3WTMA

Crystal structure of lymnaea stagnalis acetylcholine-binding protein q55r mutant complexed with nitromethylene analogue of imidacloprid
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
207
structure length
207
Chain Sequence
ADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQRTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 48
structure length 207
sequence length 207
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wtmA00
3JAEA 4B5DA 5CO5A 4Z90A 5AFJA 3WTIA 3U8JA 4ZJTA 4X5TA 4A98A 1I9BA 3TLTA 3UU5A 5BRXA 2XYTA 3TLUA 4BFQA 4LMKA 4ALXA 2PH9A 3UU3A 2BG9B 4ZK4A 2XZ6A 5HEJA 4Z91A 4EZ1A 3ZDGA 4HFHA 4UXUA 3IGQA 3SH1A 2BYRA 4UM3A 2C9TA 5AINA 3P50A 3T4MA 3ZDHA 5J0ZA 2BR7A 4QACA 3GUAA 3WTNA 4D01A 4UM1A 2XQ7A 5LXBA 3JAFA 5HCJA 3EI0A 3UU6A 3WIPA 3TLWA 4TWFA 3WTOA 4ZK1A 2XQ9A 3SQ6A 2ZJUA 4AFGA 4UM3S 2PGZA 4HFCA 3U8LA 5SYOA 4AFHA 3EAMA 4LMJA 4QAAA 4QABA 3WTHA 5J5FA 5HEUA 2BR8A 4F8HA 3C79A 5JMEA 2W8FA 4ILBA 3PEOA 1UW6A 2WNLA 5AFNA 5AFMB 3ZKRA 2XQ4A 2Y56A 4QH5A 4ZJSA 5J5GA 2VL0A 2QC1B 4ZZCA 3RQUA 3JADA 4HFIA 4NZBA 4ZZBA 5AFHA 2BYQA 2WNJA 3WTKA 2YKSA 3RIFA 4XHEA 4UM3P 3UU4A 1UX2A 5HEHA 5J5HA 2X00A 4NPPA 2Y58A 4ZR6A 3WTLA 2BG9A 2YMDA 4TNWA 3RQWA 4A97A 2XQ5A 3UQ4A 3TLVA 5L4EA 3U8NA 3SIOA 2XQ3A 5AFLA 4HQPA 5IUXA 5J5IA 4DBMA 3WTMA 2W8GA 2XZ5A 5HEGA 4TWDA 2XNTA 3U8MA 3UQ7A 2X00D 4HFBA 3RI5A 4IREA 5AFKA 4HFDA 4IL4A 3TLSA 2BYNA 4LMLA 4IL9A 2Y57A 2XQ8A 2ZJVA 2BJ0A 2Y54A 2XNVA 4ILAA 5KE4A 3RHWA 3C84A 2BG9E 4COFA 2WZYA 3U8KA 4AFTA 3EHZA 2YN6A 5AFMA 5KZUA 2XQAA 5L47A 4ILCA 3UUBA 4TWHA 4UY2A 4WV9A 5TVCA 3WTJA 5L4HA 4HFEA 5HCMA 5HEOA 3LSVA 2UZ6A 2XYSA 4XK9A 3PMZA 4PIRA 4QH1A 5LG3A 2XQ6A 4BQTA 2BYSA 2YOEA 2BG9C 3UU8A 2WN9A 2YMEA 1UV6A 4TNVA 3RIAA 2WNCA 5FJVA 5BW2A 5CFBA 3SQ9A 2Y7YA 3P4WA 2XNUA 4ZRUA 5BP0A 2BYPA 4FRRA 4QH4A
chains in the Genus database with same CATH superfamily
