3WTMA

Crystal structure of lymnaea stagnalis acetylcholine-binding protein q55r mutant complexed with nitromethylene analogue of imidacloprid
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
207
structure length
207
Chain Sequence
ADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQRTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylcholine-binding protein
publication title Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 48
structure length 207
sequence length 207
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3wtmA00
4UM3P 3ZDGA 2BYPA 3LSVA 4QABA 2PGZA 4QAAA 5HEHA 1I9BA 4IL4A 4TWFA 2QC1B 2WNLA 2YMEA 4ZJTA 3WTIA 2PH9A 4ZR6A 2YOEA 5HEGA 2BG9B 2W8GA 3EAMA 3RQUA 3WTKA 5L4HA 4X5TA 3TLVA 2VL0A 4UM3A 2WNCA 4QH4A 2BYRA 3WTOA 4HFEA 5AFJA 4LMJA 3C84A 5HEUA 3WTHA 2XQAA 2WNJA 3GUAA 2X00D 5JMEA 3SIOA 4XK9A 2BG9A 2XNTA 5HEOA 3T4MA 4ZZBA 4HFCA 3TLWA 2XYSA 3PMZA 4NZBA 5LXBA 3JADA 2BG9C 4XHEA 4AFHA 5KE4A 3IGQA 2Y54A 4HQPA 4TWHA 3TLSA 3UU8A 2BYNA 3UQ4A 2XYTA 2XZ5A 2YKSA 4IL9A 3UU5A 4A98A 4ZZCA 4ZJSA 5J0ZA 4A97A 4QACA 2YMDA 5SYOA 4EZ1A 2XQ6A 3P4WA 4QH5A 3UU6A 5HCJA 4NPPA 2C9TA 3WTMA 4HFDA 4QH1A 2Y57A 4TNVA 3UQ7A 2XQ4A 2XNVA 5HEJA 2BG9E 2XQ8A 3RQWA 4AFTA 5KZUA 3RHWA 5AFKA 3RIAA 3U8JA 3EHZA 4ILCA 3UU3A 5HCMA 5AINA 5AFLA 2BR7A 3JAFA 4D01A 1UV6A 4ZK4A 5L4EA 5CFBA 5J5IA 1UW6A 2YN6A 5L47A 3WTJA 5J5GA 5FJVA 4B5DA 3WTLA 5LG3A 5TVCA 3U8KA 4ALXA 3U8LA 2XQ9A 4IREA 3ZDHA 2ZJUA 4TWDA 3C79A 3UU4A 4ILBA 3SQ6A 4LMKA 4TNWA 2WN9A 3WIPA 5AFMB 4DBMA 4HFIA 4UY2A 4HFBA 2XQ7A 5BP0A 2XZ6A 5BW2A 5J5FA 3ZKRA 2BYQA 2X00A 3SH1A 3EI0A 4ZRUA 5AFHA 5AFMA 2WZYA 3RI5A 5BRXA 5IUXA 4Z91A 2BR8A 3U8MA 2Y58A 3P50A 4F8HA 1UX2A 4HFHA 4ILAA 4BQTA 3TLUA 3U8NA 3SQ9A 2W8FA 4COFA 2Y56A 4UXUA 2XQ3A 2ZJVA 4Z90A 4UM3S 2BYSA 5AFNA 2XNUA 3JAEA 4UM1A 4WV9A 5CO5A 2BJ0A 4AFGA 4ZK1A 3TLTA 5J5HA 4PIRA 3UUBA 4FRRA 3RIFA 4BFQA 2XQ5A 4LMLA 2Y7YA 3PEOA 3WTNA 2UZ6A
chains in the Genus database with same CATH superfamily
