3WTPA

Crystal structure of the heterotypic nucleosome containing human cenp-a and h3.3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
89
structure length
89
Chain Sequence
GWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 31
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wtpA00
4J8WB 5AV9B 3B6GA 5DNMC 5AV5C 4XUJD 2F8NA 3MGQC 1JFIA 5FUGB 1P3ID 4WU9D 3C1CB 5B24B 5AV8B 1P3MD 5BNVA 5B31D 1KX5C 5B32D 3TU4B 3VH5T 1P3GA 4WU8C 3AV1A 5B1LA 5B2IB 1S32C 2YFVA 4H9PA 5B0ZA 3KUYD 2NZDA 3REIA 5B0YA 1KX4C 1S32B 5GT0D 2F8NH 5GT3B 3UTAD 1P3OD 3UT9D 1N1JB 5F99B 4KUDC 1M18C 3AZEA 5B1MC 1H3OB 2FJ7D 1P3PD 5B33B 2PYOD 4H9RB 3AN2A 3KWQD 3AZMA 3NQUA 3V9RB 5JA4A 3AV2C 1P3LA 1P3FA 2L5AA 2BYKB 4KGCC 5CPJD 4LD9B 3X1TC 5C3IC 5E5AD 4ZUXC 3LELC 4CSRA 4XUJA 4J8UD 4JJNB 4G92C 1KX5D 3B6FC 4X23C 2HUEB 5GSUC 3MVDB 1P3IA 1F66B 4UUZB 3O62D 3MGSB 3REJB 4WU9A 1ZLAD 1P3MA 1AOIC 4R8PB 3MGPD 5B31A 5B40B 5B32A 1F1EA 5BT1C 4AWLB 3AZGC 2HIOB 3B0CT 4YM6D 3WKJD 3KUYA 1U35D 3RELC 3LZ0B 3LZ1C 4H9QB 5CPKD 5GT0A 4G91C 3W96D 2AROB 3UTAA 1P3OA 3UT9A 3KXBC 4H9NB 4Z66C 2FJ7A 4J8XD 5BO0B 3REKB 1P3PA 2PYOA 1BH8B 4QLCC 3KWQA 5AVCB 5B2JC 5AVBD 5B31G 1P3KC 5B32G 3X1TD 3AZIC 3LELD 3A6NC 5CPJA 1ID3B 1M1AC 4WNNB 5GXQB 1P3BC 4E44A 3AZND 3AZIB 5E5AA 4J8UA 1KX5A 3AYWC 3B6GB 2F8NB 3R45B 3O62A 1ZLAA 3WAAD 3REHB 3MGPA 3UTBC 5CHLB 5DNND 3RELD 3LJAC 3MNND 2BYMA 2NQBC 5B1LB 4YM6A 3WKJA 1U35A 2YFVB 1M19D 3KSYA 5B0ZB 2NZDB 5B0YB 5CPKA 3W96A 2CWEA 4YS3D 4J8VD 3AZHB 1EQZB 5B2JD 1HQ3C 4CAYB 4J8XA 2RVQD 1M1AD 3AN2B 5AVBA 1BH9A 3X1VB 3C1BC 5CP6C 3AZMB 4XZQC 3AZLD 3X1TA 1KX3B 5JA4B 3LELA 1TZYD 5CPIB 3WA9D 4Z5TD 3AZNA 4J8WC 1KU5A 5AV9C 3MGRD 4NE6A 1WWIA 5JRGC 3UTBD 4XUJB 3WAAA 3C1CC 1P3IB 5B24C 5AV8C 3AZGA 4WU9B 1P3MB 3W98B 5JRGB 3B0DB 5B31B 5DNNA 3TU4C 3RELA 5B32B 3MNNA 4EO5B 1B6WA 5B2IC 1M19A 5G49A 2LY8A 3KUYB 5BS7A 3AZKB 1HQ3D 4YS3A 4J8VA 5GT3C 5B2JA 5F99C 3UTAB 3UT9B 5CP6D 5AV6D 5B33C 1P3AD 3AZJD 2FJ7B 1M1AA 3AZFD 2PYOB 4Z2MH 3KWQB 3AZLA 4Z2MG 3W99D 5KDMA 5CPJB 2IO5B 4LD9C 1TZYA 3WA9A 1P34B 4Z5TA 5AY8B 3MGRA 5DNMD 5AV5D 3X1SB 4JJNC 5E5AB 3MGQD 4J8UB 3UTBA 3W97B 2HUEC 3MVDC 3AFAB 1F66C 3REJC 3MGSC 3O62B 1ZLAB 5B2ID 4R8PC 4WZSB 5B40C 3MGPB 4ZBJB 4WU8D 4AWLC 1S32D 2HIOC 3VH5W 2YFWA 4YM6B 1R4VA 3WKJB 1U35B 3LZ0C 1HQ3A 1KX4D 3W96B 4NFTA 3WTPC 2AROC 3X1UB 4KUDD 5CP6A 1M18D 5B1MD 5AV6A 3REKC 1P3AA 3AZJA 4J8XB 3AZFA 1A7WA 3WTPB 5AVCC 5AVBB 3AV2D 3W99A 2CV5B 4KGCD 1ID3C 4DRBA 5GXQC 3MVDD 5FUGA 1F66D 5BNXB 4ZUXD 3AZNB 5AV5A 5DNMA 3B6FD 3MGQA 3B6GC 4X23D 5GSUD 3REHC 1AOID 5B2IA 3WAAB 5BT1D 5DNNB 4WU8A 1JFIB 3AZGD 1S32A 4H9SC 3MNNB 5B1LC 5BNVB 2AROD 1N1JA 5B0ZC 1M19B 5G49B 3LZ1D 1P3GB 2NZDC 3B0CW 1KX4A 1H3OA 5B0YC 4H9RA 3AZHC 3AV1B 1EQZC 4YS3B 4J8VB 4H9PB 3KXBD 4KUDA 1M18A 4Z66D 5B1MA 3REIB 1ID3D 4QLCD 5GXQD 3AN2C 3X1VC 4NE5A 3AV2A 1P3KD 3AZMC 1KX3C 3AZID 3AZEB 3AZLB 3A6ND 4KGCA 3MVDA 1P3BD 1F66A 5KDMB 5CPIC 3REHD 3NQUB 3WA9B 1P3LB 4Z5TB 4ZUXA 3B6FA 1P3FB 3AYWD 4H9OA 3MGRB 4NE3A 4X23A 5GSUA 4XUJC 3VH6A 4KHAA 1P3IC 4DRAA 1AOIA 4WU9C 3B0BA 1P3MC 3W98C 3B0DC 5B31C 4CSRB 5B32C 3LJAD 4EO5C 2NQBD 3AZHD 1EQZD 2AROA 2YFWB 1HTAA 3KUYC 3LZ1A 4H9NA 3AZKC 1B67A 5BO0A 3KXBA 3X1VD 3UTAC 3UT9C 4Z66A 1KX3D 1ID3A 2FJ7C 4QLCA 5GT0B 5AV6B 5GXQA 4E45A 3AZJB 1P3AB 3AZFB 2PYOC 3C1BD 3KWQC 1P3OB 1TAFA 5CPID 1P3KA 4XZQD 3AZIA 3A6NA 1P3PB 3W99B 1P3BA 5CPJC 2IO5C 3R45A 3WTPE 3REHA 3VH6T 1P34C 4J8WD 5AV9D 5AY8C 3W98D 3AYWA 5JRGD 3X1SC 3W97C 5E5AC 5AV5B 5DNMB 4J8UC 3AFAC 3MGQB 3C1CD 5B24D 5AV8D 3O62C 4H9SA 1ZLAC 3NQJA 3MGPC 4M6BA 4ZBJC 3TU4D 1KX5B 3LJAA 3AZKD 4WU8B 2NQBA 3AZHA 1EQZA 4YM6C 3WKJC 1U35C 2F8NG 4CAYA 1KX4B 2BYMB 5CPKC 3W96C 5GT3D 3X1VA 3X1UC 5F99D 4KUDB 1M18B 1KX3A 5B33D 5B1MB 4J8XC 5CPKB 3C1BA 5AVBC 5CPIA 4XZQA 1P34D 3AV2B 5AY8D 2CV5C 3X1SD 3W97D 4KGCB 3VH6W 3AFAD 4LD9D 4WV4B 1BH9B 4J8WA 5AV9A 3W98A 3AZNC 5JRGA 4JJND 3X1TB 5C3IB 4ZUXB 3LELB 3B6FB 4G92B 4H9OB 4X23B 5GSUB 3MGSD 3C1CA 3REJD 5B24A 4KHAB 5AV8A 3WAAC 4R8PD 2F8NK 1AOIB 5B40D 3TU4A 5DNNC 3AZKA 2HIOD 3MNNC 3AZGB 3X1UD 1M19C 3LZ0D 3RELB 1P3GC 5BS7C 3LZ1B 2JSSA 1WWSA 3AV1C 4G91B 5GT3A 4YS3C 3WTPD 4J8VC 5F99A 3KXBB 3REIC 1BFMA 4Z66B 5B33A 3REKD 2CV5D 5AVCD 2RVQC 4QLCB 5B2JB 3V9RA 1P34A 1TAFB 1P3KB 5AY8A 2BYKA 3AZEC 3AZLC 3W97A 3X1SA 3A6NB 1M1AB 3AFAA 4LD9A 1P3BB 1TZYC 3WA9C 1P3LC 4Z5TC 4JJNA 1P3FC 3MGRC 3B6GD 3AYWB 2F8ND 4UUZA 3MGSA 3REJA 1TZYB 4R8PA 5B40A 4HGAC 3NQJB 3UTBB 1P3GD 3LJAB 2HIOA 3AV1D 1Q9CA 5B1LD 2NQBB 3X1UA 3VH5A 4HGAB 5B0ZD 3LZ0A 4H9QA 2NZDD 3REID 5B0YD 3WTPA 3REKA 1HQ3B 3AZED 1BH8A 2CV5A 5GT0C 5AV6C 1P3AC 5AVCA 3AZJC 3AN2D 3AZFC 1P3OC 3C1BB 3AZMD 5CP6B 5BNXA 4XZQB 1P3LD 1P3FD 1P3PC 3W99C 4WNNA 1ULYA