3JAEA 4B5DA 5CO5A 4Z90A 5AFJA 3WTIA 3U8JA 4ZJTA 4X5TA 4A98A 1I9BA 3TLTA 3UU5A 5BRXA 2XYTA 3TLUA 4BFQA 4LMKA 4ALXA 2PH9A 3UU3A 2BG9B 4ZK4A 2XZ6A 5HEJA 4Z91A 4EZ1A 3ZDGA 4HFHA 4UXUA 3IGQA 3SH1A 2BYRA 4UM3A 2C9TA 5AINA 3P50A 3T4MA 3ZDHA 5J0ZA 2BR7A 4QACA 3GUAA 3WTNA 4D01A 4UM1A 2XQ7A 5LXBA 3JAFA 5HCJA 3EI0A 3UU6A 3WIPA 3TLWA 4TWFA 3WTOA 4ZK1A 2XQ9A 3SQ6A 2ZJUA 4AFGA 4UM3S 2PGZA 4HFCA 3U8LA 5SYOA 4AFHA 3EAMA 4LMJA 4QAAA 4QABA 3WTHA 5J5FA 5HEUA 2BR8A 4F8HA 3C79A 5JMEA 2W8FA 4ILBA 3PEOA 1UW6A 2WNLA 5AFNA 5AFMB 3ZKRA 2XQ4A 2Y56A 4QH5A 4ZJSA 5J5GA 2VL0A 2QC1B 4ZZCA 3RQUA 3JADA 4HFIA 4NZBA 4ZZBA 5AFHA 2BYQA 2WNJA 3WTKA 2YKSA 3RIFA 4XHEA 4UM3P 3UU4A 1UX2A 5HEHA 5J5HA 2X00A 4NPPA 2Y58A 4ZR6A 3WTLA 2BG9A 2YMDA 4TNWA 3RQWA 4A97A 2XQ5A 3UQ4A 3TLVA 5L4EA 3U8NA 3SIOA 2XQ3A 5AFLA 4HQPA 5IUXA 5J5IA 4DBMA 3WTMA 2W8GA 2XZ5A 5HEGA 4TWDA 2XNTA 3U8MA 3UQ7A 2X00D 4HFBA 3RI5A 4IREA 5AFKA 4HFDA 4IL4A 3TLSA 2BYNA 4LMLA 4IL9A 2Y57A 2XQ8A 2ZJVA 2BJ0A 2Y54A 2XNVA 4ILAA 5KE4A 3RHWA 3C84A 2BG9E 4COFA 2WZYA 3U8KA 4AFTA 3EHZA 2YN6A 5AFMA 5KZUA 2XQAA 5L47A 4ILCA 3UUBA 4TWHA 4UY2A 4WV9A 5TVCA 3WTJA 5L4HA 4HFEA 5HCMA 5HEOA 3LSVA 2UZ6A 2XYSA 4XK9A 3PMZA 4PIRA 4QH1A 5LG3A 2XQ6A 4BQTA 2BYSA 2YOEA 2BG9C 3UU8A 2WN9A 2YMEA 1UV6A 4TNVA 3RIAA 2WNCA 5FJVA 5BW2A 5CFBA 3SQ9A 2Y7YA 3P4WA 2XNUA 4ZRUA 5BP0A 2BYPA 4FRRA 4QH4A
chains in the Genus database with same CATH topology
3JAEA 4B5DA 5CO5A 4Z90A 5AFJA 3WTIA 3U8JA 4ZJTA 4X5TA 4A98A 1I9BA 3TLTA 3UU5A 5BRXA 2XYTA 3TLUA 4BFQA 4LMKA 4ALXA 2PH9A 3UU3A 2BG9B 4ZK4A 2XZ6A 5HEJA 4Z91A 4EZ1A 3ZDGA 4HFHA 4UXUA 3IGQA 3SH1A 2BYRA 4UM3A 2C9TA 5AINA 3P50A 3T4MA 3ZDHA 5J0ZA 2BR7A 4QACA 3GUAA 3WTNA 4D01A 4UM1A 2XQ7A 5LXBA 3JAFA 5HCJA 3EI0A 3UU6A 3WIPA 3TLWA 4TWFA 3WTOA 4ZK1A 2XQ9A 3SQ6A 2ZJUA 4AFGA 4UM3S 2PGZA 4HFCA 3U8LA 5SYOA 4AFHA 3EAMA 4LMJA 4QAAA 4QABA 3WTHA 5J5FA 5HEUA 2BR8A 4F8HA 3C79A 5JMEA 2W8FA 4ILBA 3PEOA 1UW6A 2WNLA 5AFNA 5AFMB 3ZKRA 2XQ4A 2Y56A 4QH5A 4ZJSA 5J5GA 2VL0A 2QC1B 4ZZCA 3RQUA 3JADA 4HFIA 4NZBA 4ZZBA 5AFHA 2BYQA 2WNJA 3WTKA 2YKSA 3RIFA 4XHEA 4UM3P 3UU4A 1UX2A 5HEHA 5J5HA 2X00A 4NPPA 2Y58A 4ZR6A 3WTLA 2BG9A 2YMDA 4TNWA 3RQWA 4A97A 2XQ5A 3UQ4A 3TLVA 5L4EA 3U8NA 3SIOA 2XQ3A 5AFLA 4HQPA 5IUXA 5J5IA 4DBMA 3WTMA 2W8GA 2XZ5A 5HEGA 4TWDA 2XNTA 3U8MA 3UQ7A 2X00D 4HFBA 3RI5A 4IREA 5AFKA 4HFDA 4IL4A 3TLSA 2BYNA 4LMLA 4IL9A 2Y57A 2XQ8A 2ZJVA 2BJ0A 2Y54A 2XNVA 4ILAA 5KE4A 3RHWA 3C84A 2BG9E 4COFA 2WZYA 3U8KA 4AFTA 3EHZA 2YN6A 5AFMA 5KZUA 2XQAA 5L47A 4ILCA 