4UM3P 3ZDGA 2BYPA 3LSVA 4QABA 2PGZA 4QAAA 5HEHA 1I9BA 4IL4A 4TWFA 2QC1B 2WNLA 2YMEA 4ZJTA 3WTIA 2PH9A 4ZR6A 2YOEA 5HEGA 2BG9B 2W8GA 3EAMA 3RQUA 3WTKA 5L4HA 4X5TA 3TLVA 2VL0A 4UM3A 2WNCA 4QH4A 2BYRA 3WTOA 4HFEA 5AFJA 4LMJA 3C84A 5HEUA 3WTHA 2XQAA 2WNJA 3GUAA 2X00D 5JMEA 3SIOA 4XK9A 2BG9A 2XNTA 5HEOA 3T4MA 4ZZBA 4HFCA 3TLWA 2XYSA 3PMZA 4NZBA 5LXBA 3JADA 2BG9C 4XHEA 4AFHA 5KE4A 3IGQA 2Y54A 4HQPA 4TWHA 3TLSA 3UU8A 2BYNA 3UQ4A 2XYTA 2XZ5A 2YKSA 4IL9A 3UU5A 4A98A 4ZZCA 4ZJSA 5J0ZA 4A97A 4QACA 2YMDA 5SYOA 4EZ1A 2XQ6A 3P4WA 4QH5A 3UU6A 5HCJA 4NPPA 2C9TA 3WTMA 4HFDA 4QH1A 2Y57A 4TNVA 3UQ7A 2XQ4A 2XNVA 5HEJA 2BG9E 2XQ8A 3RQWA 4AFTA 5KZUA 3RHWA 5AFKA 3RIAA 3U8JA 3EHZA 4ILCA 3UU3A 5HCMA 5AINA 5AFLA 2BR7A 3JAFA 4D01A 1UV6A 4ZK4A 5L4EA 5CFBA 5J5IA 1UW6A 2YN6A 5L47A 3WTJA 5J5GA 5FJVA 4B5DA 3WTLA 5LG3A 5TVCA 3U8KA 4ALXA 3U8LA 2XQ9A 4IREA 3ZDHA 2ZJUA 4TWDA 3C79A 3UU4A 4ILBA 3SQ6A 4LMKA 4TNWA 2WN9A 3WIPA 5AFMB 4DBMA 4HFIA 4UY2A 4HFBA 2XQ7A 5BP0A 2XZ6A 5BW2A 5J5FA 3ZKRA 2BYQA 2X00A 3SH1A 3EI0A 4ZRUA 5AFHA 5AFMA 2WZYA 3RI5A 5BRXA 5IUXA 4Z91A 2BR8A 3U8MA 2Y58A 3P50A 4F8HA 1UX2A 4HFHA 4ILAA 4BQTA 3TLUA 3U8NA 3SQ9A 2W8FA 4COFA 2Y56A 4UXUA 2XQ3A 2ZJVA 4Z90A 4UM3S 2BYSA 5AFNA 2XNUA 3JAEA 4UM1A 4WV9A 5CO5A 2BJ0A 4AFGA 4ZK1A 3TLTA 5J5HA 4PIRA 3UUBA 4FRRA 3RIFA 4BFQA 2XQ5A 4LMLA 2Y7YA 3PEOA 3WTNA 2UZ6A
chains in the Genus database with same CATH topology
4UM3P 3ZDGA 2BYPA 3LSVA 4QABA 2PGZA 4QAAA 5HEHA 1I9BA 4IL4A 4TWFA 2QC1B 2WNLA 2YMEA 4ZJTA 3WTIA 2PH9A 4ZR6A 2YOEA 5HEGA 2BG9B 2W8GA 3EAMA 3RQUA 3WTKA 5L4HA 4X5TA 3TLVA 2VL0A 4UM3A 2WNCA 4QH4A 2BYRA 3WTOA 4HFEA 5AFJA 4LMJA 3C84A 5HEUA 3WTHA 2XQAA 2WNJA 3GUAA 2X00D 5JMEA 3SIOA 4XK9A 2BG9A 2XNTA 5HEOA 3T4MA 4ZZBA 4HFCA 3TLWA 2XYSA 3PMZA 4NZBA 5LXBA 3JADA 2BG9C 4XHEA 4AFHA 5KE4A 3IGQA 2Y54A 4HQPA 4TWHA 3TLSA 3UU8A 2BYNA 3UQ4A 2XYTA 2XZ5A 2YKSA 4IL9A 3UU5A 4A98A 4ZZCA 4ZJSA 5J0ZA 4A97A 4QACA 2YMDA 5SYOA 4EZ1A 2XQ6A 3P4WA 4QH5A 3UU6A 5HCJA 4NPPA 2C9TA 3WTMA 4HFDA 4QH1A 2Y57A 4TNVA 3UQ7A 2XQ4A 2XNVA 5HEJA 2BG9E 2XQ8A 3RQWA 4AFTA 5KZUA 3RHWA 5AFKA 3RIAA 3U8JA 3EHZA 4ILCA 3UU3A 5HCMA 5AINA 5AFLA 2BR7A 3JAFA 4D01A 1UV6A 4ZK4A 5L4EA 5CFBA 5J5IA 1UW6A 2YN6A 5L47A 3WTJA 5J5GA 5FJVA 4B5DA 3WTLA 5LG3A 5TVCA 3U8KA 4ALXA 3U8LA 2XQ9A 4IREA 3ZDHA 2ZJUA 4TWDA 3C79A 3UU4A 4ILBA 3SQ6A 4LMKA 4TNWA 2WN9A 3WIPA 5AFMB 4DBMA 4HFIA 4UY2A 4HFBA 2XQ7A 5BP0A 2XZ6A 5BW2A 5J5FA 3ZKRA 2BYQA 2X00A 3SH1A 