chains in the Genus database with same CATH superfamily
4J8WB 5AV9B 3B6GA 5DNMC 5AV5C 4XUJD 2F8NA 3MGQC 1JFIA 5FUGB 1P3ID 4WU9D 3C1CB 5B24B 5AV8B 1P3MD 2Y2MA 5BNVA 5B31D 1KX5C 5B32D 3TU4B 3VH5T 1P3GA 4WU8C 3AV1A 5B1LA 5B2IB 1S32C 2YFVA 4H9PA 5B0ZA 3KUYD 3IP4C 2NZDA 3REIA 5B0YA 1KX4C 1S32B 5GT0D 2UWXA 2F8NH 5GT3B 3UTAD 1P3OD 3UT9D 2Y2KA 1N1JB 5F99B 4KUDC 1M18C 3AZEA 5B1MC 1H3OB 2FJ7D 1P3PD 5B33B 2PYOD 4H9RB 3AN2A 3KWQD 3EPLA 3AZMA 3NQUA 3V9RB 5JA4A 3AV2C 1P3LA 1P3FA 2L5AA 2BYKB 4KGCC 5CPJD 4LD9B 3X1TC 5C3IC 5E5AD 4ZUXC 3LELC 4CSRA 4XUJA 4J8UD 4JJNB 2W8SA 4G92C 1KX5D 4X23C 2HUEB 5GSUC 3MVDB 1P3IA 1F66B 4UUZB 3O62D 3MGSB 3REJB 4WU9A 1ZLAD 1P3MA 1AOIC 4R8PB 3MGPD 5B31A 5B40B 3B6FC 5B32A 1F1EA 5BT1C 4AWLB 3AZGC 2HIOB 3B0CT 4YM6D 3WKJD 3KUYA 1U35D 2Y2QA 3RELC 3LZ0B 3LZ1C 4H9QB 5CPKD 5GT0A 4G91C 3W96D 3EPJA 2AROB 3UTAA 1P3OA 3UT9A 3KXBC 4H9NB 4Z66C 2FJ7A 4J8XD 5BO0B 2Y2PA 3REKB 1P3PA 1BH8B 2PYOA 4QLCC 3KWQA 5AVCB 5B2JC 5AVBD 5B31G 1P3KC 5B32G 3X1TD 3AZIC 3LELD 3A6NC 5CPJA 1ID3B 1M1AC 4WNNB 5GXQB 1P3BC 4E44A 3AZND 3AZIB 5E5AA 4J8UA 1KX5A 3AYWC 3AL0C 3B6GB 2F8NB 3R45B 3O62A 1ZLAA 3WAAD 1PZRA 3EG5B 3REHB 3MGPA 3UTBC 5CHLB 5DNND 3RELD 3LJAC 3MNND 2BYMA 2NQBC 5B1LB 4YM6A 3WKJA 1U35A 2YFVB 1M19D 3KSYA 5B0ZB 2NZDB 5B0YB 5CPKA 3W96A 2CWEA 4YS3D 4J8VD 3AZHB 1EQZB 3EPKA 5B2JD 1HQ3C 3H0MC 4CAYB 4J8XA 2RVQD 1M1AD 3AN2B 5AVBA 1BH9A 3X1VB 3C1BC 5CP6C 2ZY2A 3AZMB 4XZQC 3AZLD 3X1TA 1KX3B 5JA4B 3LELA 1TZYD 5CPIB 2Y2IA 3WA9D 4Z5TD 3AZNA 4J8WC 1KU5A 5AV9C 3MGRD 4NE6A 1WWIA 5JRGC 3UTBD 4XUJB 2JE5A 3WAAA 3C1CC 1P3IB 5B24C 5AV8C 3AZGA 4WU9B 1P3MB 3W98B 5JRGB 3EPHA 2Y2OA 3B0DB 5B31B 5DNNA 3TU4C 3RELA 5B32B 3MNNA 4EO5B 1B6WA 5B2IC 1M19A 5G49A 2LY8A 3KUYB 5BS7A 3AZKB 1HQ3D 4YS3A 4J8VA 5GT3C 5B2JA 5F99C 3UTAB 3UT9B 5CP6D 2Y2JA 2JCHA 5AV6D 5B33C 1P3AD 3AZJD 2FJ7B 1M1AA 3AZFD 2PYOB 1Z2CB 4Z2MH 3KWQB 3AZLA 4Z2MG 3W99D 5KDMA 5CPJB 2IO5B 4LD9C 1TZYA 3WA9A 1P34B 4Z5TA 5AY8B 3MGRA 2BG1A 5DNMD 5AV5D 3X1SB 4JJNC 5E5AB 3MGQD 4J8UB 3UTBA 3W97B 2HUEC 3MVDC 3AFAB 1F66C 3REJC 3MGSC 3O62B 1ZLAB 5B2ID 4R8PC 4WZSB 5B40C 3MGPB 4ZBJB 4WU8D 4AWLC 1S32D 2HIOC 3VH5W 2YFWA 4YM6B 1R4VA 3WKJB 1U35B 3LZ0C 2Y2LA 1HQ3A 1KX4D 3W96B 4NFTA 3WTPC 2AROC 3X1UB 2Y2GA 4KUDD 5CP6A 1M18D 5B1MD 5AV6A 3REKC 1P3AA 3AZJA 4J8XB 3AZFA 1A7WA 3WTPB 5AVCC 3KFUG 5AVBB 3AV2D 2ZM5A 3H0LC 3W99A 2CV5B 4KGCD 1ID3C 4DRBA 5GXQC 3MVDD 5FUGA 1F66D 5BNXB 4ZUXD 3AZNB 5AV5A 5DNMA 3B6FD 3MGQA 3B6GC 4X23D 5GSUD 3REHC 1AOID 5B2IA 3WAAB 2Y2HA 5BT1D 5DNNB 4WU8A 1JFIB 3AZGD 1S32A 4H9SC 3MNNB 5B1LC 5BNVB 2AROD 1N1JA 5B0ZC 1M19B 5G49B 3LZ1D 1P3GB 2NZDC 3B0CW 1KX4A 1H3OA 5B0YC 4H9RA 3AZHC 3AV1B 1EQZC 4YS3B 4J8VB 4H9PB 3KXBD 4KUDA 1M18A 4Z66D 5B1MA 3REIB 1ID3D 4QLCD 3F6TA 5GXQD 3AN2C 3X1VC 4NE5A 3AV2A 1P3KD 3AZMC 1KX3C 3AZID 3AZEB 3AZLB 3A6ND 4KGCA 3MVDA 1P3BD 1F66A 5KDMB 5CPIC 3REHD 3NQUB 3WA9B 1P3LB 4Z5TB 4ZUXA 3B6FA 1P3FB 3AYWD 4H9OA 3MGRB 4NE3A 4X23A 5GSUA 4XUJC 3VH6A 4KHAA 1P3IC 4DRAA 1AOIA 4WU9C 3B0BA 2G5IC 2J8PA 1P3MC 3W98C 3B0DC 5B31C 4CSRB 5B32C 3LJAD 2XD5A 4EO5C 2NQBD 3AZHD 1EQZD 3A1KA 2AROA 2YFWB 1HTAA 3KUYC 3LZ1A 4H9NA 3AZKC 1B67A 5BO0A 3KXBA 3X1VD 2G5HC 3FDDA 3UTAC 2ZY3A 3UT9C 4Z66A 1KX3D 1ID3A 2FJ7C 4QLCA 5GT0B 5AV6B 5GXQA 4E45A 3AZJB 1P3AB 3AZFB 2PYOC 3C1BD 3KWQC 1P3OB 1TAFA 5CPID 1P3KA 4XZQD 3AZIA 3A6NA 1P3PB 3W99B 1P3BA 5CPJC 2IO5C 3R45A 3WTPE 3REHA 3VH6T 1P34C 4J8WD 5AV9D 5AY8C 3W98D 3AYWA 5JRGD 3X1SC 3W97C 5E5AC 5AV5B 5DNMB 4J8UC 3AFAC 3MGQB 3C1CD 5B24D 5AV8D 3O62C 4H9SA 2VQRA 1ZLAC 3NQJA 3MGPC 4M6BA 4ZBJC 3TU4D 1KX5B 3LJAA 3AZKD 4WU8B 2NQBA 3AZHA 1EQZA 4YM6C 3WKJC 1U35C 2F8NG 4CAYA 2DF4C 1KX4B 2BYMB 5CPKC 3W96C 5GT3D 3X1VA 3X1UC 5F99D 4KUDB 1M18B 1KX3A 5B33D 3A1IA 5B1MB 4J8XC 5CPKB 3C1BA 5AVBC 5CPIA 4XZQA 1P34D 3AV2B 5AY8D 2CV5C 3X1SD 3W97D 4KGCB 3VH6W 3AFAD 4LD9D 2DQNC 4WV4B 1BH9B 4J8WA 5AV9A 3W98A 3AZNC 5JRGA 4JJND 1W2EA 5C3IB 3X1TB 4ZUXB 3LELB 3B6FB 4G92B 4H9OB 4X23B 5GSUB 3MGSD 3C1CA 3REJD 5B24A 4KHAB 5AV8A 3WAAC 4R8PD 2F8NK 2ZY4A 2ZY5A 1AOIB 5B40D 3TU4A 5DNNC 3AZKA 2HIOD 2Y2NA 3MNNC 3AZGB 3X1UD 3P5JB 1M19C 3LZ0D 2RIQA 