3WTPA

Crystal structure of the heterotypic nucleosome containing human cenp-a and h3.3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
89
structure length
89
Chain Sequence
b'GWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 31
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wtpA00
4J8WA 3B6GC 5DNNC 5CPKD 4J8VA 5KDMA 1M1AD 1P3PC 1ZLAA 1P3AC 3C1BA 1P3MB 4R8PA 1U35D 5AV9A 1P3IB 3B6GB 3KXBA 2PYOD 3O62C 2AROD 5AV9D 5CPIC 5DNNB 3LZ0A 2CV5A 3LJAA 3C1CA 1P3PB 1P3AB 3WKJD 2F8NK 1P34A 1BFMA 1B67A 1P34D 1ID3D 3AZHD 1WWIA 3O62B 5B0ZA 5F99A 3WA9A 2YFWA 3AZLD 4J8XC 4YS3D 4H9NA 3UTBD 5BNVB 3WTPA 3V9RA 3B0BA 1P3OD 3AFAA 5BS7C 5GT3D 3UTAC 4J8XB 3B6FC 4J8UC 3X1SA 5E5AA 1TZYC 1EQZD 3KUYA 3B6FB 2CWEA 1S32D 1KX5D 1HTAA 3AN2D 1P3LC 4JJNA 5CPJD 4J8UB 2FJ7D 1TZYB 5DNMD 3LZ1D 5GXQB 3LELB 4JJND 1F66A 4Z5TC 5B32G 5B2IA 1P3FD 3REIC 1F66D 3TU4A 4G92B 4QLCB 4Z5TD 2HIOD 1P3LB 1H3OA 3AYWB 4G91C 4WV4B 5CHLB 1HQ3A 5AVCA 4Z66C 3REKA 2F8NA 1M18A 1M18D 3NQUB 5FUGA 4X23A 4XUJB 3AZNA 3AZGA 4WU8C 3MGQC 5B31G 4Z66B 5B33C 3B0DC 5AY8D 5AV5A 5AVBC 4DRBA 3X1TB 4YM6A 4WU8D 3AZFC 3NQJB 4CSRB 3RELD 1M19A 4NE3A 3AZKA 2HUEC 3MGQB 3MGSC 5BNXA 3B0DB 3REHC 3KWQA 5AVBB 3MGPD 3AV1D 4EO5C 3WAAD 2RVQC 1BH9B 3REHD 1KX3D 5B40D 3A6ND 1AOID 3R45A 2HUEB 3MGSB 3AZEC 5B0YC 3W97D 3AZMA 5B24C 4EO5B 1KX4D 3W99A 4M6BA 3MGRA 3AZMD 5B32C 3W99D 4WU9C 3MNND 3W96B 4KUDC 3AZEB 2NZDA 1P3KB 5B1LC 5BO0B 5B0YB 5JRGD 5GSUA 1P3GC 5B24B 2F8NH 3MVDC 5B32B 2YFVB 5AV8C 4WU9B 3REJD 4UUZA 4KGCC 4KUDB 3AZJB 5B1MB 5B1LB 3X1VA 3AZID 4ZUXD 1P3GB 5B31C 2JSSA 3UT9C 3MVDB 5JA4B 1P3MC 2NQBC 5B2JC 1P3IC 4KGCB 5CPKA 4LD9C 4H9QA 1M1AA 3X1UC 5B31B 5GT0C 3UT9B 1P3ID 3B6GD 1TAFA 1U35A 3W98B 5DNND 2PYOA 2BYKB 2AROA 2NQBB 5B2JB 1JFIB 4H9SC 4LD9B 1P3PD 1P3AD 3X1UB 4E45A 5AV6C 3WKJA 3VH6W 5GT0B 3AV2C 4XZQB 5CP6C 4J8WC 5CPIA 3O62D 4WNNA 4HGAB 1ID3A 3AZHA 5CPID 4J8VC 2BYMB 4H9PB 5G49A 3AZLA 1ZLAC 5AV6B 4H9RB 3C1BC 4R8PC 3AV2B 5CP6B 4J8WB 4YS3A 3KXBC 3UTBA 3LZ0C 2CV5C 1P3OA 4J8VB 5GT3A 5KDMB 3LJAC 3C1CC 1ZLAB 4J8XD 3C1BB 4R8PB 4H9OA 2F8NG 5AV9B 3KXBB 3UTAA 5B0ZC 3LZ0B 3UTAD 2CV5B 5F99C 1F1EA 1EQZA 3WA9C 3LJAB 3C1CB 3LELC 5GXQC 3B6FD 1P34B 1S32A 4J8UD 1KX5A 3AN2A 4KHAA 4G92C 1TZYD 4E44A 4QLCC 5GXQD 3WTPC 5CPJA 2FJ7A 5B0ZB 5DNMA 5F99B 2YFWB 3LZ1A 3AFAC 3AYWC 3WA9B 1P3FA 1P3LD 4H9NB 3AYWD 4Z2MH 4Z5TA 2HIOA 4XUJC 3REIA 5E5AC 3X1SC 3WTPB 3V9RB 3AFAB 3REID 1WWSA 4XUJD 3KUYC 3X1TC 3VH6T 4Z66D 3X1SB 5E5AB 1P3BC 1N1JA 4CSRA 5AY8A 5B2IC 3KSYA 4WU8A 3KUYB 3TU4C 3RELA 5B33A 3MGQD 5B33D 1P3BB 5AVCC 1HQ3C 3REKC 3AZFA 1F66B 5AVBD 5B2IB 3AZFD 3WAAA 3VH5A 4X23C 3MGPA 3TU4B 3AV1A 1BH8A 5C3IC 4WZSB 3AZNC 3REHA 4CAYA 3MGSD 4DRAA 1H3OB 5B40A 3A6NA 3AZGC 1KX3A 1AOIA 5AVCB 1HQ3B 3REKB 2F8NB 1M18B 3W96C 5AV5C 2RVQD 3W97A 4YM6C 5FUGB 4X23B 1KX4A 1P3KC 5C3IB 3AZNB 1M19C 4AWLC 3AZKC 3AZGB 3W96D 1Q9CA 3MNNA 3AZED 5B0YD 5B24D 5AV5B 5JRGA 3KWQC 5B1MC 3AZJC 4YM6B 5B32D 4WU9D 5BT1C 1M19B 4AWLB 3AZKB 3B0CW 4KUDD 3REJA 3AZJD 5BNXB 5B1LD 5BT1D 1P3GD 1A7WA 5AV8A 3KWQB 3AZIA 4ZUXA 3MVDD 5AV8D 3MGRC 4KGCA 4KGCD 3R45B 3W98C 2NZDC 5B31D 4ZBJC 5GSUC 3WTPE 3AZMB 3UT9D 1P3MA 3W99B 3MGRB 1P3IA 3W98D 3B6GA 1P3MD 4LD9A 2NQBD 5B2JD 4XZQC 5DNNA 4LD9D 4HGAC 4NFTA 2NZDB 3X1UD 1P3PA 1P3AA 3X1VC 4ZBJB 5GSUB 5GT0D 3O62A 2IO5B 4UUZB 5CPKC 2L5AA 2LY8A 3VH5W 5AV6D 3X1VB 1M1AC 3AV2D 5CP6D 4J8WD 1U35C 5BNVA 2PYOC 2AROC 5AV9C 4NE5A 4J8VD 5CPKB 1ZLAD 4H9QB 1M1AB 3C1BD 4R8PD 3WKJC 4J8XA 1TAFB 3KXBD 1U35B 1P34C 1ID3C 3AZHC 3LZ0D 2CV5D 2PYOB 2AROB 5BS7A 3LJAD 3B0CT 3C1CD 1R4VA 3AZLC 3WKJB 3B6FA 4YS3C 5CPIB 1B6WA 4WNNB 4J8UA 3UTBC 3AZHB 1ID3B 5B0ZD 1TZYA 5F99D 3LELA 5GXQA 3WA9D 1P3OC 3LELD 5GT3C 5G49B 3AZLB 4QLCA 1KU5A 4YS3B 1P3LA 3AYWA 4QLCD 3WTPD 3UTBB 3AFAD 1P3OB 1EQZC 5GT3B 3NQUA 4XUJA 4H9OB 1S32C 1KX5C 3X1SD 5E5AD 3AN2C 3UTAB 5CPJC 4Z66A 2FJ7C 5DNMC 3LZ1C 4JJNC 1EQZB 3X1TA 3KUYD 1P3FC 3NQJA 1F66C 3VH5T 1P3BA 3X1TD 1S32B 1KX5B 1P3BD 3AN2B 4KHAB 2HIOC 3MGQA 5CPJB 2FJ7B 5B2ID 3LZ1B 5DNMB 4JJNB 5AVBA 1P3FB 3TU4D 1M18C 4NE6A 1BH9A 4Z5TB 2HIOB 3MGSA 5AVCD 1HQ3D 3REIB 3REKD 2F8ND 5AY8C 1ULYA 4X23D 3AZND 4G91B 3RELC 3AZGD 3W96A 3AZEA 1P3KA 1N1JB 5BO0A 5AV5D 5AY8B 5B0YA 4YM6D 3VH6A 5B24A 1P3KD 3WAAC 3MGPC 4WU8B 3AV1C 1M19D 5B32A 2YFVA 3RELB 4WU9A 3AZKD 5B33B 1KX3C 5B40C 3A6NC 1AOIC 4KUDA 3AZJA 5B1MA 3AZFB 5B1LA 3KWQD 5B1MD 4Z2MG 1P3GA 3W97C 3WAAB 3MGPB 3AV1B 1KX4C 1BH8B 3MVDA 3AZMC 3W99C 5JA4A 3REHB 4CAYB 1KX3B 5B40B 3MNNC 3A6NB 1AOIB 5B31A 5JRGC 3W97B 3MGRD 3UT9A 1KX4B 3W98A 2BYKA 2NQBA 5B2JA 3MNNB 3REJC 1JFIA 2NZDD 2IO5C 5GSUD 3X1UA 5JRGB 3AZIC 4ZUXC 5GT0A 4XZQA 4XZQD 3REJB 2BYMA 4H9SA 4H9PA 3X1VD 5AV8B 5AV6A 4H9RA 3AZIB 4ZUXB 3AV2A 5CP6A