3EI0A 4ZRUA 5AFHA 5AFMA 2WZYA 3RI5A 5BRXA 5IUXA 4Z91A 2BR8A 3U8MA 2Y58A 3P50A 4F8HA 1UX2A 4HFHA 4ILAA 4BQTA 3TLUA 3U8NA 3SQ9A 2W8FA 4COFA 2Y56A 4UXUA 2XQ3A 2ZJVA 4Z90A 4UM3S 2BYSA 5AFNA 2XNUA 3JAEA 4UM1A 4WV9A 5CO5A 2BJ0A 4AFGA 4ZK1A 3TLTA 5J5HA 4PIRA 3UUBA 4FRRA 3RIFA 4BFQA 2XQ5A 4LMLA 2Y7YA 3PEOA 3WTNA 2UZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UM3 P;  3ZDG A;  2BYP A;  3LSV A;  4QAB A;  2PGZ A;  4QAA A;  5HEH A;  1I9B A;  4IL4 A;  4TWF A;  2QC1 B;  2WNL A;  2YME A;  4ZJT A;  3WTI A;  2PH9 A;  4ZR6 A;  2YOE A;  5HEG A;  2BG9 B;  2W8G A;  3EAM A;  3RQU A;  3WTK A;  5L4H A;  4X5T A;  3TLV A;  2VL0 A;  4UM3 A;  2WNC A;  4QH4 A;  2BYR A;  3WTO A;  4HFE A;  5AFJ A;  4LMJ A;  3C84 A;  5HEU A;  3WTH A;  2XQA A;  2WNJ A;  3GUA A;  2X00 D;  5JME A;  3SIO A;  4XK9 A;  2BG9 A;  2XNT A;  5HEO A;  3T4M A;  4ZZB A;  4HFC A;  3TLW A;  2XYS A;  3PMZ A;  4NZB A;  5LXB A;  3JAD A;  2BG9 C;  4XHE A;  4AFH A;  5KE4 A;  3IGQ A;  2Y54 A;  4HQP A;  4TWH A;  3TLS A;  3UU8 A;  2BYN A;  3UQ4 A;  2XYT A;  2XZ5 A;  2YKS A;  4IL9 A;  3UU5 A;  4A98 A;  4ZZC A;  4ZJS A;  5J0Z A;  4A97 A;  4QAC A;  2YMD A;  5SYO A;  4EZ1 A;  2XQ6 A;  3P4W A;  4QH5 A;  3UU6 A;  5HCJ A;  4NPP A;  2C9T A;  3WTM A;  4HFD A;  4QH1 A;  2Y57 A;  4TNV A;  3UQ7 A;  2XQ4 A;  2XNV A;  5HEJ A;  2BG9 E;  2XQ8 A;  3RQW A;  4AFT A;  5KZU A;  3RHW A;  5AFK A;  3RIA A;  3U8J A;  3EHZ A;  4ILC A;  3UU3 A;  5HCM A;  5AIN A;  5AFL A;  2BR7 A;  3JAF A;  4D01 A;  1UV6 A;  4ZK4 A;  5L4E A;  5CFB A;  5J5I A;  1UW6 A;  2YN6 A;  5L47 A;  3WTJ A;  5J5G A;  5FJV A;  4B5D A;  3WTL A;  5LG3 A;  5TVC A;  3U8K A;  4ALX A;  3U8L A;  2XQ9 A;  4IRE A;  3ZDH A;  2ZJU A;  4TWD A;  3C79 A;  3UU4 A;  4ILB A;  3SQ6 A;  4LMK A;  4TNW A;  2WN9 A;  3WIP A;  5AFM B;  4DBM A;  4HFI A;  4UY2 A;  4HFB A;  2XQ7 A;  5BP0 A;  2XZ6 A;  5BW2 A;  5J5F A;  3ZKR A;  2BYQ A;  2X00 A;  3SH1 A;  3EI0 A;  4ZRU A;  5AFH A;  5AFM A;  2WZY A;  3RI5 A;  5BRX A;  5IUX A;  4Z91 A;  2BR8 A;  3U8M A;  2Y58 A;  3P50 A;  4F8H A;  1UX2 A;  4HFH A;  4ILA A;  4BQT A;  3TLU A;  3U8N A;  3SQ9 A;  2W8F A;  4COF A;  2Y56 A;  4UXU A;  2XQ3 A;  2ZJV A;  4Z90 A;  4UM3 S;  2BYS A;  5AFN A;  2XNU A;  3JAE A;  4UM1 A;  4WV9 A;  5CO5 A;  2BJ0 A;  4AFG A;  4ZK1 A;  3TLT A;  5J5H A;  4PIR A;  3UUB A;  4FRR A;  3RIF A;  4BFQ A;  2XQ5 A;  4LML A;  2Y7Y A;  3PEO A;  3WTN A;  2UZ6 A; 