3RELB 1P3GC 5BS7C 3LZ1B 2JSSA 1WWSA 3AV1C 4G91B 5GT3A 4YS3C 3WTPD 4J8VC 5F99A 3KXBB 2XD1A 3REIC 1BFMA 4Z66B 5B33A 3REKD 2CV5D 5AVCD 2RVQC 4QLCB 5B2JB 3V9RA 1P34A 1TAFB 1P3KB 5AY8A 2BYKA 4DQYB 3AZEC 3AZLC 3W97A 3X1SA 3A6NB 1M1AB 3AFAA 4LD9A 1P3BB 1T3UA 1TZYC 3WA9C 1P3LC 4Z5TC 4JJNA 1P3FC 3MGRC 3B6GD 3AYWB 2F8ND 4UUZA 3MGSA 3REJA 1TZYB 4R8PA 5B40A 2FFFB 4HGAC 3NQJB 3UTBB 1P3GD 3LJAB 2HIOA 3AV1D 1Q9CA 5B1LD 2NQBB 3X1UA 3VH5A 4HGAB 5B0ZD 3LZ0A 4H9QA 2NZDD 3REID 5B0YD 3WTPA 4WJ3C 3REKA 1HQ3B 3AZED 1BH8A 2CV5A 5GT0C 5AV6C 1P3AC 5AVCA 3AZJC 3H0RC 3AZFC 3AN2D 1P3OC 2F2AC 3C1BB 3AZMD 5CP6B 5BNXA 4XZQB 1P3LD 1P3FD 1P3PC 3W99C 4WNNA 1ULYA 4UPKA
chains in the Genus database with same CATH topology
4J8WB 5AV9B 3B6GA 5DNMC 5AV5C 4XUJD 2F8NA 3MGQC 1JFIA 5FUGB 1P3ID 4WU9D 3C1CB 5B24B 5AV8B 1P3MD 2Y2MA 5BNVA 5B31D 1KX5C 5B32D 3TU4B 3VH5T 1P3GA 4WU8C 3AV1A 5B1LA 5B2IB 1S32C 2YFVA 4H9PA 5B0ZA 3KUYD 3IP4C 2NZDA 3REIA 5B0YA 1KX4C 1S32B 5GT0D 2UWXA 2F8NH 5GT3B 3UTAD 1P3OD 3UT9D 2Y2KA 1N1JB 5F99B 4KUDC 1M18C 3AZEA 5B1MC 1H3OB 2FJ7D 1P3PD 5B33B 2PYOD 4H9RB 3AN2A 3KWQD 3EPLA 3AZMA 3NQUA 3V9RB 5JA4A 3AV2C 1P3LA 1P3FA 2L5AA 2BYKB 4KGCC 5CPJD 4LD9B 3X1TC 5C3IC 5E5AD 4ZUXC 3LELC 4CSRA 4XUJA 4J8UD 4JJNB 2W8SA 4G92C 1KX5D 4X23C 2HUEB 5GSUC 3MVDB 1P3IA 1F66B 4UUZB 3O62D 3MGSB 3REJB 4WU9A 1ZLAD 1P3MA 1AOIC 4R8PB 3MGPD 5B31A 5B40B 3B6FC 5B32A 1F1EA 5BT1C 4AWLB 3AZGC 2HIOB 3B0CT 4YM6D 3WKJD 3KUYA 1U35D 2Y2QA 3RELC 3LZ0B 3LZ1C 4H9QB 5CPKD 5GT0A 4G91C 3W96D 3EPJA 2AROB 3UTAA 1P3OA 3UT9A 3KXBC 4H9NB 4Z66C 2FJ7A 4J8XD 5BO0B 2Y2PA 3REKB 1P3PA 1BH8B 2PYOA 4QLCC 3KWQA 5AVCB 5B2JC 5AVBD 5B31G 1P3KC 5B32G 3X1TD 3AZIC 3LELD 3A6NC 5CPJA 1ID3B 1M1AC 4WNNB 5GXQB 1P3BC 4E44A 3AZND 3AZIB 5E5AA 4J8UA 1KX5A 3AYWC 3AL0C 3B6GB 2F8NB 3R45B 3O62A 1ZLAA 3WAAD 1PZRA 3EG5B 3REHB 3MGPA 3UTBC 5CHLB 5DNND 3RELD 3LJAC 3MNND 2BYMA 2NQBC 5B1LB 4YM6A 3WKJA 1U35A 2YFVB 1M19D 3KSYA 5B0ZB 2NZDB 5B0YB 5CPKA 3W96A 2CWEA 4YS3D 4J8VD 3AZHB 1EQZB 3EPKA 5B2JD 1HQ3C 3H0MC 4CAYB 4J8XA 2RVQD 1M1AD 3AN2B 5AVBA 1BH9A 3X1VB 3C1BC 5CP6C 2ZY2A 3AZMB 4XZQC 3AZLD 3X1TA 1KX3B 5JA4B 3LELA 1TZYD 5CPIB 2Y2IA 3WA9D 4Z5TD 3AZNA 4J8WC 1KU5A 5AV9C 3MGRD 4NE6A 1WWIA 5JRGC 3UTBD 4XUJB 2JE5A 3WAAA 3C1CC 1P3IB 5B24C 5AV8C 3AZGA 4WU9B 1P3MB 3W98B 5JRGB 3EPHA 2Y2OA 3B0DB 5B31B 5DNNA 3TU4C 3RELA 5B32B 3MNNA 4EO5B 1B6WA 5B2IC 1M19A 5G49A 2LY8A 3KUYB 5BS7A 3AZKB 1HQ3D 4YS3A 4J8VA 5GT3C 5B2JA 5F99C 3UTAB 3UT9B 5CP6D 2Y2JA 2JCHA 5AV6D 5B33C 1P3AD 3AZJD 2FJ7B 1M1AA 3AZFD 2PYOB 1Z2CB 4Z2MH 3KWQB 3AZLA 4Z2MG 3W99D 5KDMA 5CPJB 2IO5B 4LD9C 1TZYA 3WA9A 1P34B 4Z5TA 5AY8B 3MGRA 2BG1A 5DNMD 5AV5D 3X1SB 4JJNC 5E5AB 3MGQD 4J8UB 3UTBA 3W97B 2HUEC 3MVDC 3AFAB 1F66C 3REJC 3MGSC 3O62B 1ZLAB 5B2ID 4R8PC 4WZSB 5B40C 3MGPB 4ZBJB 4WU8D 4AWLC 1S32D 2HIOC 3VH5W 2YFWA 4YM6B 1R4VA 3WKJB 1U35B 3LZ0C 2Y2LA 1HQ3A 1KX4D 3W96B 4NFTA 3WTPC 2AROC 3X1UB 2Y2GA 4KUDD 5CP6A 1M18D 5B1MD 5AV6A 3REKC 1P3AA 3AZJA 4J8XB 3AZFA 1A7WA 3WTPB 5AVCC 3KFUG 5AVBB 3AV2D 2ZM5A 3H0LC 3W99A 2CV5B 4KGCD 1ID3C 4DRBA 5GXQC 3MVDD 5FUGA 1F66D 5BNXB 4ZUXD 3AZNB 5AV5A 5DNMA 3B6FD 3MGQA 3B6GC 4X23D 5GSUD 3REHC 1AOID 5B2IA 3WAAB 2Y2HA 5BT1D 5DNNB 4WU8A 1JFIB 3AZGD 1S32A 4H9SC 3MNNB 5B1LC 5BNVB 2AROD 1N1JA 5B0ZC 1M19B 5G49B 3LZ1D 1P3GB 2NZDC 3B0CW 1KX4A 1H3OA 5B0YC 4H9RA 3AZHC 3AV1B 1EQZC 4YS3B 4J8VB 4H9PB 3KXBD 4KUDA 1M18A 4Z66D 5B1MA 3REIB 1ID3D 4QLCD 3F6TA 5GXQD 3AN2C 3X1VC 4NE5A 3AV2A 1P3KD 3AZMC 1KX3C 3AZID 3AZEB 3AZLB 3A6ND 4KGCA 3MVDA 1P3BD 1F66A 5KDMB 5CPIC 3REHD 3NQUB 3WA9B 1P3LB 4Z5TB 4ZUXA 3B6FA 1P3FB 3AYWD 4H9OA 3MGRB 4NE3A 4X23A 5GSUA 4XUJC 3VH6A 4KHAA 1P3IC 4DRAA 1AOIA 4WU9C 3B0BA 2G5IC 2J8PA 1P3MC 3W98C 3B0DC 5B31C 4CSRB 5B32C 3LJAD 2XD5A 4EO5C 2NQBD 3AZHD 1EQZD 3A1KA 2AROA 2YFWB 1HTAA 3KUYC 3LZ1A 4H9NA 3AZKC 1B67A 5BO0A 3KXBA 3X1VD 2G5HC 3FDDA 3UTAC 2ZY3A 3UT9C 4Z66A 1KX3D 1ID3A 2FJ7C 4QLCA 5GT0B 5AV6B 5GXQA 4E45A 3AZJB 1P3AB 3AZFB 2PYOC 3C1BD 3KWQC 1P3OB 1TAFA 5CPID 1P3KA 4XZQD 3AZIA 3A6NA 1P3PB 3W99B 1P3BA 5CPJC 2IO5C 3R45A 3WTPE 3REHA 3VH6T 1P34C 4J8WD 5AV9D 5AY8C 3W98D 3AYWA 5JRGD 3X1SC 3W97C 5E5AC 5AV5B 5DNMB 4J8UC 3AFAC 3MGQB 3C1CD 5B24D 5AV8D 3O62C 4H9SA 2VQRA 1ZLAC 3NQJA 3MGPC 4M6BA 4ZBJC 3TU4D 1KX5B 3LJAA 3AZKD 4WU8B 2NQBA 3AZHA 1EQZA 4YM6C 3WKJC 1U35C 2F8NG 4CAYA 2DF4C 1KX4B 2BYMB 5CPKC 3W96C 5GT3D 3X1VA 3X1UC 5F99D 4KUDB 1M18B 1KX3A 5B33D 3A1IA 5B1MB 