chains in the Genus database with same CATH superfamily
4J8WA 3B6GC 5DNNC 5CPKD 4J8VA 2F2AC 5KDMA 1M1AD 3EPHA 1P3PC 1ZLAA 1P3AC 3C1BA 1P3MB 4R8PA 1U35D 5AV9A 1P3IB 3B6GB 3KXBA 2PYOD 3O62C 2AROD 5AV9D 5CPIC 5DNNB 3LZ0A 2CV5A 3LJAA 3C1CA 1P3PB 1P3AB 3WKJD 2F8NK 1P34A 1BFMA 1B67A 1P34D 1ID3D 3AZHD 1WWIA 3O62B 5B0ZA 5F99A 3WA9A 2YFWA 3AZLD 4J8XC 4YS3D 4H9NA 3UTBD 5BNVB 3WTPA 3V9RA 3B0BA 1P3OD 3AFAA 5BS7C 5GT3D 3UTAC 4J8XB 3B6FC 4J8UC 3X1SA 5E5AA 1TZYC 1EQZD 2ZY3A 3KUYA 3B6FB 2CWEA 1S32D 1KX5D 1HTAA 3AN2D 1P3LC 4JJNA 5CPJD 4J8UB 2FJ7D 1TZYB 5DNMD 3LZ1D 5GXQB 3LELB 4JJND 1F66A 4Z5TC 5B32G 5B2IA 2Y2HA 1P3FD 3REIC 1F66D 3TU4A 4G92B 4QLCB 4Z5TD 2HIOD 1P3LB 1H3OA 3AYWB 4G91C 4WV4B 5CHLB 1HQ3A 5AVCA 4Z66C 3REKA 2F8NA 1M18A 1M18D 3NQUB 5FUGA 4X23A 4XUJB 3AZNA 3AZGA 4WU8C 3MGQC 5B31G 4Z66B 3H0RC 5B33C 3B0DC 5AY8D 1PZRA 5AV5A 5AVBC 4DRBA 3X1TB 4YM6A 4WU8D 3AZFC 3NQJB 4CSRB 3RELD 1M19A 4NE3A 3AZKA 2HUEC 2VQRA 3MGQB 3MGSC 5BNXA 3B0DB 3REHC 3KWQA 5AVBB 3H0LC 3MGPD 4EO5C 3AV1D 3WAAD 2RVQC 1BH9B 2BG1A 3REHD 1KX3D 5B40D 3A6ND 1AOID 3R45A 2HUEB 3MGSB 3AZEC 4UPKA 3H0MC 5B0YC 3W97D 3AZMA 5B24C 4EO5B 1KX4D 3W99A 4M6BA 3MGRA 3AZMD 5B32C 3W99D 4WU9C 3MNND 3W96B 4KUDC 3AZEB 2NZDA 1P3KB 5B1LC 5BO0B 5B0YB 5JRGD 5GSUA 2Y2LA 5B24B 1P3GC 2F8NH 2Y2MA 3MVDC 5B32B 2YFVB 5AV8C 4WU9B 3REJD 4UUZA 4KGCC 4KUDB 3AZJB 5B1MB 5B1LB 3X1VA 3AZID 4ZUXD 1P3GB 5B31C 2JSSA 3EPJA 3UT9C 3MVDB 5JA4B 1P3MC 2NQBC 5B2JC 1P3IC 4KGCB 5CPKA 4LD9C 4H9QA 1M1AA 3X1UC 5B31B 5GT0C 3UT9B 1P3ID 3B6GD 1TAFA 1U35A 3W98B 5DNND 2PYOA 2BYKB 2AROA 2NQBB 5B2JB 1JFIB 4H9SC 4LD9B 1P3PD 1P3AD 3X1UB 4E45A 5AV6C 3WKJA 3VH6W 5GT0B 3AV2C 4XZQB 5CP6C 4J8WC 5CPIA 3O62D 4WNNA 4HGAB 1ID3A 3AZHA 5CPID 2Y2OA 4J8VC 2BYMB 4H9PB 5G49A 3AZLA 1ZLAC 5AV6B 4H9RB 3C1BC 4R8PC 3AV2B 5CP6B 4J8WB 4YS3A 3KXBC 3UTBA 3LZ0C 2CV5C 1P3OA 4J8VB 2Y2PA 5KDMB 5GT3A 3LJAC 3C1CC 1ZLAB 4J8XD 3C1BB 4R8PB 4H9OA 2F8NG 5AV9B 2G5IC 3KXBB 3UTAA 5B0ZC 3LZ0B 3UTAD 2CV5B 5F99C 1F1EA 3EPKA 1T3UA 1EQZA 3WA9C 3LJAB 3C1CB 3LELC 5GXQC 3B6FD 1P34B 2ZY4A 1S32A 4J8UD 1KX5A 3AN2A 4KHAA 4G92C 1TZYD 4E44A 4QLCC 5GXQD 3WTPC 5CPJA 2FJ7A 5B0ZB 5DNMA 5F99B 2YFWB 3LZ1A 3AFAC 3AYWC 3WA9B 1P3FA 2Y2IA 1P3LD 4H9NB 3AYWD 4Z2MH 4Z5TA 2HIOA 4XUJC 3REIA 5E5AC 3X1SC 3WTPB 2ZY2A 3V9RB 3AFAB 3REID 1WWSA 4XUJD 3EG5B 3KUYC 3X1TC 3VH6T 4Z66D 3X1SB 5E5AB 1P3BC 2Y2JA 3EPLA 1N1JA 4CSRA 5AY8A 5B2IC 3KSYA 4WU8A 3KUYB 3TU4C 3RELA 5B33A 3MGQD 5B33D 1P3BB 5AVCC 1HQ3C 3REKC 3AZFA 1F66B 5AVBD 5B2IB 3AZFD 3WAAA 2ZY5A 3VH5A 4X23C 3MGPA 3TU4B 3AV1A 1BH8A 5C3IC 4WZSB 3AZNC 3REHA 4CAYA 3MGSD 4DRAA 1H3OB 2JE5A 5B40A 3A6NA 3AZGC 1KX3A 1AOIA 5AVCB 1HQ3B 3REKB 2F8NB 1M18B 3W96C 2JCHA 5AV5C 2RVQD 3W97A 4YM6C 5FUGB 4X23B 1KX4A 1P3KC 5C3IB 3AZNB 1M19C 4AWLC 3AZKC 3AZGB 3W96D 1Q9CA 3MNNA 3AZED 3P5JB 5B0YD 5B24D 5AV5B 5JRGA 3KWQC 5B1MC 3AZJC 4YM6B 5B32D 4WU9D 5BT1C 3F6TA 1M19B 4AWLB 1Z2CB 3AZKB 3B0CW 4KUDD 3REJA 3AZJD 5BNXB 5B1LD 5BT1D 1P3GD 1A7WA 5AV8A 3KWQB 3AZIA 4ZUXA 3MVDD 2Y2QA 5AV8D 3MGRC 4KGCA 4KGCD 3R45B 4WJ3C 3W98C 2NZDC 5B31D 4ZBJC 5GSUC 3WTPE 3AZMB 3UT9D 1P3MA 3W99B 2Y2GA 2W8SA 3MGRB 1P3IA 3W98D 3B6GA 1P3MD 4LD9A 2NQBD 5B2JD 4XZQC 5DNNA 4LD9D 4HGAC 4NFTA 2NZDB 3X1UD 1P3PA 1P3AA 3X1VC 4ZBJB 5GSUB 5GT0D 3O62A 2IO5B 4UUZB 5CPKC 2L5AA 2LY8A 3VH5W 5AV6D 3X1VB 3FDDA 1M1AC 3AV2D 5CP6D 4J8WD 1U35C 5BNVA 2PYOC 3IP4C 2AROC 5AV9C 4NE5A 4J8VD 5CPKB 1ZLAD 4H9QB 1M1AB 1W2EA 2Y2KA 3C1BD 4R8PD 3WKJC 4J8XA 1TAFB 3KXBD 1U35B 1P34C 1ID3C 3AZHC 3LZ0D 2CV5D 2PYOB 2AROB 5BS7A 3LJAD 3B0CT 3C1CD 1R4VA 3AZLC 2RIQA 3WKJB 3B6FA 4YS3C 5CPIB 1B6WA 4WNNB 4J8UA 3UTBC 3AZHB 1ID3B 5B0ZD 1TZYA 5F99D 3LELA 5GXQA 3WA9D 3AL0C 1P3OC 3LELD 5GT3C 5G49B 3AZLB 4QLCA 1KU5A 4YS3B 1P3LA 3AYWA 4QLCD 3WTPD 3UTBB 3AFAD 2XD5A 1P3OB 1EQZC 5GT3B 3NQUA 4XUJA 4H9OB 1S32C 1KX5C 3X1SD 5E5AD 3AN2C 3UTAB 5CPJC 4Z66A 2FJ7C 2DQNC 5DNMC 3LZ1C 4JJNC 1EQZB 3X1TA 3KUYD 1P3FC 3NQJA 1F66C 3VH5T 1P3BA 3X1TD 1S32B 2UWXA 1P3BD 3AN2B 4KHAB 2HIOC 3MGQA 1KX5B 5CPJB 2FJ7B 3A1IA 5B2ID 3LZ1B 5DNMB 4JJNB 5AVBA 1P3FB 3TU4D 1M18C 4NE6A 1BH9A 4Z5TB 2HIOB 3MGSA 5AVCD 1HQ3D 3REIB 