3WTPA

Crystal structure of the heterotypic nucleosome containing human cenp-a and h3.3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
89
structure length
89
Chain Sequence
GWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Histone H3-like centromeric protein A
total genus 31
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wtpA00
3UTBD 3X1SD 4QLCB 3KWQA 3UTAB 3X1VD 1BH9A 1TAFB 4QLCA 4ZBJC 3O62D 1M19B 2NZDA 5B31C 1KX4B 3LZ1A 3AFAC 3AFAD 4QLCC 1ID3D 1BH8A 3NQUA 3AV1D 1P3OC 3MVDD 1A7WA 3AN2B 5B2JC 1AOID 5AV5C 4KUDB 4Z5TB 1KX4C 3AV1B 1BFMA 3X1SC 5B40D 3LJAC 1U35D 1M18B 5GSUD 3TU4B 1M19D 4KHAA 5AV6B 4JJNB 3W96B 5GT3B 5AV9A 4J8UD 1M19A 3KXBD 3MGQC 4YS3A 3MNNA 3AZMC 5CPJC 2HIOC 4R8PB 3LELA 5AV8B 4XZQB 3KWQD 4J8VC 1B67A 5KDMA 4WU9A 5B0YC 1ZLAB 3VH5A 3X1TD 3RELB 1EQZD 5F99C 3NQJA 3AZMB 3AV2D 3KUYD 1WWIA 3REIB 4LD9C 1P3MC 5DNND 3AZLB 4ZUXA 3RELC 3KUYB 5G49A 4EO5B 3AV2B 5GT0B 4XUJB 2YFVB 1P3LD 3WA9D 3RELD 1ZLAD 4R8PA 3B6GC 5JRGA 3REHA 3B0CT 3WTPD 2NQBD 3AZIA 1S32A 3AV2C 5GXQC 3C1CC 5B24B 3B6FA 3KXBB 5AVBA 4H9NA 3C1BD 2AROC 1TZYB 4J8UB 2BYMA 3REJB 3B0DC 3WAAB 3X1UB 3AZFC 3AZHD 4KGCA 4ZUXB 3TU4D 2HIOD 5CPJD 3AZHC 4J8UC 5G49B 4Z5TD 3NQUB 5C3IC 3C1BC 3A6NB 3MNNC 5CPJA 5B32C 1M19C 3MGPA 3MVDB 5GSUC 3WTPC 3LJAD 4NE3A 5B40C 3LZ0D 1P3KC 1KX4D 1ZLAC 2CWEA 1P3LC 3WA9C 3O62B 3AZGB 3MVDC 3W96A 1P3OD 5AV5A 4QLCD 3X1SB 4LD9D 3REKC 1Q9CA 1P3FA 3B0BA 3O62C 3UT9C 1P3PC 2BYKB 3LZ1C 5B1LB 3VH6W 4E45A 3AZJD 3TU4A 3X1TC 5E5AC 1P3IA 1KX5B 3WKJB 3MGSD 4NE5A 2NZDC 3B6GB 3WKJC 3KWQC 1M1AC 2IO5B 1P3BB 5B1MD 3UT9B 5GXQB 3C1CB 5KDMB 2CV5D 3KXBC 3MGQD 5AY8D 3W98C 5B0YB 4CSRA 1F66B 5B1MA 5DNMA 3X1UA 1H3OB 5B31B 5CHLB 1U35C 5B2JB 3LELD 2PYOA 3AZLC 1F66C 3AZGA 3VH5W 5CP6B 1P3AC 3KSYA 4WU9D 5B2JD 4G92C 4KUDA 3X1VA 4H9QB 4XUJA 4Z66C 4WU8D 1P3AA 3AZLA 1BH8B 3MGSA 3AV1A 2FJ7A 4WU8B 1WWSA 1HQ3C 1KX5D 3WKJD 3AZJB 5BNXA 4WU9B 5DNMD 3WTPE 3REHD 3LZ1B 2RVQD 2BYMB 3W98A 3KXBA 3LELB 1BH9B 1TAFA 5CPIB 3W99C 5E5AA 1P3FB 3AZGD 5AV6C 4J8XA 3UT9A 1M18A 3LZ0B 1P3PA 3O62A 5AV8C 1P3BD 4WNNA 1P3FC 1EQZA 5B0ZC 4YM6B 5JA4A 1P3GC 3AZEC 5CPKC 3REIA 1N1JA 3MGSB 3REJC 3W96C 1P3LA 3WA9A 2F8NA 5B1LD 2F8NK 1P3KA 5CP6C 1P3AB 1P3PB 5B2ID 5JRGD 5B40A 2YFWA 3MGPC 4LD9B 4YM6C 3B0CW 5B32A 3AZFB 1P3GB 3B6FD 3WTPA 1P34D 3WAAD 4XZQA 4EO5C 3AN2C 3AYWC 5B24D 3AZHA 3C1BA 3W98B 5GT3A 2YFWB 2NQBB 5BT1C 4KGCC 4KHAB 4H9SC 4J8XD 3V9RB 3A6NA 3MGRD 4E44A 3LJAB 4CSRB 4WZSB 2F8NG 1N1JB 5GT0C 5B24C 5BNVB 5GXQA 3A6ND 3MGRA 3C1CA 1S32C 1P3BA 4H9OA 2AROA 5B33D 4X23D 5AVBC 5DNNB 5BNVA 3B6FC 3AZNA 3B6GA 3AV2A 3AZIC 2HIOB 4R8PC 4J8WC 3REID 3W99B 4H9OB 4ZUXD 1TZYA 3V9RA 5JRGC 5B1LA 3AZND 5B2IC 4Z66B 4H9QA 5B2IA 3X1UD 3W97C 5B1LC 1EQZB 1TZYC 1TZYD 3C1BB 4J8WA 3REJD 1R4VA 3AZNC 3LZ0A 5B0ZD 3UTAA 4ZUXC 3RELA 3KWQB 4XZQD 3WTPB 5AV8D 1P3BC 4R8PD 5GT0A 5F99A 5AVBD 1HQ3B 5GT3D 4JJND 3A6NC 1ULYA 4XUJD 5AV6D 5GT0D 4Z2MH 1HTAA 1KX3D 4G91C 3W99D 5B0YA 5B40B 3AZMA 5JA4B 4YS3C 3MGQA 5CPIC 2FJ7D 5B33B 5B31G 4X23B 4J8VA 1JFIA 1P3ID 2F8NB 2F8NH 3AZKB 4H9PA 4CAYA 1AOIB 4YM6A 3AN2D 3X1TB 4H9RA 1P34C 3MGRB 1ID3B 4J8XB 3AFAB 4HGAB 5BS7C 5AVCC 2CV5A 5CP6A 3LJAA 2PYOB 4H9NB 4DRBA 1KU5A 3REJA 3AZEA 3X1SA 5CPKA 3X1VB 5B2JA 5B0ZA 3UTAD 1P34B 1P3OA 3W96D 4UUZB 1P3GD 3AFAA 2PYOD 1M18C 5GSUB 1M18D 1U35B 1P3AD 4KUDD 1H3OA 5B31A 4Z2MG 3AZKD 4G92B 2L5AA 2F8ND 1P3IB 1KX5A 3WKJA 2HUEB 2FJ7B 3NQJB 4M6BA 3VH5T 1KX3B 1HQ3A 2RVQC 5BS7A 5AVCA 2CV5C 5BO0B 1P34A 1HQ3D 5CPID 5AVBB 2FJ7C 2BYKA 5BO0A 3UTBB 3MGSC 2NZDD 5E5AD 5AV9B 3AZJC 2IO5C 5CPIA 5B0ZB 3LZ1D 3UTBA 3AZKC 5DNMB 4XUJC 4Z66A 5AV5B 4JJNC 4KUDC 3MGPB 4Z66D 3AZNB 1ID3A 1F66A 4J8VB 2PYOC 4WU8A 4CAYB 1AOIA 1U35A 3UTAC 1JFIB 3LZ0C 3X1UC 3W97D 2NQBA 3WAAA 3W97A 3AZID 1P3MB 5B32D 5AVCD 3AZEB 3MNND 5CPKB 4X23C 5B33C 1M1AA 5C3IB 5AY8C 1S32D 5F99B 3W98D 5B32G 1M1AD 1P3IC 4DRAA 3TU4C 2JSSA 2HUEC 3X1TA 3MGRC 2YFVA 5B24A 4YS3D 3B6FB 3AZFD 4KGCD 5BT1D 1P3KB 1KX3C 5JRGB 3REKA 3MGQB 4H9SA 2CV5B 5B2IB 1P3PD 5GXQD 3C1CD 3AYWD 5B1MB 3R45B 5FUGB 2AROB 3UT9D 4Z5TA 5GT3C 3MVDA 3REKD 3B6GD 3AYWA 4YM6D 3AN2A 5DNNA 3KUYA 4XZQC 4AWLC 1ZLAA 1F1EA 2LY8A 3AYWB 5GSUA 3B0DB 3R45A 5FUGA 5DNNC 1P3KD 4KGCB 4YS3B 4UUZA 4J8WB 1P3OB 4AWLB 1P3FD 4G91B 3KUYC 4J8WD 3REIC 4J8UA 1P3GA 5F99D 1S32B 1EQZC 5BNXB 4Z5TC 1B6WA 5AV8A 3REHB 3MNNB 4HGAC 5AVCB 5B32B 4WV4B 3AZFA 1KX3A 4H9RB 5AV6A 4J8XC 4NFTA 3W97B 3REKB 4WNNB 3VH6T 3W99A 2AROD 5B33A 4X23A 3REHC 5AY8A 5CPJB 3WAAC 2NQBC 3AZHB 3MGPD 1M1AB 5AV5D 4NE6A 1AOIC 5CP6D 1P3MA 4LD9A 3VH6A 5E5AB 3AV1C 2NZDB 1ID3C 4WU8C 3AZED 5CPKD 3AZIB 1P3MD 1P3LB 5B31D 3WA9B 4JJNA 4WU9C 3X1VC 1F66D 3AZJA 3AZLD 5B0YD 5AY8B 3LELC 2HIOA 4H9PB 3UTBC 3AZKA 3AZGC 5AV9C 4J8VD 3AZMD 5DNMC 4ZBJB 5B1MC 1KX4A 5AV9D 1KX5C