#chains in the Genus database with same CATH topology
 4UM3 P;  3ZDG A;  2BYP A;  3LSV A;  4QAB A;  2PGZ A;  4QAA A;  5HEH A;  1I9B A;  4IL4 A;  4TWF A;  2QC1 B;  2WNL A;  2YME A;  4ZJT A;  3WTI A;  2PH9 A;  4ZR6 A;  2YOE A;  5HEG A;  2BG9 B;  2W8G A;  3EAM A;  3RQU A;  3WTK A;  5L4H A;  4X5T A;  3TLV A;  2VL0 A;  4UM3 A;  2WNC A;  4QH4 A;  2BYR A;  3WTO A;  4HFE A;  5AFJ A;  4LMJ A;  3C84 A;  5HEU A;  3WTH A;  2XQA A;  2WNJ A;  3GUA A;  2X00 D;  5JME A;  3SIO A;  4XK9 A;  2BG9 A;  2XNT A;  5HEO A;  3T4M A;  4ZZB A;  4HFC A;  3TLW A;  2XYS A;  3PMZ A;  4NZB A;  5LXB A;  3JAD A;  2BG9 C;  4XHE A;  4AFH A;  5KE4 A;  3IGQ A;  2Y54 A;  4HQP A;  4TWH A;  3TLS A;  3UU8 A;  2BYN A;  3UQ4 A;  2XYT A;  2XZ5 A;  2YKS A;  4IL9 A;  3UU5 A;  4A98 A;  4ZZC A;  4ZJS A;  5J0Z A;  4A97 A;  4QAC A;  2YMD A;  5SYO A;  4EZ1 A;  2XQ6 A;  3P4W A;  4QH5 A;  3UU6 A;  5HCJ A;  4NPP A;  2C9T A;  3WTM A;  4HFD A;  4QH1 A;  2Y57 A;  4TNV A;  3UQ7 A;  2XQ4 A;  2XNV A;  5HEJ A;  2BG9 E;  2XQ8 A;  3RQW A;  4AFT A;  5KZU A;  3RHW A;  5AFK A;  3RIA A;  3U8J A;  3EHZ A;  4ILC A;  3UU3 A;  5HCM A;  5AIN A;  5AFL A;  2BR7 A;  3JAF A;  4D01 A;  1UV6 A;  4ZK4 A;  5L4E A;  5CFB A;  5J5I A;  1UW6 A;  2YN6 A;  5L47 A;  3WTJ A;  5J5G A;  5FJV A;  4B5D A;  3WTL A;  5LG3 A;  5TVC A;  3U8K A;  4ALX A;  3U8L A;  2XQ9 A;  4IRE A;  3ZDH A;  2ZJU A;  4TWD A;  3C79 A;  3UU4 A;  4ILB A;  3SQ6 A;  4LMK A;  4TNW A;  2WN9 A;  3WIP A;  5AFM B;  4DBM A;  4HFI A;  4UY2 A;  4HFB A;  2XQ7 A;  5BP0 A;  2XZ6 A;  5BW2 A;  5J5F A;  3ZKR A;  2BYQ A;  2X00 A;  3SH1 A;  3EI0 A;  4ZRU A;  5AFH A;  5AFM A;  2WZY A;  3RI5 A;  5BRX A;  5IUX A;  4Z91 A;  2BR8 A;  3U8M A;  2Y58 A;  3P50 A;  4F8H A;  1UX2 A;  4HFH A;  4ILA A;  4BQT A;  3TLU A;  3U8N A;  3SQ9 A;  2W8F A;  4COF A;  2Y56 A;  4UXU A;  2XQ3 A;  2ZJV A;  4Z90 A;  4UM3 S;  2BYS A;  5AFN A;  2XNU A;  3JAE A;  4UM1 A;  4WV9 A;  5CO5 A;  2BJ0 A;  4AFG A;  4ZK1 A;  3TLT A;  5J5H A;  4PIR A;  3UUB A;  4FRR A;  3RIF A;  4BFQ A;  2XQ5 A;  4LML A;  2Y7Y A;  3PEO A;  3WTN A;  2UZ6 A; 