3REKD 2F8ND 5AY8C 4DQYB 1ULYA 4X23D 3AZND 4G91B 3RELC 2FFFB 3AZGD 3W96A 3AZEA 2ZM5A 1P3KA 1N1JB 5BO0A 5AV5D 5AY8B 5B0YA 4YM6D 3VH6A 5B24A 1P3KD 3WAAC 3MGPC 2J8PA 4WU8B 3AV1C 1M19D 2XD1A 5B32A 2YFVA 3RELB 4WU9A 3AZKD 5B33B 3KFUG 1KX3C 5B40C 3A6NC 1AOIC 4KUDA 3AZJA 5B1MA 3AZFB 5B1LA 3KWQD 5B1MD 4Z2MG 1P3GA 3W97C 3WAAB 3MGPB 3AV1B 1KX4C 1BH8B 3MVDA 3AZMC 3W99C 5JA4A 3REHB 4CAYB 1KX3B 5B40B 3MNNC 3A6NB 1AOIB 5B31A 5JRGC 3W97B 3MGRD 2Y2NA 3UT9A 1KX4B 3W98A 2BYKA 2NQBA 5B2JA 3MNNB 3REJC 1JFIA 2G5HC 2NZDD 2IO5C 5GSUD 3X1UA 5JRGB 3AZIC 4ZUXC 5GT0A 4XZQA 4XZQD 3REJB 3A1KA 2BYMA 4H9SA 4H9PA 3X1VD 5AV8B 5AV6A 4H9RA 2DF4C 3AZIB 4ZUXB 3AV2A 5CP6A
chains in the Genus database with same CATH topology
4J8WA 3B6GC 5DNNC 5CPKD 4J8VA 2F2AC 5KDMA 1M1AD 3EPHA 1P3PC 1ZLAA 1P3AC 3C1BA 1P3MB 4R8PA 1U35D 5AV9A 1P3IB 3B6GB 3KXBA 2PYOD 3O62C 2AROD 5AV9D 5CPIC 5DNNB 3LZ0A 2CV5A 3LJAA 3C1CA 1P3PB 1P3AB 3WKJD 2F8NK 1P34A 1BFMA 1B67A 1P34D 1ID3D 3AZHD 1WWIA 3O62B 5B0ZA 5F99A 3WA9A 2YFWA 3AZLD 4J8XC 4YS3D 4H9NA 3UTBD 5BNVB 3WTPA 3V9RA 3B0BA 1P3OD 3AFAA 5BS7C 5GT3D 3UTAC 4J8XB 3B6FC 4J8UC 3X1SA 5E5AA 1TZYC 1EQZD 2ZY3A 3KUYA 3B6FB 2CWEA 1S32D 1KX5D 1HTAA 3AN2D 1P3LC 4JJNA 5CPJD 4J8UB 2FJ7D 1TZYB 5DNMD 3LZ1D 5GXQB 3LELB 4JJND 1F66A 4Z5TC 5B32G 5B2IA 2Y2HA 1P3FD 3REIC 1F66D 3TU4A 4G92B 4QLCB 4Z5TD 2HIOD 1P3LB 1H3OA 3AYWB 4G91C 4WV4B 5CHLB 1HQ3A 5AVCA 4Z66C 3REKA 2F8NA 1M18A 1M18D 3NQUB 5FUGA 4X23A 4XUJB 3AZNA 3AZGA 4WU8C 3MGQC 5B31G 4Z66B 3H0RC 5B33C 3B0DC 5AY8D 1PZRA 5AV5A 5AVBC 4DRBA 3X1TB 4YM6A 4WU8D 3AZFC 3NQJB 4CSRB 3RELD 1M19A 4NE3A 3AZKA 2HUEC 2VQRA 3MGQB 3MGSC 5BNXA 3B0DB 3REHC 3KWQA 5AVBB 3H0LC 3MGPD 4EO5C 3AV1D 3WAAD 2RVQC 1BH9B 2BG1A 3REHD 1KX3D 5B40D 3A6ND 1AOID 3R45A 2HUEB 3MGSB 3AZEC 4UPKA 3H0MC 5B0YC 3W97D 3AZMA 5B24C 4EO5B 1KX4D 3W99A 4M6BA 3MGRA 3AZMD 5B32C 3W99D 4WU9C 3MNND 3W96B 4KUDC 3AZEB 2NZDA 1P3KB 5B1LC 5BO0B 5B0YB 5JRGD 5GSUA 2Y2LA 5B24B 1P3GC 2F8NH 2Y2MA 3MVDC 5B32B 2YFVB 5AV8C 4WU9B 3REJD 4UUZA 4KGCC 4KUDB 3AZJB 5B1MB 5B1LB 3X1VA 3AZID 4ZUXD 1P3GB 5B31C 2JSSA 3EPJA 3UT9C 3MVDB 5JA4B 1P3MC 2NQBC 5B2JC 1P3IC 4KGCB 5CPKA 4LD9C 4H9QA 1M1AA 3X1UC 5B31B 5GT0C 3UT9B 1P3ID 3B6GD 1TAFA 1U35A 3W98B 5DNND 2PYOA 2BYKB 2AROA 2NQBB 5B2JB 1JFIB 4H9SC 4LD9B 1P3PD 1P3AD 3X1UB 4E45A 5AV6C 3WKJA 3VH6W 5GT0B 3AV2C 4XZQB 5CP6C 4J8WC 5CPIA 3O62D 4WNNA 4HGAB 1ID3A 3AZHA 5CPID 2Y2OA 4J8VC 2BYMB 4H9PB 5G49A 3AZLA 1ZLAC 5AV6B 4H9RB 3C1BC 4R8PC 3AV2B 5CP6B 4J8WB 4YS3A 3KXBC 3UTBA 3LZ0C 2CV5C 1P3OA 4J8VB 2Y2PA 5KDMB 5GT3A 3LJAC 3C1CC 1ZLAB 4J8XD 3C1BB 4R8PB 4H9OA 2F8NG 5AV9B 2G5IC 3KXBB 3UTAA 5B0ZC 3LZ0B 3UTAD 2CV5B 5F99C 1F1EA 3EPKA 1T3UA 1EQZA 3WA9C 3LJAB 3C1CB 3LELC 5GXQC 3B6FD 1P34B 2ZY4A 1S32A 4J8UD 1KX5A 3AN2A 4KHAA 4G92C 1TZYD 4E44A 4QLCC 5GXQD 3WTPC 5CPJA 2FJ7A 5B0ZB 5DNMA 5F99B 2YFWB 3LZ1A 3AFAC 3AYWC 3WA9B 1P3FA 2Y2IA 1P3LD 4H9NB 3AYWD 4Z2MH 4Z5TA 2HIOA 4XUJC 3REIA 5E5AC 3X1SC 3WTPB 2ZY2A 3V9RB 3AFAB 3REID 1WWSA 4XUJD 3EG5B 3KUYC 3X1TC 3VH6T 4Z66D 3X1SB 5E5AB 1P3BC 2Y2JA 3EPLA 1N1JA 4CSRA 5AY8A 5B2IC 3KSYA 4WU8A 3KUYB 3TU4C 3RELA 5B33A 3MGQD 5B33D 1P3BB 5AVCC 1HQ3C 3REKC 3AZFA 1F66B 5AVBD 5B2IB 3AZFD 3WAAA 2ZY5A 3VH5A 4X23C 3MGPA 3TU4B 3AV1A 1BH8A 5C3IC 4WZSB 3AZNC 3REHA 4CAYA 3MGSD 4DRAA 1H3OB 2JE5A 5B40A 3A6NA 3AZGC 1KX3A 1AOIA 5AVCB 1HQ3B 3REKB 2F8NB 1M18B 3W96C 2JCHA 5AV5C 2RVQD 3W97A 4YM6C 5FUGB 4X23B 1KX4A 1P3KC 5C3IB 3AZNB 1M19C 4AWLC 3AZKC 3AZGB 3W96D 1Q9CA 3MNNA 3AZED 3P5JB 5B0YD 5B24D 5AV5B 5JRGA 3KWQC 5B1MC 3AZJC 4YM6B 5B32D 4WU9D 5BT1C 3F6TA 1M19B 4AWLB 1Z2CB 3AZKB 3B0CW 4KUDD 3REJA 3AZJD 5BNXB 5B1LD 5BT1D 1P3GD 1A7WA 5AV8A 3KWQB 3AZIA 4ZUXA 3MVDD 2Y2QA 5AV8D 3MGRC 4KGCA 4KGCD 3R45B 4WJ3C 3W98C 2NZDC 5B31D 4ZBJC 5GSUC 3WTPE 3AZMB 3UT9D 1P3MA 3W99B 2Y2GA 2W8SA 3MGRB 1P3IA 3W98D 3B6GA 1P3MD 4LD9A 2NQBD 5B2JD 4XZQC 5DNNA 4LD9D 4HGAC 4NFTA 2NZDB 3X1UD 1P3PA 1P3AA 3X1VC 4ZBJB 5GSUB 5GT0D 3O62A 2IO5B 4UUZB 5CPKC 2L5AA 2LY8A 3VH5W 5AV6D 3X1VB 3FDDA 1M1AC 3AV2D 5CP6D 4J8WD 1U35C 5BNVA 2PYOC 3IP4C 2AROC 5AV9C 4NE5A 4J8VD 5CPKB 1ZLAD 4H9QB 1M1AB 1W2EA 2Y2KA 3C1BD 4R8PD 3WKJC 4J8XA 1TAFB 3KXBD 1U35B 1P34C 1ID3C 3AZHC 3LZ0D 2CV5D 2PYOB 2AROB 5BS7A 3LJAD 3B0CT 3C1CD 1R4VA 3AZLC 2RIQA 3WKJB 3B6FA 4YS3C 5CPIB 1B6WA 4WNNB 4J8UA 3UTBC 3AZHB 1ID3B 5B0ZD 1TZYA 5F99D 3LELA 5GXQA 3WA9D 3AL0C 1P3OC 3LELD 5GT3C 5G49B 3AZLB 4QLCA 1KU5A 4YS3B 1P3LA 3AYWA 