3WT3A

New crystal form of a hyperthermophilic endocellulase
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
270
Chain Sequence
KVLKIRYPDDGEWPGAPIDKDGDGNPEFYIEINLWNILNATGFAEMTYNLTSGVLHYVQQLDNIVLRDRSNWVHGYPEIFYGNKPWNANYATDGPIPLPSKVSNLTDFYLTISYKLEPKNGLPINFAIESWLTREAWRTTGINSDEQEVMIWIYYDGLQPAGSKVKEIVVPIIVNGTPVNATFEVWKANIGWEYVAFRIKTPIKEGTVTIPYGAFISVAANISSLPNYTELYLEDVEIGTEFGTPSTTSAHLEWWITNITLTPLDRPLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new crystal form of a hyperthermophilic endocellulase
rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Endoglucanase A
total genus 72
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wt3A00
1YNAA 1OA4A 1XYNA 3MFCA 1OLQA 2Z79A 1UU4A 1H8VA 3VZMA 1REDA 1C5HA 1UU6A 1BK1A 1HV0A 3MFAA 3ZSEA 3AKTA 3M4FA 2QZ2A 1OA3A 2NLRA 1HV1A 3AMPA 4XQDA 4S2FA 3VZOA 1QH6A 3AMQA 3VZKA 2B45X 2QZ3A 3WX5A 1XNBA 3LB9A 4XQ4A 1QH7A 3AKQA 1H4GA 2DCKA 4XPVA 5EJ3A 3WP6A 3AMNA 3VHNA 1W2UA 3WR0A 1M4WA 1OLRA 2VGDA 1BVVA 3WXPA 1XNKA 3VLBB 4HK8A 2B42B 2JENA 2DCZA 3HD8B 2BWAA 3AMMA 2DCYA 2VULA 4S2GA 2DCJA 2DFCA 1IGOA 1XYPA 4HK9A 3AKPA 2JEMA 3VGIA 2F6BA 3O7OA 5K9YA 3WQ0A 1H4HA 3RI8A 2JICA 1KS5A 1BCXA 1PVXA 1XNDA 1H1AA 2D98A 1TE1B 2VG9A 4S2HA 4NPRA 3VZLA 1ENXA 4XQWA 3B7MA 3VZJA 5HXVA 2D97A 1H0BA 3WP5A 1C5IA 1T6GC 1NLRA 3WQ7A 3MF6A 4H7MA 1UKRA 1UU5A 2BVVA 3AKRA 3WQ1A 4HKWA 2NQYA 1REEA 2DFBA 3AMHA 4HKLA 3WY6A 3RI9A 3EXUA 4S2DA 3WP4A 1OA2A 3AKSA 5K7PA 1XYOA 1REFA 1AXKA 3MF9A 1F5JA 3VL9A 1XXNA 3WT3A 2BW8A 2C1FA 3VZNA 4HKOA 1KS4A 3WP3A 1HIXA 3VL8A 2VUJA 3LGRA 1XNCA 2B46X 3VHOA 3VHPA 3B5LB 4IXLA 2BWCA
chains in the Genus database with same CATH superfamily
3AP6A 3MYXA 3LEKA 3VBSA 2GC3A 2VE1A 4CDUC 5I8TA 5A1AA 1CAXA 4PDWA 2DU0A 2XHKA 1NZCA 4AHWA 1CIYA 1U5ZA 1ZBA1 4KGQA 3VDDC 5IK8A 3OOXA 4BYYA 5CKQA 5JZGC 3VV1A 2E51A 1SBDA 1TMF3 2W95A 4HLTA 1BK1A 1OQDA 2D6KA 4P00B 5GLZA 3UV9A 3JBG2 1D0HA 1B09A 5FZHA 2JECA 1OUSA 5IK7A 2R0HA 4EN8B 2YMZA 1C8M2 2VMEA 4I02A 4LQRA 1RC6A 4WM7B 3HPNA 4P14A 2B5HA 5FP8A 3WINE 3U0ZA 1H9WA 1O6UA 4JDOA 1AR91 3M8LA 1XNBA 4ARXA 3LB9A 1YHFA 3N9LA 3PU8A 4MOAA 3I49A 2RDRA 4XJWA 4EYUA 5KR7A 2VY0A 3W9AA 2ZEZA 2D40A 1BEV3 1JZ7A 2P3KA 4PT6A 4P9LA 1WCKA 2QNKA 4NIAA 2R1BA 4QXBA 4MADA 3O1VA 1OFNA 3RSJA 3WR0A 1CAVA 5DAVA 3L2YA 5T5LA 1LHVA 4JGYB 5F5CA 4R52A 5CKMA 5EJ1B 1HRV1 3DV8A 1GBGA 1GLHA 4NRMA 1YLLA 3T2QA 4MHRA 4A6SA 4SLIA 3USUA 4D6QA 5AC92 1UW8A 2OXBA 3WW2A 1J3QA 5GLWA 5FY7A 5IUQA 1PK6A 2KR2A 3ZFGC 1GNYA 2D3PA 2R043 1C8NA 4LO6B 4W6WA 4YRDA 2GNBA 3T0DA 1APNA 3KT1A 2RHPA 1POV0 4CEYA 2ORXA 1QJU1 3V0BB 4JC1A 4O7XA 4E8DA 5E89A 4OFGA 3AYAA 4NE9A 3ILRA 1SEFA 4GKYA 3A0KA 4Q0UA 1PVXA 2W91A 4XBLA 5BV6A 1O4ZA 4XUOA 5LEKA 1MEC1 3CDZB 3LSDA 5F37A 2UWAA 1ZBA2 4CEWA 2ZHLA 2JB8A 4GJZA 3WSOA 2FDIA 4MGSA 4WBBA 1RUI2 3LZZA 4LR4A 2D7FA 3FBYA 3NVCA 1RVF1 2GN7A 2X5IA 4K8FA 4PJYA 1OHFA 3TNQA 5A3OA 2ZGNA 1FOD3 4UW5A 1OVSA 5C4WA 4BK4A 1YI7A 4OQ8A 1WLWA 5A7NA 3J26N 3VBSC 5KHHA 3EYPA 1DQ4A 5FWEA 4Q0PA 2RJKA 3AL5A 1DQ1A 4GD4A 4GKXA 4JGYC 1RVF2 4QPGB 2VC9A 1DZRA 1REEA 1UNBA 2BP6A 2XBO1 3WDUA 5A6QA 5J1XA 4RQPC 5JCTA 1SBEA 3H0OA 3FC0A 4XDPA 4NPLA 1QU0A 2DTWA 5JIAA 5JXIA 1DDLA 2WABA 2XUEA 3WF2A 1W6MA 3NW4A 2QCSB 3QH6A 5CFDC 3I3BA 4WZCA 1UMIA 1EP0A 3E97A 1NCQA 2ATFA 2NMOA 2UU8A 3AYCA 5AC91 1ZA7A 2QFEA 4N53A 4YM0A 2E31A 4JKKA 1CIWA 3RZZA 4IE4A 1W6MB 3WW1A 2A73B 2Q8DA 4TZDA 1BVP1 3M70A 2W3JA 3HNMA 1HQLA 1S0BA 5FMCA 3THPA 1UYXA 4E2QA 2WNUB 1UYYA 4FXKB 3WV6A 1J3PA 1ZA4A 4YARA 2VNOA 5FXXA 1V70A 3J7NA 3AP9A 1MEC2 1NLSA 1C5HA 5FXWA 3WDWA 4TLFA 2RR11 4QX1A 2HEVF 2Y60A 4XAAA 4H7LA 2ZJCA 5C71A 3B00A 3B3QE 1VE0A 4J1XA 3VZOA 4AZZA 4CEYC 3DGTA 4KGGA 4RS5A 2B45X 1HN1A 1UMZA 4HPKA 3ORJA 5FPVA 5A3PA 3B69A 2C9AA 1VAMA 1XNAA 3ZFGB 1TME2 4XPVA 3WOGA 3WF4A 2WFF2 2HWE2 3JB8A 1OT5A 1LENA 3CJXA 3ZXLA 3DXTA 1VBA1 3K4ZA 3W5NA 3ZYIB 2DF7A 1U5XA 5AVPA 4ZU5A 1ASJ2 4RN5A 3CMGA 2X5IC 3OPTA 2LW8A 2YXSA 3OBRA 3TEZA 4JRLA 1W6NB 1NCRC 3GNEA 4OMDA 3RS6A 1W8TA 3VD4A 3LPGA 3AMMA 4PIYA 2CWMA 4X8NA 2BEOA 3AC0A 5IAVA 2BGPA 4RSUA 2ZHKA 2UY9A 4MGIE 2PQSA 2IFWA 2JEMA 4JHZA 1TNRA 3DKQA 3K48A 5LASA 1FATA 1WW7A 5ANNA 5F6KA 3APBA 5FLIA 4K20A 2CHHA 2RS52 5ANQA 2X10A 5EZWA 3ZKYA 1UF2C 1W3VA 2BZDA 2WZR2 5JOZA 3ILNA 3LWCA 5GLTA 2JKBA 3TRSB 4AGVA 5KWRA 1HKDA 2NP0A 1IOAA 4SBVA 4XETA 1ZRRA 4AVSA 3SNMA 5FYTA 4MXWA 4AEDB 5LEJA 1TQ5A 1VB2A 3NV2A 4LMFA 1WA6X 1H0BA 2LS6A 5CYYA 5CU1A 5FKBA 1JZ6A 3J7LA 4UW4A 1G9CA 3OJBA 4JGZA 1UY2A 4XVHA 5T5PA 1R1A3 4D7YA 5FQ0B 2IXJA 3MDPA 3USUB 1AYM3 3RJRA 3FMGA 5FZLA 2NM1A 4Q4W3 4KBZA 2BDRA 5D21A 3KCYA 1GZWB 1RUF1 5FYMA 4S2DA 2P1BA 3WP4A 4MSVA 3RZJA 4GQ7A 1HXS1 2ZPXA 1AXKA 4CUBA 1E57A 4Q4Y1 4YZ1A 1YFXA 1W3XA 1LHOA 1POQA 3M3OA 5FKCA 1W2OA 4YW4A 2XR4A 5A80A 3VZNA 2OA2A 1RGSA 3OSDA 3PIJA 1VBC1 3GDBA 1H8TC 1W6NA 1HXS2 4JKLA 2VCAA 1XNCA 4HONA 4NJ4A 5JR2A 4NROA 4Q4V3 3VHPA 4LKDA 4N9IA 1YJLA 3X29B 1SDDB 2WYFA 3NV4A 3ZSMA 2P34A 4XUQA 1IHMA 4IESA 5IVEA 3FL7A 1N3QA 2ZA9A 3NAPB 3NNLA 4TSVA 4UF0A 2OVUA 4YVSB 4BMBA 3MFCA 3C7GA 5HCHA 4LORA 2DUOA 3T3YA 1Q8VA 4FFIA 1X82A 3KM5A 5DUUA 3I2HA 2XL7A 4Y5SA 