chains in the Genus database with same CATH superfamily
3UTBD 3X1SD 4QLCB 3KWQA 3UTAB 3X1VD 1BH9A 1TAFB 4QLCA 4ZBJC 3O62D 2JCHA 1M19B 2NZDA 5B31C 1KX4B 3LZ1A 3AFAC 3AFAD 4QLCC 1ID3D 2Y2QA 1BH8A 3NQUA 3AV1D 1P3OC 3MVDD 2Y2LA 1A7WA 3AN2B 5B2JC 2G5HC 1AOID 2BG1A 5AV5C 4KUDB 4Z5TB 1KX4C 3AV1B 1BFMA 3X1SC 2Y2NA 5B40D 3LJAC 1U35D 1M18B 5GSUD 3TU4B 1M19D 4KHAA 5AV6B 4JJNB 3W96B 5GT3B 5AV9A 4J8UD 1M19A 3KXBD 3MGQC 4YS3A 3MNNA 3AZMC 5CPJC 2HIOC 4R8PB 3LELA 5AV8B 1Z2CB 4XZQB 3KWQD 4J8VC 2ZY3A 1B67A 5KDMA 4WU9A 5B0YC 1ZLAB 3VH5A 3X1TD 3RELB 1EQZD 5F99C 3NQJA 3AZMB 3AV2D 3KUYD 1WWIA 3REIB 4LD9C 1P3MC 5DNND 3AZLB 4ZUXA 3RELC 3KUYB 5G49A 4EO5B 3AV2B 5GT0B 2W8SA 4XUJB 2YFVB 1P3LD 3WA9D 3RELD 1ZLAD 4R8PA 3B6GC 5JRGA 3REHA 3B0CT 3WTPD 2NQBD 3AZIA 1S32A 3AV2C 5GXQC 3C1CC 5B24B 3B6FA 3KXBB 5AVBA 4H9NA 3C1BD 2AROC 1TZYB 4J8UB 2BYMA 3IP4C 1PZRA 3REJB 3B0DC 3WAAB 3X1UB 3AZFC 3AZHD 4KGCA 4ZUXB 3TU4D 2HIOD 5CPJD 3AZHC 2Y2GA 4J8UC 2FFFB 5G49B 3H0MC 2ZM5A 4Z5TD 3NQUB 5C3IC 3H0RC 3A6NB 3MNNC 3C1BC 5CPJA 5B32C 3EPLA 1M19C 3MGPA 3MVDB 5GSUC 3WTPC 3LJAD 4NE3A 5B40C 3LZ0D 1P3KC 1KX4D 1ZLAC 2CWEA 1P3LC 3WA9C 3O62B 3AZGB 3MVDC 3W96A 1P3OD 5AV5A 3A1KA 4QLCD 3X1SB 2Y2IA 4LD9D 3REKC 1Q9CA 1P3FA 3B0BA 3O62C 3UT9C 1P3PC 2BYKB 3LZ1C 5B1LB 3VH6W 4E45A 3AZJD 3TU4A 3X1TC 5E5AC 1P3IA 1KX5B 3WKJB 3MGSD 4NE5A 2NZDC 3B6GB 2ZY2A 3WKJC 3KWQC 1M1AC 2IO5B 1P3BB 5B1MD 3UT9B 5GXQB 3C1CB 5KDMB 2CV5D 3KXBC 3MGQD 5AY8D 3W98C 5B0YB 3F6TA 4CSRA 1F66B 5B1MA 5DNMA 3X1UA 1H3OB 5B31B 5CHLB 1U35C 5B2JB 3LELD 2PYOA 3AZLC 1F66C 3AZGA 3VH5W 5CP6B 1P3AC 2UWXA 3KSYA 4WU9D 5B2JD 4G92C 4KUDA 3X1VA 4H9QB 4XUJA 4Z66C 4WU8D 1P3AA 3AZLA 1BH8B 3MGSA 2Y2HA 3AV1A 2FJ7A 4WU8B 1WWSA 1HQ3C 4WJ3C 1KX5D 3WKJD 3AZJB 5BNXA 4WU9B 5DNMD 3WTPE 2ZY5A 3REHD 3LZ1B 2RVQD 2BYMB 3W98A 3KXBA 3LELB 1BH9B 1TAFA 5CPIB 3FDDA 3H0LC 3W99C 5E5AA 1P3FB 4DQYB 3AZGD 5AV6C 4J8XA 3UT9A 1M18A 3LZ0B 1P3PA 3O62A 5AV8C 1P3BD 4WNNA 1P3FC 1EQZA 5B0ZC 4YM6B 5JA4A 1P3GC 3AZEC 5CPKC 3REIA 1N1JA 3MGSB 3REJC 3W96C 1P3LA 3WA9A 2JE5A 2F8NA 5B1LD 2F8NK 1P3KA 5CP6C 1P3AB 1P3PB 5B2ID 3KFUG 5JRGD 5B40A 2YFWA 3MGPC 4LD9B 4YM6C 3B0CW 5B32A 3AZFB 1P3GB 3B6FD 3WTPA 1P34D 3WAAD 4XZQA 4EO5C 3AN2C 3AYWC 5B24D 3AZHA 3C1BA 3W98B 5GT3A 2YFWB 2NQBB 5BT1C 4KGCC 4KHAB 4H9SC 2VQRA 4J8XD 3V9RB 3A6NA 3MGRD 4E44A 3LJAB 4CSRB 4WZSB 2F8NG 1N1JB 5GT0C 5B24C 5BNVB 5GXQA 3A6ND 3MGRA 3C1CA 1S32C 1P3BA 4H9OA 2AROA 5B33D 4X23D 5AVBC 5DNNB 5BNVA 3B6FC 3AZNA 3B6GA 3AV2A 3AZIC 2HIOB 4R8PC 4J8WC 3REID 3W99B 4H9OB 2XD5A 4ZUXD 1TZYA 3V9RA 5JRGC 5B1LA 3AZND 5B2IC 4Z66B 4H9QA 5B2IA 3X1UD 3W97C 5B1LC 1EQZB 1TZYC 1TZYD 3C1BB 1T3UA 3P5JB 1R4VA 4J8WA 2Y2OA 3REJD 3AZNC 3LZ0A 5B0ZD 3UTAA 4ZUXC 3RELA 3KWQB 4XZQD 3WTPB 5AV8D 1P3BC 4R8PD 5GT0A 5F99A 5AVBD 1HQ3B 5GT3D 4JJND 3A6NC 1ULYA 4XUJD 5AV6D 5GT0D 4Z2MH 3AL0C 1HTAA 1KX3D 4G91C 3W99D 5B0YA 5B40B 3AZMA 5JA4B 4YS3C 3MGQA 5CPIC 2FJ7D 5B33B 5B31G 4X23B 4J8VA 1JFIA 1P3ID 2F8NB 2F8NH 3AZKB 4H9PA 4CAYA 1AOIB 4YM6A 3AN2D 3X1TB 4H9RA 1P34C 3MGRB 1ID3B 4J8XB 3AFAB 4HGAB 5BS7C 5AVCC 2CV5A 5CP6A 3LJAA 2PYOB 4H9NB 4DRBA 1KU5A 3REJA 3AZEA 3X1SA 5CPKA 3X1VB 5B2JA 5B0ZA 3UTAD 1P34B 1P3OA 3W96D 4UUZB 1P3GD 3AFAA 2PYOD 1M18C 5GSUB 1M18D 1U35B 1P3AD 4KUDD 1H3OA 5B31A 4Z2MG 3AZKD 4G92B 2L5AA 2F8ND 1P3IB 1KX5A 3WKJA 2HUEB 2FJ7B 3NQJB 4M6BA 3VH5T 1KX3B 1HQ3A 2RVQC 5BS7A 5AVCA 2CV5C 5BO0B 1P34A 1HQ3D 5CPID 5AVBB 2FJ7C 2BYKA 5BO0A 3UTBB 3MGSC 2NZDD 1W2EA 5E5AD 5AV9B 3AZJC 2IO5C 5CPIA 5B0ZB 3LZ1D 3UTBA 3AZKC 5DNMB 4XUJC 4Z66A 5AV5B 4JJNC 4KUDC 4UPKA 3MGPB 4Z66D 3AZNB 1ID3A 1F66A 4J8VB 2PYOC 2DQNC 4WU8A 4CAYB 3EG5B 1AOIA 2J8PA 1U35A 3UTAC 1JFIB 3LZ0C 3X1UC 3W97D 2NQBA 3WAAA 3W97A 3AZID 1P3MB 5B32D 2Y2MA 5AVCD 3AZEB 3MNND 5CPKB 4X23C 5B33C 1M1AA 2XD1A 5C3IB 5AY8C 1S32D 5F99B 3W98D 2Y2JA 5B32G 1M1AD 1P3IC 4DRAA 3TU4C 2JSSA 2HUEC 3X1TA 3MGRC 2YFVA 5B24A 4YS3D 3B6FB 3AZFD 4KGCD 5BT1D 1P3KB 2G5IC 2DF4C 1KX3C 5JRGB 3REKA 3MGQB 4H9SA 2CV5B 5B2IB 1P3PD 5GXQD 3C1CD 3AYWD 5B1MB 3R45B 5FUGB 2AROB 3UT9D 4Z5TA 5GT3C 3MVDA 3REKD 3B6GD 3AYWA 4YM6D 3AN2A 