4QLCD 3WTPD 3UTBB 3AFAD 2XD5A 1P3OB 1EQZC 5GT3B 3NQUA 4XUJA 4H9OB 1S32C 1KX5C 3X1SD 5E5AD 3AN2C 3UTAB 5CPJC 4Z66A 2FJ7C 2DQNC 5DNMC 3LZ1C 4JJNC 1EQZB 3X1TA 3KUYD 1P3FC 3NQJA 1F66C 3VH5T 1P3BA 3X1TD 1S32B 2UWXA 1P3BD 3AN2B 4KHAB 2HIOC 3MGQA 1KX5B 5CPJB 2FJ7B 3A1IA 5B2ID 3LZ1B 5DNMB 4JJNB 5AVBA 1P3FB 3TU4D 1M18C 4NE6A 1BH9A 4Z5TB 2HIOB 3MGSA 5AVCD 1HQ3D 3REIB 3REKD 2F8ND 5AY8C 4DQYB 1ULYA 4X23D 3AZND 4G91B 3RELC 2FFFB 3AZGD 3W96A 3AZEA 2ZM5A 1P3KA 1N1JB 5BO0A 5AV5D 5AY8B 5B0YA 4YM6D 3VH6A 5B24A 1P3KD 3WAAC 3MGPC 2J8PA 4WU8B 3AV1C 1M19D 2XD1A 5B32A 2YFVA 3RELB 4WU9A 3AZKD 5B33B 3KFUG 1KX3C 5B40C 3A6NC 1AOIC 4KUDA 3AZJA 5B1MA 3AZFB 5B1LA 3KWQD 5B1MD 4Z2MG 1P3GA 3W97C 3WAAB 3MGPB 3AV1B 1KX4C 1BH8B 3MVDA 3AZMC 3W99C 5JA4A 3REHB 4CAYB 1KX3B 5B40B 3MNNC 3A6NB 1AOIB 5B31A 5JRGC 3W97B 3MGRD 2Y2NA 3UT9A 1KX4B 3W98A 2BYKA 2NQBA 5B2JA 3MNNB 3REJC 1JFIA 2G5HC 2NZDD 2IO5C 5GSUD 3X1UA 5JRGB 3AZIC 4ZUXC 5GT0A 4XZQA 4XZQD 3REJB 3A1KA 2BYMA 4H9SA 4H9PA 3X1VD 5AV8B 5AV6A 4H9RA 2DF4C 3AZIB 4ZUXB 3AV2A 5CP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8W A;  3B6G C;  5DNN C;  5CPK D;  4J8V A;  5KDM A;  1M1A D;  1P3P C;  1ZLA A;  1P3A C;  3C1B A;  1P3M B;  4R8P A;  1U35 D;  5AV9 A;  1P3I B;  3B6G B;  3KXB A;  2PYO D;  3O62 C;  2ARO D;  5AV9 D;  5CPI C;  5DNN B;  3LZ0 A;  2CV5 A;  3LJA A;  3C1C A;  1P3P B;  1P3A B;  3WKJ D;  2F8N K;  1P34 A;  1BFM A;  1B67 A;  1P34 D;  1ID3 D;  3AZH D;  1WWI A;  3O62 B;  5B0Z A;  5F99 A;  3WA9 A;  2YFW A;  3AZL D;  4J8X C;  4YS3 D;  4H9N A;  3UTB D;  5BNV B;  3WTP A;  3V9R A;  3B0B A;  1P3O D;  3AFA A;  5BS7 C;  5GT3 D;  3UTA C;  4J8X B;  3B6F C;  4J8U C;  3X1S A;  5E5A A;  1TZY C;  1EQZ D;  3KUY A;  3B6F B;  2CWE A;  1S32 D;  1KX5 D;  1HTA A;  3AN2 D;  1P3L C;  4JJN A;  5CPJ D;  4J8U B;  2FJ7 D;  1TZY B;  5DNM D;  3LZ1 D;  5GXQ B;  3LEL B;  4JJN D;  1F66 A;  4Z5T C;  5B32 G;  5B2I A;  1P3F D;  3REI C;  1F66 D;  3TU4 A;  4G92 B;  4QLC B;  4Z5T D;  2HIO D;  1P3L B;  1H3O A;  3AYW B;  4G91 C;  4WV4 B;  5CHL B;  1HQ3 A;  5AVC A;  4Z66 C;  3REK A;  2F8N A;  1M18 A;  1M18 D;  3NQU B;  5FUG A;  4X23 A;  4XUJ B;  3AZN A;  3AZG A;  4WU8 C;  3MGQ C;  5B31 G;  4Z66 B;  5B33 C;  3B0D C;  5AY8 D;  5AV5 A;  5AVB C;  4DRB A;  3X1T B;  4YM6 A;  4WU8 D;  3AZF C;  3NQJ B;  4CSR B;  3REL D;  1M19 A;  4NE3 A;  3AZK A;  2HUE C;  3MGQ B;  3MGS C;  5BNX A;  3B0D B;  3REH C;  3KWQ A;  5AVB B;  3MGP D;  3AV1 D;  4EO5 C;  3WAA D;  2RVQ C;  1BH9 B;  3REH D;  1KX3 D;  5B40 D;  3A6N D;  1AOI D;  3R45 A;  2HUE B;  3MGS B;  3AZE C;  5B0Y C;  3W97 D;  3AZM A;  5B24 C;  4EO5 B;  1KX4 D;  3W99 A;  4M6B A;  3MGR A;  3AZM D;  5B32 C;  3W99 D;  4WU9 C;  3MNN D;  3W96 B;  4KUD C;  3AZE B;  2NZD A;  1P3K B;  5B1L C;  5BO0 B;  5B0Y B;  5JRG D;  5GSU A;  1P3G C;  5B24 B;  2F8N H;  3MVD C;  5B32 B;  2YFV B;  5AV8 C;  4WU9 B;  3REJ D;  4UUZ A;  4KGC C;  4KUD B;  3AZJ B;  5B1M B;  5B1L B;  3X1V A;  3AZI D;  4ZUX D;  1P3G B;  5B31 C;  2JSS A;  3UT9 C;  3MVD B;  5JA4 B;  1P3M C;  2NQB C;  5B2J C;  1P3I C;  4KGC B;  5CPK A;  4LD9 C;  4H9Q A;  1M1A A;  3X1U C;  5B31 B;  5GT0 C;  3UT9 B;  1P3I D;  3B6G D;  1TAF A;  1U35 A;  3W98 B;  5DNN D;  2PYO A;  2BYK B;  2ARO A;  2NQB B;  5B2J B;  1JFI B;  4H9S C;  4LD9 B;  1P3P D;  1P3A D;  3X1U B;  4E45 A;  5AV6 C;  3WKJ A;  3VH6 W;  5GT0 B;  3AV2 C;  4XZQ B;  5CP6 C;  4J8W C;  5CPI A;  3O62 D;  4WNN A;  4HGA B;  1ID3 A;  3AZH A;  5CPI D;  4J8V C;  2BYM B;  4H9P B;  5G49 A;  3AZL A;  1ZLA C;  5AV6 B;  4H9R B;  3C1B C;  4R8P C;  3AV2 B;  5CP6 B;  4J8W B;  4YS3 A;  3KXB C;  3UTB A;  3LZ0 C;  2CV5 C;  1P3O A;  4J8V B;  5GT3 A;  5KDM B;  3LJA C;  3C1C C;  1ZLA B;  4J8X D;  3C1B B;  4R8P B;  4H9O A;  2F8N G;  5AV9 B;  3KXB B;  3UTA A;  5B0Z C;  3LZ0 B;  3UTA D;  2CV5 B;  5F99 C;  1F1E A;  1EQZ A;  3WA9 C;  3LJA B;  3C1C B;  3LEL C;  5GXQ C;  3B6F D;  1P34 B;  1S32 A;  4J8U D;  1KX5 A;  3AN2 A;  4KHA A;  4G92 C;  1TZY D;  4E44 A;  4QLC C;  5GXQ D;  3WTP C;  5CPJ A;  2FJ7 A;  5B0Z B;  5DNM A;  5F99 B;  2YFW B;  3LZ1 A;  3AFA C;  3AYW C;  3WA9 B;  1P3F A;  1P3L D;  4H9N B;  3AYW D;  4Z2M H;  4Z5T A;  2HIO A;  4XUJ C;  3REI A;  5E5A C;  3X1S C;  3WTP B;  3V9R B;  3AFA B;  3REI D;  1WWS A;  4XUJ D;  3KUY C;  3X1T C;  3VH6 T;  4Z66 D;  3X1S B;  5E5A B;  1P3B C;  1N1J A;  4CSR A;  5AY8 A;  5B2I C;  3KSY A;  4WU8 A;  3KUY