4FPOB 4CTEA 4XFGA 1KFXL 1GUIA 2DCTA 1A34A 1PZ9A 3KV4A 3QBQA 1YIFA 3BI3A 5LZ6A 5FP7A 4XUPA 4CCJA 3RQ0A 3VBUC 4EZHA 5EYYA 2G1MA 1W0PA 2UY8A 4YM2A 2YV8A 4KNCA 4Y1XA 2R073 5L9VA 5GALA 3UT0A 4IV1A 4IEUA 5GKAC 1FX5A 1NUKA 2PN5A 1AR61 2E7TA 3KF3A 1YXWA 4HN1A 1D4M3 4QHZA 5FK7A 4AQ2A 1VRH1 1UWWA 2JDNA 2J22A 2WLQA 5LBCA 2ZBJA 1KRIA 2GMMA 1LOAA 5BNQA 2XKPA 1JTZX 2WZR3 2ZX0A 3PVOA 1O4TA 3FLPA 1JOBA 4BQ1A 5AFBA 1BYHA 2QQNA 4KU7A 1ACCA 3NO8A 1IG0A 3FLRA 2Y6HA 3DCQA 3GJBA 1Q8SA 4H2AA 4R9DA 1AXYA 3TN93 1EAH2 2VULA 2QTWB 1LGCA 3C3VA 1IGOA 3WNPA 4YSFA 1LOBA 1UZ0A 2GNMA 2XG3A 4JRAA 4L0PA 2UYAA 4RR3C 4CVUA 5HCFA 4O61A 1N3PA 4N9HA 4BQ3A 4QPGC 4HN0A 4EE2A 2BGCA 3RDIA 2D6LX 2FCUA 3ENRA 5E16A 3WW4A 5I0SA 1CVNA 1JOJA 1MQTC 5B2GB 3U4XA 1EV12 4I2OA 2RDSA 4U36A 2B9VA 1Z78A 3A21A 5FMDA 5A3LA 1S2EA 1VBC2 3I8TA 4KBBA 3V64A 1R091 4IE0A 3VZJA 5J7MA 4FOYA 5L9BA 2WSVA 1RUC3 4OUMA 5FK8A 4YW5A 4FPCA 3OY8A 4C1XA 1L7LA 3WNMA 4D69A 1EV11 2Z69A 4L97A 2OQ6A 4JGYA 3SXWA 2WAOA 2EIGA 3WQ1A 4BXSV 4BOWA 2H6CA 1VMJA 2XGXA 4ET7A 2NQYA 4E2SA 4ZXEA 3VBOC 3WNOA 3RI9A 4YW7A 3EXUA 5FZ3A 5FJKA 4CUCA 4FOWA 1DU3D 4BJ0A 4PI0A 3NV1A 4XXPA 1XOYA 1FV2A 2YPJA 2P3IA 1N3OA 4MGQA 4FFGA 3PUIA 4IV3A 4BCUA 3Q8BA 5ISLA 1B35A 1F2NA 2AH2A 1GANA 4UFIA 1UZYA 5LW9A 4Q4Y2 4HVOA 4QGLA 3ST7A 3AJYA 5IT6A 4XFAA 3I59A 1MZ6A 1O8SA 4HFSA 2R0FA 3DPRB 1DQ6A 2ES3A 3OD0A 4PDWC 3O5SA 5A7OA 1O91A 2BWCA 1Z7S3 2D44A 1SQ4A 3BODA 4Y33A 4EN9B 5LA2A 1D2QA 2B8MA 2D3RA 2RDNA 3NNFA 1XB9A 5JVVA 5FPAA 4IEWA 2YZ4A 4Y22B 4E2GA 3TBDA 5EV7A 3IDEA 1AJKA 2WWJA 2XLFA 3PVEA 4FPYA 3KV9A 2VXRA 4PLOA 2Y33A 1QOOA 4IETA 5LBBA 5FZDA 3VZMA 2FDKA 1JN2P 1QMJA 1KGYA 1OVPA 2VQUA 3ITQA 4BPZA 4C1WA 2WZEA 2EXIA 2QZ2A 4K9SA 4LHLA 1S0GA 4DQAA 4WM8B 4IE5A 2J1UA 5JDBA 2Q8CA 4QPGA 4FAHA 1WLCA 2QQVA 3CEWA 3GZEA 1WBLA 1XC6A 3H7JA 2GNTA 3JD73 3JBG1 3NAPC 4IEPA 4JTOA 4XURA 5I0UA 3R6SA 1AR73 1QJFA 2WQZC 4JQTA 5LY1A 1YUDA 1YYNA 2Z4FA 4W8JA 3IIIA 3ACIA 2PHXA 3POIA 5FYHA 4QQOA 1K12A 1RXFA 3I2KA 4LBLA 5DAWA 5DZGA 5FYIA 3IKWA 4QQPA 1NCRA 1MS0A 3VD5A 4AI8A 1LOFC 4AI9A 1AUYA 3NJVA 3KGLA 1BBT2 3GXUA 3R4DB 1WA4A 1WMEA 1XQNA 4IGQA 5FOJB 5C6CA 1SLTA 4RGAA 2JKXA 5CISA 3PVNA 1GWMA 4MGKE 2Q1ZB 5A7QA 5FY1A 4RGKA 4UW6A 1GP5A 1QOSA 4DEVA 1HQNA 4W4ZA 1D7PM 1IS5A 5I0RA 4QU1A 1Z7S1 3T0BA 4M3CA 3MIBA 3AZZA 2ZS6B 3IDAA 1RYYA 5D8AC 1W9TA 1JZ3A 4LK6A 3EHKA 3MEPA 2WZPP 4B1LA 4W6YA 2GALA 5A32A 4QGMA 2AACA 3ZM8A 4PDWB 2Y34A 3AVRA 4B3NA 2BUKA 1AR82 2C24A 2VVDA 2HWC3 3J8F3 3VKFC 1HRV3 2ZMNA 3IM0A 1YQ8A 4YVWB 4D0QA 4DXRA 1VLNA 2WL1A 1V6IA 5F32A 1PO21 2DVGA 3MF6A 2W46A 4HSLA 2KD7A 1ZM1A 3VDDB 4DUWA 2J1EA 3TWIA 5JI9A 4CDXC 1MS8A 4ISRA 1DF0A 1GQPA 4MGZE 2UWCA 2HWE3 5CB7A 4YFZA 5IVBA 4I3PA 1ODMA 3V65A 1UAIA 4URTA 1MPXA 4XBQA 4XMIA 5LWBA 5CIRA 5JXGA 4D7SA 4OCTA 3N9QA 3USSA 3AMHA 1SLAA 2A6XA 1ZZ8A 2EIEA 1MQTB 1WCUA 4YVSC 1F4AA 5D1IA 1V00A 3PMEA 3RNSA 1H2NA 5A7SA 4CSWA 1MS9A 1Q8QA 2GH8A 3BIWE 5IK4A 2WT2A 1RTVA 2WR9A 3GCWA 3LOIA 1DZQA 1PZ8A 5CZKA 5APAA 1RJ8A 1VBB3 1MVEA 1JS9A 5FY0A 4LEJA 2RJ2A 2HWB1 1YJKA 4AQ6A 4B8EA 5JWPA 3AVSA 3NJZA 4GH4B 1COV1 4IEQA 4Q5OA 5LY2A 4BE3A 5C5TA 1POV3 4AI2A 3OY8B 4QKBA 1YWKA 1ZZCA 4TWTA 5F2SA 4JGZB 3LOBA 2WQ8A 5FPBA 4B29A 3Q8AA 4M3CF 3TN91 4YNIA 1ASJ3 3BGAA 2OIIA 1NT0A 3OBAA 1UIKA 1SZBA 1HV0A 1SPPA 1LEDA 3ETPA 4BIOA 3AMPA 4XC9A 1LEMA 2W1SA 3MW3A 4DO0A 1QQP2 4HANA 4JX0A 5FYBA 1WUVA 4OI0A 4LBJA 4NOTA 2E7AA 1CAWA 4JZRA 5H9PA 5ERLA 5C9AC 2VMHA 4LBQD 2P5BA 2VTXJ 4INDA 4XFCA 4AE2A 2JJ6A 3AZXA 2NYYA 4HZFA 2AEYA 5CFCA 1AR92 2JE9A 2OZJA 5DUWA 2BNOA 3GZUC 5BNNB 1JYXA 5T5OA 3RPQA 1H6XA 2A3XA 3TYJA 3ZLIA 3IMMA 4GH4C 1ND3C 2VMGA 2WAAA 2B42B 4UBGA 4CCOA 4XF3A 3ZFFC 4DFSA 4C91A 1RINA 3I3QA 3RMYA 4BLIA 1ASJ1 2WUHA 1S4CA 3BN6A 1RUJ2 4KQ7A 3N3HA 3NV3A 2RS12 2ZGUA 1ZYBA 4EV0A 3VBOA 3D8CA 4DRVA 3K46A 4Z2AA 3UGFA 4PIZA 5FZ6A 1UIJA 2EA7A 2YY1A 3WF0A 4HK9A 4MV2A 5DN2A 1HLCA 3U75A 3O1RA 1RUJ1 1MS1A 3HJRA 4CDWA 3I2DA 4PBPA 3B93A 1XNDA 4LK7A 4UWDA 2ZGKA 3U07A 3ZYBA 1ULEA 3GM8A 2LRPA 5L7OA 1LOGA 2R6QA 2ZAHA 1DFQA 3B7MA 1NYWA 2VNVA 3LSEA 3WHUA 2GP3A 1LU2A 4CP1A 1T6BX 2AZ5A 3LFIA 2DDUA 2HBUA 1NG0A 4XUTA 4LBQA 4YW1A 3OUIA 5A32B 4BDVB 1G9BA 5FCCA 4M01A 4COVA 4TTGA 2DV9A 3B94A 4PF5A 4GAZA 3PJYA 4MVTA 2PHTA 3T0AA 2ILMA 3LAGA 5BNOB 4PI2A 3OPZA 1PO22 1QKQA 1LAJA 3H1YA 2A3WA 4FOVA 1XSRA 4IDZA 4R9AA 4M3CE 2ZKLA 4Q2FA 1IS4A 2IXLA 3AYDA 1QJY1 4OLLA 4QT6A 1R083 2AGSA 4XJUA 1BHGA 5CBLA 1J59A 2WN3A 4QX3A 2OX0A 4YZ3A 5KHKA 1DIWA 1KITA 3PVBB 3UYJA 4COWA 2VCCA 3EQEA 3IT8A 4RGGA 1WMXA 3HWJA 3HN1A 2E63A 3IIAA 2W68A 4GMP1 4LOSA 2H0BA 4OHVA 1HRV2 1KS4A 4PF1A 1JYNA 5L73A 4ITCA 3VBSB 4HL0A 1BBT3 1OQ1A 2D5FA 3CNAA 3ZYPA 5BNPC 1CJDA 5IFTA 2FQPA 3LA3A 1SLBA 3KT7A 4LA2A 3VHOA 5CG9A 2WNVA 3H8UA 3KCXA 3S0MA 2VZQA 4ORFA 1NXD1 1Y9QA 1NCRB 2ZGQA 5DAPA 5GJ6A 3JZVA 1V9U1 3QLQA 3R4SA 2UYBA 3POEA 1G86A 1LOFA 1N1VA 2YHJA 3WW3A 3OUHA 3POJA 1JH5A 2WJSA 3PTRB 4G3YC 5DABA 4UOJA 5FZ1A 1WKYA 2YGLA 2E6VA 3CIHA 2N7GA 5BNNC 5EYXA 2BNNA 2Q5TA 3AXEA 4LBQB 2PHDA 4LBNA 4NHKA 3MFAA 1R64A 2IXHA 3ZSEA 1H8TB 1Q5OA 2R7EB 1ZNPA 5A7PA 4Y26A 2ZGPA 3HQRA 3ZSKA 3ZXGA 