5DNNA 3KUYA 4XZQC 4AWLC 1ZLAA 1F1EA 2LY8A 3AYWB 5GSUA 3B0DB 3R45A 5FUGA 5DNNC 1P3KD 2F2AC 4KGCB 4YS3B 4UUZA 4J8WB 2ZY4A 1P3OB 4AWLB 1P3FD 4G91B 3KUYC 4J8WD 3REIC 4J8UA 1P3GA 5F99D 1S32B 1EQZC 5BNXB 4Z5TC 2Y2KA 1B6WA 5AV8A 3REHB 3MNNB 4HGAC 5AVCB 5B32B 4WV4B 3AZFA 1KX3A 4H9RB 5AV6A 4J8XC 4NFTA 3W97B 3REKB 4WNNB 3VH6T 3W99A 2AROD 5B33A 4X23A 3REHC 3EPHA 5AY8A 5CPJB 3WAAC 2NQBC 3A1IA 2RIQA 3AZHB 3MGPD 1M1AB 5AV5D 4NE6A 1AOIC 5CP6D 3EPJA 1P3MA 4LD9A 3VH6A 5E5AB 3AV1C 2NZDB 1ID3C 4WU8C 3AZED 5CPKD 3AZIB 1P3MD 1P3LB 5B31D 3WA9B 4JJNA 4WU9C 3X1VC 1F66D 3AZJA 3AZLD 5B0YD 5AY8B 3LELC 2HIOA 4H9PB 3UTBC 3AZKA 3AZGC 5AV9C 4J8VD 3AZMD 2Y2PA 5DNMC 4ZBJB 5B1MC 3EPKA 1KX4A 5AV9D 1KX5C
chains in the Genus database with same CATH topology
3UTBD 3X1SD 4QLCB 3KWQA 3UTAB 3X1VD 1BH9A 1TAFB 4QLCA 4ZBJC 3O62D 2JCHA 1M19B 2NZDA 5B31C 1KX4B 3LZ1A 3AFAC 3AFAD 4QLCC 1ID3D 2Y2QA 1BH8A 3NQUA 3AV1D 1P3OC 3MVDD 2Y2LA 1A7WA 3AN2B 5B2JC 2G5HC 1AOID 2BG1A 5AV5C 4KUDB 4Z5TB 1KX4C 3AV1B 1BFMA 3X1SC 2Y2NA 5B40D 3LJAC 1U35D 1M18B 5GSUD 3TU4B 1M19D 4KHAA 5AV6B 4JJNB 3W96B 5GT3B 5AV9A 4J8UD 1M19A 3KXBD 3MGQC 4YS3A 3MNNA 3AZMC 5CPJC 2HIOC 4R8PB 3LELA 5AV8B 1Z2CB 4XZQB 3KWQD 4J8VC 2ZY3A 1B67A 5KDMA 4WU9A 5B0YC 1ZLAB 3VH5A 3X1TD 3RELB 1EQZD 5F99C 3NQJA 3AZMB 3AV2D 3KUYD 1WWIA 3REIB 4LD9C 1P3MC 5DNND 3AZLB 4ZUXA 3RELC 3KUYB 5G49A 4EO5B 3AV2B 5GT0B 2W8SA 4XUJB 2YFVB 1P3LD 3WA9D 3RELD 1ZLAD 4R8PA 3B6GC 5JRGA 3REHA 3B0CT 3WTPD 2NQBD 3AZIA 1S32A 3AV2C 5GXQC 3C1CC 5B24B 3B6FA 3KXBB 5AVBA 4H9NA 3C1BD 2AROC 1TZYB 4J8UB 2BYMA 3IP4C 1PZRA 3REJB 3B0DC 3WAAB 3X1UB 3AZFC 3AZHD 4KGCA 4ZUXB 3TU4D 2HIOD 5CPJD 3AZHC 2Y2GA 4J8UC 2FFFB 5G49B 3H0MC 2ZM5A 4Z5TD 3NQUB 5C3IC 3H0RC 3A6NB 3MNNC 3C1BC 5CPJA 5B32C 3EPLA 1M19C 3MGPA 3MVDB 5GSUC 3WTPC 3LJAD 4NE3A 5B40C 3LZ0D 1P3KC 1KX4D 1ZLAC 2CWEA 1P3LC 3WA9C 3O62B 3AZGB 3MVDC 3W96A 1P3OD 5AV5A 3A1KA 4QLCD 3X1SB 2Y2IA 4LD9D 3REKC 1Q9CA 1P3FA 3B0BA 3O62C 3UT9C 1P3PC 2BYKB 3LZ1C 5B1LB 3VH6W 4E45A 3AZJD 3TU4A 3X1TC 5E5AC 1P3IA 1KX5B 3WKJB 3MGSD 4NE5A 2NZDC 3B6GB 2ZY2A 3WKJC 3KWQC 1M1AC 2IO5B 1P3BB 5B1MD 3UT9B 5GXQB 3C1CB 5KDMB 2CV5D 3KXBC 3MGQD 5AY8D 3W98C 5B0YB 3F6TA 4CSRA 1F66B 5B1MA 5DNMA 3X1UA 1H3OB 5B31B 5CHLB 1U35C 5B2JB 3LELD 2PYOA 3AZLC 1F66C 3AZGA 3VH5W 5CP6B 1P3AC 2UWXA 3KSYA 4WU9D 5B2JD 4G92C 4KUDA 3X1VA 4H9QB 4XUJA 4Z66C 4WU8D 1P3AA 3AZLA 1BH8B 3MGSA 2Y2HA 3AV1A 2FJ7A 4WU8B 1WWSA 1HQ3C 4WJ3C 1KX5D 3WKJD 3AZJB 5BNXA 4WU9B 5DNMD 3WTPE 2ZY5A 3REHD 3LZ1B 2RVQD 2BYMB 3W98A 3KXBA 3LELB 1BH9B 1TAFA 5CPIB 3FDDA 3H0LC 3W99C 5E5AA 1P3FB 4DQYB 3AZGD 5AV6C 4J8XA 3UT9A 1M18A 3LZ0B 1P3PA 3O62A 5AV8C 1P3BD 4WNNA 1P3FC 1EQZA 5B0ZC 4YM6B 5JA4A 1P3GC 3AZEC 5CPKC 3REIA 1N1JA 3MGSB 3REJC 3W96C 1P3LA 3WA9A 2JE5A 2F8NA 5B1LD 2F8NK 1P3KA 5CP6C 1P3AB 1P3PB 5B2ID 3KFUG 5JRGD 5B40A 2YFWA 3MGPC 4LD9B 4YM6C 3B0CW 5B32A 3AZFB 1P3GB 3B6FD 3WTPA 1P34D 3WAAD 4XZQA 4EO5C 3AN2C 3AYWC 5B24D 3AZHA 3C1BA 3W98B 5GT3A 2YFWB 2NQBB 5BT1C 4KGCC 4KHAB 4H9SC 2VQRA 4J8XD 3V9RB 3A6NA 3MGRD 4E44A 3LJAB 4CSRB 4WZSB 2F8NG 1N1JB 5GT0C 5B24C 5BNVB 5GXQA 3A6ND 3MGRA 3C1CA 1S32C 1P3BA 4H9OA 2AROA 5B33D 4X23D 5AVBC 5DNNB 5BNVA 3B6FC 3AZNA 3B6GA 3AV2A 3AZIC 2HIOB 4R8PC 4J8WC 3REID 3W99B 4H9OB 2XD5A 4ZUXD 1TZYA 3V9RA 5JRGC 5B1LA 3AZND 5B2IC 4Z66B 4H9QA 5B2IA 3X1UD 3W97C 5B1LC 1EQZB 1TZYC 1TZYD 3C1BB 1T3UA 3P5JB 1R4VA 4J8WA 2Y2OA 3REJD 3AZNC 3LZ0A 5B0ZD 3UTAA 4ZUXC 3RELA 3KWQB 4XZQD 3WTPB 5AV8D 1P3BC 4R8PD 5GT0A 5F99A 5AVBD 1HQ3B 5GT3D 4JJND 3A6NC 1ULYA 4XUJD 5AV6D 5GT0D 4Z2MH 3AL0C 1HTAA 1KX3D 4G91C 3W99D 5B0YA 5B40B 3AZMA 5JA4B 4YS3C 3MGQA 5CPIC 2FJ7D 5B33B 5B31G 4X23B 4J8VA 1JFIA 1P3ID 2F8NB 2F8NH 3AZKB 4H9PA 4CAYA 1AOIB 4YM6A 3AN2D 3X1TB 4H9RA 1P34C 3MGRB 1ID3B 4J8XB 3AFAB 4HGAB 5BS7C 5AVCC 2CV5A 5CP6A 3LJAA 2PYOB 4H9NB 4DRBA 1KU5A 3REJA 3AZEA 3X1SA 5CPKA 3X1VB 5B2JA 5B0ZA 3UTAD 1P34B 1P3OA 3W96D 4UUZB 1P3GD 3AFAA 2PYOD 1M18C 5GSUB 1M18D 1U35B 1P3AD 4KUDD 1H3OA 5B31A 4Z2MG 3AZKD 4G92B 2L5AA 2F8ND 1P3IB 1KX5A 3WKJA 2HUEB 2FJ7B 3NQJB 4M6BA 3VH5T 1KX3B 1HQ3A 2RVQC 5BS7A 5AVCA 2CV5C 5BO0B 1P34A 1HQ3D 5CPID 5AVBB 2FJ7C 2BYKA 5BO0A 3UTBB 3MGSC 2NZDD 1W2EA 5E5AD 5AV9B 3AZJC 2IO5C 5CPIA 5B0ZB 3LZ1D 3UTBA 3AZKC 5DNMB 4XUJC 4Z66A 5AV5B 4JJNC 4KUDC 4UPKA 3MGPB 4Z66D 3AZNB 1ID3A 1F66A 4J8VB 2PYOC 2DQNC 4WU8A 4CAYB 3EG5B 1AOIA 2J8PA 1U35A 3UTAC 1JFIB 3LZ0C 3X1UC 3W97D 2NQBA 3WAAA 3W97A 3AZID 1P3MB 