3WTPA

Crystal structure of the heterotypic nucleosome containing human cenp-a and h3.3
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
89
structure length
89
Chain Sequence
GWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 31
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wtpA00
1P3KB 4X23C 1TZYC 3TU4A 3AZHA 4J8XA 3X1TB 5F99A 4DRAA 1P3MA 5GT0C 3MVDA 1P3IA 1ZLAD 1P3OD 3MGQD 4DRBA 2F8NA 2HIOB 1TZYA 5B33C 1KX4B 5GT0A 1F66B 5GSUA 3AZJC 3KWQC 4Z5TB 2YFVB 4YM6B 1BH8A 1KX3A 3AZID 4KUDB 5CPJC 5B33A 3MGQC 3WTPB 3KXBB 3AZJA 3W97A 3KWQA 4ZBJB 3X1SB 5B31D 4ZUXC 1P3FD 5CPJA 1P3BB 5G49A 1M1AB 3LJAC 5B31G 3AZMD 3LZ0C 3AZIC 3C1BD 4ZUXA 4Z2MG 3WKJA 1ID3B 4G92C 3WA9A 5DNNC 3LJAA 5AV8D 5B40A 3LZ0A 3AZIA 3W96D 3AZGA 3MNNB 1P3KC 4J8UB 1P3LD 4XUJD 2CV5A 4H9RB 3X1TC 5B0ZD 3W98D 3AZLB 5BO0B 3KSYA 5AV6D 5DNNA 3MGRB 3AZMC 1P34A 3C1BC 1M19A 3MGPB 3VH5T 2HIOC 3REIB 4J8VB 1P3KA 3X1TA 1KX4C 4CAYB 4J8WB 3B6GD 1B67A 5AV5B 1AOIB 3C1CD 5B32B 3X1VB 3W96C 2HIOA 3REHB 1P3LC 4E44A 2FJ7D 5CPKD 5AV6C 1KX4A 3NQUB 1F66A 3AN2D 4Z5TA 2YFVA 4ZBJC 5GXQD 1U35B 4YM6A 4KUDA 1P3BC 3KUYB 3B6GC 5CPID 1EQZB 5AV9B 3WTPA 3KXBA 3C1CC 1M1AC 3WAAD 3AZEB 5B0YD 3X1SA 1R4VA 4Z2MH 2FJ7C 3B6FD 5CHLB 3AZFB 1P3BA 5CP6B 5B24D 1ID3C 5BNVB 1P3GB 1M1AA 3X1UD 3UTAB 5AV5D 3TU4D 4J8XD 2NQBB 5F99D 2FJ7A 5B2IB 3MVDD 1P3ID 1ULYA 1ID3A 2F8ND 5B0YC 3LZ1B 1TZYD 5GT0D 5GSUD 3B0CT 4H9RA 4G91B 2IO5B 4J8WC 3AZLA 5BO0A 4H9PB 5AV5C 3TU4C 3MGRA 1KX3D 4J8XC 3X1VC 4Z66B 4E45A 5B33D 3REIA 3UT9B 3MVDC 4J8VA 4JJNB 3AZFD 2JSSA 1HQ3B 3R45B 4CAYA 3KWQD 4J8WA 3W97D 5AV5A 1AOIA 1P3GD 5B32A 1P3AB 5CPJD 3X1VA 3UTAD 5GSUC 3REHA 3KUYC 4KGCB 1EQZC 3NQUA 1KX3C 1HTAA 4KHAB 3O62B 4ZUXD 4H9NB 5AVBB 3AZNB 1U35A 3WKJD 5JRGB 3AZFC 3B0DB 5CP6C 3KUYA 3W97C 3WA9D 1A7WA 3LJAD 3AZKB 1EQZA 3B0BA 5AVCB 5B40D 5AV9A 3LZ0D 1P3GC 3VH6A 3AZEA 3AZGD 3UTAC 1BH9B 2CV5D 2NQBC 5B2IC 3AZFA 5CP6A 1P34D 5DNND 5BNVA 1M19D 1P3GA 1KX5B 5AY8B 3LZ1C 1M18B 3WKJC 1S32B 3UTAA 1P3KD 2NQBA 3X1TD 2PYOB 5B2IA 3WA9C 4H9SA 5B40C 4G91C 2IO5C 3AZGC 2HIOD 3LZ1A 2CV5C 2BYMB 3REKB 5B2JB 4LD9B 3AV1B 4QLCB 2AROB 4JJNC 4WU8B 1P34C 1KX4D 1F66D 4EO5B 1M19C 1HQ3C 4Z5TD 4H9PA 4YM6D 4KUDD 4XZQB 3LELB 1P3AC 4Z66A 3UT9A 3RELB 5B1LB 