3VZKA 5FZMA 3M3QA 1Q56A 2DU1A 2YC2A 4N7UA 5FP9A 4N90A 1G9AA 1N1SA 1H4GA 2CAVA 3MV11 1C1LA 1ZBE3 2A6YA 4AL9A 4XF1A 2XQXA 1UY3A 4NHXA 3BTAA 3E6CC 1O3RA 3VBHC 1HB1A 1F5FA 1TMF2 2WQ4A 1RUOA 4YZ2A 4ZU4A 1EV13 2RDQA 1RL3A 1V6KA 5BYNA 1YRZA 1BVVA 2CV6A 3KD4A 1LODA 4DUXA 3WDVA 5EP9A 3UK9A 4XXAA 2CDPA 1UN1A 5ABJA 1V6JA 3I2IA 4YVWC 2A6ZA 3W20A 4MG2A 3WCSA 2DCJA 1W28A 4DINB 2HWB2 3NJYA 5L9RA 3T2OA 3O0VA 2EIDA 1UY4A 5D8AA 4C8DA 2XMLA 5C8CB 1W05A 3E6DA 1SLLA 4Z82A 3WLUA 3I2OA 1UOJA 4LPLA 1TE1B 1CZTA 3LIGA 4LO8A 1PO12 4NPRA 1GP4A 2WS93 2JD9A 1LRHA 2EXHA 2WO2A 3IB3A 3ZXDA 2F17A 5HBAA 2W52A 4W6XA 1ONAA 2HWD3 2CDOA 5FXZA 3SITA 1C5IA 1KDKA 1UY1A 3JU9A 1IKQA 3JD71 3QD6A 5FUPA 3POBA 1H2MA 3DEMA 2BVVA 1S0IA 2PFWA 2ZMLA 4ZS3A 3VD3A 5J48A 3GBWA 1NA1C 4A2UA 2AC1A 4WVZA 4GMP0 5F2WA 1JXNA 2EIBA 1L3JA 1QJEA 2PMWB 4Z2WA 2J42A 2XLGA 3LA7A 3KLSA 4BU2A 4CU9A 2OZ6A 3RYPA 2RR12 2Y38A 4ZXKA 4A45A 1SDWA 2C5DA 5F1RA 1XE0A 3I2GA 1HJGA 3AZWA 4MLOA 3JXSA 5FBZA 3CO2A 1PMIA 5BPXA 3VDDA 3ZXJA 4CP2A 2V72A 4CXWA 1HIXA 1QY4A 3KCCA 4AYUA 3CLPA 5FR3A 2C4XA 4AEJA 4B4PA 4Q27A 3UKNA 4YZ5A 2DVFA 2JX9A 3J4UH 5FDBA 2QQLA 5LBFA 3BCWA 1YQ6A 1JUHA 4CUGA 5FZ9A 4N8MA 2G9ZA 3ZFGA 4LUKA 2ZTNA 4XF9A 1CD3G 1NZIA 1FNYA 1S0JA 1ZBE2 3ZFFA 3AZYA 4CP9B 4IEOA 4ZZ8A 2XVGA 4I30A 4LIUA 1F9KA 2VZ1A 3MLKA 4IERA 1VR3A 3IAPA 4BH9A 2ZAAA 5A6ZA 4XFBA 1DGLA 3BPZA 2P2KA 3WG1A 3FUQA 4HG6B 1DGWX 1F31A 1JI6A 1CONA 1QH6A 1QEXA 4K3UA 1PNFA 3ACLA 4O9GA 1BEV1 3BOWA 5ABJB 1S2KA 5FY5A 3R0RA 3ELNA 3CBNA 3HBKA 4UXAA 3ZSLA 5CFCC 1SBFA 1AYM1 3FUOA 1PGL2 3R05A 4YW6A 2RV9A 3OB8A 2WLPA 1E5HA 5FOBB 3BTZA 4G4FA 1V6LA 3CL1A 1VRBA 1ZX5A 3J7HA 1IPKA 1KDMA 1O59A 1ZZ9A 5A6XA 3SH3A 4K8RB 5BY5A 1ENSA 1HB4A 2ARAA 2J1AA 4K7JA 3N9NA 1SLIA 5G05L 1UL9A 5JIUA 4BXFA 4ZPIA 3O12A 4Q4X2 1NA1A 3HT1A 3SEEA 4FXGB 5EQUA 2BBVA 2LM3A 5D2AA 2VCMA 1MS3A 4I01A 2R042 3C7HA 2VUAA 4TYSA 3OCPA 5FPXA 1BBT1 1OMIA 1QXRA 4AQSA 5FY4A 5JPNB 5FZFA 1LHUA 2I74A 3ATGA 1BMV1 1W8FA 4MZUA 4FAGA 4GMP3 2QQMA 4Q4W2 4JCKA 2VZUA 1SG3A 3GBGA 3ZMNA 4JTNA 3WVJA 1A78A 5GZEA 1OPOA 4FTBA 1QOTA 4UFMA 2RM23 1XRUA 2VVFA 4EWEA 2VCBA 4XQWA 2RM22 1F4HA 2QQUA 2TEPA 4AOCA 2CGNA 1W8UA 2BFUL 2BGOA 2WBKA 1G9FA 5IVFA 1FOD2 1YIPA 1Y9GA 3AP4A 4PCRA 1T6GC 4LBKA 3EJKA 3PLQA 3N9OA 4IV3B 1HXS3 3SLIA 2YGMA 4EWDA 3AM2A 2XJVA 1LCLA 4CA9A 1WBFA 5JR7B 5TSWA 3MPPG 4AI1A 5FZCA 1CGPA 1Y9MA 3RZLA 5C3QA 1UD1A 2UURA 2ZGOA 3U14A 4B1MA 1RUG3 4KI5M 3WY6A 2VZRA 5K4LA 5DQ0A 4I3GA 3W59A 5IW0A 1AL22 1X7NA 4BQ5A 4EZ4A 3TAYA 1UY0A 3ALQA 2ZXQA 5I8SA 2YPDA 5T5JA 4QKNA 4RHV2 4A6OA 4IEYA 4K21A 5T3NA 1XXNA 3MZHA 3WEZA 4CP9A 1XPWA 2VQAA 3AFKA 3H42B 3WF3A 2W39A 1AL21 1LGNA 1DCSA 1UZZA 2G4IA 3B01A 3M3CA 3VBRB 4ZY9A 1AJOA 1CAUA 2ARBA 4KL1A 5LRRA 4YM3A 4CP0A 3CHXA 4QKDA 3UGGA 5DZFA 2TNFA 3MHZA 2IXCA 4GALA 4NAMA 2Q30A 1W9WA 3ZMOA 3HNYM 2TBVA 1YNAA 2DBNA 4OULA 4FPJA 4NHMA 1OPMA 2SLIA 4QHBA 2A7AA 2ZZQA 2IFRA 1OXCA 4A4AA 5EHDA 1K5MC 3KVBA 2I45A 1DQ2A 2BU9A 3NSTA 4R9BA 3NNMA 2V5DA 1U12A 1ZRCA 2VOXA 3SEPA 2Y6GA 1HV1A 1OD5A 2ZZJA 3TN92 5K0UC 1LNSA 3C7EA 3WX5A 1KQRA 4D6RA 3I54A 5A70A 1AX0A 3WNKA 1FPN2 1VB4A 4XCBA 2QDNA 4MHUA 2X09A 2Z5WA 1B35B 5EJ3A 4ZZ5A 4UW3A 2OKXA 4D94A 1YQCA 4FSJA 1PGSA 3D0JA 4RYDA 4QPIC 5FTTC 4BQ2A 2I07B 3BTYA 2VBPA 2YUEA 5HPOA 3O1OA 1EPZA 4QPYA 3OBZA 2OUHA 3UJQA 2FDGA 4QQHA 3S5AA 1ND2A 1L7RA 2WA4A 3DXUA 4C90A 1DQ5A 1KD7A 2EAAA 1F35A 1XE7A 3E5XA 1XNTA 1YC61 3B9CA 3HD8B 1WCSA 4XCAA 2BWAA 5HI0A 5I91A 4YGEA 1VMFA 1JHNA 4NUBA 1FYUA 4S2GA 3T2TA 1RXGA 4XFFA 1R1ZA 3UESA 5FYSA 2WN2A 4KG0A 4ZHNA 3OBTA 4DIQA 2G9GA 3PUQA 1RUD1 2F6BA 1NE6A 3SHRA 1RHI3 2PAKA 5FMOS 5FWJA 5DUXA 1DBNA 2VTXA 4BIFA 4OUSA 5JPMB 2A75A 5A3MA 1O5LA 3ZFEC 1OSGA 1KS5A 3ZYJB 5DAXA 4LBOA 3RG0A 3GGLA 2QKDA 1VRH2 1TG7A 3UKTA 4CU6A 5FPUA 2A71A 1LR5A 2YBPA 3ILFA 2JG8B 5A6YA 5AC93 3KB5A 5C3OA 1IS6A 5J36A 3VD9A 1PMHX 1UQXA 3SH4A 3UKVA 5FYZA 2D6PA 4NIGA 4XJAA 4URAA 3WNNA 2A5ZA 3AYEA 4NRQA 4JQRA 3Q8CA 1NLRA 2LROA 4YZ4A 1XU2A 5FZKA 4DXTA 3AJZA 1JYCA 3ZDVA 1YO8A 5ACA2 2HYKA 4A7ZA 2D93A 1EY2A 5FUNA 2IZWA 3VN4A 1AYM2 2GC2A 5FZ7A 4AVBA 4KMQA 1W6PA 5FZAA 2Y6LA 3KQRA 4FPLA 3E5UA 3AKSA 1KJLA 3ZN6B 2JG9C 4FCAA 2WZ8A 1D4M2 1YFWA 1GZ9A 1VAKA 3KZ4C 4XF0A 4BWOA 3BB6A 4AVVA 5JXHA 2P3YA 3LEGA 1W0OA 3PDQA 2W1QA 3F95A 4LO5B 2C1FA 1RIRA 4OQ9A 4OVEA 1E5RA 1CQ9A 3ZOIA 4KWKA 4EN0A 2D43A 2ORZA 3TEWA 5FP3A 3WHTA 1CPNA 3H8XA 3V56A 2DUQA 2B46X 3K4AA 2WSUA 1DG6A 1IPSA 1W39A 4V2WA 4DMIA 2XH6A 3LEMA 4OYUA 1CAVB 2WWUA 3ZPOA 5J96B 3I4IA 3KGZA 2BPA2 5GZFA 3JB4C 1UOBA 4AEDC 2AENA 2K46A 2JG9B 2XL9A 3VHRA 2ZKNA 4LO4B 5FYUA 4PQ9A 1OOPA 1UU4A 2CTVA 3MUZ1 1LHWA 1REDA 4QXKA 4NIIA 3NKTA 3SKVA 4UT5A 2IUWA 2WIIB 4QB1A 4IE6A 4GB33 4H14A 2E33A 1S0FA 1RUG1 5IVVA 2OPWA 2Q0AA 1MQTA 1C8M3 1ZBE1 3WDTA 3LD8A 4GZ9A 4WVMB 2Y6KA 4Q4Y3 3ETQA 5I8YA 3P3NA 1HJFA 2XUMA 3A4UA 1QNWA 2QZ3A 4OUEA 1RUD2 3CJIC 5HV4A 1RUF3 3VKNA 1O4YA 2ZGTA 2ZGSA 4PIXA 4QXHA 1UXZA 2E32A 2BERA 2ZACA 3IWZA 2WDBA 4QHOA 4K1ZA 4XFIA 4DS0A 4JGZC 1AR93 1NX9A 5C33A 1ENQA 4H3WA 5GLVA 5CAZA 1GQHA 1GZCA 4CDWB 4META 1L7QA 1M4WA 2HWD1 1BXHA 1JU4A 3HIFA 2YROA 4RHV1 3MI8A 4NR1A 