5B32D 2Y2MA 5AVCD 3AZEB 3MNND 5CPKB 4X23C 5B33C 1M1AA 2XD1A 5C3IB 5AY8C 1S32D 5F99B 3W98D 2Y2JA 5B32G 1M1AD 1P3IC 4DRAA 3TU4C 2JSSA 2HUEC 3X1TA 3MGRC 2YFVA 5B24A 4YS3D 3B6FB 3AZFD 4KGCD 5BT1D 1P3KB 2G5IC 2DF4C 1KX3C 5JRGB 3REKA 3MGQB 4H9SA 2CV5B 5B2IB 1P3PD 5GXQD 3C1CD 3AYWD 5B1MB 3R45B 5FUGB 2AROB 3UT9D 4Z5TA 5GT3C 3MVDA 3REKD 3B6GD 3AYWA 4YM6D 3AN2A 5DNNA 3KUYA 4XZQC 4AWLC 1ZLAA 1F1EA 2LY8A 3AYWB 5GSUA 3B0DB 3R45A 5FUGA 5DNNC 1P3KD 2F2AC 4KGCB 4YS3B 4UUZA 4J8WB 2ZY4A 1P3OB 4AWLB 1P3FD 4G91B 3KUYC 4J8WD 3REIC 4J8UA 1P3GA 5F99D 1S32B 1EQZC 5BNXB 4Z5TC 2Y2KA 1B6WA 5AV8A 3REHB 3MNNB 4HGAC 5AVCB 5B32B 4WV4B 3AZFA 1KX3A 4H9RB 5AV6A 4J8XC 4NFTA 3W97B 3REKB 4WNNB 3VH6T 3W99A 2AROD 5B33A 4X23A 3REHC 3EPHA 5AY8A 5CPJB 3WAAC 2NQBC 3A1IA 2RIQA 3AZHB 3MGPD 1M1AB 5AV5D 4NE6A 1AOIC 5CP6D 3EPJA 1P3MA 4LD9A 3VH6A 5E5AB 3AV1C 2NZDB 1ID3C 4WU8C 3AZED 5CPKD 3AZIB 1P3MD 1P3LB 5B31D 3WA9B 4JJNA 4WU9C 3X1VC 1F66D 3AZJA 3AZLD 5B0YD 5AY8B 3LELC 2HIOA 4H9PB 3UTBC 3AZKA 3AZGC 5AV9C 4J8VD 3AZMD 2Y2PA 5DNMC 4ZBJB 5B1MC 3EPKA 1KX4A 5AV9D 1KX5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB D;  3X1S D;  4QLC B;  3KWQ A;  3UTA B;  3X1V D;  1BH9 A;  1TAF B;  4QLC A;  4ZBJ C;  3O62 D;  1M19 B;  2NZD A;  5B31 C;  1KX4 B;  3LZ1 A;  3AFA C;  3AFA D;  4QLC C;  1ID3 D;  1BH8 A;  3NQU A;  3AV1 D;  1P3O C;  3MVD D;  1A7W A;  3AN2 B;  5B2J C;  1AOI D;  5AV5 C;  4KUD B;  4Z5T B;  1KX4 C;  3AV1 B;  1BFM A;  3X1S C;  5B40 D;  3LJA C;  1U35 D;  1M18 B;  5GSU D;  3TU4 B;  1M19 D;  4KHA A;  5AV6 B;  4JJN B;  3W96 B;  5GT3 B;  5AV9 A;  4J8U D;  1M19 A;  3KXB D;  3MGQ C;  4YS3 A;  3MNN A;  3AZM C;  5CPJ C;  2HIO C;  4R8P B;  3LEL A;  5AV8 B;  4XZQ B;  3KWQ D;  4J8V C;  1B67 A;  5KDM A;  4WU9 A;  5B0Y C;  1ZLA B;  3VH5 A;  3X1T D;  3REL B;  1EQZ D;  5F99 C;  3NQJ A;  3AZM B;  3AV2 D;  3KUY D;  1WWI A;  3REI B;  4LD9 C;  1P3M C;  5DNN D;  3AZL B;  4ZUX A;  3REL C;  3KUY B;  5G49 A;  4EO5 B;  3AV2 B;  5GT0 B;  4XUJ B;  2YFV B;  1P3L D;  3WA9 D;  3REL D;  1ZLA D;  4R8P A;  3B6G C;  5JRG A;  3REH A;  3B0C T;  3WTP D;  2NQB D;  3AZI A;  1S32 A;  3AV2 C;  5GXQ C;  3C1C C;  5B24 B;  3B6F A;  3KXB B;  5AVB A;  4H9N A;  3C1B D;  2ARO C;  1TZY B;  4J8U B;  2BYM A;  3REJ B;  3B0D C;  3WAA B;  3X1U B;  3AZF C;  3AZH D;  4KGC A;  4ZUX B;  3TU4 D;  2HIO D;  5CPJ D;  3AZH C;  4J8U C;  5G49 B;  4Z5T D;  3NQU B;  5C3I C;  3C1B C;  3A6N B;  3MNN C;  5CPJ A;  5B32 C;  1M19 C;  3MGP A;  3MVD B;  5GSU C;  3WTP C;  3LJA D;  4NE3 A;  5B40 C;  3LZ0 D;  1P3K C;  1KX4 D;  1ZLA C;  2CWE A;  1P3L C;  3WA9 C;  3O62 B;  3AZG B;  3MVD C;  3W96 A;  1P3O D;  5AV5 A;  4QLC D;  3X1S B;  4LD9 D;  3REK C;  1Q9C A;  1P3F A;  3B0B A;  3O62 C;  3UT9 C;  1P3P C;  2BYK B;  3LZ1 C;  5B1L B;  3VH6 W;  4E45 A;  3AZJ D;  3TU4 A;  3X1T C;  5E5A C;  1P3I A;  1KX5 B;  3WKJ B;  3MGS D;  4NE5 A;  2NZD C;  3B6G B;  3WKJ C;  3KWQ C;  1M1A C;  2IO5 B;  1P3B B;  5B1M D;  3UT9 B;  5GXQ B;  3C1C B;  5KDM B;  2CV5 D;  3KXB C;  3MGQ D;  5AY8 D;  3W98 C;  5B0Y B;  4CSR A;  1F66 B;  5B1M A;  5DNM A;  3X1U A;  1H3O B;  5B31 B;  5CHL B;  1U35 C;  5B2J B;  3LEL D;  2PYO A;  3AZL C;  1F66 C;  3AZG A;  3VH5 W;  5CP6 B;  1P3A C;  3KSY A;  4WU9 D;  5B2J D;  4G92 C;  4KUD A;  3X1V A;  4H9Q B;  4XUJ A;  4Z66 C;  4WU8 D;  1P3A A;  3AZL A;  1BH8 B;  3MGS A;  3AV1 A;  2FJ7 A;  4WU8 B;  1WWS A;  1HQ3 C;  1KX5 D;  3WKJ D;  3AZJ B;  5BNX A;  4WU9 B;  5DNM D;  3WTP E;  3REH D;  3LZ1 B;  2RVQ D;  2BYM B;  3W98 A;  3KXB A;  3LEL B;  1BH9 B;  1TAF A;  5CPI B;  3W99 C;  5E5A A;  1P3F B;  3AZG D;  5AV6 C;  4J8X A;  3UT9 A;  1M18 A;  3LZ0 B;  1P3P A;  3O62 A;  5AV8 C;  1P3B D;  4WNN A;  1P3F C;  1EQZ A;  5B0Z C;  4YM6 B;  5JA4 A;  1P3G C;  3AZE C;  5CPK C;  3REI A;  1N1J A;  3MGS B;  3REJ C;  3W96 C;  1P3L A;  3WA9 A;  2F8N A;  5B1L D;  2F8N K;  1P3K A;  5CP6 C;  1P3A B;  1P3P B;  5B2I D;  5JRG D;  5B40 A;  2YFW A;  3MGP C;  4LD9 B;  4YM6 C;  3B0C W;  5B32 A;  3AZF B;  1P3G B;  3B6F D;  3WTP A;  1P34 D;  3WAA D;  4XZQ A;  4EO5 C;  3AN2 C;  3AYW C;  5B24 D;  3AZH A;  3C1B A;  3W98 B;  5GT3 A;  2YFW B;  2NQB B;  5BT1 C;  4KGC C;  4KHA B;  4H9S C;  4J8X D;  3V9R B;  3A6N A;  3MGR D;  4E44 A;  3LJA B;  4CSR B;  4WZS B;  2F8N G;  1N1J B;  5GT0 C;  5B24 C;  5BNV B;  5GXQ A;  3A6N D;  3MGR A;  3C1C A;  1S32 C;  1P3B A;  4H9O A;  2ARO A;  5B33 D;  4X23 