 5ACA2 2NYYA 1AXKA 1VBE3 2XG3A 2PLV2 4Q8LA 4I3GA 4IERA 2ZA9A 2DVFA 2ZABA 3N3HA 3WG2A 2A73B 4BPZA 1GZWB 5A32B 2VQAA 1H1AA 3ACLA 4M0NA 4Y22B 3EXUA 4YNIA 4K6BA 2QUOA 2VU9A 4MXWB 1OD5A 1W6OA 1TME1 3TN91 2DTWA 4RR3C 4QPIC 4META 1AXZA 1REFA 1H8TC 1QKQA 3WY6A 4MXVA 1IZ3A 4BE3A 2R16A 2H0VA 1CESA 4WM7B 4E2SA 5DDJ2 4YVWB 2VMIA 2HWE1 2RMU3 3OCPA 3ZFEC 4HK8A 1MZ5A 1RL3A 1VBE2 4YSFA 1VBB2 5I0SA 3R4SA 4YVSC 5C8WA 4BH9A 2GNDA 5BNPB 3WW1A 3O0XA 5JSPA 1TQ5A 1O4ZA 4Q4W1 5LEKA 4NO4A 1UCXA 4D3WA 4XF0A 1LB2A 4EROA 2Y38A 3TRSB 2RM23 3WDTA 4WBBA 3J4UH 1RUD1 5KXEA 4JDNA 1ZZ9A 2GN7A 2ZHMA 4JGZA 3IWZA 1X36A 4P5HA 1LENA 3MLKA 4WZFA 1CAXA 2UYBA 1GICA 3RJRA 4C1XA 4BIOA 1WUVA 3DF0A 1S2BA 5A3MA 2GH2A 2Z2SB 4D7TA 5F6LB 1NXD1 1JH5A 4AK3A 4PCRA 3NV1A 2IFWA 1RC6A 5EFUA 3PTYA 2PHXA 1RUNA 1ZX5A 2RMU2 1Q56A 4IEVA 4LEJA 3USUA 2NQYA 1LECA 3VBSC 3I54A 4AQTA 2WZR3 2IXHA 3QH7A 4TYSA 3FJSA 1V6OA 4AEDA 3SHRA 5HCBA 4URTA 2RM22 3QACA 2D6OX 5CU1A 1QY4A 2OUJA 1KDKA 1Z7S2 5I8TA 1V6IA 1K5MC 4LO7A 2E6VA 3D8CA 2CGOA 3FWEA 3V0BB 4AVTA 3MLJA 4LBLA 4FPEA 2B46X 5CG9A 5C6CA 3WUCA 1PVXA 4IEXA 5DUUA 4E2QA 2WT0A 2HJIA 1AX0A 4NHMA 4ONUA 4JRLA 2ZCWA 4PLOA 1ONAA 1HLCA 1SLLA 2H6CA 4CDWA 1MS3A 2ZX4A 3IN9A 3MIBA 4UXAA 3SCHA 2E51A 1RMU1 3QD6A 4N7IA 2WZR2 4L11A 4QT6A 1CD3G 4XJ8A 5T52A 4CDXA 3ES1A 1N3QA 1A8DA 3UKTA 5A33A 1BVVA 3PLQA 4Y1VA 3AZYA 4XQDA 1MZFA 5D8AB 4FPCA 2X5IB 3HMYA 4B3NA 2JENA 5EZWA 5GZDA 3RYKA 2VNOA 1RTVA 2DVDA 1CR7A 4G9SB 1RUE1 4H3WA 4V1PA 1VB4A 2V09A 1XYPA 4A7KA 1CAVA 2AH2A 4CDUB 1R083 1WLDA 1QDOA 2GC3A 3O14A 3D5OA 2H6BA 5K9YA 4EN8B 1BMV1 1KS5A 1OMIA 1GQHA 3WDWA 1PGW2 2XKOA 1J3QA 3GZUC 1RUG1 1GANA 1LKNA 3L2HA 4K21A 2E7AA 3ILNA 1U0AA 2ETEA 5I0UA 2QKDA 3WNXA 4DINB 4E2GA 1HRV3 3DPRC 1QQP2 4Y1YA 3RI9A 1NLRA 5JDBA 4BA6A 3RWNA 1RVF3 4CEWB 2GH8A 1EP0A 5HXVA 1S0FA 3W59A 1HV0A 4JVAA 4LE4A 3E5UA 2D6LX 1R082 2ZAAA 3HIFA 1XYNA 1WCSA 1UZZA 1BVP1 3SMHA 4QM8A 2MEV3 1PO11 5CFDC 4MYEA 1SLBA 4COZA 1OQDA 1H2LA 1KITA 4SLIA 2XVLA 