4J8XC 5CPKB 3C1BA 5AVBC 5CPIA 4XZQA 1P34D 3AV2B 5AY8D 2CV5C 3X1SD 3W97D 4KGCB 3VH6W 3AFAD 4LD9D 2DQNC 4WV4B 1BH9B 4J8WA 5AV9A 3W98A 3AZNC 5JRGA 4JJND 1W2EA 5C3IB 3X1TB 4ZUXB 3LELB 3B6FB 4G92B 4H9OB 4X23B 5GSUB 3MGSD 3C1CA 3REJD 5B24A 4KHAB 5AV8A 3WAAC 4R8PD 2F8NK 2ZY4A 2ZY5A 1AOIB 5B40D 3TU4A 5DNNC 3AZKA 2HIOD 2Y2NA 3MNNC 3AZGB 3X1UD 3P5JB 1M19C 3LZ0D 2RIQA 3RELB 1P3GC 5BS7C 3LZ1B 2JSSA 1WWSA 3AV1C 4G91B 5GT3A 4YS3C 3WTPD 4J8VC 5F99A 3KXBB 2XD1A 3REIC 1BFMA 4Z66B 5B33A 3REKD 2CV5D 5AVCD 2RVQC 4QLCB 5B2JB 3V9RA 1P34A 1TAFB 1P3KB 5AY8A 2BYKA 4DQYB 3AZEC 3AZLC 3W97A 3X1SA 3A6NB 1M1AB 3AFAA 4LD9A 1P3BB 1T3UA 1TZYC 3WA9C 1P3LC 4Z5TC 4JJNA 1P3FC 3MGRC 3B6GD 3AYWB 2F8ND 4UUZA 3MGSA 3REJA 1TZYB 4R8PA 5B40A 2FFFB 4HGAC 3NQJB 3UTBB 1P3GD 3LJAB 2HIOA 3AV1D 1Q9CA 5B1LD 2NQBB 3X1UA 3VH5A 4HGAB 5B0ZD 3LZ0A 4H9QA 2NZDD 3REID 5B0YD 3WTPA 4WJ3C 3REKA 1HQ3B 3AZED 1BH8A 2CV5A 5GT0C 5AV6C 1P3AC 5AVCA 3AZJC 3H0RC 3AZFC 3AN2D 1P3OC 2F2AC 3C1BB 3AZMD 5CP6B 5BNXA 4XZQB 1P3LD 1P3FD 1P3PC 3W99C 4WNNA 1ULYA 4UPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8W B;  5AV9 B;  3B6G A;  5DNM C;  5AV5 C;  4XUJ D;  2F8N A;  3MGQ C;  1JFI A;  5FUG B;  1P3I D;  4WU9 D;  3C1C B;  5B24 B;  5AV8 B;  1P3M D;  5BNV A;  5B31 D;  1KX5 C;  5B32 D;  3TU4 B;  3VH5 T;  1P3G A;  4WU8 C;  3AV1 A;  5B1L A;  5B2I B;  1S32 C;  2YFV A;  4H9P A;  5B0Z A;  3KUY D;  2NZD A;  3REI A;  5B0Y A;  1KX4 C;  1S32 B;  5GT0 D;  2F8N H;  5GT3 B;  3UTA D;  1P3O D;  3UT9 D;  1N1J B;  5F99 B;  4KUD C;  1M18 C;  3AZE A;  5B1M C;  1H3O B;  2FJ7 D;  1P3P D;  5B33 B;  2PYO D;  4H9R B;  3AN2 A;  3KWQ D;  3AZM A;  3NQU A;  3V9R B;  5JA4 A;  3AV2 C;  1P3L A;  1P3F A;  2L5A A;  2BYK B;  4KGC C;  5CPJ D;  4LD9 B;  3X1T C;  5C3I C;  5E5A D;  4ZUX C;  3LEL C;  4CSR A;  4XUJ A;  4J8U D;  4JJN B;  4G92 C;  1KX5 D;  3B6F C;  4X23 C;  2HUE B;  5GSU C;  3MVD B;  1P3I A;  1F66 B;  4UUZ B;  3O62 D;  3MGS B;  3REJ B;  4WU9 A;  1ZLA D;  1P3M A;  1AOI C;  4R8P B;  3MGP D;  5B31 A;  5B40 B;  5B32 A;  1F1E A;  5BT1 C;  4AWL B;  3AZG C;  2HIO B;  3B0C T;  4YM6 D;  3WKJ D;  3KUY A;  1U35 D;  3REL C;  3LZ0 B;  3LZ1 C;  4H9Q B;  5CPK D;  5GT0 A;  4G91 C;  3W96 D;  2ARO B;  3UTA A;  1P3O A;  3UT9 A;  3KXB C;  4H9N B;  4Z66 C;  2FJ7 A;  4J8X D;  5BO0 B;  3REK B;  1P3P A;  2PYO A;  1BH8 B;  4QLC C;  3KWQ A;  5AVC B;  5B2J C;  5AVB D;  5B31 G;  1P3K C;  5B32 G;  3X1T D;  3AZI C;  3LEL D;  3A6N C;  5CPJ A;  1ID3 B;  1M1A C;  4WNN B;  5GXQ B;  1P3B C;  4E44 A;  3AZN D;  3AZI B;  5E5A A;  4J8U A;  1KX5 A;  3AYW C;  3B6G B;  2F8N B;  3R45 B;  3O62 A;  1ZLA A;  3WAA D;  3REH B;  3MGP A;  3UTB C;  5CHL B;  5DNN D;  3REL D;  3LJA C;  3MNN D;  2BYM A;  2NQB C;  5B1L B;  4YM6 A;  3WKJ A;  1U35 A;  2YFV B;  1M19 D;  3KSY A;  5B0Z B;  2NZD B;  5B0Y B;  5CPK A;  3W96 A;  2CWE A;  4YS3 D;  4J8V D;  3AZH B;  1EQZ B;  5B2J D;  1HQ3 C;  4CAY B;  4J8X A;  2RVQ D;  1M1A D;  3AN2 B;  5AVB A;  1BH9 A;  3X1V B;  3C1B C;  5CP6 C;  3AZM B;  4XZQ C;  3AZL D;  3X1T A;  1KX3 B;  5JA4 B;  3LEL A;  1TZY D;  5CPI B;  3WA9 D;  4Z5T D;  3AZN A;  4J8W C;  1KU5 A;  5AV9 C;  3MGR D;  4NE6 A;  1WWI A;  5JRG C;  3UTB D;  4XUJ B;  3WAA A;  3C1C C;  1P3I B;  5B24 C;  5AV8 C;  3AZG A;  4WU9 B;  1P3M B;  3W98 B;  5JRG B;  3B0D B;  5B31 B;  5DNN A;  3TU4 C;  3REL A;  5B32 B;  3MNN A;  4EO5 B;  1B6W A;  5B2I C;  1M19 A;  5G49 A;  2LY8 A;  3KUY B;  5BS7 A;  3AZK B;  1HQ3 D;  4YS3 A;  4J8V A;  5GT3 C;  5B2J A;  5F99 C;  3UTA B;  3UT9 B;  5CP6 D;  5AV6 D;  5B33 C;  1P3A D;  3AZJ D;  2FJ7 B;  1M1A A;  3AZF D;  2PYO B;  4Z2M H;  3KWQ B;  3AZL A;  4Z2M G;  3W99 D;  5KDM A;  5CPJ B;  2IO5 B;  4LD9 C;  1TZY A;  3WA9 A;  1P34 B;  4Z5T A;  5AY8 B;  3MGR A;  5DNM D;  5AV5 D;  3X1S B;  4JJN C;  5E5A B;  3MGQ D;  4J8U B;  3UTB A;  3W97 B;  2HUE C;  3MVD C;  3AFA B;  1F66 C;  3REJ C;  3MGS C;  3O62 B;  1ZLA B;  5B2I D;  4R8P C;  4WZS B;  5B40 C;  3MGP B;  4ZBJ B;  4WU8 D;  4AWL C;  1S32 D;  2HIO C;  3VH5 W;  2YFW A;  4YM6 B;  1R4V A;  3WKJ B;  1U35 B;  3LZ0 C;  1HQ3 A;  1KX4 D;  3W96 B;  4NFT A;  3WTP C;  2ARO C;  3X1U B;  4KUD D;  5CP6 A;  1M18 D;  5B1M D;  5AV6 A;  3REK C;  1P3A A;  3AZJ A;  4J8X B;  3AZF A;  1A7W A;  3WTP B;  5AVC C;  5AVB B;  3AV2 D;  3W99 A;  2CV5 B;  4KGC D;  1ID3 C;  4DRB A;  5GXQ C;  3MVD D;  5FUG A;  1F66 D;  5BNX B;  4ZUX D;  3AZN B;  5AV5 