D;  5AVB C;  5DNN B;  5BNV A;  3B6F C;  3AZN A;  3B6G A;  3AV2 A;  3AZI C;  2HIO B;  4R8P C;  4J8W C;  3REI D;  3W99 B;  4H9O B;  4ZUX D;  1TZY A;  3V9R A;  5JRG C;  5B1L A;  3AZN D;  5B2I C;  4Z66 B;  4H9Q A;  5B2I A;  3X1U D;  3W97 C;  5B1L C;  1EQZ B;  1TZY C;  1TZY D;  3C1B B;  4J8W A;  3REJ D;  1R4V A;  3AZN C;  3LZ0 A;  5B0Z D;  3UTA A;  4ZUX C;  3REL A;  3KWQ B;  4XZQ D;  3WTP B;  5AV8 D;  1P3B C;  4R8P D;  5GT0 A;  5F99 A;  5AVB D;  1HQ3 B;  5GT3 D;  4JJN D;  3A6N C;  1ULY A;  4XUJ D;  5AV6 D;  5GT0 D;  4Z2M H;  1HTA A;  1KX3 D;  4G91 C;  3W99 D;  5B0Y A;  5B40 B;  3AZM A;  5JA4 B;  4YS3 C;  3MGQ A;  5CPI C;  2FJ7 D;  5B33 B;  5B31 G;  4X23 B;  4J8V A;  1JFI A;  1P3I D;  2F8N B;  2F8N H;  3AZK B;  4H9P A;  4CAY A;  1AOI B;  4YM6 A;  3AN2 D;  3X1T B;  4H9R A;  1P34 C;  3MGR B;  1ID3 B;  4J8X B;  3AFA B;  4HGA B;  5BS7 C;  5AVC C;  2CV5 A;  5CP6 A;  3LJA A;  2PYO B;  4H9N B;  4DRB A;  1KU5 A;  3REJ A;  3AZE A;  3X1S A;  5CPK A;  3X1V B;  5B2J A;  5B0Z A;  3UTA D;  1P34 B;  1P3O A;  3W96 D;  4UUZ B;  1P3G D;  3AFA A;  2PYO D;  1M18 C;  5GSU B;  1M18 D;  1U35 B;  1P3A D;  4KUD D;  1H3O A;  5B31 A;  4Z2M G;  3AZK D;  4G92 B;  2L5A A;  2F8N D;  1P3I B;  1KX5 A;  3WKJ A;  2HUE B;  2FJ7 B;  3NQJ B;  4M6B A;  3VH5 T;  1KX3 B;  1HQ3 A;  2RVQ C;  5BS7 A;  5AVC A;  2CV5 C;  5BO0 B;  1P34 A;  1HQ3 D;  5CPI D;  5AVB B;  2FJ7 C;  2BYK A;  5BO0 A;  3UTB B;  3MGS C;  2NZD D;  5E5A D;  5AV9 B;  3AZJ C;  2IO5 C;  5CPI A;  5B0Z B;  3LZ1 D;  3UTB A;  3AZK C;  5DNM B;  4XUJ C;  4Z66 A;  5AV5 B;  4JJN C;  4KUD C;  3MGP B;  4Z66 D;  3AZN B;  1ID3 A;  1F66 A;  4J8V B;  2PYO C;  4WU8 A;  4CAY B;  1AOI A;  1U35 A;  3UTA C;  1JFI B;  3LZ0 C;  3X1U C;  3W97 D;  2NQB A;  3WAA A;  3W97 A;  3AZI D;  1P3M B;  5B32 D;  5AVC D;  3AZE B;  3MNN D;  5CPK B;  4X23 C;  5B33 C;  1M1A A;  5C3I B;  5AY8 C;  1S32 D;  5F99 B;  3W98 D;  5B32 G;  1M1A D;  1P3I C;  4DRA A;  3TU4 C;  2JSS A;  2HUE C;  3X1T A;  3MGR C;  2YFV A;  5B24 A;  4YS3 D;  3B6F B;  3AZF D;  4KGC D;  5BT1 D;  1P3K B;  1KX3 C;  5JRG B;  3REK A;  3MGQ B;  4H9S A;  2CV5 B;  5B2I B;  1P3P D;  5GXQ D;  3C1C D;  3AYW D;  5B1M B;  3R45 B;  5FUG B;  2ARO B;  3UT9 D;  4Z5T A;  5GT3 C;  3MVD A;  3REK D;  3B6G D;  3AYW A;  4YM6 D;  3AN2 A;  5DNN A;  3KUY A;  4XZQ C;  4AWL C;  1ZLA A;  1F1E A;  2LY8 A;  3AYW B;  5GSU A;  3B0D B;  3R45 A;  5FUG A;  5DNN C;  1P3K D;  4KGC B;  4YS3 B;  4UUZ A;  4J8W B;  1P3O B;  4AWL B;  1P3F D;  4G91 B;  3KUY C;  4J8W D;  3REI C;  4J8U A;  1P3G A;  5F99 D;  1S32 B;  1EQZ C;  5BNX B;  4Z5T C;  1B6W A;  5AV8 A;  3REH B;  3MNN B;  4HGA C;  5AVC B;  5B32 B;  4WV4 B;  3AZF A;  1KX3 A;  4H9R B;  5AV6 A;  4J8X C;  4NFT A;  3W97 B;  3REK B;  4WNN B;  3VH6 T;  3W99 A;  2ARO D;  5B33 A;  4X23 A;  3REH C;  5AY8 A;  5CPJ B;  3WAA C;  2NQB C;  3AZH B;  3MGP D;  1M1A B;  5AV5 D;  4NE6 A;  1AOI C;  5CP6 D;  1P3M A;  4LD9 A;  3VH6 A;  5E5A B;  3AV1 C;  2NZD B;  1ID3 C;  4WU8 C;  3AZE D;  5CPK D;  3AZI B;  1P3M D;  1P3L B;  5B31 D;  3WA9 B;  4JJN A;  4WU9 C;  3X1V C;  1F66 D;  3AZJ A;  3AZL D;  5B0Y D;  5AY8 B;  3LEL C;  2HIO A;  4H9P B;  3UTB C;  3AZK A;  3AZG C;  5AV9 C;  4J8V D;  3AZM D;  5DNM C;  4ZBJ B;  5B1M C;  1KX4 A;  5AV9 D;  1KX5 C; 
#chains in the Genus database with same CATH topology
 3UTB D;  3X1S D;  4QLC B;  3KWQ A;  3UTA B;  3X1V D;  1BH9 A;  1TAF B;  4QLC A;  4ZBJ C;  3O62 D;  2JCH A;  1M19 B;  2NZD A;  5B31 C;  1KX4 B;  3LZ1 A;  3AFA C;  3AFA D;  4QLC C;  1ID3 D;  2Y2Q A;  1BH8 A;  3NQU A;  3AV1 D;  1P3O C;  3MVD D;  2Y2L A;  1A7W A;  3AN2 B;  5B2J C;  2G5H C;  1AOI D;  2BG1 A;  5AV5 C;  4KUD B;  4Z5T B;  1KX4 C;  3AV1 B;  1BFM A;  3X1S C;  2Y2N A;  5B40 D;  3LJA C;  1U35 D;  1M18 B;  5GSU D;  3TU4 B;  1M19 D;  4KHA A;  5AV6 B;  4JJN B;  3W96 B;  5GT3 B;  5AV9 A;  4J8U D;  1M19 A;  3KXB D;  3MGQ C;  4YS3 A;  3MNN A;  3AZM C;  5CPJ C;  2HIO C;  4R8P B;  3LEL A;  5AV8 B;  1Z2C B;  4XZQ B;  3KWQ D;  4J8V C;  2ZY3 A;  1B67 A;  5KDM A;  4WU9 A;  5B0Y C;  1ZLA B;  3VH5 A;  3X1T D;  3REL B;  1EQZ D;  5F99 C;  3NQJ A;  3AZM B;  3AV2 D;  3KUY D;  1WWI A;  3REI B;  4LD9 C;  1P3M C;  5DNN D;  3AZL B;  4ZUX A;  3REL C;  3KUY B;  5G49 A;  4EO5 B;  3AV2 B;  5GT0 B;  2W8S A;  4XUJ B;  2YFV B;  1P3L D;  3WA9 D;  3REL D;  1ZLA D;  4R8P A;  3B6G C;  5JRG A;  3REH A;  3B0C T;  3WTP D;  