3HAGA 4YM1A 3U78A 3A22A 3U1XA 2P6CA 1RUJ3 2JB4A 1TMF1 4FPEA 4UFLA 3N7KA 4O9EA 4F83A 1X8MA 2JDZA 3ECQA 4GULA 4OHZA 3WDYA 5SV8A 3RYRA 4FP2A 1OI6A 3GHMA 5F5AA 4QX7A 4GIQA 1CZVA 4OHWA 3ROUA 2ZX4A 4A41A 1AX2A 2BOIA 3B9IA 3O7OA 1H9PA 3OUJA 4N43A 2BVBA 3ZXEA 1H4HA 1HW5A 4PLMA 4CDQC 3K2OA 4NWVA 1NY72 3BKZA 1H1AA 4P5HA 4DY5A 5KXEA 1C4RA 3FLTA 1AF9A 3GBFA 1AHSA 3T09A 2XQRA 2VVEA 1VBB1 3M3EA 2PHWA 2CWSA 3SISA 2X05A 4TN7A 1OF3A 1VMHA 2NPIA 2VR4A 4XEZA 1RUH3 1VBD1 3GYDA 3VBRC 1ALYA 1VBB2 3VBHB 2A70A 1QIQA 1W04A 1ZZBA 1UU5A 5KC6A 3KHCA 1W8NA 3GF6A 2DBIA 1ZREA 5T50A 1OH3A 1VBD2 2BBAA 3C7FA 4QB6A 1VBD3 2IC1A 1Y7BA 4QU2A 4JAAA 2YU1A 2C26A 3VKOA 3PNAA 2RS53 2HWE1 3K3OA 4GWIA 4X6RB 5CVRA 4ISQA 4DOUA 1PO13 4LITA 3KWVA 4F7ZA 4AEKA 4RFT0 1CX1A 3OYWB 4QQLA 1FAYA 3KHBA 1FMD2 3UGHA 3THDA 3WNXA 4F3JA 5IHRA 4I0AA 5KBFA 2JIJA 3MIGA 2VW1A 3K3NA 1W90A 5EIYB 1WD3A 2GNDA 4NO4A 3H3LA 4YG3A 2W1UA 4XDOA 1CX4A 4WM7C 5KXDA 2GMPA 2JG8A 3D82A 4XHBA 2QQPA 3LE0A 2FDJA 2PHFA 5EWSA 4R4XA 3WUCA 1S0EA 2B9UA 2ADEA 5LATA 4FPFA 2XONA 1OLMA 5C9AB 3KT4A 4PBOA 5EXOA 1CWPA 2B39A 2XJTA 5DDJ2 4X8PA 1WW6A 4NMIA 2I2SA 4QKFA 1A8DA 1GV9A 3FX3A 1K5MA 1WW5A 2NMNA 5SV5A 4R8HA 4E9KA 5DG1A 5H9RA 4CU7A 4Z07A 5CA6A 2GP5A 2Y6JA 4Z92B 1PVC3 3NQHA 5DDJ1 3TB0A 5F3IA 3T08A 2P37A 3RWNA 3LFMA 4CYDA 3WUDA 2HWC2 3DL3A 3J8F2 4Q8LA 1EAH3 3AMQA 3ZIWA 2RJLA 3CQOA 4P9XA 4CCMA 2HLEA 2K0GA 4Y20A 1BZWA 2LUWA 3WP6A 1DGRN 4Q1RA 3ZYGA 3IN9A 2YYOA 1DYOA 3HN3A 4IL7A 4J6GA 3C7OA 4E4ZA 1W0NA 4BLJA 2MHFA 1FV3A 2ET7A 3PL0A 1LESA 1EAH1 1SPPB 1MZ5A 3LDKA 3QH7A 4N7IA 2D3SA 2FBEA 1Z0HA 1S55A 2VGDA 3DPRC 2X8KA 4GB32 1OC1A 4HBNA 1PIV3 4FOQA 3ZFEB 5F39A 4JDNA 1V6NA 1CPMA 1HDKA 2EICA 5FZOA 4YGDA 5BNOA 5LBEA 4DEQA 5IWFA 4DUVA 3MIEA 1GU3A 4PHZA 4DPNA 4DXSA 2VPVA 4OI4A 3DN7A 2R32A 1URXA 2EF6A 2SBAA 1QDOA 3IMNA 1E5IA 4QM9A 4CDUA 1LB2A 3MICA 3NRUA 2HWB3 4C0BA 1JOPA 1J1LA 1W06A 2LTNA 4P08A 3ZR5A 5F5IA 1YFUA 3KSCA 5K9YA 2A6VA 1WD4A 4MH0E 3RI8A 3KMHA 1DZTA 1PM4A 2FMYA 1OURA 2VD7A 2GMEA 1NQDA 4YFWA 3J9SA 4PLNA 4HVRA 1I6XA 4AR2A 5A33A 3V0AA 3ZFFB 2HBTA 3FWEA 3PU3A 4W50A 4N43B 5FV3A 2X29A 5F3GA 5IYYA 1PHMA 2FCVA 1ND3A 4QPIB 3WP5A 5JI7A 1UX7A 1X50A 1BKZA 3WQ7A 3JBG3 1XBFA 1SMVA 3D3AA 4K6BA 4P9YA 2VZSA 2O8QA 4KG8A 1W8WA 2CU5A 3RFRA 1U5IA 1G9DA 3AKRA 1SFNA 3PIGA 2YFZA 3AXDA 2Z42A 1PZ7A 5LB6A 4AI3A 5FO7B 4QDSA 2DFBA 1JYIA 1N47A 1HX6A 2MEV3 2VO5A 2D5HA 1REFA 1DHKB 2JIGA 3H3UA 4HPKB 2VUCA 3D0SA 1F5JA 2ET1A 1FNZA 1PVC2 3ACHA 2PHRA 1IG3A 1W2NA 4YLZA 5FQ0A 2VOTA 4XYXA 1W6QB 2FZ1A 4COUA 2WNEA 2AREA 2PLV2 1LTEA 1RUE3 3F2ZA 5FZOB 3S7IA 3ZDSA 1RUE2 1RUNA 4IXLA 3IAQA 1JBCA 2PHLA 1O3SA 4A7KA 2H0VA 2VMDA 4MXWB 4AEDA 4L2NA 5DMYA 1X8EA 5C8WA 3GZAA 3UNPA 3ZN6A 4QQ2A 4QX2A 2HYXA 4B4RA 1QDCA 1XYNA 3M2MA 1RUE1 2W47A 1Y4WA 2BNMA 5JSRA 2OT7A 1WWYA 2GU9A 3U11A 4RS5B 1R081 3EBRA 5JUVA 1PO11 2DVAA 4LJHA 5T52A 4QB2A 4YGCA 2VL4A 4AQTA 1ULFA 2HWF3 2YU2A 4B7KA 4R9CA 4BK5A 4DRRA 1ZRDA 4XQDA 2QVSB 5KXCA 4IGOA 4NWWA 1GSLA 4XIKA 3ZX7A 2C6SA 4XFHA 3INAA 4XTMA 5FO8B 1DQ0A 2DWRA 4CRQA 1RMU1 4RQPA 2EAKA 1ND3B 2QQKA 1Z7S2 1DYPA 1MZEA 2JDYA 3OGVA 1BK0A 4MX3A 4QPIA 4LNVA 2Y0IA 2Q1MA 1YCIA 1VALA 3ES4A 3WF1A 1ENRA 4CDXA 1QQP1 2VQ0A 3TEXA 4AAPA 1J58A 1RHI2 5C8CC 3HMYA 3VKMA 2WNVB 5GZGA 1W6OA 1KEXA 2FDFA 4YPJA 4MGYE 3MO4A 3IPVB 2FCTA 4XF4A 1AX1A 4A42A 1OBNA 3MIDA 3RVHA 1LOEA 1J83A 3ACFA 4FPKA 5HCBA 2WS92 3POWA 3S57A 3OTFA 1PGW2 3FBMA 3T1LA 1NKGA 1PNGA 4AFDA 2DYCA 3VBFC 2Y8KA 1YFYA 3A0NA 4GWJA 2ZX1A 2CGPA 4BA6A 1JZ5A 4ZKTB 2O0OA 3P6BA 3ZFEA 1ZVFA 2MNGA 3HT2A 4J25A 1NXMA 4KH9A 5A7WB 4Z1VA 3RRDA 2K9ZA 3J7MA 5DAQA 5IVJA 1BCXA 1A6CA 1S2BA 3ZXAC 2D98A 4C0HA 4LKEA 3AB0A 3VD7A 3VBHA 2E9QA 3MGUA 4EN6B 1DLCA 1UMHA 1VBC3 4I0BA 2G9FA 4LHSA 4AFMA 4NRPA 2ZEYA 1RUH2 1OD3A 1AR63 1ULOA 5FMBA 3ZVXA 3LDBA 3O1UA 5FZGA 3IDBB 5LA0A 1QGLA 2JDMA 2R071 4AFBA 1TVGA 2XJQA 3CU7A 4N53B 1WCDJ 2VW2A 1Y43B 4M00A 5BNPA 3BU0A 1FOD1 3AK0A 3W58A 1WMDA 5F8PA 1RUC1 1JHJA 2QQWA 2WKKA 3KVAA 4HKLA 4MUVA 1V6OA 1GICA 4KU8A 1SFPA 3WZ1A 2XJUA 5FZ0A 2Y26A 2WO7A 3VL9A 3AP5A 1W6OB 4O65A 3SCGA 1J1TA 3NWKA 4HKOA 1NLQA 4Q1PA 3MIFA 5K8SA 1POV1 3LGRA 1V0AA 3BOPA 1GZTA 1HB2A 5C3RA 3VB9A 3CZUA 2WYSA 1I3HA 1NCQB 3MLLA 2W92A 1HRI2 2XDVA 4FVVA 4LE3A 1TEIA 3D6EA 4YVWA 3JQXA 3SKJE 5FYCA 4AVAA 2VOWA 3CJIB 2VMIA 3RGBA 1CZSA 1I9RA 2RMU1 1UXXX 2RVAA 3BU7A 4UBHA 4N53C 1UU6A 2WNOA 1LECA 2ARCA 2A1XA 4CPBA 4QPWA 3VUOA 1Q8OA 3I3EA 2CAUA 4Q8KA 3DYOA 4K1YA 4S2FA 2JDAA 1GQGA 3AZVA 4Y1YA 2YBKA 1VBA2 2E26A 2XXZA 1FPN3 5DUVA 1VBA3 1CJPA 3RZMA 4E4SA 1J3RA 3VKLA 1KFUL 4XQ4A 1PO23 4EQVA 1J84A 1RUG2 2Z2SB 1AR72 3HEIA 3I97A 4XE9A 5DG2A 5LK7B 3V0AB 1JZ8A 1ZZ7A 2VZPA 4WZFA 3H1WA 4QWNA 1G8WA 1FPN1 2VNGA 1STMA 1PGW1 5B4XA 2JWPA 3AMNA 3VHNA 2IVJA 4E8CA 1H8TA 2XKOA 5FPZA 4D6SA 5K0UB 1ZBA3 1RUH1 1OLRA 1QF3A 4KWLA 1WW4A 1XE8A 3U4SA 4A3ZA 5FAXA 2AEZA 2DCZA 4NVPA 4Y22A 3OGJA 4WM8C 1GYKA 2P3JA 1XSQA 1RUD3 3KV6A 1US2A 4UYBA 4QGNA 1X36A 2J1RA 2K2SA 1RB8G 2DFCA 3URFA 3I7DA 3K51A 2VNRA 3LCPA 1GWLA 2RS32 4N43C 4X6QB 4GWMA 5FYYA 1LOCA 4MGTA 1W99A 1JW6A 4Q4V2 3N35A 4OI1A 4COYA 3RWKX 4Y5Z0 5LCWL 