A;  5DNM A;  3B6F D;  3MGQ A;  3B6G C;  4X23 D;  5GSU D;  3REH C;  1AOI D;  5B2I A;  3WAA B;  5BT1 D;  5DNN B;  4WU8 A;  1JFI B;  3AZG D;  1S32 A;  4H9S C;  3MNN B;  5B1L C;  5BNV B;  2ARO D;  1N1J A;  5B0Z C;  1M19 B;  5G49 B;  3LZ1 D;  1P3G B;  2NZD C;  3B0C W;  1KX4 A;  1H3O A;  5B0Y C;  4H9R A;  3AZH C;  3AV1 B;  1EQZ C;  4YS3 B;  4J8V B;  4H9P B;  3KXB D;  4KUD A;  1M18 A;  4Z66 D;  5B1M A;  3REI B;  1ID3 D;  4QLC D;  5GXQ D;  3AN2 C;  3X1V C;  4NE5 A;  3AV2 A;  1P3K D;  3AZM C;  1KX3 C;  3AZI D;  3AZE B;  3AZL B;  3A6N D;  4KGC A;  3MVD A;  1P3B D;  1F66 A;  5KDM B;  5CPI C;  3REH D;  3NQU B;  3WA9 B;  1P3L B;  4Z5T B;  4ZUX A;  3B6F A;  1P3F B;  3AYW D;  4H9O A;  3MGR B;  4NE3 A;  4X23 A;  5GSU A;  4XUJ C;  3VH6 A;  4KHA A;  1P3I C;  4DRA A;  1AOI A;  4WU9 C;  3B0B A;  1P3M C;  3W98 C;  3B0D C;  5B31 C;  4CSR B;  5B32 C;  3LJA D;  4EO5 C;  2NQB D;  3AZH D;  1EQZ D;  2ARO A;  2YFW B;  1HTA A;  3KUY C;  3LZ1 A;  4H9N A;  3AZK C;  1B67 A;  5BO0 A;  3KXB A;  3X1V D;  3UTA C;  3UT9 C;  4Z66 A;  1KX3 D;  1ID3 A;  2FJ7 C;  4QLC A;  5GT0 B;  5AV6 B;  5GXQ A;  4E45 A;  3AZJ B;  1P3A B;  3AZF B;  2PYO C;  3C1B D;  3KWQ C;  1P3O B;  1TAF A;  5CPI D;  1P3K A;  4XZQ D;  3AZI A;  3A6N A;  1P3P B;  3W99 B;  1P3B A;  5CPJ C;  2IO5 C;  3R45 A;  3WTP E;  3REH A;  3VH6 T;  1P34 C;  4J8W D;  5AV9 D;  5AY8 C;  3W98 D;  3AYW A;  5JRG D;  3X1S C;  3W97 C;  5E5A C;  5AV5 B;  5DNM B;  4J8U C;  3AFA C;  3MGQ B;  3C1C D;  5B24 D;  5AV8 D;  3O62 C;  4H9S A;  1ZLA C;  3NQJ A;  3MGP C;  4M6B A;  4ZBJ C;  3TU4 D;  1KX5 B;  3LJA A;  3AZK D;  4WU8 B;  2NQB A;  3AZH A;  1EQZ A;  4YM6 C;  3WKJ C;  1U35 C;  2F8N G;  4CAY A;  1KX4 B;  2BYM B;  5CPK C;  3W96 C;  5GT3 D;  3X1V A;  3X1U C;  5F99 D;  4KUD B;  1M18 B;  1KX3 A;  5B33 D;  5B1M B;  4J8X C;  5CPK B;  3C1B A;  5AVB C;  5CPI A;  4XZQ A;  1P34 D;  3AV2 B;  5AY8 D;  2CV5 C;  3X1S D;  3W97 D;  4KGC B;  3VH6 W;  3AFA D;  4LD9 D;  4WV4 B;  1BH9 B;  4J8W A;  5AV9 A;  3W98 A;  3AZN C;  5JRG A;  4JJN D;  3X1T B;  5C3I B;  4ZUX B;  3LEL B;  3B6F B;  4G92 B;  4H9O B;  4X23 B;  5GSU B;  3MGS D;  3C1C A;  3REJ D;  5B24 A;  4KHA B;  5AV8 A;  3WAA C;  4R8P D;  2F8N K;  1AOI B;  5B40 D;  3TU4 A;  5DNN C;  3AZK A;  2HIO D;  3MNN C;  3AZG B;  3X1U D;  1M19 C;  3LZ0 D;  3REL B;  1P3G C;  5BS7 C;  3LZ1 B;  2JSS A;  1WWS A;  3AV1 C;  4G91 B;  5GT3 A;  4YS3 C;  3WTP D;  4J8V C;  5F99 A;  3KXB B;  3REI C;  1BFM A;  4Z66 B;  5B33 A;  3REK D;  2CV5 D;  5AVC D;  2RVQ C;  4QLC B;  5B2J B;  3V9R A;  1P34 A;  1TAF B;  1P3K B;  5AY8 A;  2BYK A;  3AZE C;  3AZL C;  3W97 A;  3X1S A;  3A6N B;  1M1A B;  3AFA A;  4LD9 A;  1P3B B;  1TZY C;  3WA9 C;  1P3L C;  4Z5T C;  4JJN A;  1P3F C;  3MGR C;  3B6G D;  3AYW B;  2F8N D;  4UUZ A;  3MGS A;  3REJ A;  1TZY B;  4R8P A;  5B40 A;  4HGA C;  3NQJ B;  3UTB B;  1P3G D;  3LJA B;  2HIO A;  3AV1 D;  1Q9C A;  5B1L D;  2NQB B;  3X1U A;  3VH5 A;  4HGA B;  5B0Z D;  3LZ0 A;  4H9Q A;  2NZD D;  3REI D;  5B0Y D;  3WTP A;  3REK A;  1HQ3 B;  3AZE D;  1BH8 A;  2CV5 A;  5GT0 C;  5AV6 C;  1P3A C;  5AVC A;  3AZJ C;  3AN2 D;  3AZF C;  1P3O C;  3C1B B;  3AZM D;  5CP6 B;  5BNX A;  4XZQ B;  1P3L D;  1P3F D;  1P3P C;  3W99 C;  4WNN A;  1ULY A; 
#chains in the Genus database with same CATH topology
 4J8W B;  5AV9 B;  3B6G A;  5DNM C;  5AV5 C;  4XUJ D;  2F8N A;  3MGQ C;  1JFI A;  5FUG B;  1P3I D;  4WU9 D;  3C1C B;  5B24 B;  5AV8 B;  1P3M D;  2Y2M A;  5BNV A;  5B31 D;  1KX5 C;  5B32 D;  3TU4 B;  3VH5 T;  1P3G A;  4WU8 C;  3AV1 A;  5B1L A;  5B2I B;  1S32 C;  2YFV A;  4H9P A;  5B0Z A;  3KUY D;  3IP4 C;  2NZD A;  3REI A;  5B0Y A;  1KX4 C;  1S32 B;  5GT0 D;  2UWX A;  2F8N H;  5GT3 B;  3UTA D;  1P3O D;  3UT9 D;  2Y2K A;  1N1J B;  5F99 B;  4KUD C;  1M18 C;  3AZE A;  5B1M C;  1H3O B;  2FJ7 D;  1P3P D;  5B33 B;  2PYO D;  4H9R B;  3AN2 A;  3KWQ D;  3EPL A;  3AZM A;  3NQU A;  3V9R B;  5JA4 A;  3AV2 C;  1P3L A;  1P3F A;  2L5A A;  2BYK B;  4KGC C;  5CPJ D;  4LD9 B;  3X1T C;  5C3I C;  5E5A D;  4ZUX C;  3LEL C;  4CSR A;  4XUJ A;  4J8U D;  4JJN B;  2W8S A;  4G92 C;  1KX5 D;  4X23 C;  2HUE B;  5GSU C;  3MVD B;  1P3I A;  1F66 B;  4UUZ B;  3O62 D;  3MGS B;  3REJ B;  4WU9 A;  1ZLA D;  1P3M A;  1AOI C;  4R8P B;  3MGP D;  5B31 A;  5B40 B;  3B6F C;  5B32 A;  1F1E A;  5BT1 C;  4AWL B;  3AZG C;  2HIO B;  3B0C T;  4YM6 D;  3WKJ D;  