B;  3TU4 C;  3REL A;  5B33 A;  3MGQ D;  5B33 D;  1P3B B;  5AVC C;  1HQ3 C;  3REK C;  3AZF A;  1F66 B;  5AVB D;  5B2I B;  3AZF D;  3WAA A;  3VH5 A;  4X23 C;  3MGP A;  3TU4 B;  3AV1 A;  1BH8 A;  5C3I C;  4WZS B;  3AZN C;  3REH A;  4CAY A;  3MGS D;  4DRA A;  1H3O B;  5B40 A;  3A6N A;  3AZG C;  1KX3 A;  1AOI A;  5AVC B;  1HQ3 B;  3REK B;  2F8N B;  1M18 B;  3W96 C;  5AV5 C;  2RVQ D;  3W97 A;  4YM6 C;  5FUG B;  4X23 B;  1KX4 A;  1P3K C;  5C3I B;  3AZN B;  1M19 C;  4AWL C;  3AZK C;  3AZG B;  3W96 D;  1Q9C A;  3MNN A;  3AZE D;  5B0Y D;  5B24 D;  5AV5 B;  5JRG A;  3KWQ C;  5B1M C;  3AZJ C;  4YM6 B;  5B32 D;  4WU9 D;  5BT1 C;  1M19 B;  4AWL B;  3AZK B;  3B0C W;  4KUD D;  3REJ A;  3AZJ D;  5BNX B;  5B1L D;  5BT1 D;  1P3G D;  1A7W A;  5AV8 A;  3KWQ B;  3AZI A;  4ZUX A;  3MVD D;  5AV8 D;  3MGR C;  4KGC A;  4KGC D;  3R45 B;  3W98 C;  2NZD C;  5B31 D;  4ZBJ C;  5GSU C;  3WTP E;  3AZM B;  3UT9 D;  1P3M A;  3W99 B;  3MGR B;  1P3I A;  3W98 D;  3B6G A;  1P3M D;  4LD9 A;  2NQB D;  5B2J D;  4XZQ C;  5DNN A;  4LD9 D;  4HGA C;  4NFT A;  2NZD B;  3X1U D;  1P3P A;  1P3A A;  3X1V C;  4ZBJ B;  5GSU B;  5GT0 D;  3O62 A;  2IO5 B;  4UUZ B;  5CPK C;  2L5A A;  2LY8 A;  3VH5 W;  5AV6 D;  3X1V B;  1M1A C;  3AV2 D;  5CP6 D;  4J8W D;  1U35 C;  5BNV A;  2PYO C;  2ARO C;  5AV9 C;  4NE5 A;  4J8V D;  5CPK B;  1ZLA D;  4H9Q B;  1M1A B;  3C1B D;  4R8P D;  3WKJ C;  4J8X A;  1TAF B;  3KXB D;  1U35 B;  1P34 C;  1ID3 C;  3AZH C;  3LZ0 D;  2CV5 D;  2PYO B;  2ARO B;  5BS7 A;  3LJA D;  3B0C T;  3C1C D;  1R4V A;  3AZL C;  3WKJ B;  3B6F A;  4YS3 C;  5CPI B;  1B6W A;  4WNN B;  4J8U A;  3UTB C;  3AZH B;  1ID3 B;  5B0Z D;  1TZY A;  5F99 D;  3LEL A;  5GXQ A;  3WA9 D;  1P3O C;  3LEL D;  5GT3 C;  5G49 B;  3AZL B;  4QLC A;  1KU5 A;  4YS3 B;  1P3L A;  3AYW A;  4QLC D;  3WTP D;  3UTB B;  3AFA D;  1P3O B;  1EQZ C;  5GT3 B;  3NQU A;  4XUJ A;  4H9O B;  1S32 C;  1KX5 C;  3X1S D;  5E5A D;  3AN2 C;  3UTA B;  5CPJ C;  4Z66 A;  2FJ7 C;  5DNM C;  3LZ1 C;  4JJN C;  1EQZ B;  3X1T A;  3KUY D;  1P3F C;  3NQJ A;  1F66 C;  3VH5 T;  1P3B A;  3X1T D;  1S32 B;  1KX5 B;  1P3B D;  3AN2 B;  4KHA B;  2HIO C;  3MGQ A;  5CPJ B;  2FJ7 B;  5B2I D;  3LZ1 B;  5DNM B;  4JJN B;  5AVB A;  1P3F B;  3TU4 D;  1M18 C;  4NE6 A;  1BH9 A;  4Z5T B;  2HIO B;  3MGS A;  5AVC D;  1HQ3 D;  3REI B;  3REK D;  2F8N D;  5AY8 C;  1ULY A;  4X23 D;  3AZN D;  4G91 B;  3REL C;  3AZG D;  3W96 A;  3AZE A;  1P3K A;  1N1J B;  5BO0 A;  5AV5 D;  5AY8 B;  5B0Y A;  4YM6 D;  3VH6 A;  5B24 A;  1P3K D;  3WAA C;  3MGP C;  4WU8 B;  3AV1 C;  1M19 D;  5B32 A;  2YFV A;  3REL B;  4WU9 A;  3AZK D;  5B33 B;  1KX3 C;  5B40 C;  3A6N C;  1AOI C;  4KUD A;  3AZJ A;  5B1M A;  3AZF B;  5B1L A;  3KWQ D;  5B1M D;  4Z2M G;  1P3G A;  3W97 C;  3WAA B;  3MGP B;  3AV1 B;  1KX4 C;  1BH8 B;  3MVD A;  3AZM C;  3W99 C;  5JA4 A;  3REH B;  4CAY B;  1KX3 B;  5B40 B;  3MNN C;  3A6N B;  1AOI B;  5B31 A;  5JRG C;  3W97 B;  3MGR D;  3UT9 A;  1KX4 B;  3W98 A;  2BYK A;  2NQB A;  5B2J A;  3MNN B;  3REJ C;  1JFI A;  2NZD D;  2IO5 C;  5GSU D;  3X1U A;  5JRG B;  3AZI C;  4ZUX C;  5GT0 A;  4XZQ A;  4XZQ D;  3REJ B;  2BYM A;  4H9S A;  4H9P A;  3X1V D;  5AV8 B;  5AV6 A;  4H9R A;  3AZI B;  4ZUX B;  3AV2 A;  5CP6 A; 
#chains in the Genus database with same CATH topology
 4J8W A;  3B6G C;  5DNN C;  5CPK D;  4J8V A;  2F2A C;  5KDM A;  1M1A D;  3EPH A;  1P3P C;  1ZLA A;  1P3A C;  3C1B A;  1P3M B;  4R8P A;  1U35 D;  5AV9 A;  1P3I B;  3B6G B;  3KXB A;  2PYO D;  3O62 C;  2ARO D;  5AV9 D;  5CPI C;  5DNN B;  3LZ0 A;  2CV5 A;  3LJA A;  3C1C A;  1P3P B;  1P3A B;  3WKJ D;  2F8N K;  1P34 A;  1BFM A;  1B67 A;  1P34 D;  1ID3 D;  3AZH D;  1WWI A;  3O62 B;  5B0Z A;  5F99 A;  3WA9 A;  2YFW A;  3AZL D;  4J8X C;  4YS3 D;  4H9N A;  3UTB D;  5BNV B;  3WTP A;  3V9R A;  3B0B A;  1P3O D;  3AFA A;  5BS7 C;  5GT3 D;  3UTA C;  4J8X B;  3B6F C;  4J8U C;  3X1S A;  5E5A A;  1TZY C;  1EQZ D;  2ZY3 A;  3KUY A;  3B6F B;  2CWE A;  1S32 D;  1KX5 D;  1HTA A;  3AN2 D;  1P3L C;  4JJN A;  5CPJ D;  4J8U B;  2FJ7 D;  1TZY B;  5DNM D;  3LZ1 D;  5GXQ B;  3LEL B;  4JJN D;  1F66 A;  4Z5T C;  5B32 G;  5B2I A;  2Y2H A;  1P3F D;  3REI C;  1F66 D;  3TU4 A;  4G92 B;  4QLC B;  4Z5T D;  2HIO D;  1P3L B;  1H3O A;  3AYW B;  4G91 C;  4WV4 B;  5CHL B;  1HQ3 A;  5AVC A;  4Z66 C;  3REK A;  2F8N A;  1M18 A;  1M18 D;  3NQU B;  5FUG A;  