2PYTA 2WNVC 4IE7A 3VBOB 3SC7X 3O1TA 2JICA 2XJRA 4MXVA 4RQPB 4Y4RA 4LLOA 3RMXA 1ODNA 4ZS2A 3ZKUA 2CSGA 4KWUA 1W9YA 1ZRFA 1NCQC 2VG9A 4S2HA 1AL23 1BJQA 2VMCA 3FFQA 5FIXA 3I2FA 1GR3A 3ZSJA 3H3ZA 3KV5A 1TNFA 1GFF2 5FZBA 2ZHNA 3OG2A 2BQPA 5BNNA 2WZR1 3ZPYA 2PTMA 3WQBA 3T30A 4AWDA 2J1VA 1PX3A 1CR7A 2RE9A 1UKRA 4GWNA 2XJPA 1D4M1 1UO9A 1R1A2 4IQPA 4G9SB 3POSA 5FY8A 4ZU7A 2P17A 1PGL1 4OHXA 4AVCA 5JLVA 3I3MA 4OMCA 2GN3A 4HETA 3LF7A 3VBUB 4AHZA 1QJX3 4RL7A 2P4EA 3UL2A 2FD8A 2TUNA 4CE8A 1YQ5A 2EXKA 4RR3B 4YG6A 1VBE1 3ZYHA 1VPHA 4FTSA 3WP3A 2HEYF 2RM21 3NKGA 4U2AA 4QX0A 1E5SA 2VZVA 2VECA 2W1WA 1FMD1 1H2LA 1MZFA 3P5BA 4IEVA 4UFKA 2R30A 5JOYA 4EWAA 5FLHA 5C8CA 5IVCA 1UZVA 2WO1A 1DLLA 1QJU2 3W5MA 4XMAA 4Z8BA 1QJU3 4ATFA 5F7UA 1BMV2 1AL0G 1K42A 1CAWB 1NAEA 4HXCA 5FLJA 2PLV1 4P9JA 1U5YA 4AXOA 4BQ4A 1FMD3 2Z79A 3LA2A 4WM8A 5F3EA 4CCKA 2BFUS 4M0HA 3QCWA 3POGA 2QQJA 4COZA 2QDRA 4IUGA 3O1PA 1CAUB 4RA0A 4LKFA 2WNUA 4Q0QA 3AKTA 2YB7A 4RFRB 5A3UA 2RMU2 4FQ4A 1W03A 2ZGMA 3DECA 3FHIB 4Y24A 2WFPA 3VDAA 4JHTA 1IQDC 5DXDA 2IXIA 1JZ4A 3MW4A 3BVCA 4YWAA 5CADA 1Q43A 4HMZA 5FUIA 2VZ3A 1EPWA 2XWJB 3CF6E 4P02B 4UAPA 1SACA 5BUVA 4QAWA 5HXMA 4AG4A 2IXKA 2BTVC 2O8OA 2GSYA 4ES9A 3OYWA 1D4VB 3HQUA 2OYZA 4IEXA 1R093 2RR13 3C8XA 3FE5A 1BEV2 1OKOA 4Q0SA 5A3WA 1CN1A 1WGPA 5T54A 4B4QA 2ENRA 1W2UA 1MEC3 4ASLA 3PUAA 3ZN4A 2F4LA 3WXPA 3VLBB 5FYVA 2PXJA 3IBMA 3PTYA 3SQOA 1JZ2A 1W8HA 5KC5A 1VJ2A 2DVDA 3N9MA 3O14A 4HSJA 5FP4A 3R4UA 5J98B 3RZKA 2HJIA 2G19A 1A3KA 5A1FA 1VIWB 3LEIA 3N7JA 1DGWA 1H2KA 3U10A 1ST8A 4I09A 4BMEA 1P8JA 3LPFA 3BUCA 2ADDA 3RZHA 4CDXB 5AFEA 4LUMA 2VOKA 2VU9A 1EUTA 2QE3A 4JDMA 4DB5A 5FZIA 5KHIA 2R062 1QHDA 5T55A 3OD4A 4LIVA 3DYPA 5KHGA 3WG4A 2PQQA 3GALA 2NN8A 3M7AA 4IW3A 4AGGA 2EALA 2YC4A 3WCRA 5JAXA 1QXJA 2J1SA 2R1DA 2MEV2 1O8PA 1CESA 4CCCA 3AP7A 2ZHMA 3MIHA 1H6YA 1VBE3 2ARXA 2ZX2A 3H50A 4QDQA 4CCEA 1O3QA 1US3A 2XBO3 2VZTA 2Y6FA 3OGSA 4A44A 2F4PA 2ZOEB 3NMBA 3BTXA 4RR3A 1RUF2 3KF5A 5JZGB 5IFPA 3N7MA 2MEV1 1QJX1 2R49A 5H9SA 4CDQB 4FBFA 3O0XA 5C3SA 3OGGA 5A7WA 1M06G 2D6NA 1UX6A 2YC0A 4HKWA 1IPJA 5EPAA 4FPHA 5F9TA 2VQTA 1RVF3 2Q4SA 1GNZA 2DUPA 4FFHA 3JUUA 1LU1A 2B4KA 5E8AA 2BRTA 4A3XA 1A8MA 4MO3M 1OA2A 1SLCA 1XYOA 2WT0A 3SCFA 3SCHA 1WZXA 1W2AX 4JKMA 2WA3A 5H9QA 3LQCA 1JYWA 2BW8A 4D3WA 4Q4X3 5J09A 4CXYA 5CEHA 1GZWA 4F8AA 2W0XA 1ND2C 1WMFA 2O14A 3DKWA 3IPVA 4UI9L 2C0ZA 3K75B 1YQ2A 2CNAA 3IDCB 3ME2A 4Q26A 3O1MA 1Y3TA 2ID4A 4GJYA 5L7OB 2XVLA 4A7YA 4IV1C 4Q4V1 4CXXA 3H9AA 2XPJA 1HRI3 2RS31 3H7YA 5K0UA 2JDUA 1SFYA 2X53S 5C70A 1D2SA 1UCXA 4TLGA 2QBXA 2VJXA 1OLME 4Y1UA 2AYHA 2Q8OA 2DTYA 2L9LA 4IV3C 4LE4A 2PAEA 4CCLA 5C7GA 3AX4A 5A1LA 5IK5A 1B35C 1H8VA 4YW3A 1OF4A 1W6PB 3M1HA 2XHNA 1V6MA 4Q4X1 4NPMA 3FJSA 3PURA 4R4ZA 1CAXB 2YFUA 5BXXA 5JZGA 1AYN2 1X9TA 1JU3A 2JDHA 3PUSA 5A33B 2DVBA 4YYOA 4CEWB 1GP6A 5FO9B 4HOOA 4LHKA 5I0DA 2CGOA 4CCNA 1MVQA 4ES8A 1R1A1 3CKHA 4IGPA 5FPLA 4M0NA 3JD72 1IZ3A 2OUJA 5G04L 5F3CA 3D5OA 4QMAA 4YVSA 3ABZA 2DCKA 3O0WA 4FPGA 2WFF3 3FHAA 4CZSA 3N9PA 1HB3A 4K40A 4L8QA 3O1SA 1GNHA 4WV8A 2V09A 2WS91 1KXGA 1YI9A 3C2UA 3NNGA 5L19A 1YEWA 3EO6A 1UYPA 3S6PA 2ERFA 1UYZA 5GZDA 1W2TA 3M3IA 1XNKA 3WG3A 3SH5A 4HK8A 5L36A 1SHWB 2VH9A 2JG9A 1VBE2 4IEZA 2W08A 3FN9A 4V2VA 4AHYA 1W8OA 3E5QA 3A7QA 3GZTB 4OI2A 5DPNA 5CFDB 2XVKA 1UZWA 3ZIXA 2J1TA 5FZ4A 3T4VA 4DXZA 5I93A 1PM7A 3CJIA 4QXCA 5DZEA 1NA1B 2ZGRA 2KM2A 5CG8A 1O3TA 1NQJA 3H8RA 3AFGA 4TXWA 3UETA 2CYFA 2R041 4Q0VA 4D8MA 2OW4A 4L92A 3N4MA 2ZABA 2XB6C 1W9FA 1ZRIA 3GJAA 1QJZA 3GHNA 4FFFA 2R061 3EB7A 3T2PA 2V4VA 2QJVA 2HWD2 1W8ZA 2C9KA 2ZX3A 3NAPA 3GCXA 4UF0B 4XZUG 5C9AA 5LA9A 1OOPC 2BV4A 4AAXA 5FMOL 1UKGA 1TME3 4DNYA 1RITA 1KJRA 1AZDA 1TME1 4LXLA 5EJZB 1T2XA 1UPSA 1W6QA 3POFA 2JE7A 4Y5TA 5JMCA 1MACA 1FXZA 3Q8EA 1LHNA 4YGBA 5F6LB 5LA1A 1H1MA 2QQIA 1O5UA 2R072 3OEAA 1X33A 5C4WB 5JSPA 2QUOA 2FMDA 1OFSA 2BJSA 2WNUC 4CDUB 2MPFA 4XOGA 2R16A 3Q8FA 4NHLA 4Y3OA 2ZMKA 4HVQA 5FJHA 2VW0A 4JVAA 5FBJA 5M0TA 3OF1A 3WT3A 5IJRA 1RUI3 3POYA 1RUC2 2GDFA 2JXAA 3H1MA 4LHNA 3PHMA 2Y0OA 2ETEA 3VL8A 5CFDA 4LOTA 1V9U2 3S30A 3Q9OA 3S7EA 1V9U3 2P6HA 4AI0A 4XJZA 2VUDA 5JSOA 4BB3A 4CEYB 4Y4YA 4B7EA 5KXBA 2OQ7A 2PLV3 3B5LB 1K5JA 1QWRA 3NJXA 3WNLA 1JMUB 2HH9A 1PK6B 1XU1A 2DURA 1C28A 1G7YA 4OHYA 4Y20B 3MBWA 1XJAA 3ES1A 1DYKA 1COV2 2VOVA 3RJ2X 4ARYA 4BISA 4BQYA 4J1WA 1I5ZA 4DY3A 3NL1A 3JQWA 3PUHA 5CFCB 1AR83 1ULGA 2BYVE 2X5IB 3ZXKA 1QJY3 1FI2A 4LA3A 1VAVA 4AVTA 2Q8EA 1K3IA 3ASIA 2BOJA 5D8AB 3M4FA 3N36A 2YDEA 2NLRA 1AR71 5FXVA 5A3TA 2IWGB 1F15A 2WFF1 2W5FA 2GAUA 1AR62 1GKBA 3L2HA 3ZN5A 4AF9A 3DUIA 1LULA 4P5YA 4L99A 1QH7A 1AYN1 2JDPA 4FO9A 3FZ3A 2XJSA 4RS5C 1WLDA 3AL6A 3VBRA 1GMMA 4AW7A 1TZOA 1AXZA 2CL2A 1GWKA 3OPWA 1JUIA 4XZPA 2VTFA 4OZXA 3VDCA 4LO7A 4M3CB 5HCAA 2VM9A 2E7QA 4W65A 4NHYA 3IZOA 2QQOA 3S5QA 2WWSA 2B7YA 2HEWF 1LGBA 1X9PA 2GH2A 3LKJA 5I0TA 4CDQA 3WG2A 1BLZA 4LBMA 1S1AA 3B02A 5A3NA 2JENA 5CNAA 3I3DA 5GM0A 1UOFA 2EVXA 2Y64A 2DCYA 3HVDA 4XJ8A 3D4KA 1H30A 1DP0A 1Q3EA 4BQXA 2YG0A 1ULDA 3P1IA 2O1QA 3ZYRA 4YW2A 1WCQA 2D6OX 5GLUA 4WM7A 1C3HA 5JOWA 1OKQA 1COV3 1UPIA 5GZCA 