4DNYA 5GZCA 1ULGA 2HWD3 1S0BA 1HRV2 4DPNA 1APNA 3OYWB 3NKTA 4JQRA 4QPIB 2PAKA 4MVTA 4OI2A 5JSRA 1H8TB 5DG2A 1QH6A 3ZPYA 1YYNA 1HXS3 4FPLA 1ZBE1 1PVC3 1S2KA 4F8AA 3QOPA 3SISA 2JG8B 1SBFA 2TUNA 1BK1A 1DU3D 4HFSA 4YVSB 1O91A 2MEV2 1FV2A 4FP2A 4B29A 3V65A 5C8CC 3CJIA 3WP5A 2XKPA 3ROUA 3VZJA 2IXLA 1N3OA 1MQTC 1VAVA 3LA7A 4EN9B 3H7JA 4ISRA 3USSA 1ND2A 3AJZA 1QJY1 2HWD2 1V6LA 3AYCA 2ZTNA 3WP6A 4M0HA 4EN7B 5C9AA 2OUHA 2AR6A 5FLHA 3AKPA 3O5SA 1HXS2 5GLZA 1SLTA 4KWLA 5FPZA 1U5IA 1RUC1 4GULA 3MZHA 3OJBA 1R1A1 5EJ3A 4XJUA 2PELA 1QMJA 4YZ2A 1OI6A 3O0VA 1MACA 4W65A 3NWKA 2ET7A 1UIJA 1A3KA 3P3PA 1BZWA 2WWSA 4Y1UA 3RG0A 1CONA 1NXMA 2R32A 4AVCA 3TOJA 3ZSKA 1N1VA 2BTVC 3JD71 1K5MB 3B9IA 3GF6A 4QGLA 1C4RA 5F9TA 4A7ZA 4XJWA 4CP2A 4YRDA 4RS5B 3DN7A 5J7MA 1FAYA 4I30A 2YMZA 3WP3A 3BALA 4DQAA 3SH4A 1X82A 3JU9A 4N9HA 3AMMA 5TSWA 3U11A 1U5XA 4GWMA 4MSVA 1YI9A 4KU7A 1AYN3 1PZ8A 2VNRA 4AHWA 1QWRA 3WQ1A 4OI4A 3KS7A 1W2UA 4N7UA 4U2AA 1H1MA 2Y0OA 4Q26A 1QXPA 2ZACA 3WG3A 3AXEA 3M70A 4BM8A 5FMOS 4EWAA 4CDQC 1W6PB 4LBNA 3KCXA 1KJRA 4XXPA 4QGNA 1LOAA 4HVQA 1KD7A 1F2NA 5DUWA 1CAUA 2GNBA 2JD4A 1G9DA 3VDDB 1ZRDA 1TEIA 1WCKA 3WG4A 4KH9A 3KT4A 1YUDA 2DCYA 2PAEA 4NWVA 1XNCA 2R043 1N1SA 1PK6A 2CWSA 5EYYA 2DCTA 4IESA 3C3VA 3MGUA 2RS13 2XJSA 2QDNA 1AYN2 2BNOA 4BOWA 1AJKA 3NSTA 3AYDA 3VBUC 4M3CA 2B5HA 3VZKA 2XPJA 2W08A 4O9EA 2NMNA 1J1TA 4AE2A 2WKKA 5JVVA 4Z82A 3MPPG 1SLAA 4JGYB 5D1IA 3WQ7A 5DZGA 5I8SA 2R073 3GBWA 4KWJA 1LCLA 1W6MA 2NMOA 1HRI1 2RR12 1AHSA 1GZ9A 4Q4Y1 3BIWE 1ZNPA 3HR9A 4YZ4A 1FT9A 1C57A 3MEPA 1OKQA 2O1QA 1J3PA 3N35A 4HLTA 1POV1 3EBRA 1YHFA 1VR3A 2R042 4XILA 3WW3A 3AJYA 1VRH1 4MV2A 4IV1C 2YHJA 4RQPB 4F7ZA 4DOUA 1AR71 1MVQA 2VVDA 3G7DA 4DY5A 1FI2A 3ZN6B 2OYZA 2E9QA 5JZGA 1X8MA 3DUIA 4TLFA 4E4ZA 3HWJA 2C5DA 4QPYA 4YW5A 1ZM1A 1J58A 2D44A 2R072 2TBVA 3NAPB 1Q8VA 2B8MA 5JPMB 3FX3A 5E88A 4R8HA 4QGMA 2QE3A 3OGGA 3KGZA 4Q0PA 1PIV3 2A6WA 1REDA 3VHNA 4IEZA 4LA2A 4Y4YA 4Q27A 2YGMA 4A7YA 3AMHA 3WW2A 