4X23 A;  4XUJ B;  3AZN A;  3AZG A;  4WU8 C;  3MGQ C;  5B31 G;  4Z66 B;  3H0R C;  5B33 C;  3B0D C;  5AY8 D;  1PZR A;  5AV5 A;  5AVB C;  4DRB A;  3X1T B;  4YM6 A;  4WU8 D;  3AZF C;  3NQJ B;  4CSR B;  3REL D;  1M19 A;  4NE3 A;  3AZK A;  2HUE C;  2VQR A;  3MGQ B;  3MGS C;  5BNX A;  3B0D B;  3REH C;  3KWQ A;  5AVB B;  3H0L C;  3MGP D;  4EO5 C;  3AV1 D;  3WAA D;  2RVQ C;  1BH9 B;  2BG1 A;  3REH D;  1KX3 D;  5B40 D;  3A6N D;  1AOI D;  3R45 A;  2HUE B;  3MGS B;  3AZE C;  4UPK A;  3H0M C;  5B0Y C;  3W97 D;  3AZM A;  5B24 C;  4EO5 B;  1KX4 D;  3W99 A;  4M6B A;  3MGR A;  3AZM D;  5B32 C;  3W99 D;  4WU9 C;  3MNN D;  3W96 B;  4KUD C;  3AZE B;  2NZD A;  1P3K B;  5B1L C;  5BO0 B;  5B0Y B;  5JRG D;  5GSU A;  2Y2L A;  5B24 B;  1P3G C;  2F8N H;  2Y2M A;  3MVD C;  5B32 B;  2YFV B;  5AV8 C;  4WU9 B;  3REJ D;  4UUZ A;  4KGC C;  4KUD B;  3AZJ B;  5B1M B;  5B1L B;  3X1V A;  3AZI D;  4ZUX D;  1P3G B;  5B31 C;  2JSS A;  3EPJ A;  3UT9 C;  3MVD B;  5JA4 B;  1P3M C;  2NQB C;  5B2J C;  1P3I C;  4KGC B;  5CPK A;  4LD9 C;  4H9Q A;  1M1A A;  3X1U C;  5B31 B;  5GT0 C;  3UT9 B;  1P3I D;  3B6G D;  1TAF A;  1U35 A;  3W98 B;  5DNN D;  2PYO A;  2BYK B;  2ARO A;  2NQB B;  5B2J B;  1JFI B;  4H9S C;  4LD9 B;  1P3P D;  1P3A D;  3X1U B;  4E45 A;  5AV6 C;  3WKJ A;  3VH6 W;  5GT0 B;  3AV2 C;  4XZQ B;  5CP6 C;  4J8W C;  5CPI A;  3O62 D;  4WNN A;  4HGA B;  1ID3 A;  3AZH A;  5CPI D;  2Y2O A;  4J8V C;  2BYM B;  4H9P B;  5G49 A;  3AZL A;  1ZLA C;  5AV6 B;  4H9R B;  3C1B C;  4R8P C;  3AV2 B;  5CP6 B;  4J8W B;  4YS3 A;  3KXB C;  3UTB A;  3LZ0 C;  2CV5 C;  1P3O A;  4J8V B;  2Y2P A;  5KDM B;  5GT3 A;  3LJA C;  3C1C C;  1ZLA B;  4J8X D;  3C1B B;  4R8P B;  4H9O A;  2F8N G;  5AV9 B;  2G5I C;  3KXB B;  3UTA A;  5B0Z C;  3LZ0 B;  3UTA D;  2CV5 B;  5F99 C;  1F1E A;  3EPK A;  1T3U A;  1EQZ A;  3WA9 C;  3LJA B;  3C1C B;  3LEL C;  5GXQ C;  3B6F D;  1P34 B;  2ZY4 A;  1S32 A;  4J8U D;  1KX5 A;  3AN2 A;  4KHA A;  4G92 C;  1TZY D;  4E44 A;  4QLC C;  5GXQ D;  3WTP C;  5CPJ A;  2FJ7 A;  5B0Z B;  5DNM A;  5F99 B;  2YFW B;  3LZ1 A;  3AFA C;  3AYW C;  3WA9 B;  1P3F A;  2Y2I A;  1P3L D;  4H9N B;  3AYW D;  4Z2M H;  4Z5T A;  2HIO A;  4XUJ C;  3REI A;  5E5A C;  3X1S C;  3WTP B;  2ZY2 A;  3V9R B;  3AFA B;  3REI D;  1WWS A;  4XUJ D;  3EG5 B;  3KUY C;  3X1T C;  3VH6 T;  4Z66 D;  3X1S B;  5E5A B;  1P3B C;  2Y2J A;  3EPL A;  1N1J A;  4CSR A;  5AY8 A;  5B2I C;  3KSY A;  4WU8 A;  3KUY B;  3TU4 C;  3REL A;  5B33 A;  3MGQ D;  5B33 D;  1P3B B;  5AVC C;  1HQ3 C;  3REK C;  3AZF A;  1F66 B;  5AVB D;  5B2I B;  3AZF D;  3WAA A;  2ZY5 A;  3VH5 A;  4X23 C;  3MGP A;  3TU4 B;  3AV1 A;  1BH8 A;  5C3I C;  4WZS B;  3AZN C;  3REH A;  4CAY A;  3MGS D;  4DRA A;  1H3O B;  2JE5 A;  5B40 A;  3A6N A;  3AZG C;  1KX3 A;  1AOI A;  5AVC B;  1HQ3 B;  3REK B;  2F8N B;  1M18 B;  3W96 C;  2JCH A;  5AV5 C;  2RVQ D;  3W97 A;  4YM6 C;  5FUG B;  4X23 B;  1KX4 A;  1P3K C;  5C3I B;  3AZN B;  1M19 C;  4AWL C;  3AZK C;  3AZG B;  3W96 D;  1Q9C A;  3MNN A;  3AZE D;  3P5J B;  5B0Y D;  5B24 D;  5AV5 B;  5JRG A;  3KWQ C;  5B1M C;  3AZJ C;  4YM6 B;  5B32 D;  4WU9 D;  5BT1 C;  3F6T A;  1M19 B;  4AWL B;  1Z2C B;  3AZK B;  3B0C W;  4KUD D;  3REJ A;  3AZJ D;  5BNX B;  5B1L D;  5BT1 D;  1P3G D;  1A7W A;  5AV8 A;  3KWQ B;  3AZI A;  4ZUX A;  3MVD D;  2Y2Q A;  5AV8 D;  3MGR C;  4KGC A;  4KGC D;  3R45 B;  4WJ3 C;  3W98 C;  2NZD C;  5B31 D;  4ZBJ C;  5GSU C;  3WTP E;  3AZM B;  3UT9 D;  1P3M A;  3W99 B;  2Y2G A;  2W8S A;  3MGR B;  1P3I A;  3W98 D;  3B6G A;  1P3M D;  4LD9 A;  2NQB D;  5B2J D;  4XZQ C;  5DNN A;  4LD9 D;  4HGA C;  4NFT A;  2NZD B;  3X1U D;  1P3P A;  1P3A A;  3X1V C;  4ZBJ B;  5GSU B;  5GT0 D;  3O62 A;  2IO5 B;  4UUZ B;  5CPK C;  2L5A A;  2LY8 A;  3VH5 W;  5AV6 D;  3X1V B;  3FDD A;  1M1A C;  3AV2 D;  5CP6 D;  4J8W D;  1U35 C;  5BNV A;  2PYO C;  3IP4 C;  2ARO C;  5AV9 C;  4NE5 A;  4J8V D;  5CPK B;  1ZLA D;  4H9Q B;  1M1A B;  1W2E A;  2Y2K A;  3C1B D;  4R8P D;  3WKJ C;  4J8X A;  1TAF B;  3KXB D;  1U35 B;  1P34 C;  1ID3 C;  3AZH C;  3LZ0 D;  2CV5 D;  2PYO B;  2ARO B;  5BS7 A;  3LJA D;  3B0C T;  3C1C D;  1R4V A;  3AZL C;  2RIQ A;  3WKJ B;  3B6F A;  4YS3 C;  5CPI B;  1B6W A;  4WNN B;  4J8U A;  3UTB C;  3AZH B;  1ID3 B;  5B0Z D;  1TZY A;  5F99 D;  3LEL A;  5GXQ A;  3WA9 D;  3AL0 C;  1P3O C;  3LEL D;  5GT3 C;  5G49 B;  3AZL B;  4QLC A;  1KU5 A;  