5JMOA 4UFJA 3FFZA 4E4HA 4PQQA 1AVBA 4EN7B 1GOFA 3VDBA 2ZCWA 4ASMB 2ZEWA 1PIV2 3I59B 2XLAA 2XOMA 3VZLA 3EMRA 4XHXA 1DGRA 3CZJA 4AEMA 3NNJA 3RYKA 2RS51 4H55A 2FZ2A 4DZGA 4CUAA 3I2JA 2D97A 3DF0A 1NY71 2WO3A 2XBO2 3VBFB 1AYN3 5IAXA 1MR5A 5E88A 4JV4A 5E1RA 3TNPB 3HOBA 1RMU3 3HR9A 4LLFA 4CU8A 3BIEA 4FI9A 1IQAA 1RMU2 3THCA 4CDWC 5HV0A 4V1PA 1WLTA 3HQXA 2JG8C 1PK6C 2LALA 2ZGLA 1C57A 1NE4A 4NN0A 4QX8A 1ZZ6A 5L7OC 1F8VA 1N1TA 2VMFA 1HN0A 5K7PA 1R082 4FTEA 4Q29A 5J37A 1N1YA 1O7FA 3HNBM 4GXLA 3N7LA 4HT1T 2JD4A 5B4NA 4MYEA 5ACA3 2VUJA 4OZOA 2AUYA 2Q1FA 4M4PA 3T4HB 1EUUA 2RMU3 3WDXA 4CPBD 4KWJA 4I0WB 2PHUA 4LULA 4XAEA 1I5PA 5BNOC 1C1FA 3MV01 1RHI1 5C4WC 1UOGA 3ZYFA 1MS4A 1S0DA 1LKNA 2HKXA 1OA4A 5FZEA 3KQ4B 3DYMA 3T1MA 4XW3A 1OLQA 2YBSA 4FP3A 1Q8PA 2AR6A 2VAUA 2ZEXA 2GZWA 3ACGA 4GH4A 5EFUA 3SMHA 3FHQA 5BNPB 4XBNA 3LIHA 4LKSA 4LTAA 4RD7A 3P3PA 4XDQA 1VRH3 1ND2B 1LJ7A 1PIV1 3K77A 4P9IA 2WRAA 4ZONA 4AFAA 2WC2A 1VP6A 3E1F1 1OA3A 5FZ8A 3RZGA 3DPRA 4E27A 3TEYA 4XIOA 3MUY1 4BM8A 2RS13 4P9WA 2PA7A 2H6BA 2GC1A 3AKQA 1MS5A 3OEBA 3VBUA 2V73A 1K5MB 1C8M1 4AFCA 4ATEA 2JDKA 1QXPA 2HWC1 3J8F1 1QNYA 4GB31 4YG0A 2R063 2W9XA 2UWBA 5KHJA 3ON7A 1QJY2 5E6HA 2D6MA 4BQWA 2OS2A 2FDHA 2HWF2 4XJ9A 3ZXFA 3L9JT 4QDRA 4WVWA 2W94A 3W21A 4D7TA 1GOHA 2OPKA 5CKNA 4AGRA 3UJOA 2A3YA 4AK3A 4ONUA 3LDRA 3K4DA 2W87A 4AHXA 4E4DX 4Y1VA 3PMSA 4UFHA 1XYPA 4FQZA 4Y1ZA 1JYVA 3AKPA 3VGIA 5LRSA 1EYBA 4NIHA 2WT1A 4P9GA 1K45A 2EXJA 1HRI1 1OQEA 3G6JB 4M4RA 1JODA 1R092 5AVAA 3WQ0A 4EJRA 4NIDA 1RUI1 1ULCA 4FT8A 3BYWA 3QOPA 3KS7A 3MPBA 2KA3A 4QM8A 4XILA 4ASKA 1IKPA 1RJ7A 1SCSA 2KXLA 2PAMA 3E6BA 3MW2A 5C5UA 5J3UA 3HBZA 3G7DA 1ENXA 5ABJC 2W2IA 1FT9A 1JYTA 1H1IA 4EROA 4RHV3 2A6WA 4XUNA 5FY9A 2GC0A 4Q4W1 5HXVA 5IVYA 4CCDA 4WVVA 2WINB 4L9BA 4H7MA 1W9SA 3QACA 4QD2A 2VBBA 2RS11 2PELA 1BQPA 2VZOA 2FHRA 1QQP3 2V4AA 5FREA 1HQWA 3WD5A 2CY6A 2VXJA 1G6NA 2E53A 1PX4A 3BALA 4NAOA 3U37A 5JOXA 1SCRA 4LT5A 1PVC1 2VBDA 1QJX2 5DDJ3 1PMJX 5FRAA 3V0BA 4IV1B 5LK5A 4WVMA 1IS3A 4QX5A 4XABA 4BHPA 5C3PA 1S0CA 2IVIB 3MF9A 3TOJA 1OH4A 2J7MA 2V5YA 2HWF1 3THTA 4BZ4A 4XACA 3PJQA 1OOPB 5JXJA 3H8OA 2JE8A 2NZ9A 1NOVA 2XWBB 1AR81 3JCIA 4L11A 4XTPA 4CEWC 2RS33 5IATA 3BPSA 1OUXA 1U0AA 1I1EA 3ZR6A 3A23A 3MLJA 5FFOC 1D0GA 1GOGA 3VBFA 3ZO0B 3OGRA 5ACA1 2RG4A 1ULPA 5F5QA 4GA9A
chains in the Genus database with same CATH topology
3AP6A 3MYXA 3VBSA 2GC3A 4CDUC 5I8TA 1CAXA 4PDWA 2DU0A 2XHKA 1NZCA 4AHWA 1U5ZA 1ZBA1 4KGQA 3VDDC 5IK8A 4BYYA 5JZGC 3VV1A 2E51A 1SBDA 1TMF3 4HLTA 1BK1A 1OQDA 2D6KA 5GLZA 3UV9A 3JBG2 1D0HA 1B09A 5IK7A 2JECA 2R0HA 4EN8B 2YMZA 1C8M2 4WM7B 4I02A 1RC6A 4P14A 3WINE 2B5HA 3U0ZA 1H9WA 4JDOA 1AR91 3M8LA 1XNBA 3LB9A 1YHFA 4XJWA 2VY0A 3W9AA 2D40A 1BEV3 2P3KA 4P9LA 1WCKA 2QNKA 2R1BA 1OFNA 3RSJA 3WR0A 1CAVA 3L2YA 5T5LA 1LHVA 4JGYB 4R52A 1HRV1 3DV8A 1GBGA 1GLHA 1YLLA 5AC92 4SLIA 3USUA 1UW8A 3WW2A 1J3QA 5GLWA 5IUQA 1PK6A 3ZFGC 2D3PA 2R043 1C8NA 4LO6B 4W6WA 4YRDA 2GNBA 1APNA 3KT1A 2RHPA 1POV0 4CEYA 1QJU1 3V0BB 4JC1A 5E89A 4OFGA 3AYAA 3ILRA 1SEFA 4GKYA 3A0KA 4Q0UA 1PVXA 4XBLA 5BV6A 1O4ZA 5LEKA 1MEC1 3LSDA 2UWAA 1ZBA2 4CEWA 2ZHLA 4WBBA 1RUI2 3LZZA 4LR4A 2D7FA 3FBYA 3NVCA 1RVF1 2GN7A 2X5IA 4K8FA 4PJYA 1OHFA 3TNQA 2ZGNA 1FOD3 4UW5A 5C4WA 1YI7A 1WLWA 3J26N 3VBSC 5KHHA 1DQ4A 4Q0PA 2RJKA 1DQ1A 4GKXA 4JGYC 1RVF2 4QPGB 1DZRA 1REEA 2XBO1 5JCTA 3WDUA 4RQPC 1SBEA 3H0OA 3FC0A 1QU0A 2DTWA 5JIAA 1DDLA 1W6MA 3NW4A 2QCSB 3QH6A 5CFDC 4WZCA 1EP0A 3E97A 1NCQA 2ATFA 2NMOA 2UU8A 3AYCA 5AC91 2QFEA 4N53A 4YM0A 3RZZA 1CIWA 1W6MB 3WW1A 2A73B 4TZDA 1BVP1 3M70A 1HQLA 1S0BA 3THPA 4E2QA 2WNUB 4FXKB 3WV6A 1J3PA 1ZA4A 4YARA 2VNOA 1V70A 3AP9A 1MEC2 1NLSA 1C5HA 3WDWA 4TLFA 2RR11 2HEVF 4H7LA 2ZJCA 3B00A 3B3QE 4J1XA 3VZOA 4CEYC 3DGTA 4KGGA 4RS5A 2B45X 1UMZA 4HPKA 3B69A 2C9AA 1VAMA 3ZFGB 1TME2 4XPVA 3WOGA 2WFF2 2HWE2 3JB8A 1LENA 3CJXA 3ZXLA 1VBA1 3ZYIB 2DF7A 1U5XA 5AVPA 4ZU5A 1ASJ2 2X5IC 2YXSA 3OBRA 4JRLA 1W6NB 1NCRC 3GNEA 3RS6A 3AMMA 4PIYA 2CWMA 4X8NA 2BEOA 4RSUA 2ZHKA 2UY9A 4MGIE 2IFWA 2JEMA 1TNRA 3K48A 1FATA 1WW7A 5F6KA 3APBA 5FLIA 4K20A 2RS52 5EZWA 1UF2C 5JOZA 2WZR2 3ILNA 3LWCA 5GLTA 2JKBA 3TRSB 4AGVA 5KWRA 1HKDA 2NP0A 1IOAA 4SBVA 4XETA 1ZRRA 4AVSA 3SNMA 4MXWA 4AEDB 5LEJA 1TQ5A 1VB2A 3NV2A 1H0BA 5CU1A 4UW4A 1G9CA 3OJBA 4JGZA 4D7YA 5T5PA 1R1A3 5FQ0B 2IXJA 3MDPA 3USUB 1AYM3 3RJRA 3FMGA 2NM1A 4Q4W3 3KCYA 1GZWB 1RUF1 4S2DA 3WP4A 4MSVA 4GQ7A 1HXS1 2ZPXA 1AXKA 1E57A 4Q4Y1 4YZ1A 1YFXA 3V0BA 1LHOA 3M3OA 4YW4A 3VZNA 2OA2A 1RGSA 1VBC1 1H8TC 1W6NA 1HXS2 1XNCA 4Q4V3 3VHPA 4N9IA 3X29B 1YJLA 3NV4A 3ZSMA 2P34A 1IHMA 4IESA 1N3QA 2ZA9A 3NAPB 4TSVA 2OVUA 4YVSB 4BMBA 3MFCA 2DUOA 1Q8VA 1X82A 3KM5A 5DUUA 2XL7A 4FPOB 4CTEA 4XFGA 1KFXL 2DCTA 1PZ9A 3QBQA 1YIFA 3RQ0A 3VBUC 5EYYA 1W0PA 2UY8A 4YM2A 2YV8A 4KNCA 4Y1XA 2R073 5GALA 4IV1A 4IEUA 5GKAC 1FX5A 2PN5A 1AR61 2E7TA 1YXWA 4HN1A 1D4M3 4AQ2A 1VRH1 2WLQA 2ZBJA 1KRIA 2GMMA 1LOAA 5BNQA 2XKPA 1JTZX 2WZR3 2ZX0A 3PVOA 1O4TA 3FLPA 4BQ1A 5AFBA 1BYHA 4KU7A 3NO8A 3FLRA 1Q8SA 4R9DA 1AXYA 3TN93 1EAH2 2VULA 1LGCA 3C3VA 1IGOA 4YSFA 1LOBA 2GNMA 2XG3A 4JRAA 2UYAA 4RR3C 