2NQB D;  3AZI A;  1S32 A;  3AV2 C;  5GXQ C;  3C1C C;  5B24 B;  3B6F A;  3KXB B;  5AVB A;  4H9N A;  3C1B D;  2ARO C;  1TZY B;  4J8U B;  2BYM A;  3IP4 C;  1PZR A;  3REJ B;  3B0D C;  3WAA B;  3X1U B;  3AZF C;  3AZH D;  4KGC A;  4ZUX B;  3TU4 D;  2HIO D;  5CPJ D;  3AZH C;  2Y2G A;  4J8U C;  2FFF B;  5G49 B;  3H0M C;  2ZM5 A;  4Z5T D;  3NQU B;  5C3I C;  3H0R C;  3A6N B;  3MNN C;  3C1B C;  5CPJ A;  5B32 C;  3EPL A;  1M19 C;  3MGP A;  3MVD B;  5GSU C;  3WTP C;  3LJA D;  4NE3 A;  5B40 C;  3LZ0 D;  1P3K C;  1KX4 D;  1ZLA C;  2CWE A;  1P3L C;  3WA9 C;  3O62 B;  3AZG B;  3MVD C;  3W96 A;  1P3O D;  5AV5 A;  3A1K A;  4QLC D;  3X1S B;  2Y2I A;  4LD9 D;  3REK C;  1Q9C A;  1P3F A;  3B0B A;  3O62 C;  3UT9 C;  1P3P C;  2BYK B;  3LZ1 C;  5B1L B;  3VH6 W;  4E45 A;  3AZJ D;  3TU4 A;  3X1T C;  5E5A C;  1P3I A;  1KX5 B;  3WKJ B;  3MGS D;  4NE5 A;  2NZD C;  3B6G B;  2ZY2 A;  3WKJ C;  3KWQ C;  1M1A C;  2IO5 B;  1P3B B;  5B1M D;  3UT9 B;  5GXQ B;  3C1C B;  5KDM B;  2CV5 D;  3KXB C;  3MGQ D;  5AY8 D;  3W98 C;  5B0Y B;  3F6T A;  4CSR A;  1F66 B;  5B1M A;  5DNM A;  3X1U A;  1H3O B;  5B31 B;  5CHL B;  1U35 C;  5B2J B;  3LEL D;  2PYO A;  3AZL C;  1F66 C;  3AZG A;  3VH5 W;  5CP6 B;  1P3A C;  2UWX A;  3KSY A;  4WU9 D;  5B2J D;  4G92 C;  4KUD A;  3X1V A;  4H9Q B;  4XUJ A;  4Z66 C;  4WU8 D;  1P3A A;  3AZL A;  1BH8 B;  3MGS A;  2Y2H A;  3AV1 A;  2FJ7 A;  4WU8 B;  1WWS A;  1HQ3 C;  4WJ3 C;  1KX5 D;  3WKJ D;  3AZJ B;  5BNX A;  4WU9 B;  5DNM D;  3WTP E;  2ZY5 A;  3REH D;  3LZ1 B;  2RVQ D;  2BYM B;  3W98 A;  3KXB A;  3LEL B;  1BH9 B;  1TAF A;  5CPI B;  3FDD A;  3H0L C;  3W99 C;  5E5A A;  1P3F B;  4DQY B;  3AZG D;  5AV6 C;  4J8X A;  3UT9 A;  1M18 A;  3LZ0 B;  1P3P A;  3O62 A;  5AV8 C;  1P3B D;  4WNN A;  1P3F C;  1EQZ A;  5B0Z C;  4YM6 B;  5JA4 A;  1P3G C;  3AZE C;  5CPK C;  3REI A;  1N1J A;  3MGS B;  3REJ C;  3W96 C;  1P3L A;  3WA9 A;  2JE5 A;  2F8N A;  5B1L D;  2F8N K;  1P3K A;  5CP6 C;  1P3A B;  1P3P B;  5B2I D;  3KFU G;  5JRG D;  5B40 A;  2YFW A;  3MGP C;  4LD9 B;  4YM6 C;  3B0C W;  5B32 A;  3AZF B;  1P3G B;  3B6F D;  3WTP A;  1P34 D;  3WAA D;  4XZQ A;  4EO5 C;  3AN2 C;  3AYW C;  5B24 D;  3AZH A;  3C1B A;  3W98 B;  5GT3 A;  2YFW B;  2NQB B;  5BT1 C;  4KGC C;  4KHA B;  4H9S C;  2VQR A;  4J8X D;  3V9R B;  3A6N A;  3MGR D;  4E44 A;  3LJA B;  4CSR B;  4WZS B;  2F8N G;  1N1J B;  5GT0 C;  5B24 C;  5BNV B;  5GXQ A;  3A6N D;  3MGR A;  3C1C A;  1S32 C;  1P3B A;  4H9O A;  2ARO A;  5B33 D;  4X23 D;  5AVB C;  5DNN B;  5BNV A;  3B6F C;  3AZN A;  3B6G A;  3AV2 A;  3AZI C;  2HIO B;  4R8P C;  4J8W C;  3REI D;  3W99 B;  4H9O B;  2XD5 A;  4ZUX D;  1TZY A;  3V9R A;  5JRG C;  5B1L A;  3AZN D;  5B2I C;  4Z66 B;  4H9Q A;  5B2I A;  3X1U D;  3W97 C;  5B1L C;  1EQZ B;  1TZY C;  1TZY D;  3C1B B;  1T3U A;  3P5J B;  1R4V A;  4J8W A;  2Y2O A;  3REJ D;  3AZN C;  3LZ0 A;  5B0Z D;  3UTA A;  4ZUX C;  3REL A;  3KWQ B;  4XZQ D;  3WTP B;  5AV8 D;  1P3B C;  4R8P D;  5GT0 A;  5F99 A;  5AVB D;  1HQ3 B;  5GT3 D;  4JJN D;  3A6N C;  1ULY A;  4XUJ D;  5AV6 D;  5GT0 D;  4Z2M H;  3AL0 C;  1HTA A;  1KX3 D;  4G91 C;  3W99 D;  5B0Y A;  5B40 B;  3AZM A;  5JA4 B;  4YS3 C;  3MGQ A;  5CPI C;  2FJ7 D;  5B33 B;  5B31 G;  4X23 B;  4J8V A;  1JFI A;  1P3I D;  2F8N B;  2F8N H;  3AZK B;  4H9P A;  4CAY A;  1AOI B;  4YM6 A;  3AN2 D;  3X1T B;  4H9R A;  1P34 C;  3MGR B;  1ID3 B;  4J8X B;  3AFA B;  4HGA B;  5BS7 C;  5AVC C;  2CV5 A;  5CP6 A;  3LJA A;  2PYO B;  4H9N B;  4DRB A;  1KU5 A;  3REJ A;  3AZE A;  3X1S A;  5CPK A;  3X1V B;  5B2J A;  5B0Z A;  3UTA D;  1P34 B;  1P3O A;  3W96 D;  4UUZ B;  1P3G D;  3AFA A;  2PYO D;  1M18 C;  5GSU B;  1M18 D;  1U35 B;  1P3A D;  4KUD D;  1H3O A;  5B31 A;  4Z2M G;  3AZK D;  4G92 B;  2L5A A;  2F8N D;  1P3I B;  1KX5 A;  3WKJ A;  2HUE B;  2FJ7 B;  3NQJ B;  4M6B A;  3VH5 T;  1KX3 B;  1HQ3 A;  2RVQ C;  5BS7 A;  5AVC A;  2CV5 C;  5BO0 B;  1P34 A;  1HQ3 D;  5CPI D;  5AVB B;  2FJ7 C;  2BYK A;  5BO0 A;  3UTB B;  3MGS C;  2NZD D;  1W2E A;  5E5A D;  5AV9 B;  3AZJ C;  2IO5 C;  5CPI A;  5B0Z B;  3LZ1 D;  3UTB A;  3AZK C;  5DNM B;  4XUJ C;  4Z66 A;  5AV5 B;  4JJN C;  4KUD C;  4UPK A;  3MGP B;  4Z66 D;  3AZN B;  1ID3 A;  1F66 A;  4J8V B;  2PYO C;  2DQN C;  4WU8 A;  4CAY B;  3EG5 B;  1AOI A;  2J8P A;  1U35 A;  3UTA C;  1JFI B;  3LZ0 C;  3X1U C;  3W97 D;  2NQB A;  3WAA A;  3W97 A;  3AZI D;  1P3M B;  5B32 