4HVOA 4XDQA 3KD4A 4JDOA 5DG1A 3VZLA 1RINA 2YYOA 4C91A 1IGOA 1PO23 4AGGA 5K0UC 2XL9A 1IQAA 4QQPA 2A75A 4QQHA 5ABJB 1CIWA 2BW8A 3ZXJA 1OPMA 3ENRA 3VBFA 2BGCA 4B8EA 4CTEA 2XJTA 2ZMLA 3LB9A 4WM7C 5HBAA 1ZRRA 3IDBB 1QXRA 4RL7A 4WV8A 3AZWA 5C8CB 5AC91 4JV4A 3TB0A 1FV3A 1GNZA 1ASJ1 2SLIA 3NJZA 1S0IA 1VBC1 4O9GA 4BMEA 4N43A 1DYKA 3OF1A 2PYTA 3DGTA 1S0JA 3BTAA 3URFA 2JKBA 3WINE 3D82A 5J3UA 4GKYA 4DRVA 1UU5A 1DF0A 1AR61 2BWAA 2DWRA 1CPMA 1PMIA 3E97A 3LSEA 3SITA 1MEC1 1VBA1 1KRIA 4A2UA 4XZPA 1RJ8A 3RZZA 3LOIA 1EAH1 2HWB1 1Q8QA 3E6BA 1C8M3 3N7MA 4AHYA 2VOWA 4COVA 3M7AA 4Y5Z0 1H4HA 3WHTA 2DVAA 4LTAA 1PHMA 3H1YA 4IEPA 3BOPA 2ZX2A 1VP6A 2D6KA 5BNNA 3RNSA 3ZN4A 4XMAA 1TMF2 1MS4A 5T5PA 1C5IA 4YM0A 1D4M1 4MUVA 3LAGA 1NE6A 5J36A 2EXKA 4GMP3 4NOTA 1QJU1 4KGQA 3RYPA 1A8MA 4IEOA 4XMIA 2OZJA 4LLOA 1WMEA 2XHKA 2A6ZA 4FPKA 4IEWA 2HWF3 2X8KA 4BIFA 5BUVA 1RUF1 1C8M2 1H9PA 2R063 3AP6A 3JBG3 4PF5A 3POWA 4CDQB 4U36A 1V9U1 5LRRA 5F5QA 5HCAA 2GDFA 3PVBB 5J96B 1O3SA 4FOQA 2SBAA 1GV9A 1C1LA 2BFUL 1U12A 3ZVXA 5D8AC 3B00A 1EV11 1H1IA 2ET1A 1QJX1 4AG4A 4RD7A 2YC0A 4YARA 1XE8A 1BCXA 2ZGQA 4ITCA 4JRAA 1ZBA1 4IQPA 5I0RA 3WR0A 1ZZBA 2VVFA 4XJAA 3GZAA 1J3RA 2EA7A 4CDUC 1TNFA 1W0OA 1YJKA 2WNVB 3B01A 5JMCA 1W6NA 2HWF2 3J8F3 3KM5A 2ZOEB 1BEV1 2JECA 3BOWA 2R062 3ZSLA 1ALYA 3AKTA 4C90A 1KJLA 4XTMA 3ZFFB 3HD8B 1GSLA 1ENRA 1MVEA 2KM2A 4J6GA 2XL7A 3CL1A 5L19A 1POV0 4FPFA 4Y1ZA 3O0WA 1O3TA 4BWOA 5CG8A 3ZXLA 4OZXA 1CAWA 3UKNA 4HN0A 2R30A 2Q1ZB 5HCFA 3IIAA 2HWC2 2CYFA 5FPXA 3TNQA 1DQ5A 1QOOA 3D6EA 3VBHB 4AFMA 4AEKA 2DV9A 3M1HA 1H8VA 4Q0VA 1WW4A 3MLLA 1TME3 3AZXA 1AYM1 1D2QA 4M00A 1H2MA 1NCRB 4PBPA 3VHPA 1Q3EA 4AW7A 3NO8A 1B35A 2W68A 5A32A 3J8F2 1SBDA 5L7OB 4KQ7A 4Y24A 4Z2WA 3N4MA 3I2DA 5ACA1 1SCRA 5H9RA 5GLTA 1JW6A 1VALA 4LULA 4KU8A 2PLV1 4JCKA 3D0JA 2WNUB 5LK5A 4FCAA 5FLIA 3RQ0A 1OOPA 3U10A 4K1ZA 2CAVA 5FFOC 1Q8PA 4H7MA 1ZZ8A 3V64A 2CGPA 4Q4W3 4BCUA 3VBRA 3QLQA 3LCPA 5CFCA 1DBNA 5K0UB 1WD3A 2AENA 2HYKA 3T1LA 1IS5A 