5HCFA 1N3PA 4N9HA 4QPGC 4HN0A 2BGCA 3RDIA 2D6LX 3ENRA 5E16A 3WW4A 5I0SA 1CVNA 1JOJA 1MQTC 5B2GB 3U4XA 1EV12 4I2OA 5A3LA 4U36A 1Z78A 1VBC2 3I8TA 4KBBA 3V64A 1R091 3VZJA 5J7MA 4FOYA 2WSVA 1RUC3 4OUMA 4YW5A 4FPCA 3OY8A 4C1XA 4D69A 1EV11 2Z69A 4L97A 4JGYA 3SXWA 2EIGA 3WQ1A 4BOWA 2H6CA 2XGXA 2NQYA 4E2SA 3VBOC 3RI9A 3EXUA 4FOWA 1DU3D 3NV1A 4XXPA 1FV2A 2YPJA 2P3IA 1N3OA 4IV3A 4BCUA 1B35A 1F2NA 2AH2A 1GANA 1UZYA 4Q4Y2 4HVOA 4QGLA 3ST7A 3AJYA 5IT6A 4XFAA 3I59A 1MZ6A 4HFSA 2R0FA 3DPRB 1DQ6A 2ES3A 3OD0A 4PDWC 3O5SA 1O91A 2BWCA 1Z7S3 2D44A 1SQ4A 3BODA 4EN9B 1D2QA 2B8MA 2D3RA 5JVVA 4IEWA 2YZ4A 4Y22B 4E2GA 3TBDA 5EV7A 3IDEA 1AJKA 2XLFA 3PVEA 4FPYA 2VXRA 4PLOA 1QOOA 4IETA 3VZMA 1JN2P 1QMJA 4BPZA 4C1WA 2EXIA 2QZ2A 4K9SA 4LHLA 1S0GA 4DQAA 4WM8B 5JDBA 4FAHA 4QPGA 1WLCA 3CEWA 3JD73 1WBLA 3H7JA 4IEPA 2GNTA 4JTOA 3JBG1 3NAPC 5I0UA 5JI7A 3R6SA 1AR73 2WQZC 1YUDA 1YYNA 2PHXA 4QQOA 5DZGA 4LBLA 3IKWA 4QQPA 1NCRA 1MS0A 4AI8A 1LOFC 1AUYA 3KGLA 1BBT2 3R4DB 1WA4A 1WMEA 1XQNA 5FOJB 5C6CA 1SLTA 4RGAA 3PVNA 4MGKE 2Q1ZB 4UW6A 1QOSA 1HQNA 1IS5A 5I0RA 1Z7S1 4M3CA 3MIBA 3AZZA 2ZS6B 5D8AC 2WZPP 3EHKA 3MEPA 4W6YA 2GALA 5A32A 4QGMA 4PDWB 4B3NA 2BUKA 1AR82 2VVDA 2HWC3 3J8F3 3VKFC 1HRV3 2ZMNA 3IM0A 4YVWB 1VLNA 2WL1A 1V6IA 3VDDB 1PO21 2DVGA 3MF6A 4HSLA 5JI9A 1ZM1A 3TWIA 4CDXC 1MS8A 4ISRA 1DF0A 4MGZE 5CB7A 2UWCA 2HWE3 4YFZA 4I3PA 3V65A 1UAIA 4URTA 4XBQA 4XMIA 5CIRA 4D7SA 3USSA 3AMHA 1SLAA 2A6XA 1ZZ8A 1MQTB 4YVSC 5D1IA 1V00A 3PMEA 3RNSA 1H2NA 1MS9A 1Q8QA 2GH8A 3BIWE 5IK4A 2WT2A 1RTVA 3LOIA 1DZQA 1PZ8A 1RJ8A 1VBB3 1MVEA 4LEJA 2HWB1 1YJKA 4AQ6A 4B8EA 5JWPA 3NJZA 4GH4B 1COV1 4IEQA 4BE3A 1POV3 4AI2A 3OY8B 1YWKA 1ZZCA 4TWTA 4JGZB 3LOBA 4B29A 4M3CF 3TN91 4YNIA 1ASJ3 2OIIA 1UIKA 1HV0A 1LEDA 4BIOA 3AMPA 1LEMA 3MW3A 1QQP2 4HANA 1WUVA 4OI0A 4LBJA 4NOTA 2E7AA 1CAWA 5H9PA 5C9AC 2VMHA 4LBQD 4INDA 4XFCA 4AE2A 2JJ6A 3AZXA 2NYYA 4HZFA 5CFCA 1AR92 2JE9A 2OZJA 5DUWA 2BNOA 3GZUC 5BNNB 5T5OA 3RPQA 2A3XA 3TYJA 4GH4C 1ND3C 2VMGA 2B42B 4UBGA 4DFSA 4XF3A 3ZFFC 4C91A 1RINA 3RMYA 4BLIA 1ASJ1 4KQ7A 1RUJ2 3N3HA 3NV3A 2RS12 2ZGUA 1ZYBA 4EV0A 3VBOA 3D8CA 4DRVA 4PIZA 1UIJA 2EA7A 2YY1A 4HK9A 4MV2A 1HLCA 1RUJ1 1MS1A 4CDWA 3I2DA 4PBPA 3B93A 1XNDA 2ZGKA 3U07A 1ULEA 5L7OA 1LOGA 2R6QA 2ZAHA 1DFQA 3B7MA 1NYWA 3LSEA 3WHUA 1LU2A 4CP1A 2AZ5A 1NG0A 4LBQA 4YW1A 5A32B 1G9BA 5FCCA 4M01A 4COVA 2DV9A 3B94A 4PF5A 3PJYA 4MVTA 2PHTA 2ILMA 3LAGA 5BNOB 3OPZA 1PO22 1QKQA 3H1YA 2A3WA 4FOVA 4R9AA 4M3CE 2ZKLA 4Q2FA 1IS4A 2IXLA 3AYDA 1QJY1 4OLLA 4QT6A 1R083 2AGSA 4XJUA 5CBLA 1J59A 4YZ3A 5KHKA 1DIWA 1KITA 3PVBB 4COWA 4RGGA 3EQEA 3IT8A 4F8AA 3HWJA 3IIAA 3HN1A 2E63A 4GMP1 2W68A 4OHVA 2H0BA 1HRV2 1KS4A 5L73A 4ITCA 3VBSB 4HL0A 1BBT3 1OQ1A 2D5FA 3CNAA 3ZYPA 5BNPC 1CJDA 5CG9A 2FQPA 3LA3A 1SLBA 3KT7A 4LA2A 3VHOA 2WNVA 3H8UA 3KCXA 3S0MA 4ORFA 1NXD1 1Y9QA 1NCRB 2ZGQA 5GJ6A 3JZVA 1V9U1 3QLQA 3R4SA 2UYBA 1G86A 1LOFA 1N1VA 2YHJA 3WW3A 1JH5A 2WJSA 4G3YC 2YGLA 2E6VA 2N7GA 5BNNC 5EYXA 2BNNA 2Q5TA 3AXEA 4LBQB 2PHDA 4LBNA 4NHKA 3MFAA 2IXHA 3ZSEA 1H8TB 1Q5OA 1ZNPA 4Y26A 2ZGPA 3ZSKA 3ZXGA 3VZKA 3M3QA 1Q56A 2DU1A 4N7UA 4N90A 1G9AA 1N1SA 1H4GA 2CAVA 1C1LA 1ZBE3 2A6YA 3E6CC 4XF1A 3BTAA 1O3RA 3VBHC 1F5FA 1TMF2 2WQ4A 1RUOA 4YZ2A 4ZU4A 1EV13 1RL3A 1V6KA 5BYNA 1YRZA 1BVVA 2CV6A 3KD4A 1LODA 3WDVA 3UK9A 4XXAA 5ABJA 1UN1A 1V6JA 4YVWC 2A6ZA 3WCSA 2DCJA 4DINB 2HWB2 3O0VA 5D8AA 5C8CB 3E6DA 1SLLA 4Z82A 3WLUA 1TE1B 4LO8A 1PO12 4NPRA 2WS93 1LRHA 2EXHA 3ZXDA 5HBAA 2W52A 4W6XA 1ONAA 2HWD3 3SITA 1C5IA 1KDKA 3JU9A 1IKQA 3JD71 3QD6A 1H2MA 2BVVA 1S0IA 2PFWA 2ZMLA 5J48A 3GBWA 1NA1C 4A2UA 4WVZA 4GMP0 1JXNA 1L3JA 4Z2WA 2XLGA 3LA7A 3KLSA 2OZ6A 3RYPA 2RR12 2Y38A 4ZXKA 1SDWA 2C5DA 5F1RA 3AZWA 4MLOA 5BPXA 3VDDA 5FBZA 3CO2A 1PMIA 3ZXJA 4CP2A 1HIXA 1QY4A 3KCCA 4AYUA 3CLPA 4AEJA 4B4PA 4Q27A 3UKNA 4YZ5A 2DVFA 2JX9A 3J4UH 5FDBA 3BCWA 1JUHA 3ZFGA 4LUKA 2ZTNA 4XF9A 1CD3G 1FNYA 1S0JA 1ZBE2 3ZFFA 3AZYA 4IEOA 2XVGA 4I30A 1F9KA 3MLKA 4IERA 1VR3A 4BH9A 2ZAAA 4XFBA 1DGLA 3BPZA 2P2KA 3WG1A 3FUQA 1DGWX 1F31A 1CONA 1QH6A 4K3UA 1PNFA 3ACLA 4O9GA 1BEV1 3BOWA 5ABJB 1S2KA 3R0RA 3ELNA 4UXAA 3ZSLA 5CFCC 1SBFA 1AYM1 3FUOA 1PGL2 3R05A 2WLPA 5FOBB 4G4FA 1V6LA 3CL1A 1ZX5A 1IPKA 1KDMA 1ZZ9A 3SH3A 5BY5A 1ENSA 4K7JA 1SLIA 1UL9A 5JIUA 3O12A 4Q4X2 1NA1A 3HT1A 4FXGB 2BBVA 2LM3A 1MS3A 4I01A 2R042 2VUAA 4TYSA 3OCPA 5FPXA 1BBT1 1OMIA 1QXRA 4AQSA 5JPNB 1LHUA 2I74A 3ATGA 1BMV1 4MZUA 4FAGA 4GMP3 4Q4W2 4JCKA 3GBGA 3ZMNA 4JTNA 3WVJA 1A78A 5GZEA 1OPOA 4FTBA 1QOTA 2RM23 1XRUA 2VVFA 4EWEA 4XQWA 2RM22 2TEPA 2CGNA 2BFUL 1G9FA 1FOD2 1YIPA 4PCRA 3AP4A 1T6GC 4LBKA 3EJKA 3PLQA 4IV3B 3SLIA 1HXS3 2YGMA 4EWDA 3AM2A 2XJVA 1LCLA 1WBFA 5JR7B 5TSWA 3MPPG 4AI1A 1CGPA 1UD1A 2UURA 2ZGOA 1RUG3 3WY6A 4I3GA 3W59A 1AL22 1X7NA 3TAYA 3ALQA 5I8SA 5T5JA 4RHV2 4IEYA 4K21A 5T3NA 1XXNA 3MZHA 3AFKA 2VQAA 2W39A 1AL21 1LGNA 1UZZA 2G4IA 3B01A 3M3CA 3VBRB 1AJOA 1CAUA 2ARBA 5LRRA 4YM3A 4CP0A 5DZFA 2TNFA 4GALA 2IXCA 2Q30A 3ZMOA 2TBVA 1YNAA 4OULA 4FPJA 4NHMA 1OPMA 2SLIA 4QHBA 2A7AA 2ZZQA 2IFRA 1K5MC 2I45A 1DQ2A 3NSTA 4R9BA 1ZRCA 1U12A 2VOXA 1HV1A 1OD5A 2ZZJA 3TN92 5K0UC 