D;  2Y2M A;  5AVC D;  3AZE B;  3MNN D;  5CPK B;  4X23 C;  5B33 C;  1M1A A;  2XD1 A;  5C3I B;  5AY8 C;  1S32 D;  5F99 B;  3W98 D;  2Y2J A;  5B32 G;  1M1A D;  1P3I C;  4DRA A;  3TU4 C;  2JSS A;  2HUE C;  3X1T A;  3MGR C;  2YFV A;  5B24 A;  4YS3 D;  3B6F B;  3AZF D;  4KGC D;  5BT1 D;  1P3K B;  2G5I C;  2DF4 C;  1KX3 C;  5JRG B;  3REK A;  3MGQ B;  4H9S A;  2CV5 B;  5B2I B;  1P3P D;  5GXQ D;  3C1C D;  3AYW D;  5B1M B;  3R45 B;  5FUG B;  2ARO B;  3UT9 D;  4Z5T A;  5GT3 C;  3MVD A;  3REK D;  3B6G D;  3AYW A;  4YM6 D;  3AN2 A;  5DNN A;  3KUY A;  4XZQ C;  4AWL C;  1ZLA A;  1F1E A;  2LY8 A;  3AYW B;  5GSU A;  3B0D B;  3R45 A;  5FUG A;  5DNN C;  1P3K D;  2F2A C;  4KGC B;  4YS3 B;  4UUZ A;  4J8W B;  2ZY4 A;  1P3O B;  4AWL B;  1P3F D;  4G91 B;  3KUY C;  4J8W D;  3REI C;  4J8U A;  1P3G A;  5F99 D;  1S32 B;  1EQZ C;  5BNX B;  4Z5T C;  2Y2K A;  1B6W A;  5AV8 A;  3REH B;  3MNN B;  4HGA C;  5AVC B;  5B32 B;  4WV4 B;  3AZF A;  1KX3 A;  4H9R B;  5AV6 A;  4J8X C;  4NFT A;  3W97 B;  3REK B;  4WNN B;  3VH6 T;  3W99 A;  2ARO D;  5B33 A;  4X23 A;  3REH C;  3EPH A;  5AY8 A;  5CPJ B;  3WAA C;  2NQB C;  3A1I A;  2RIQ A;  3AZH B;  3MGP D;  1M1A B;  5AV5 D;  4NE6 A;  1AOI C;  5CP6 D;  3EPJ A;  1P3M A;  4LD9 A;  3VH6 A;  5E5A B;  3AV1 C;  2NZD B;  1ID3 C;  4WU8 C;  3AZE D;  5CPK D;  3AZI B;  1P3M D;  1P3L B;  5B31 D;  3WA9 B;  4JJN A;  4WU9 C;  3X1V C;  1F66 D;  3AZJ A;  3AZL D;  5B0Y D;  5AY8 B;  3LEL C;  2HIO A;  4H9P B;  3UTB C;  3AZK A;  3AZG C;  5AV9 C;  4J8V D;  3AZM D;  2Y2P A;  5DNM C;  4ZBJ B;  5B1M C;  3EPK A;  1KX4 A;  5AV9 D;  1KX5 C; 
#chains in the Genus database with same CATH homology
 3UTB D;  3X1S D;  4QLC B;  3KWQ A;  3UTA B;  3X1V D;  1BH9 A;  1TAF B;  4QLC A;  4ZBJ C;  3O62 D;  2JCH A;  1M19 B;  2NZD A;  5B31 C;  1KX4 B;  3LZ1 A;  3AFA C;  3AFA D;  4QLC C;  1ID3 D;  2Y2Q A;  1BH8 A;  3NQU A;  3AV1 D;  1P3O C;  3MVD D;  2Y2L A;  1A7W A;  3AN2 B;  5B2J C;  2G5H C;  1AOI D;  2BG1 A;  5AV5 C;  4KUD B;  4Z5T B;  1KX4 C;  3AV1 B;  1BFM A;  3X1S C;  2Y2N A;  5B40 D;  3LJA C;  1U35 D;  1M18 B;  5GSU D;  3TU4 B;  1M19 D;  4KHA A;  5AV6 B;  4JJN B;  3W96 B;  5GT3 B;  5AV9 A;  4J8U D;  1M19 A;  3KXB D;  3MGQ C;  4YS3 A;  3MNN A;  3AZM C;  5CPJ C;  2HIO C;  4R8P B;  3LEL A;  5AV8 B;  1Z2C B;  4XZQ B;  3KWQ D;  4J8V C;  2ZY3 A;  1B67 A;  5KDM A;  4WU9 A;  5B0Y C;  1ZLA B;  3VH5 A;  3X1T D;  3REL B;  1EQZ D;  5F99 C;  3NQJ A;  3AZM B;  3AV2 D;  3KUY D;  1WWI A;  3REI B;  4LD9 C;  1P3M C;  5DNN D;  3AZL B;  4ZUX A;  3REL C;  3KUY B;  5G49 A;  4EO5 B;  3AV2 B;  5GT0 B;  2W8S A;  4XUJ B;  2YFV B;  1P3L D;  3WA9 D;  3REL D;  1ZLA D;  4R8P A;  3B6G C;  5JRG A;  3REH A;  3B0C T;  3WTP D;  2NQB D;  3AZI A;  1S32 A;  3AV2 C;  5GXQ C;  3C1C C;  5B24 B;  3B6F A;  3KXB B;  5AVB A;  4H9N A;  3C1B D;  2ARO C;  1TZY B;  4J8U B;  2BYM A;  3IP4 C;  1PZR A;  3REJ B;  3B0D C;  3WAA B;  3X1U B;  3AZF C;  3AZH D;  4KGC A;  4ZUX B;  3TU4 D;  2HIO D;  5CPJ D;  3AZH C;  2Y2G A;  4J8U C;  2FFF B;  5G49 B;  3H0M C;  2ZM5 A;  4Z5T D;  3NQU B;  5C3I C;  3H0R C;  3A6N B;  3MNN C;  3C1B C;  5CPJ A;  5B32 C;  3EPL A;  1M19 C;  3MGP A;  3MVD B;  5GSU C;  3WTP C;  3LJA D;  4NE3 A;  5B40 C;  3LZ0 D;  1P3K C;  1KX4 D;  1ZLA C;  2CWE A;  1P3L C;  3WA9 C;  3O62 B;  3AZG B;  3MVD C;  3W96 A;  1P3O D;  5AV5 A;  3A1K A;  4QLC D;  3X1S B;  2Y2I A;  4LD9 D;  3REK C;  1Q9C A;  1P3F A;  3B0B A;  3O62 C;  3UT9 C;  1P3P C;  2BYK B;  3LZ1 C;  5B1L B;  3VH6 W;  4E45 A;  3AZJ D;  3TU4 A;  3X1T C;  5E5A C;  1P3I A;  1KX5 B;  3WKJ B;  3MGS D;  4NE5 A;  2NZD C;  3B6G B;  2ZY2 A;  3WKJ C;  3KWQ C;  1M1A C;  2IO5 B;  1P3B B;  5B1M D;  3UT9 B;  5GXQ B;  3C1C B;  5KDM B;  2CV5 D;  3KXB C;  3MGQ D;  5AY8 D;  3W98 C;  5B0Y B;  3F6T A;  4CSR A;  1F66 B;  5B1M A;  5DNM A;  3X1U A;  1H3O B;  5B31 B;  5CHL B;  1U35 C;  5B2J B;  3LEL D;  2PYO A;  3AZL C;  1F66 C;  3AZG A;  3VH5 W;  5CP6 B;  1P3A C;  2UWX A;  3KSY A;  4WU9 D;  5B2J D;  4G92 C;  4KUD A;  3X1V A;  4H9Q B;  4XUJ A;  4Z66 C;  4WU8 D;  1P3A A;  3AZL A;  1BH8 B;  3MGS A;  2Y2H A;  3AV1 A;  2FJ7 A;  4WU8 B;  1WWS A;  1HQ3 C;  4WJ3 C;  1KX5 D;  3WKJ D;  3AZJ B;  5BNX A;  4WU9 B;  5DNM D;  3WTP E;  2ZY5 A;  3REH D;  3LZ1 B;  2RVQ D;  2BYM B;  3W98 A;  3KXB A;  3LEL B;  1BH9 B;  1TAF A;  5CPI B;  3FDD A;  3H0L C;  3W99 C;  5E5A A;  1P3F B;  4DQY B;  