4YS3 B;  1P3L A;  3AYW A;  4QLC D;  3WTP D;  3UTB B;  3AFA D;  2XD5 A;  1P3O B;  1EQZ C;  5GT3 B;  3NQU A;  4XUJ A;  4H9O B;  1S32 C;  1KX5 C;  3X1S D;  5E5A D;  3AN2 C;  3UTA B;  5CPJ C;  4Z66 A;  2FJ7 C;  2DQN C;  5DNM C;  3LZ1 C;  4JJN C;  1EQZ B;  3X1T A;  3KUY D;  1P3F C;  3NQJ A;  1F66 C;  3VH5 T;  1P3B A;  3X1T D;  1S32 B;  2UWX A;  1P3B D;  3AN2 B;  4KHA B;  2HIO C;  3MGQ A;  1KX5 B;  5CPJ B;  2FJ7 B;  3A1I A;  5B2I D;  3LZ1 B;  5DNM B;  4JJN B;  5AVB A;  1P3F B;  3TU4 D;  1M18 C;  4NE6 A;  1BH9 A;  4Z5T B;  2HIO B;  3MGS A;  5AVC D;  1HQ3 D;  3REI B;  3REK D;  2F8N D;  5AY8 C;  4DQY B;  1ULY A;  4X23 D;  3AZN D;  4G91 B;  3REL C;  2FFF B;  3AZG D;  3W96 A;  3AZE A;  2ZM5 A;  1P3K A;  1N1J B;  5BO0 A;  5AV5 D;  5AY8 B;  5B0Y A;  4YM6 D;  3VH6 A;  5B24 A;  1P3K D;  3WAA C;  3MGP C;  2J8P A;  4WU8 B;  3AV1 C;  1M19 D;  2XD1 A;  5B32 A;  2YFV A;  3REL B;  4WU9 A;  3AZK D;  5B33 B;  3KFU G;  1KX3 C;  5B40 C;  3A6N C;  1AOI C;  4KUD A;  3AZJ A;  5B1M A;  3AZF B;  5B1L A;  3KWQ D;  5B1M D;  4Z2M G;  1P3G A;  3W97 C;  3WAA B;  3MGP B;  3AV1 B;  1KX4 C;  1BH8 B;  3MVD A;  3AZM C;  3W99 C;  5JA4 A;  3REH B;  4CAY B;  1KX3 B;  5B40 B;  3MNN C;  3A6N B;  1AOI B;  5B31 A;  5JRG C;  3W97 B;  3MGR D;  2Y2N A;  3UT9 A;  1KX4 B;  3W98 A;  2BYK A;  2NQB A;  5B2J A;  3MNN B;  3REJ C;  1JFI A;  2G5H C;  2NZD D;  2IO5 C;  5GSU D;  3X1U A;  5JRG B;  3AZI C;  4ZUX C;  5GT0 A;  4XZQ A;  4XZQ D;  3REJ B;  3A1K A;  2BYM A;  4H9S A;  4H9P A;  3X1V D;  5AV8 B;  5AV6 A;  4H9R A;  2DF4 C;  3AZI B;  4ZUX B;  3AV2 A;  5CP6 A; 
#chains in the Genus database with same CATH homology
 4J8W A;  3B6G C;  5DNN C;  5CPK D;  4J8V A;  2F2A C;  5KDM A;  1M1A D;  3EPH A;  1P3P C;  1ZLA A;  1P3A C;  3C1B A;  1P3M B;  4R8P A;  1U35 D;  5AV9 A;  1P3I B;  3B6G B;  3KXB A;  2PYO D;  3O62 C;  2ARO D;  5AV9 D;  5CPI C;  5DNN B;  3LZ0 A;  2CV5 A;  3LJA A;  3C1C A;  1P3P B;  1P3A B;  3WKJ D;  2F8N K;  1P34 A;  1BFM A;  1B67 A;  1P34 D;  1ID3 D;  3AZH D;  1WWI A;  3O62 B;  5B0Z A;  5F99 A;  3WA9 A;  2YFW A;  3AZL D;  4J8X C;  4YS3 D;  4H9N A;  3UTB D;  5BNV B;  3WTP A;  3V9R A;  3B0B A;  1P3O D;  3AFA A;  5BS7 C;  5GT3 D;  3UTA C;  4J8X B;  3B6F C;  4J8U C;  3X1S A;  5E5A A;  1TZY C;  1EQZ D;  2ZY3 A;  3KUY A;  3B6F B;  2CWE A;  1S32 D;  1KX5 D;  1HTA A;  3AN2 D;  1P3L C;  4JJN A;  5CPJ D;  4J8U B;  2FJ7 D;  1TZY B;  5DNM D;  3LZ1 D;  5GXQ B;  3LEL B;  4JJN D;  1F66 A;  4Z5T C;  5B32 G;  5B2I A;  2Y2H A;  1P3F D;  3REI C;  1F66 D;  3TU4 A;  4G92 B;  4QLC B;  4Z5T D;  2HIO D;  1P3L B;  1H3O A;  3AYW B;  4G91 C;  4WV4 B;  5CHL B;  1HQ3 A;  5AVC A;  4Z66 C;  3REK A;  2F8N A;  1M18 A;  1M18 D;  3NQU B;  5FUG A;  4X23 A;  4XUJ B;  3AZN A;  3AZG A;  4WU8 C;  3MGQ C;  5B31 G;  4Z66 B;  3H0R C;  5B33 C;  3B0D C;  5AY8 D;  1PZR A;  5AV5 A;  5AVB C;  4DRB A;  3X1T B;  4YM6 A;  4WU8 D;  3AZF C;  3NQJ B;  4CSR B;  3REL D;  1M19 A;  4NE3 A;  3AZK A;  2HUE C;  2VQR A;  3MGQ B;  3MGS C;  5BNX A;  3B0D B;  3REH C;  3KWQ A;  5AVB B;  3H0L C;  3MGP D;  4EO5 C;  3AV1 D;  3WAA D;  2RVQ C;  1BH9 B;  2BG1 A;  3REH D;  1KX3 D;  5B40 D;  3A6N D;  1AOI D;  3R45 A;  2HUE B;  3MGS B;  3AZE C;  4UPK A;  3H0M C;  5B0Y C;  3W97 D;  3AZM A;  5B24 C;  4EO5 B;  1KX4 D;  3W99 A;  4M6B A;  3MGR A;  3AZM D;  5B32 C;  3W99 D;  4WU9 C;  3MNN D;  3W96 B;  4KUD C;  3AZE B;  2NZD A;  1P3K B;  5B1L C;  5BO0 B;  5B0Y B;  5JRG D;  5GSU A;  2Y2L A;  5B24 B;  1P3G C;  2F8N H;  2Y2M A;  3MVD C;  5B32 B;  2YFV B;  5AV8 C;  4WU9 B;  3REJ D;  4UUZ A;  4KGC C;  4KUD B;  3AZJ B;  5B1M B;  5B1L B;  3X1V A;  3AZI D;  4ZUX D;  1P3G B;  5B31 C;  2JSS A;  3EPJ A;  3UT9 C;  3MVD B;  5JA4 B;  1P3M C;  2NQB C;  5B2J C;  1P3I C;  4KGC B;  5CPK A;  4LD9 C;  4H9Q A;  1M1A A;  3X1U C;  5B31 B;  5GT0 C;  3UT9 B;  1P3I D;  3B6G D;  1TAF A;  1U35 A;  3W98 B;  5DNN D;  2PYO A;  2BYK B;  2ARO A;  2NQB B;  5B2J B;  1JFI B;  4H9S C;  4LD9 B;  1P3P D;  1P3A D;  3X1U B;  4E45 A;  5AV6 C;  3WKJ A;  3VH6 W;  5GT0 B;  3AV2 C;  4XZQ B;  5CP6 C;  4J8W C;  5CPI A;  3O62 D;  4WNN A;  4HGA B;  1ID3 A;  3AZH A;  5CPI D;  2Y2O A;  4J8V C;  2BYM B;  4H9P B;  5G49 A;  3AZL A;  1ZLA C;  5AV6 B;  4H9R B;  3C1B C;  4R8P C;  3AV2 B;  5CP6 B;  4J8W B;  4YS3 A;  3KXB C;  3UTB A;  3LZ0 C;  2CV5 C;  1P3O A;  4J8V B;  2Y2P A;  5KDM B;  5GT3 A;  3LJA