3KUY A;  1U35 D;  2Y2Q A;  3REL C;  3LZ0 B;  3LZ1 C;  4H9Q B;  5CPK D;  5GT0 A;  4G91 C;  3W96 D;  3EPJ A;  2ARO B;  3UTA A;  1P3O A;  3UT9 A;  3KXB C;  4H9N B;  4Z66 C;  2FJ7 A;  4J8X D;  5BO0 B;  2Y2P A;  3REK B;  1P3P A;  1BH8 B;  2PYO A;  4QLC C;  3KWQ A;  5AVC B;  5B2J C;  5AVB D;  5B31 G;  1P3K C;  5B32 G;  3X1T D;  3AZI C;  3LEL D;  3A6N C;  5CPJ A;  1ID3 B;  1M1A C;  4WNN B;  5GXQ B;  1P3B C;  4E44 A;  3AZN D;  3AZI B;  5E5A A;  4J8U A;  1KX5 A;  3AYW C;  3AL0 C;  3B6G B;  2F8N B;  3R45 B;  3O62 A;  1ZLA A;  3WAA D;  1PZR A;  3EG5 B;  3REH B;  3MGP A;  3UTB C;  5CHL B;  5DNN D;  3REL D;  3LJA C;  3MNN D;  2BYM A;  2NQB C;  5B1L B;  4YM6 A;  3WKJ A;  1U35 A;  2YFV B;  1M19 D;  3KSY A;  5B0Z B;  2NZD B;  5B0Y B;  5CPK A;  3W96 A;  2CWE A;  4YS3 D;  4J8V D;  3AZH B;  1EQZ B;  3EPK A;  5B2J D;  1HQ3 C;  3H0M C;  4CAY B;  4J8X A;  2RVQ D;  1M1A D;  3AN2 B;  5AVB A;  1BH9 A;  3X1V B;  3C1B C;  5CP6 C;  2ZY2 A;  3AZM B;  4XZQ C;  3AZL D;  3X1T A;  1KX3 B;  5JA4 B;  3LEL A;  1TZY D;  5CPI B;  2Y2I A;  3WA9 D;  4Z5T D;  3AZN A;  4J8W C;  1KU5 A;  5AV9 C;  3MGR D;  4NE6 A;  1WWI A;  5JRG C;  3UTB D;  4XUJ B;  2JE5 A;  3WAA A;  3C1C C;  1P3I B;  5B24 C;  5AV8 C;  3AZG A;  4WU9 B;  1P3M B;  3W98 B;  5JRG B;  3EPH A;  2Y2O A;  3B0D B;  5B31 B;  5DNN A;  3TU4 C;  3REL A;  5B32 B;  3MNN A;  4EO5 B;  1B6W A;  5B2I C;  1M19 A;  5G49 A;  2LY8 A;  3KUY B;  5BS7 A;  3AZK B;  1HQ3 D;  4YS3 A;  4J8V A;  5GT3 C;  5B2J A;  5F99 C;  3UTA B;  3UT9 B;  5CP6 D;  2Y2J A;  2JCH A;  5AV6 D;  5B33 C;  1P3A D;  3AZJ D;  2FJ7 B;  1M1A A;  3AZF D;  2PYO B;  1Z2C B;  4Z2M H;  3KWQ B;  3AZL A;  4Z2M G;  3W99 D;  5KDM A;  5CPJ B;  2IO5 B;  4LD9 C;  1TZY A;  3WA9 A;  1P34 B;  4Z5T A;  5AY8 B;  3MGR A;  2BG1 A;  5DNM D;  5AV5 D;  3X1S B;  4JJN C;  5E5A B;  3MGQ D;  4J8U B;  3UTB A;  3W97 B;  2HUE C;  3MVD C;  3AFA B;  1F66 C;  3REJ C;  3MGS C;  3O62 B;  1ZLA B;  5B2I D;  4R8P C;  4WZS B;  5B40 C;  3MGP B;  4ZBJ B;  4WU8 D;  4AWL C;  1S32 D;  2HIO C;  3VH5 W;  2YFW A;  4YM6 B;  1R4V A;  3WKJ B;  1U35 B;  3LZ0 C;  2Y2L A;  1HQ3 A;  1KX4 D;  3W96 B;  4NFT A;  3WTP C;  2ARO C;  3X1U B;  2Y2G A;  4KUD D;  5CP6 A;  1M18 D;  5B1M D;  5AV6 A;  3REK C;  1P3A A;  3AZJ A;  4J8X B;  3AZF A;  1A7W A;  3WTP B;  5AVC C;  3KFU G;  5AVB B;  3AV2 D;  2ZM5 A;  3H0L C;  3W99 A;  2CV5 B;  4KGC D;  1ID3 C;  4DRB A;  5GXQ C;  3MVD D;  5FUG A;  1F66 D;  5BNX B;  4ZUX D;  3AZN B;  5AV5 A;  5DNM A;  3B6F D;  3MGQ A;  3B6G C;  4X23 D;  5GSU D;  3REH C;  1AOI D;  5B2I A;  3WAA B;  2Y2H A;  5BT1 D;  5DNN B;  4WU8 A;  1JFI B;  3AZG D;  1S32 A;  4H9S C;  3MNN B;  5B1L C;  5BNV B;  2ARO D;  1N1J A;  5B0Z C;  1M19 B;  5G49 B;  3LZ1 D;  1P3G B;  2NZD C;  3B0C W;  1KX4 A;  1H3O A;  5B0Y C;  4H9R A;  3AZH C;  3AV1 B;  1EQZ C;  4YS3 B;  4J8V B;  4H9P B;  3KXB D;  4KUD A;  1M18 A;  4Z66 D;  5B1M A;  3REI B;  1ID3 D;  4QLC D;  3F6T A;  5GXQ D;  3AN2 C;  3X1V C;  4NE5 A;  3AV2 A;  1P3K D;  3AZM C;  1KX3 C;  3AZI D;  3AZE B;  3AZL B;  3A6N D;  4KGC A;  3MVD A;  1P3B D;  1F66 A;  5KDM B;  5CPI C;  3REH D;  3NQU B;  3WA9 B;  1P3L B;  4Z5T B;  4ZUX A;  3B6F A;  1P3F B;  3AYW D;  4H9O A;  3MGR B;  4NE3 A;  4X23 A;  5GSU A;  4XUJ C;  3VH6 A;  4KHA A;  1P3I C;  4DRA A;  1AOI A;  4WU9 C;  3B0B A;  2G5I C;  2J8P A;  1P3M C;  3W98 C;  3B0D C;  5B31 C;  4CSR B;  5B32 C;  3LJA D;  2XD5 A;  4EO5 C;  2NQB D;  3AZH D;  1EQZ D;  3A1K A;  2ARO A;  2YFW B;  1HTA A;  3KUY C;  3LZ1 A;  4H9N A;  3AZK C;  1B67 A;  5BO0 A;  3KXB A;  3X1V D;  2G5H C;  3FDD A;  3UTA C;  2ZY3 A;  3UT9 C;  4Z66 A;  1KX3 D;  1ID3 A;  2FJ7 C;  4QLC A;  5GT0 B;  5AV6 B;  5GXQ A;  4E45 A;  3AZJ B;  1P3A B;  3AZF B;  2PYO C;  3C1B D;  3KWQ C;  1P3O B;  1TAF A;  5CPI D;  1P3K A;  4XZQ D;  3AZI A;  3A6N A;  1P3P B;  3W99 B;  1P3B A;  5CPJ C;  2IO5 C;  3R45 A;  3WTP E;  3REH A;  3VH6 T;  1P34 C;  4J8W D;  5AV9 D;  5AY8 C;  3W98 D;  3AYW A;  5JRG D;  3X1S C;  3W97 C;  5E5A C;  5AV5 B;  5DNM B;  4J8U C;  3AFA C;  3MGQ B;  3C1C D;  5B24 D;  5AV8 D;  3O62 C;  4H9S A;  2VQR A;  1ZLA C;  3NQJ A;  3MGP C;  4M6B A;  4ZBJ C;  3TU4 D;  1KX5 B;  3LJA A;  3AZK D;  4WU8 B;  2NQB A;  3AZH A;  1EQZ A;  4YM6 C;  3WKJ C;  1U35 C;  2F8N G;  4CAY A;  2DF4 C;  1KX4 B;  2BYM B;  5CPK C;  3W96 C;  5GT3 D;  3X1V A;  3X1U C;  5F99 D;  4KUD B;  1M18 B;  1KX3 A;  