3UUBA 4TWHA 4UY2A 4WV9A 5TVCA 3WTJA 5L4HA 4HFEA 5HCMA 5HEOA 3LSVA 2UZ6A 2XYSA 4XK9A 3PMZA 4PIRA 4QH1A 5LG3A 2XQ6A 4BQTA 2BYSA 2YOEA 2BG9C 3UU8A 2WN9A 2YMEA 1UV6A 4TNVA 3RIAA 2WNCA 5FJVA 5BW2A 5CFBA 3SQ9A 2Y7YA 3P4WA 2XNUA 4ZRUA 5BP0A 2BYPA 4FRRA 4QH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAE A;  4B5D A;  5CO5 A;  4Z90 A;  5AFJ A;  3WTI A;  3U8J A;  4ZJT A;  4X5T A;  4A98 A;  1I9B A;  3TLT A;  3UU5 A;  5BRX A;  2XYT A;  3TLU A;  4BFQ A;  4LMK A;  4ALX A;  2PH9 A;  3UU3 A;  2BG9 B;  4ZK4 A;  2XZ6 A;  5HEJ A;  4Z91 A;  4EZ1 A;  3ZDG A;  4HFH A;  4UXU A;  3IGQ A;  3SH1 A;  2BYR A;  4UM3 A;  2C9T A;  5AIN A;  3P50 A;  3T4M A;  3ZDH A;  5J0Z A;  2BR7 A;  4QAC A;  3GUA A;  3WTN A;  4D01 A;  4UM1 A;  2XQ7 A;  5LXB A;  3JAF A;  5HCJ A;  3EI0 A;  3UU6 A;  3WIP A;  3TLW A;  4TWF A;  3WTO A;  4ZK1 A;  2XQ9 A;  3SQ6 A;  2ZJU A;  4AFG A;  4UM3 S;  2PGZ A;  4HFC A;  3U8L A;  5SYO A;  4AFH A;  3EAM A;  4LMJ A;  4QAA A;  4QAB A;  3WTH A;  5J5F A;  5HEU A;  2BR8 A;  4F8H A;  3C79 A;  5JME A;  2W8F A;  4ILB A;  3PEO A;  1UW6 A;  2WNL A;  5AFN A;  5AFM B;  3ZKR A;  2XQ4 A;  2Y56 A;  4QH5 A;  4ZJS A;  5J5G A;  2VL0 A;  2QC1 B;  4ZZC A;  3RQU A;  3JAD A;  4HFI A;  4NZB A;  4ZZB A;  5AFH A;  2BYQ A;  2WNJ A;  3WTK A;  2YKS A;  3RIF A;  4XHE A;  4UM3 P;  3UU4 A;  1UX2 A;  5HEH A;  5J5H A;  2X00 A;  4NPP A;  2Y58 A;  4ZR6 A;  3WTL A;  2BG9 A;  2YMD A;  4TNW A;  3RQW A;  4A97 A;  2XQ5 A;  3UQ4 A;  3TLV A;  5L4E A;  3U8N A;  3SIO A;  2XQ3 A;  5AFL A;  4HQP A;  5IUX A;  5J5I A;  4DBM A;  3WTM A;  2W8G A;  2XZ5 A;  5HEG A;  4TWD A;  2XNT A;  3U8M A;  3UQ7 A;  2X00 D;  4HFB A;  3RI5 A;  4IRE A;  5AFK A;  4HFD A;  4IL4 A;  3TLS A;  2BYN A;  4LML A;  4IL9 A;  2Y57 A;  2XQ8 A;  2ZJV A;  2BJ0 A;  2Y54 A;  2XNV A;  4ILA A;  5KE4 A;  3RHW A;  3C84 A;  2BG9 E;  4COF A;  2WZY A;  3U8K A;  4AFT A;  3EHZ A;  2YN6 A;  5AFM A;  5KZU A;  2XQA A;  5L47 A;  4ILC A;  3UUB A;  4TWH A;  4UY2 A;  4WV9 A;  5TVC A;  3WTJ A;  5L4H A;  4HFE A;  5HCM A;  5HEO A;  3LSV A;  2UZ6 A;  2XYS A;  4XK9 A;  3PMZ A;  4PIR A;  4QH1 A;  5LG3 A;  2XQ6 A;  4BQT A;  2BYS A;  2YOE A;  2BG9 C;  3UU8 A;  2WN9 A;  2YME A;  1UV6 A;  4TNV A;  3RIA A;  2WNC A;  5FJV A;  5BW2 A;  5CFB A;  3SQ9 A;  2Y7Y A;  3P4W A;  2XNU A;  4ZRU A;  5BP0 A;  2BYP A;  4FRR A;  4QH4 A; 
#chains in the Genus database with same CATH topology
 3JAE A;  4B5D A;  5CO5 A;  4Z90 A;  5AFJ A;  3WTI A;  3U8J A;  4ZJT A;  4X5T A;  4A98 A;  1I9B A;  3TLT A;  3UU5 A;  5BRX A;  2XYT A;  3TLU A;  4BFQ A;  4LMK A;  4ALX A;  2PH9 A;  3UU3 A;  2BG9 B;  4ZK4 A;  2XZ6 A;  5HEJ A;  4Z91 A;  4EZ1 A;  3ZDG A;  4HFH A;  4UXU A;  3IGQ A;  3SH1 A;  2BYR A;  4UM3 A;  2C9T A;  5AIN A;  3P50 A;  3T4M A;  3ZDH A;  5J0Z A;  2BR7 A;  4QAC A;  3GUA A;  3WTN A;  4D01 A;  4UM1 A;  2XQ7 A;  5LXB A;  3JAF A;  5HCJ A;  3EI0 A;  3UU6 A;  3WIP A;  3TLW A;  4TWF A;  3WTO A;  4ZK1 A;  2XQ9 A;  3SQ6 A;  2ZJU A;  4AFG A;  4UM3 S;  2PGZ A;  4HFC A;  3U8L A;  5SYO A;  4AFH A;  3EAM A;  4LMJ A;  4QAA A;  4QAB A;  3WTH A;  5J5F A;  5HEU A;  2BR8 A;  4F8H A;  3C79 A;  5JME A;  2W8F A;  4ILB A;  3PEO A;  1UW6 A;  2WNL A;  5AFN A;  5AFM B;  3ZKR A;  2XQ4 A;  2Y56 A;  4QH5 A;  4ZJS A;  5J5G A;  2VL0 A;  2QC1 B;  4ZZC A;  3RQU A;  3JAD A;  4HFI A;  4NZB A;  4ZZB A;  5AFH A;  2BYQ A;  2WNJ A;  3WTK A;  2YKS A;  3RIF A;  4XHE A;  4UM3 P;  3UU4 A;  1UX2 A;  5HEH A;  5J5H A;  2X00 A;  4NPP A;  2Y58 A;  4ZR6 A;  3WTL A;  2BG9 A;  2YMD A;  4TNW A;  3RQW A;  4A97 A;  2XQ5 A;  3UQ4 A;  3TLV A;  5L4E A;  3U8N A;  3SIO A;  2XQ3 A;  5AFL A;  4HQP A;  5IUX A;  5J5I A;  4DBM A;  3WTM A;  2W8G A;  2XZ5 A;  5HEG A;  4TWD A;  2XNT A;  3U8M A;  3UQ7 A;  2X00 D;  4HFB A;  3RI5 A;  4IRE A;  5AFK A;  4HFD A;  4IL4 A;  3TLS A;  2BYN A;  4LML A;  4IL9 A;  2Y57 A;  2XQ8 A;  2ZJV A;  2BJ0 A;  2Y54 A;  2XNV A;  4ILA A;  5KE4 A;  3RHW A;  3C84 A;  2BG9 E;  4COF A;  2WZY A;  3U8K A;  4AFT A;  3EHZ A;  2YN6 A;  5AFM A;  5KZU A;  2XQA A;  5L47 A;  4ILC A;  3UUB A;  4TWH A;  4UY2 A;  4WV9 A;  5TVC A;  3WTJ A;  5L4H A;  4HFE A;  5HCM A;  5HEO A;  3LSV A;  2UZ6 A;  2XYS A;  4XK9 A;  3PMZ A;  4PIR A;  4QH1 A;  5LG3 A;  2XQ6 A;  4BQT A;  2BYS A;  2YOE A;  2BG9 C;  3UU8 A;  2WN9 A;  2YME A;  1UV6 A;  4TNV A;  3RIA A;  2WNC A;  5FJV A;  5BW2 A;  5CFB A;  3SQ9 A;  2Y7Y A;  3P4W A;  2XNU A;  4ZRU A;  5BP0 A;  2BYP A;  4FRR A;  4QH4 A; 