3WX5A 1KQRA 3I54A 1AX0A 1FPN2 1VB4A 2QDNA 2Z5WA 1B35B 5EJ3A 4UW3A 4D94A 4FSJA 1PGSA 3D0JA 4QPIC 5FTTC 2I07B 2YUEA 1EPZA 4QPYA 2OUHA 3UJQA 4QQHA 1ND2A 2WA4A 4C90A 1DQ5A 1KD7A 2EAAA 1XE7A 3E5XA 3B9CA 3HD8B 1WCSA 2BWAA 5HI0A 5I91A 4YGEA 1JHNA 4S2GA 1FYUA 3T2TA 4XFFA 1R1ZA 4KG0A 3OBTA 2G9GA 1RUD1 2F6BA 1NE6A 3SHRA 1RHI3 2PAKA 5FMOS 5DUXA 1DBNA 4BIFA 5JPMB 4OUSA 2A75A 5A3MA 1O5LA 3ZFEC 1OSGA 1KS5A 3ZYJB 3RG0A 4LBOA 2QKDA 1VRH2 3UKTA 2A71A 1LR5A 3ILFA 5AC93 2JG8B 3KB5A 1IS6A 5J36A 3SH4A 3UKVA 2D6PA 4XJAA 2A5ZA 3AYEA 4JQRA 1NLRA 4YZ4A 1XU2A 3AJZA 1JYCA 1YO8A 5ACA2 2HYKA 4A7ZA 2D93A 1EY2A 3VN4A 2IZWA 1AYM2 2GC2A 4AVBA 1W6PA 3KQRA 4FPLA 3E5UA 3AKSA 1KJLA 3ZN6B 2JG9C 4FCAA 1D4M2 1YFWA 1GZ9A 1VAKA 3KZ4C 4XF0A 4BWOA 3BB6A 4AVVA 1W0OA 4LO5B 2C1FA 1RIRA 4OVEA 1CQ9A 4KWKA 4EN0A 2D43A 3WHTA 1CPNA 3V56A 2DUQA 2B46X 2WSUA 1DG6A 1W39A 4DMIA 2XH6A 5J96B 1CAVB 3I4IA 3KGZA 2BPA2 5GZFA 3JB4C 4AEDC 2AENA 2JG9B 2XL9A 3VHRA 2ZKNA 4LO4B 4PQ9A 1OOPA 1UU4A 2CTVA 1LHWA 1REDA 4QXKA 3NKTA 2WIIB 4GB33 4H14A 1S0FA 1RUG1 2Q0AA 1MQTA 1C8M3 1ZBE1 3WDTA 4WVMB 4Q4Y3 3ETQA 5I8YA 3P3NA 2XUMA 3A4UA 1QNWA 2QZ3A 1RUD2 3CJIC 1RUF3 3VKNA 1O4YA 2ZGTA 2ZGSA 4PIXA 3IWZA 2ZACA 4XFIA 4K1ZA 4DS0A 4JGZC 1AR93 1ENQA 4H3WA 5GLVA 5CAZA 1GQHA 1GZCA 4CDWB 4META 1M4WA 2HWD1 1BXHA 3HIFA 2YROA 4RHV1 3MI8A 4NR1A 3HAGA 4YM1A 1RUJ3 4FPEA 1TMF1 3N7KA 4O9EA 4F83A 1X8MA 2JDZA 3ECQA 4GULA 4OHZA 3WDYA 5SV8A 3RYRA 4FP2A 1OI6A 3GHMA 4GIQA 4OHWA 3ROUA 2ZX4A 1AX2A 3B9IA 3O7OA 1H9PA 4N43A 2BVBA 3ZXEA 1H4HA 1HW5A 4PLMA 4CDQC 4NWVA 1NY72 1H1AA 4P5HA 4DY5A 5KXEA 1C4RA 3FLTA 1AF9A 3GBFA 1AHSA 2VVEA 1VBB1 3M3EA 2PHWA 2CWSA 3SISA 2NPIA 4XEZA 1RUH3 1VBD1 3GYDA 3VBRC 1ALYA 1VBB2 3VBHB 2A70A 1ZZBA 1UU5A 5KC6A 1ZREA 3GF6A 5T50A 1VBD2 1VBD3 2IC1A 1Y7BA 4QU2A 4JAAA 3VKOA 3PNAA 2RS53 2HWE1 4X6RB 5CVRA 4ISQA 4DOUA 1PO13 4F7ZA 4AEKA 4RFT0 3OYWB 4QQLA 1FAYA 5KBFA 1FMD2 3WNXA 4F3JA 4I0AA 3MIGA 2VW1A 1WD3A 2GNDA 4NO4A 4YG3A 1CX4A 4WM7C 5KXDA 2GMPA 2JG8A 3D82A 4XHBA 2QQPA 2PHFA 5EWSA 4R4XA 3WUCA 1S0EA 2B9UA 4FPFA 5C9AB 3KT4A 4PBOA 5EXOA 2B39A 2XJTA 5DDJ2 4X8PA 1WW6A 2I2SA 1A8DA 1GV9A 3FX3A 1K5MA 1WW5A 2NMNA 5SV5A 4R8HA 4E9KA 5DG1A 5H9RA 4Z07A 5CA6A 4Z92B 1PVC3 5DDJ1 3TB0A 2P37A 3RWNA 4CYDA 3WUDA 2HWC2 3DL3A 3J8F2 4Q8LA 1EAH3 3AMQA 3ZIWA 2RJLA 4P9XA 2K0GA 4Y20A 1BZWA 2LUWA 3WP6A 1DGRN 4Q1RA 3ZYGA 3IN9A 2YYOA 4E4ZA 4IL7A 4J6GA 4BLJA 1FV3A 2MHFA 2ET7A 1LESA 1EAH1 1MZ5A 3QH7A 4N7IA 2D3SA 2FBEA 1Z0HA 1S55A 2VGDA 3DPRC 2X8KA 4GB32 4HBNA 1PIV3 4FOQA 3ZFEB 4JDNA 1V6NA 1CPMA 1HDKA 5BNOA 4YGDA 3MIEA 4DPNA 2VPVA 4OI4A 3DN7A 2R32A 1URXA 2EF6A 2SBAA 1QDOA 3IMNA 4QM9A 4CDUA 1LB2A 4OHYA 3MICA 4C0BA 2HWB3 1J1LA 2LTNA 1YFUA 3KSCA 5K9YA 2A6VA 1WD4A 4MH0E 3RI8A 3KMHA 1DZTA 2FMYA 4YFWA 2GMEA 1NQDA 3J9SA 4PLNA 4HVRA 1I6XA 5A33A 3V0AA 3ZFFB 3FWEA 4N43B 2X29A 1PHMA 1ND3A 4QPIB 3WP5A 1X50A 1BKZA 3WQ7A 3JBG3 1SMVA 4K6BA 4P9YA 2O8QA 4KG8A 1U5IA 1G9DA 3AKRA 1SFNA 3AXDA 2Z42A 1PZ7A 4AI3A 5FO7B 2DFBA 1JYIA 1N47A 1HX6A 2MEV3 2D5HA 1REFA 1DHKB 3H3UA 4HPKB 3D0SA 1F5JA 2ET1A 1FNZA 1PVC2 2PHRA 4YLZA 5FQ0A 4XYXA 1W6QB 2FZ1A 4COUA 2WNEA 2AREA 2PLV2 1LTEA 1RUE3 3S7IA 3ZDSA 1RUE2 1RUNA 4IXLA 1JBCA 2PHLA 1O3SA 4A7KA 2H0VA 4MXWB 4AEDA 4L2NA 1X8EA 5C8WA 3GZAA 3ZN6A 4QQ2A 4B4RA 1QDCA 1XYNA 3M2MA 1RUE1 2BNMA 5JSRA 2GU9A 3U11A 4RS5B 1R081 3EBRA 1PO11 2DVAA 5T52A 4YGCA 4AQTA 4B7KA 1ULFA 2HWF3 4DRRA 1ZRDA 4R9CA 4XQDA 2QVSB 5KXCA 4NWWA 3ZX7A 1GSLA 4XIKA 4XFHA 3INAA 4XTMA 5FO8B 1DQ0A 2DWRA 4CRQA 1RMU1 4RQPA 2EAKA 1ND3B 4QPIA 1Z7S2 1DYPA 1MZEA 4MX3A 5C33A 4LNVA 2Y0IA 2Q1MA 1YCIA 1VALA 3ES4A 1ENRA 4CDXA 1QQP1 2VQ0A 1J58A 1RHI2 5C8CC 3HMYA 3VKMA 2WNVB 5GZGA 1W6OA 4MGYE 3IPVB 4XF4A 1AX1A 3MIDA 1LOEA 4FPKA 5HCBA 2WS92 3POWA 3OTFA 1PGW2 3FBMA 3T1LA 1PNGA 4AFDA 2DYCA 3VBFC 1YFYA 3A0NA 2ZX1A 2CGPA 4BA6A 4ZKTB 2O0OA 3ZFEA 1ZVFA 2MNGA 3HT2A 1NXMA 4KH9A 4Z1VA 3RRDA 2K9ZA 1BCXA 1A6CA 1S2BA 3ZXAC 2D98A 4C0HA 3AB0A 3VBHA 2E9QA 3MGUA 4EN6B 1VBC3 4I0BA 2G9FA 4AFMA 1RUH2 1AR63 3ZVXA 3IDBB 1QGLA 2R071 4AFBA 2XJQA 3CU7A 4N53B 1WCDJ 2VW2A 1Y43B 4M00A 5BNPA 1FOD1 3AK0A 3W58A 1WMDA 1RUC1 2WKKA 4HKLA 4MUVA 1V6OA 1GICA 4KU8A 3WZ1A 2XJUA 2Y26A 3VL9A 3AP5A 1W6OB 3SCGA 1J1TA 3NWKA 4HKOA 4Q1PA 3MIFA 5K8SA 1POV1 3LGRA 3BOPA 1I3HA 1NCQB 3MLLA 1HRI2 4FVVA 4LE3A 1TEIA 3D6EA 4YVWA 3JQXA 4AVAA 2VOWA 3CJIB 2VMIA 1I9RA 2RMU1 3BU7A 4UBHA 4N53C 1UU6A 1LECA 3VUOA 1Q8OA 2CAUA 4Q8KA 4K1YA 4S2FA 1GQGA 3AZVA 4Y1YA 1VBA2 1FPN3 5DUVA 1VBA3 1CJPA 4E4SA 1J3RA 3VKLA 1KFUL 4XQ4A 1PO23 1RUG2 4XE9A 2Z2SB 1AR72 5DG2A 5LK7B 3V0AB 1ZZ7A 4WZFA 3H1WA 1G8WA 1FPN1 2VNGA 1PGW1 3AMNA 3VHNA 5K0UB 1H8TA 2XKOA 5FPZA 1ZBA3 1RUH1 1OLRA 1QF3A 4KWLA 1WW4A 1XE8A 5FAXA 2DCZA 4Y22A 4NVPA 3OGJA 4WM8C 1GYKA 2P3JA 1RUD3 4QGNA 1X36A 2K2SA 1RB8G 2DFCA 3URFA 3I7DA 3K51A 2VNRA 3LCPA 2RS32 4N43C 4X6QB 4GWMA 1LOCA 4Q4V2 1JW6A 3N35A 4OI1A 4COYA 4Y5Z0 2PYTA 2WNVC 3VBOB 2JICA 2XJRA 4MXVA 4RQPB 4LLOA 3RMXA 1ZRFA 1NCQC 2VG9A 4S2HA 1AL23 1BJQA 3FFQA 1GR3A 3ZSJA 3H3ZA 1TNFA 1GFF2 2ZHNA 2BQPA 5BNNA 2WZR1 3ZPYA 2PTMA 4AWDA 2RE9A 1CR7A 1UKRA 4GWNA 2XJPA 1D4M1 1R1A2 4IQPA 4G9SB