5B33 D;  3A1I A;  5B1M B;  4J8X C;  5CPK B;  3C1B A;  5AVB C;  5CPI A;  4XZQ A;  1P34 D;  3AV2 B;  5AY8 D;  2CV5 C;  3X1S D;  3W97 D;  4KGC B;  3VH6 W;  3AFA D;  4LD9 D;  2DQN C;  4WV4 B;  1BH9 B;  4J8W A;  5AV9 A;  3W98 A;  3AZN C;  5JRG A;  4JJN D;  1W2E A;  5C3I B;  3X1T B;  4ZUX B;  3LEL B;  3B6F B;  4G92 B;  4H9O B;  4X23 B;  5GSU B;  3MGS D;  3C1C A;  3REJ D;  5B24 A;  4KHA B;  5AV8 A;  3WAA C;  4R8P D;  2F8N K;  2ZY4 A;  2ZY5 A;  1AOI B;  5B40 D;  3TU4 A;  5DNN C;  3AZK A;  2HIO D;  2Y2N A;  3MNN C;  3AZG B;  3X1U D;  3P5J B;  1M19 C;  3LZ0 D;  2RIQ A;  3REL B;  1P3G C;  5BS7 C;  3LZ1 B;  2JSS A;  1WWS A;  3AV1 C;  4G91 B;  5GT3 A;  4YS3 C;  3WTP D;  4J8V C;  5F99 A;  3KXB B;  2XD1 A;  3REI C;  1BFM A;  4Z66 B;  5B33 A;  3REK D;  2CV5 D;  5AVC D;  2RVQ C;  4QLC B;  5B2J B;  3V9R A;  1P34 A;  1TAF B;  1P3K B;  5AY8 A;  2BYK A;  4DQY B;  3AZE C;  3AZL C;  3W97 A;  3X1S A;  3A6N B;  1M1A B;  3AFA A;  4LD9 A;  1P3B B;  1T3U A;  1TZY C;  3WA9 C;  1P3L C;  4Z5T C;  4JJN A;  1P3F C;  3MGR C;  3B6G D;  3AYW B;  2F8N D;  4UUZ A;  3MGS A;  3REJ A;  1TZY B;  4R8P A;  5B40 A;  2FFF B;  4HGA C;  3NQJ B;  3UTB B;  1P3G D;  3LJA B;  2HIO A;  3AV1 D;  1Q9C A;  5B1L D;  2NQB B;  3X1U A;  3VH5 A;  4HGA B;  5B0Z D;  3LZ0 A;  4H9Q A;  2NZD D;  3REI D;  5B0Y D;  3WTP A;  4WJ3 C;  3REK A;  1HQ3 B;  3AZE D;  1BH8 A;  2CV5 A;  5GT0 C;  5AV6 C;  1P3A C;  5AVC A;  3AZJ C;  3H0R C;  3AZF C;  3AN2 D;  1P3O C;  2F2A C;  3C1B B;  3AZM D;  5CP6 B;  5BNX A;  4XZQ B;  1P3L D;  1P3F D;  1P3P C;  3W99 C;  4WNN A;  1ULY A;  4UPK A; 
#chains in the Genus database with same CATH homology
 4J8W B;  5AV9 B;  3B6G A;  5DNM C;  5AV5 C;  4XUJ D;  2F8N A;  3MGQ C;  1JFI A;  5FUG B;  1P3I D;  4WU9 D;  3C1C B;  5B24 B;  5AV8 B;  1P3M D;  2Y2M A;  5BNV A;  5B31 D;  1KX5 C;  5B32 D;  3TU4 B;  3VH5 T;  1P3G A;  4WU8 C;  3AV1 A;  5B1L A;  5B2I B;  1S32 C;  2YFV A;  4H9P A;  5B0Z A;  3KUY D;  3IP4 C;  2NZD A;  3REI A;  5B0Y A;  1KX4 C;  1S32 B;  5GT0 D;  2UWX A;  2F8N H;  5GT3 B;  3UTA D;  1P3O D;  3UT9 D;  2Y2K A;  1N1J B;  5F99 B;  4KUD C;  1M18 C;  3AZE A;  5B1M C;  1H3O B;  2FJ7 D;  1P3P D;  5B33 B;  2PYO D;  4H9R B;  3AN2 A;  3KWQ D;  3EPL A;  3AZM A;  3NQU A;  3V9R B;  5JA4 A;  3AV2 C;  1P3L A;  1P3F A;  2L5A A;  2BYK B;  4KGC C;  5CPJ D;  4LD9 B;  3X1T C;  5C3I C;  5E5A D;  4ZUX C;  3LEL C;  4CSR A;  4XUJ A;  4J8U D;  4JJN B;  2W8S A;  4G92 C;  1KX5 D;  4X23 C;  2HUE B;  5GSU C;  3MVD B;  1P3I A;  1F66 B;  4UUZ B;  3O62 D;  3MGS B;  3REJ B;  4WU9 A;  1ZLA D;  1P3M A;  1AOI C;  4R8P B;  3MGP D;  5B31 A;  5B40 B;  3B6F C;  5B32 A;  1F1E A;  5BT1 C;  4AWL B;  3AZG C;  2HIO B;  3B0C T;  4YM6 D;  3WKJ D;  3KUY A;  1U35 D;  2Y2Q A;  3REL C;  3LZ0 B;  3LZ1 C;  4H9Q B;  5CPK D;  5GT0 A;  4G91 C;  3W96 D;  3EPJ A;  2ARO B;  3UTA A;  1P3O A;  3UT9 A;  3KXB C;  4H9N B;  4Z66 C;  2FJ7 A;  4J8X D;  5BO0 B;  2Y2P A;  3REK B;  1P3P A;  1BH8 B;  2PYO A;  4QLC C;  3KWQ A;  5AVC B;  5B2J C;  5AVB D;  5B31 G;  1P3K C;  5B32 G;  3X1T D;  3AZI C;  3LEL D;  3A6N C;  5CPJ A;  1ID3 B;  1M1A C;  4WNN B;  5GXQ B;  1P3B C;  4E44 A;  3AZN D;  3AZI B;  5E5A A;  4J8U A;  1KX5 A;  3AYW C;  3AL0 C;  3B6G B;  2F8N B;  3R45 B;  3O62 A;  1ZLA A;  3WAA D;  1PZR A;  3EG5 B;  3REH B;  3MGP A;  3UTB C;  5CHL B;  5DNN D;  3REL D;  3LJA C;  3MNN D;  2BYM A;  2NQB C;  5B1L B;  4YM6 A;  3WKJ A;  1U35 A;  2YFV B;  1M19 D;  3KSY A;  5B0Z B;  2NZD B;  5B0Y B;  5CPK A;  3W96 A;  2CWE A;  4YS3 D;  4J8V D;  3AZH B;  1EQZ B;  3EPK A;  5B2J D;  1HQ3 C;  3H0M C;  4CAY B;  4J8X A;  2RVQ D;  1M1A D;  3AN2 B;  5AVB A;  1BH9 A;  3X1V B;  3C1B C;  5CP6 C;  2ZY2 A;  3AZM B;  4XZQ C;  3AZL D;  3X1T A;  1KX3 B;  5JA4 B;  3LEL A;  1TZY D;  5CPI B;  2Y2I A;  3WA9 D;  4Z5T D;  3AZN A;  4J8W C;  1KU5 A;  5AV9 C;  3MGR D;  4NE6 A;  1WWI A;  5JRG C;  3UTB D;  4XUJ B;  2JE5 A;  3WAA A;  3C1C C;  1P3I B;  5B24 C;  5AV8 C;  3AZG A;  4WU9 B;  1P3M B;  3W98 B;  5JRG B;  3EPH A;  2Y2O A;  3B0D B;  5B31 B;  5DNN A;  3TU4 C;  3REL A;  5B32 B;  3MNN A;  4EO5 B;  1B6W A;  5B2I C;  1M19 A;  5G49 A;  2LY8 A;  3KUY B;  5BS7 A;  3AZK B;  1HQ3 D;  4YS3 A;  4J8V A;  5GT3 C;  5B2J A;  5F99 C;  3UTA B;  3UT9 B;  5CP6 D;  2Y2J A;  2JCH A;  5AV6 D;  5B33 C;  1P3A D;  3AZJ D;  2FJ7 B;  1M1A A;  3AZF D;  2PYO B;  1Z2C B;  4Z2M H;  3KWQ B;  3AZL A;  4Z2M G;  3W99 D;  5KDM A;  5CPJ B;  2IO5 B;  4LD9 C;  1TZY A;  3WA9 A;  1P34 B;  4Z5T A;  5AY8 B;  3MGR A;  2BG1 A;  5DNM D;  5AV5 D;  3X1S B;  4JJN C;  5E5A B;  3MGQ D;  4J8U B;  3UTB A;  3W97 B;  2HUE C;  3MVD C;  3AFA B;  1F66 C;  3REJ C;  3MGS C;  3O62 B;  1ZLA B;  5B2I D;  4R8P C;  4WZS B;  5B40 C;  3MGP B;  4ZBJ B;  4WU8 D;  4AWL C;  1S32 D;  2HIO C;  3VH5 W;  2YFW A;  4YM6 B;  1R4V A;  3WKJ B;  1U35 B;  3LZ0 C;  2Y2L A;  1HQ3 A;  1KX4 D;  3W96 B;  4NFT A;  3WTP C;  2ARO C;  3X1U B;  2Y2G A;  4KUD D;  5CP6 A;  1M18 D;  5B1M D;  5AV6 A;  3REK C;  1P3A A;  3AZJ A;  4J8X B;  3AZF A;  1A7W A;  3WTP B;  5AVC C;  3KFU G;  5AVB B;  3AV2 D;  2ZM5 A;  3H0L C;  3W99 A;  2CV5 B;  4KGC D;  1ID3 C;  4DRB A;  5GXQ C;  3MVD D;  5FUG A;  1F66 D;  5BNX B;  4ZUX D;  3AZN B;  5AV5 A;  5DNM A;  3B6F D;  3MGQ A;  3B6G C;  4X23 D;  5GSU D;  3REH C;  1AOI D;  5B2I A;  3WAA B;  2Y2H A;  5BT1 D;  5DNN B;  4WU8 A;  1JFI B;  3AZG D;  1S32 A;  4H9S C;  3MNN B;  5B1L C;  5BNV B;  2ARO D;  1N1J A;  5B0Z C;  1M19 B;  5G49 B;  3LZ1 D;  1P3G B;  2NZD C;  3B0C W;  1KX4 A;  1H3O A;  5B0Y C;  4H9R A;  3AZH C;  3AV1 B;  1EQZ C;  4YS3 B;  4J8V B;  4H9P B;  3KXB D;  4KUD A;  1M18 A;  4Z66 D;  5B1M A;  3REI B;  1ID3 D;  4QLC D;  3F6T A;  5GXQ D;  3AN2 C;  3X1V C;  4NE5 A;  3AV2 A;  1P3K D;  3AZM C;  1KX3 C;  3AZI D;  3AZE B;  3AZL B;  3A6N D;  4KGC A;  3MVD A;  1P3B D;  1F66 A;  5KDM B;  5CPI C;  3REH D;  3NQU B;  3WA9 B;  1P3L B;  4Z5T B;  4ZUX A;  3B6F A;  1P3F B;  3AYW D;  4H9O A;  3MGR B;  4NE3 A;  4X23 A;  5GSU A;  4XUJ C;  3VH6 A;  4KHA A;  1P3I C;  4DRA A;  1AOI A;  4WU9 C;  3B0B A;  2G5I C;  2J8P A;  1P3M C;  3W98 C;  3B0D C;  5B31 C;  4CSR B;  5B32 C;  3LJA D;  2XD5 A;  4EO5 C;  2NQB D;  3AZH D;  1EQZ D;  3A1K A;  2ARO A;  2YFW B;  1HTA A;  3KUY C;  3LZ1 A;  4H9N A;  3AZK C;  1B67 A;  5BO0 A;  3KXB A;  3X1V D;  2G5H C;  3FDD A;  3UTA C;  2ZY3 A;  3UT9 C;  4Z66 A;  1KX3 D;  1ID3 A;  2FJ7 C;  4QLC A;  5GT0 B;  5AV6 B;  5GXQ A;  4E45 A;  3AZJ B;  1P3A B;  3AZF B;  2PYO C;  3C1B D;  3KWQ C;  1P3O B;  1TAF A;  5CPI D;  1P3K A;  4XZQ D;  3AZI A;  3A6N A;  1P3P B;  3W99 B;  1P3B A;  5CPJ C;  2IO5 C;  3R45 A;  3WTP E;  3REH A;  3VH6 T;  1P34 C;  4J8W D;  5AV9 D;  5AY8 C;  3W98 D;  3AYW A;  5JRG D;  3X1S C;  3W97 C;  5E5A C;  5AV5 B;  5DNM B;  4J8U C;  3AFA C;  3MGQ B;  3C1C D;  5B24 D;  5AV8 D;  3O62 C;  4H9S A;  2VQR A;  1ZLA C;  3NQJ A;  3MGP C;  4M6B A;  4ZBJ C;  3TU4 D;  1KX5 B;  3LJA A;  3AZK D;  4WU8 B;  2NQB A;  3AZH A;  1EQZ A;  4YM6 C;  3WKJ C;  1U35 C;  2F8N G;  4CAY A;  2DF4 C;  1KX4 B;  2BYM B;  5CPK C;  3W96 C;  5GT3 D;  3X1V A;  3X1U C;  5F99 D;  4KUD B;  1M18 B;  1KX3 A;  5B33 D;  3A1I A;  5B1M B;  4J8X C;  5CPK B;  3C1B A;  5AVB C;  5CPI A;  4XZQ A;  1P34 D;  3AV2 B;  5AY8 D;  2CV5 C;  3X1S D;  3W97 D;  4KGC B;  3VH6 W;  3AFA D;  4LD9 D;  2DQN C;  4WV4 B;  1BH9 B;  4J8W A;  5AV9 A;  3W98 A;  3AZN C;  5JRG A;  4JJN D;  1W2E A;  5C3I B;  3X1T B;  4ZUX B;  3LEL B;  3B6F B;  4G92 B;  4H9O B;  4X23 B;  5GSU B;  3MGS D;  3C1C A;  3REJ D;  5B24 A;  4KHA B;  5AV8 A;  3WAA C;  4R8P D;  2F8N K;  2ZY4 A;  2ZY5 A;  1AOI B;  5B40 D;  3TU4 A;  5DNN C;  3AZK A;  2HIO D;  2Y2N A;  3MNN C;  3AZG B;  3X1U D;  3P5J B;  1M19 C;  3LZ0 D;  2RIQ A;  3REL B;  1P3G C;  5BS7 C;  3LZ1 B;  2JSS A;  1WWS A;  3AV1 C;  4G91 B;  5GT3 A;  4YS3 C;  3WTP D;  4J8V C;  5F99 A;  3KXB B;  2XD1 A;  3REI C;  1BFM A;  4Z66 B;  5B33 A;  3REK D;  2CV5 D;  5AVC D;  2RVQ C;  4QLC B;  5B2J B;  3V9R A;  1P34 A;  1TAF B;  1P3K B;  5AY8 A;  2BYK A;  4DQY B;  3AZE C;  3AZL C;  3W97 A;  3X1S A;  3A6N B;  1M1A B;  3AFA A;  4LD9 A;  1P3B B;  1T3U A;  1TZY C;  3WA9 C;  1P3L C;  4Z5T C;  4JJN A;  1P3F C;  3MGR C;  3B6G D;  3AYW B;  2F8N D;  4UUZ A;  3MGS A;  3REJ A;  1TZY B;  4R8P A;  5B40 A;  2FFF B;  4HGA C;  3NQJ B;  3UTB B;  1P3G D;  3LJA B;  2HIO A;  3AV1 D;  1Q9C A;  5B1L D;  2NQB B;  3X1U A;  3VH5 A;  4HGA B;  5B0Z D;  3LZ0 A;  4H9Q A;  2NZD D;  3REI D;  5B0Y D;  3WTP A;  4WJ3 C;  3REK A;  1HQ3 B;  3AZE D;  1BH8 A;  2CV5 A;  5GT0 C;  5AV6 C;  1P3A C;  5AVC A;  3AZJ C;  3H0R C;  3AZF C;  3AN2 D;  1P3O C;  2F2A C;  3C1B B;  3AZM D;  5CP6 B;  5BNX A;  4XZQ B;  1P3L D;  1P3F D;  1P3P C;  3W99 C;  4WNN A;  1ULY A;  4UPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...