#chains in the Genus database with same CATH homology
 3JAE A;  4B5D A;  5CO5 A;  4Z90 A;  5AFJ A;  3WTI A;  3U8J A;  4ZJT A;  4X5T A;  4A98 A;  1I9B A;  3TLT A;  3UU5 A;  5BRX A;  2XYT A;  3TLU A;  4BFQ A;  4LMK A;  4ALX A;  2PH9 A;  3UU3 A;  2BG9 B;  4ZK4 A;  2XZ6 A;  5HEJ A;  4Z91 A;  4EZ1 A;  3ZDG A;  4HFH A;  4UXU A;  3IGQ A;  3SH1 A;  2BYR A;  4UM3 A;  2C9T A;  5AIN A;  3P50 A;  3T4M A;  3ZDH A;  5J0Z A;  2BR7 A;  4QAC A;  3GUA A;  3WTN A;  4D01 A;  4UM1 A;  2XQ7 A;  5LXB A;  3JAF A;  5HCJ A;  3EI0 A;  3UU6 A;  3WIP A;  3TLW A;  4TWF A;  3WTO A;  4ZK1 A;  2XQ9 A;  3SQ6 A;  2ZJU A;  4AFG A;  4UM3 S;  2PGZ A;  4HFC A;  3U8L A;  5SYO A;  4AFH A;  3EAM A;  4LMJ A;  4QAA A;  4QAB A;  3WTH A;  5J5F A;  5HEU A;  2BR8 A;  4F8H A;  3C79 A;  5JME A;  2W8F A;  4ILB A;  3PEO A;  1UW6 A;  2WNL A;  5AFN A;  5AFM B;  3ZKR A;  2XQ4 A;  2Y56 A;  4QH5 A;  4ZJS A;  5J5G A;  2VL0 A;  2QC1 B;  4ZZC A;  3RQU A;  3JAD A;  4HFI A;  4NZB A;  4ZZB A;  5AFH A;  2BYQ A;  2WNJ A;  3WTK A;  2YKS A;  3RIF A;  4XHE A;  4UM3 P;  3UU4 A;  1UX2 A;  5HEH A;  5J5H A;  2X00 A;  4NPP A;  2Y58 A;  4ZR6 A;  3WTL A;  2BG9 A;  2YMD A;  4TNW A;  3RQW A;  4A97 A;  2XQ5 A;  3UQ4 A;  3TLV A;  5L4E A;  3U8N A;  3SIO A;  2XQ3 A;  5AFL A;  4HQP A;  5IUX A;  5J5I A;  4DBM A;  3WTM A;  2W8G A;  2XZ5 A;  5HEG A;  4TWD A;  2XNT A;  3U8M A;  3UQ7 A;  2X00 D;  4HFB A;  3RI5 A;  4IRE A;  5AFK A;  4HFD A;  4IL4 A;  3TLS A;  2BYN A;  4LML A;  4IL9 A;  2Y57 A;  2XQ8 A;  2ZJV A;  2BJ0 A;  2Y54 A;  2XNV A;  4ILA A;  5KE4 A;  3RHW A;  3C84 A;  2BG9 E;  4COF A;  2WZY A;  3U8K A;  4AFT A;  3EHZ A;  2YN6 A;  5AFM A;  5KZU A;  2XQA A;  5L47 A;  4ILC A;  3UUB A;  4TWH A;  4UY2 A;  4WV9 A;  5TVC A;  3WTJ A;  5L4H A;  4HFE A;  5HCM A;  5HEO A;  3LSV A;  2UZ6 A;  2XYS A;  4XK9 A;  3PMZ A;  4PIR A;  4QH1 A;  5LG3 A;  2XQ6 A;  4BQT A;  2BYS A;  2YOE A;  2BG9 C;  3UU8 A;  2WN9 A;  2YME A;  1UV6 A;  4TNV A;  3RIA A;  2WNC A;  5FJV A;  5BW2 A;  5CFB A;  3SQ9 A;  2Y7Y A;  3P4W A;  2XNU A;  4ZRU A;  5BP0 A;  2BYP A;  4FRR A;  4QH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...