3AZG D;  5AV6 C;  4J8X A;  3UT9 A;  1M18 A;  3LZ0 B;  1P3P A;  3O62 A;  5AV8 C;  1P3B D;  4WNN A;  1P3F C;  1EQZ A;  5B0Z C;  4YM6 B;  5JA4 A;  1P3G C;  3AZE C;  5CPK C;  3REI A;  1N1J A;  3MGS B;  3REJ C;  3W96 C;  1P3L A;  3WA9 A;  2JE5 A;  2F8N A;  5B1L D;  2F8N K;  1P3K A;  5CP6 C;  1P3A B;  1P3P B;  5B2I D;  3KFU G;  5JRG D;  5B40 A;  2YFW A;  3MGP C;  4LD9 B;  4YM6 C;  3B0C W;  5B32 A;  3AZF B;  1P3G B;  3B6F D;  3WTP A;  1P34 D;  3WAA D;  4XZQ A;  4EO5 C;  3AN2 C;  3AYW C;  5B24 D;  3AZH A;  3C1B A;  3W98 B;  5GT3 A;  2YFW B;  2NQB B;  5BT1 C;  4KGC C;  4KHA B;  4H9S C;  2VQR A;  4J8X D;  3V9R B;  3A6N A;  3MGR D;  4E44 A;  3LJA B;  4CSR B;  4WZS B;  2F8N G;  1N1J B;  5GT0 C;  5B24 C;  5BNV B;  5GXQ A;  3A6N D;  3MGR A;  3C1C A;  1S32 C;  1P3B A;  4H9O A;  2ARO A;  5B33 D;  4X23 D;  5AVB C;  5DNN B;  5BNV A;  3B6F C;  3AZN A;  3B6G A;  3AV2 A;  3AZI C;  2HIO B;  4R8P C;  4J8W C;  3REI D;  3W99 B;  4H9O B;  2XD5 A;  4ZUX D;  1TZY A;  3V9R A;  5JRG C;  5B1L A;  3AZN D;  5B2I C;  4Z66 B;  4H9Q A;  5B2I A;  3X1U D;  3W97 C;  5B1L C;  1EQZ B;  1TZY C;  1TZY D;  3C1B B;  1T3U A;  3P5J B;  1R4V A;  4J8W A;  2Y2O A;  3REJ D;  3AZN C;  3LZ0 A;  5B0Z D;  3UTA A;  4ZUX C;  3REL A;  3KWQ B;  4XZQ D;  3WTP B;  5AV8 D;  1P3B C;  4R8P D;  5GT0 A;  5F99 A;  5AVB D;  1HQ3 B;  5GT3 D;  4JJN D;  3A6N C;  1ULY A;  4XUJ D;  5AV6 D;  5GT0 D;  4Z2M H;  3AL0 C;  1HTA A;  1KX3 D;  4G91 C;  3W99 D;  5B0Y A;  5B40 B;  3AZM A;  5JA4 B;  4YS3 C;  3MGQ A;  5CPI C;  2FJ7 D;  5B33 B;  5B31 G;  4X23 B;  4J8V A;  1JFI A;  1P3I D;  2F8N B;  2F8N H;  3AZK B;  4H9P A;  4CAY A;  1AOI B;  4YM6 A;  3AN2 D;  3X1T B;  4H9R A;  1P34 C;  3MGR B;  1ID3 B;  4J8X B;  3AFA B;  4HGA B;  5BS7 C;  5AVC C;  2CV5 A;  5CP6 A;  3LJA A;  2PYO B;  4H9N B;  4DRB A;  1KU5 A;  3REJ A;  3AZE A;  3X1S A;  5CPK A;  3X1V B;  5B2J A;  5B0Z A;  3UTA D;  1P34 B;  1P3O A;  3W96 D;  4UUZ B;  1P3G D;  3AFA A;  2PYO D;  1M18 C;  5GSU B;  1M18 D;  1U35 B;  1P3A D;  4KUD D;  1H3O A;  5B31 A;  4Z2M G;  3AZK D;  4G92 B;  2L5A A;  2F8N D;  1P3I B;  1KX5 A;  3WKJ A;  2HUE B;  2FJ7 B;  3NQJ B;  4M6B A;  3VH5 T;  1KX3 B;  1HQ3 A;  2RVQ C;  5BS7 A;  5AVC A;  2CV5 C;  5BO0 B;  1P34 A;  1HQ3 D;  5CPI D;  5AVB B;  2FJ7 C;  2BYK A;  5BO0 A;  3UTB B;  3MGS C;  2NZD D;  1W2E A;  5E5A D;  5AV9 B;  3AZJ C;  2IO5 C;  5CPI A;  5B0Z B;  3LZ1 D;  3UTB A;  3AZK C;  5DNM B;  4XUJ C;  4Z66 A;  5AV5 B;  4JJN C;  4KUD C;  4UPK A;  3MGP B;  4Z66 D;  3AZN B;  1ID3 A;  1F66 A;  4J8V B;  2PYO C;  2DQN C;  4WU8 A;  4CAY B;  3EG5 B;  1AOI A;  2J8P A;  1U35 A;  3UTA C;  1JFI B;  3LZ0 C;  3X1U C;  3W97 D;  2NQB A;  3WAA A;  3W97 A;  3AZI D;  1P3M B;  5B32 D;  2Y2M A;  5AVC D;  3AZE B;  3MNN D;  5CPK B;  4X23 C;  5B33 C;  1M1A A;  2XD1 A;  5C3I B;  5AY8 C;  1S32 D;  5F99 B;  3W98 D;  2Y2J A;  5B32 G;  1M1A D;  1P3I C;  4DRA A;  3TU4 C;  2JSS A;  2HUE C;  3X1T A;  3MGR C;  2YFV A;  5B24 A;  4YS3 D;  3B6F B;  3AZF D;  4KGC D;  5BT1 D;  1P3K B;  2G5I C;  2DF4 C;  1KX3 C;  5JRG B;  3REK A;  3MGQ B;  4H9S A;  2CV5 B;  5B2I B;  1P3P D;  5GXQ D;  3C1C D;  3AYW D;  5B1M B;  3R45 B;  5FUG B;  2ARO B;  3UT9 D;  4Z5T A;  5GT3 C;  3MVD A;  3REK D;  3B6G D;  3AYW A;  4YM6 D;  3AN2 A;  5DNN A;  3KUY A;  4XZQ C;  4AWL C;  1ZLA A;  1F1E A;  2LY8 A;  3AYW B;  5GSU A;  3B0D B;  3R45 A;  5FUG A;  5DNN C;  1P3K D;  2F2A C;  4KGC B;  4YS3 B;  4UUZ A;  4J8W B;  2ZY4 A;  1P3O B;  4AWL B;  1P3F D;  4G91 B;  3KUY C;  4J8W D;  3REI C;  4J8U A;  1P3G A;  5F99 D;  1S32 B;  1EQZ C;  5BNX B;  4Z5T C;  2Y2K A;  1B6W A;  5AV8 A;  3REH B;  3MNN B;  4HGA C;  5AVC B;  5B32 B;  4WV4 B;  3AZF A;  1KX3 A;  4H9R B;  5AV6 A;  4J8X C;  4NFT A;  3W97 B;  3REK B;  4WNN B;  3VH6 T;  3W99 A;  2ARO D;  5B33 A;  4X23 A;  3REH C;  3EPH A;  5AY8 A;  5CPJ B;  3WAA C;  2NQB C;  3A1I A;  2RIQ A;  3AZH B;  3MGP D;  1M1A B;  5AV5 D;  4NE6 A;  1AOI C;  5CP6 D;  3EPJ A;  1P3M A;  4LD9 A;  3VH6 A;  5E5A B;  3AV1 C;  2NZD B;  1ID3 C;  4WU8 C;  3AZE D;  5CPK D;  3AZI B;  1P3M D;  1P3L B;  5B31 D;  3WA9 B;  4JJN A;  4WU9 C;  3X1V C;  1F66 D;  3AZJ A;  3AZL D;  5B0Y D;  5AY8 B;  3LEL C;  2HIO A;  4H9P B;  3UTB C;  3AZK A;  3AZG C;  5AV9 C;  4J8V D;  3AZM D;  2Y2P A;  5DNM C;  4ZBJ B;  5B1M C;  3EPK A;  1KX4 A;  5AV9 D;  1KX5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...