#chains in the Genus database with same CATH homology
 4UM3 P;  3ZDG A;  2BYP A;  3LSV A;  4QAB A;  2PGZ A;  4QAA A;  5HEH A;  1I9B A;  4IL4 A;  4TWF A;  2QC1 B;  2WNL A;  2YME A;  4ZJT A;  3WTI A;  2PH9 A;  4ZR6 A;  2YOE A;  5HEG A;  2BG9 B;  2W8G A;  3EAM A;  3RQU A;  3WTK A;  5L4H A;  4X5T A;  3TLV A;  2VL0 A;  4UM3 A;  2WNC A;  4QH4 A;  2BYR A;  3WTO A;  4HFE A;  5AFJ A;  4LMJ A;  3C84 A;  5HEU A;  3WTH A;  2XQA A;  2WNJ A;  3GUA A;  2X00 D;  5JME A;  3SIO A;  4XK9 A;  2BG9 A;  2XNT A;  5HEO A;  3T4M A;  4ZZB A;  4HFC A;  3TLW A;  2XYS A;  3PMZ A;  4NZB A;  5LXB A;  3JAD A;  2BG9 C;  4XHE A;  4AFH A;  5KE4 A;  3IGQ A;  2Y54 A;  4HQP A;  4TWH A;  3TLS A;  3UU8 A;  2BYN A;  3UQ4 A;  2XYT A;  2XZ5 A;  2YKS A;  4IL9 A;  3UU5 A;  4A98 A;  4ZZC A;  4ZJS A;  5J0Z A;  4A97 A;  4QAC A;  2YMD A;  5SYO A;  4EZ1 A;  2XQ6 A;  3P4W A;  4QH5 A;  3UU6 A;  5HCJ A;  4NPP A;  2C9T A;  3WTM A;  4HFD A;  4QH1 A;  2Y57 A;  4TNV A;  3UQ7 A;  2XQ4 A;  2XNV A;  5HEJ A;  2BG9 E;  2XQ8 A;  3RQW A;  4AFT A;  5KZU A;  3RHW A;  5AFK A;  3RIA A;  3U8J A;  3EHZ A;  4ILC A;  3UU3 A;  5HCM A;  5AIN A;  5AFL A;  2BR7 A;  3JAF A;  4D01 A;  1UV6 A;  4ZK4 A;  5L4E A;  5CFB A;  5J5I A;  1UW6 A;  2YN6 A;  5L47 A;  3WTJ A;  5J5G A;  5FJV A;  4B5D A;  3WTL A;  5LG3 A;  5TVC A;  3U8K A;  4ALX A;  3U8L A;  2XQ9 A;  4IRE A;  3ZDH A;  2ZJU A;  4TWD A;  3C79 A;  3UU4 A;  4ILB A;  3SQ6 A;  4LMK A;  4TNW A;  2WN9 A;  3WIP A;  5AFM B;  4DBM A;  4HFI A;  4UY2 A;  4HFB A;  2XQ7 A;  5BP0 A;  2XZ6 A;  5BW2 A;  5J5F A;  3ZKR A;  2BYQ A;  2X00 A;  3SH1 A;  3EI0 A;  4ZRU A;  5AFH A;  5AFM A;  2WZY A;  3RI5 A;  5BRX A;  5IUX A;  4Z91 A;  2BR8 A;  3U8M A;  2Y58 A;  3P50 A;  4F8H A;  1UX2 A;  4HFH A;  4ILA A;  4BQT A;  3TLU A;  3U8N A;  3SQ9 A;  2W8F A;  4COF A;  2Y56 A;  4UXU A;  2XQ3 A;  2ZJV A;  4Z90 A;  4UM3 S;  2BYS A;  5AFN A;  2XNU A;  3JAE A;  4UM1 A;  4WV9 A;  5CO5 A;  2BJ0 A;  4AFG A;  4ZK1 A;  3TLT A;  5J5H A;  4PIR A;  3UUB A;  4FRR A;  3RIF A;  4BFQ A;  2XQ5 A;  4LML A;  2Y7Y A;  3PEO A;  3WTN A;  2UZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...