1URXA 2I07B 4DZGA 2YY1A 3M3IA 4GIQA 3M3CA 4EJRA 5T55A 1LOFC 2IXJA 4AVSA 1DQ4A 3RMXA 2G9FA 2JG8C 3VUOA 1I5ZA 5BNOA 1Q5OA 1SMVA 2GMPA 2UY9A 5DDJ1 2O8QA 1XU2A 3VZNA 2VQ0A 4FPGA 4UBGA 2JE9A 3WLUA 1LU1A 5IK7A 1VBE1 2PTMA 3NVCA 1VBB1 2OPKA 3R6SA 1W6OB 2D40A 3DV8A 3MI8A 4XF4A 5GLWA 1FMD3 2D7FA 1E57A 2X29A 4QPGA 4M01A 1H2KA 2F4PA 4QHBA 2GALA 3ZXFA 5JAXA 3HN1A 5BPXA 2R1BA 4HK9A 1YFYA 3G6JB 2JDZA 2AREA 3CF6E 4PJYA 2CTVA 4CEYA 1UF2C 4WM8A 4FSJA 3J26N 4CP0A 1F9KA 1QF3A 1IPKA 2RMU1 1DQ2A 3H3UA 1ULCA 1CVNA 1D4VB 1VAMA 3D4KA 2MHFA 4JGZB 1G86A 2DCJA 2ZX3A 4R9CA 5C9AC 1CAXB 1FMD2 1FOD3 2RM21 3LOBA 2A3XA 1Z7S1 4S2FA 1QU0A 4RS5C 4IL7A 3K51A 2GC1A 3FLRA 4XE9A 1HW5A 4Q8KA 1PNGA 4LBQA 5CA6A 3VKOA 4P14A 4GQ7A 4S2DA 5F6KA 2KA3A 5KHHA 1O5LA 3USUB 1DYPA 1OQEA 1RJ7A 4K8FA 4NVPA 2EALA 5C4WC 4AEDB 2FZ1A 4OFGA 2GC0A 1NCQA 2Y0IA 3APBA 1DQ1A 1O3RA 2XWBB 1MZ6A 1DG6A 4Z07A 2WZR1 3P3NA 4BZ4A 3N36A 2D97A 1W0PA 1WLCA 3JZVA 5J37A 4FXKB 3VN4A 5GLVA 1SLIA 2PFWA 2RJKA 1FOD2 2VPVA 3V0AA 2WT1A 4Q4V3 2P37A 4GB33 3VDDC 5FO9B 1RUG3 4HKLA 4KG8A 4WVMA 5JI9A 2WLPA 3PMSA 1AF9A 3S7IA 4CDWB 4YW1A 2D6PA 2BPA2 2XJRA 1Q8OA 5T3NA 4CDXB 1SBEA 2ZJCA 1LHNA 4XBNA 4Y20A 3X29B 5EXOA 2Q1MA 3FUOA 5A33B 4ASMB 1O5UA 4N53A 1N47A 4RSUA 1PGW1 1UPSA 3THTA 1ZA4A 3NL1A 2A5ZA 5GALA 4JGYC 3MFAA 4HETA 5DUVA 5KBFA 1IOAA 5E16A 5BV6A 1BMV2 4AF9A 4BMBA 1AL23 5E8AA 1BKZA 3ZSJA 4KL1A 5CBLA 1OHFA 4Q4V2 5T5JA 1PO13 4GB32 1S0EA 4XHXA 3IDEA 1JXNA 1QQP1 1RUG2 1WMDA 2QCSB 1CAVB 3PVOA 2FQPA 2VVEA 1AR83 3H7YA 5H9SA 3VL8A 2O8OA 5JSOA 4FOVA 4IV3A 1BYHA 2A6XA 5JPNB 1HQLA 3JQWA 2R1DA 1REEA 4RQPC 3UK9A 1AR93 1R081 4L9BA 2ZS6B 4Q4X3 2C1FA 2RS33 3FHIB 3OYWA 1ZBE3 3PVNA 4RR3A 5T5OA 4E4DX 1C3HA 5IK5A 4D7YA 1QGLA 4PLNA 3NAPC 3FC0A 1O7FA 1CPNA 3ECQA 3V56A 1AL22 3KB5A 3L9JT 4LO5B 1PGSA 3I59A 1JBCA 1HKDA 2R6QA 1CGPA 1PO12 4AI3A 2E7QA 4HZFA 1RVF2 5CNAA 1HRV1 1RUH3 2ZAHA 4AFBA 2JXAA 3ZN5A 4IETA 2Z5WA 3ZFEA 4OHYA 2BQPA 1AR82 1AX1A 4YG3A 2IXCA 1Y43B 4HKOA 5KC5A