C;  3C1C C;  1ZLA B;  4J8X D;  3C1B B;  4R8P B;  4H9O A;  2F8N G;  5AV9 B;  2G5I C;  3KXB B;  3UTA A;  5B0Z C;  3LZ0 B;  3UTA D;  2CV5 B;  5F99 C;  1F1E A;  3EPK A;  1T3U A;  1EQZ A;  3WA9 C;  3LJA B;  3C1C B;  3LEL C;  5GXQ C;  3B6F D;  1P34 B;  2ZY4 A;  1S32 A;  4J8U D;  1KX5 A;  3AN2 A;  4KHA A;  4G92 C;  1TZY D;  4E44 A;  4QLC C;  5GXQ D;  3WTP C;  5CPJ A;  2FJ7 A;  5B0Z B;  5DNM A;  5F99 B;  2YFW B;  3LZ1 A;  3AFA C;  3AYW C;  3WA9 B;  1P3F A;  2Y2I A;  1P3L D;  4H9N B;  3AYW D;  4Z2M H;  4Z5T A;  2HIO A;  4XUJ C;  3REI A;  5E5A C;  3X1S C;  3WTP B;  2ZY2 A;  3V9R B;  3AFA B;  3REI D;  1WWS A;  4XUJ D;  3EG5 B;  3KUY C;  3X1T C;  3VH6 T;  4Z66 D;  3X1S B;  5E5A B;  1P3B C;  2Y2J A;  3EPL A;  1N1J A;  4CSR A;  5AY8 A;  5B2I C;  3KSY A;  4WU8 A;  3KUY B;  3TU4 C;  3REL A;  5B33 A;  3MGQ D;  5B33 D;  1P3B B;  5AVC C;  1HQ3 C;  3REK C;  3AZF A;  1F66 B;  5AVB D;  5B2I B;  3AZF D;  3WAA A;  2ZY5 A;  3VH5 A;  4X23 C;  3MGP A;  3TU4 B;  3AV1 A;  1BH8 A;  5C3I C;  4WZS B;  3AZN C;  3REH A;  4CAY A;  3MGS D;  4DRA A;  1H3O B;  2JE5 A;  5B40 A;  3A6N A;  3AZG C;  1KX3 A;  1AOI A;  5AVC B;  1HQ3 B;  3REK B;  2F8N B;  1M18 B;  3W96 C;  2JCH A;  5AV5 C;  2RVQ D;  3W97 A;  4YM6 C;  5FUG B;  4X23 B;  1KX4 A;  1P3K C;  5C3I B;  3AZN B;  1M19 C;  4AWL C;  3AZK C;  3AZG B;  3W96 D;  1Q9C A;  3MNN A;  3AZE D;  3P5J B;  5B0Y D;  5B24 D;  5AV5 B;  5JRG A;  3KWQ C;  5B1M C;  3AZJ C;  4YM6 B;  5B32 D;  4WU9 D;  5BT1 C;  3F6T A;  1M19 B;  4AWL B;  1Z2C B;  3AZK B;  3B0C W;  4KUD D;  3REJ A;  3AZJ D;  5BNX B;  5B1L D;  5BT1 D;  1P3G D;  1A7W A;  5AV8 A;  3KWQ B;  3AZI A;  4ZUX A;  3MVD D;  2Y2Q A;  5AV8 D;  3MGR C;  4KGC A;  4KGC D;  3R45 B;  4WJ3 C;  3W98 C;  2NZD C;  5B31 D;  4ZBJ C;  5GSU C;  3WTP E;  3AZM B;  3UT9 D;  1P3M A;  3W99 B;  2Y2G A;  2W8S A;  3MGR B;  1P3I A;  3W98 D;  3B6G A;  1P3M D;  4LD9 A;  2NQB D;  5B2J D;  4XZQ C;  5DNN A;  4LD9 D;  4HGA C;  4NFT A;  2NZD B;  3X1U D;  1P3P A;  1P3A A;  3X1V C;  4ZBJ B;  5GSU B;  5GT0 D;  3O62 A;  2IO5 B;  4UUZ B;  5CPK C;  2L5A A;  2LY8 A;  3VH5 W;  5AV6 D;  3X1V B;  3FDD A;  1M1A C;  3AV2 D;  5CP6 D;  4J8W D;  1U35 C;  5BNV A;  2PYO C;  3IP4 C;  2ARO C;  5AV9 C;  4NE5 A;  4J8V D;  5CPK B;  1ZLA D;  4H9Q B;  1M1A B;  1W2E A;  2Y2K A;  3C1B D;  4R8P D;  3WKJ C;  4J8X A;  1TAF B;  3KXB D;  1U35 B;  1P34 C;  1ID3 C;  3AZH C;  3LZ0 D;  2CV5 D;  2PYO B;  2ARO B;  5BS7 A;  3LJA D;  3B0C T;  3C1C D;  1R4V A;  3AZL C;  2RIQ A;  3WKJ B;  3B6F A;  4YS3 C;  5CPI B;  1B6W A;  4WNN B;  4J8U A;  3UTB C;  3AZH B;  1ID3 B;  5B0Z D;  1TZY A;  5F99 D;  3LEL A;  5GXQ A;  3WA9 D;  3AL0 C;  1P3O C;  3LEL D;  5GT3 C;  5G49 B;  3AZL B;  4QLC A;  1KU5 A;  4YS3 B;  1P3L A;  3AYW A;  4QLC D;  3WTP D;  3UTB B;  3AFA D;  2XD5 A;  1P3O B;  1EQZ C;  5GT3 B;  3NQU A;  4XUJ A;  4H9O B;  1S32 C;  1KX5 C;  3X1S D;  5E5A D;  3AN2 C;  3UTA B;  5CPJ C;  4Z66 A;  2FJ7 C;  2DQN C;  5DNM C;  3LZ1 C;  4JJN C;  1EQZ B;  3X1T A;  3KUY D;  1P3F C;  3NQJ A;  1F66 C;  3VH5 T;  1P3B A;  3X1T D;  1S32 B;  2UWX A;  1P3B D;  3AN2 B;  4KHA B;  2HIO C;  3MGQ A;  1KX5 B;  5CPJ B;  2FJ7 B;  3A1I A;  5B2I D;  3LZ1 B;  5DNM B;  4JJN B;  5AVB A;  1P3F B;  3TU4 D;  1M18 C;  4NE6 A;  1BH9 A;  4Z5T B;  2HIO B;  3MGS A;  5AVC D;  1HQ3 D;  3REI B;  3REK D;  2F8N D;  5AY8 C;  4DQY B;  1ULY A;  4X23 D;  3AZN D;  4G91 B;  3REL C;  2FFF B;  3AZG D;  3W96 A;  3AZE A;  2ZM5 A;  1P3K A;  1N1J B;  5BO0 A;  5AV5 D;  5AY8 B;  5B0Y A;  4YM6 D;  3VH6 A;  5B24 A;  1P3K D;  3WAA C;  3MGP C;  2J8P A;  4WU8 B;  3AV1 C;  1M19 D;  2XD1 A;  5B32 A;  2YFV A;  3REL B;  4WU9 A;  3AZK D;  5B33 B;  3KFU G;  1KX3 C;  5B40 C;  3A6N C;  1AOI C;  4KUD A;  3AZJ A;  5B1M A;  3AZF B;  5B1L A;  3KWQ D;  5B1M D;  4Z2M G;  1P3G A;  3W97 C;  3WAA B;  3MGP B;  3AV1 B;  1KX4 C;  1BH8 B;  3MVD A;  3AZM C;  3W99 C;  5JA4 A;  3REH B;  4CAY B;  1KX3 B;  5B40 B;  3MNN C;  3A6N B;  1AOI B;  5B31 A;  5JRG C;  3W97 B;  3MGR D;  2Y2N A;  3UT9 A;  1KX4 B;  3W98 A;  2BYK A;  2NQB A;  5B2J A;  3MNN B;  3REJ C;  1JFI A;  2G5H C;  2NZD D;  2IO5 C;  5GSU D;  3X1U A;  5JRG B;  3AZI C;  4ZUX C;  5GT0 A;  4XZQ A;  4XZQ D;  3REJ B;  3A1K A;  2BYM A;  4H9S A;  4H9P A;  3X1V D;  5AV8 B;  5AV6 A;  4H9R A;  2DF4 C;  3AZI B;  4ZUX B;  3AV2 A;  5CP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...