4WU9B 2L5AA 3WTPD 3KXBD 4JJNA 5E5AB 1HQ3A 4KGCC 3R45A 5BT1D 1WWIA 3X1SD 3AYWB 1P3AA 1M18D 1P3BD 1F66C 3B0DC 5JA4B 1M1AD 2CWEA 3REJB 4Z5TC 4KGCA 4YM6C 3AFAB 4KUDC 5KDMB 4KHAA 3O62A 4H9NA 5AVBA 4M6BA 3AZNA 5JRGA 3WTPC 3KXBC 5B2JD 1ID3D 3MGSB 5BT1C 4QLCD 3AV1D 4WU8D 3AZKA 3X1SC 5AVCA 1KX5C 5AY8C 1M18C 2YFWB 5BS7C 3MNND 4J8UD 1BH9A 1TAFB 3RELD 3AZLD 3MGRD 4HGAB 1P3MB 1KX5A 2LY8A 3MGPD 5AY8A 3REID 1M18A 1S32A 4J8VD 5BS7A 3AYWD 3REKC 5B2JC 4R8PB 2PYOA 3AV1C 4QLCC 4WU8C 4J8WD 4X23B 1AOID 4WV4B 5B32D 3REJD 3X1VD 3MNNC 4J8UC 3REHD 3LELC 1B6WA 2BYMA 5BNXB 5B2JA 3REKA 3UTBB 3RELC 2NZDB 3AZLC 5B1LC 3NQJB 4QLCA 2AROA 3AV1A 4WU8A 3MGRC 5B32G 5E5AC 3MGPC 3REIC 1U35D 4J8VC 3MNNA 3AYWC 4J8UA 4XZQA 3LELA 2F8NG 3KUYD 3RELA 5B1LA 4WU9A 1AOIC 1EQZD 4AWLB 5AV9D 1N1JB 5B32C 3REJC 3A6NB 4UUZB 5E5AA 3AZED 3MGPA 1ZLAB 3AFAC 1P3OB 3MGQB 3REHC 3AYWA 5CP6D 5JA4A 3REJA 1U35C 3AFAA 3VH5A 5KDMA 2BYKB 2NQBD 5B2ID 1P3PB 5AV9C 3MGSA 3AZEC 2NZDD 3LZ1D 5DNMB 1BFMA 2YFWA 5B31B 1P3FB 1TAFA 3A6ND 4Z66D 3UT9D 3AZMB 4H9QB 4H9SC 3C1BB 4NE5A 4JJND 3UTBC 5B1MB 4R8PA 2NZDC 1HQ3D 4X23A 3VH6W 2HUEB 1P3AD 5AV8B 2F8NH 3UTBA 5BNXA 3W96B 1P3PD 2NZDA 4YS3B 1P3LB 3NQJA 4KGCD 4H9OB 4XUJB 4AWLC 3A6NC 3O62D 5B0ZB 4Z66C 3UT9C 1ZLAC 3W98B 5AV6B 1P3OC 3AZND 5AVBD 5DNMD 5JRGD 5GT3B 4CSRB 3AZKD 5AVCD 1N1JA 3WTPE 3A6NA 4UUZA 3B6GB 1ZLAA 1P3OA 3MGQA 3C1CB 1P3PC 1JFIB 2FJ7B 5B1MD 3O62C 1KX5D 5CPKB 5AY8D 3AZNC 5AVBC 1S32D 5DNMC 3AN2B 5JRGC 3V9RB 2BYKA 3W99B 1Q9CA 2PYOD 5GXQB 1P3PA 5B31C 3AZKC 1P3FC 5AVCC 3B0CW 4YS3D 5CPIB 3AV2B 2RVQD 5DNMA 1H3OB 3WAAB 3REKD 5B0YB 4NE6A 4LD9D 2AROD 5B31A 3B6FB 5B1MC 5GT3D 1P3FA 5B24B 1F1EA 1S32C 4WNNB 5C3IB 2HUEC 3X1UB 5FUGB 4XZQD 3LELD 2PYOC 5AV8C 3TU4B 3AZHB 5B1LD 4WU9D 3AZMA 4H9QA 3C1BA 4J8XB 5F99B 5B1MA 5E5AD 4YS3C 3MVDB 1P3IB 4XUJC 2RVQC 5B0ZC 2F8NB 3W98C 3VH6T 4LD9C 5AV8A 2AROC 1TZYB 4EO5C 5GT3C 3W99D 3W96A 5GT0B 5GSUB 4YS3A 1P3LA 4NE3A 3AFAD 4H9OA 4XUJA 4XZQC 5B0ZA 3W98A 5AV6A 1BH8B 3AV2D 4WU9C 1KX3B 4LD9A 5GT3A 5B33B 3MGSD 1WWSA 4CSRA 3AZJB 5CPKC 3W97B 3KWQB 3B6GA 3AN2C 3C1CA 3W99C 5CPJB 5GXQC 5G49B 1JFIA 3AZHD 1P3MD 5CPKA 5CPIC 4WZSB 3AV2C 3AN2A 3WAAC 3V9RA 4ZUXB 4R8PD 3MGSC 3W99A 3WKJB 5GXQA 4X23D 3B6FC 1KU5A 5B24C 3WA9B 3LJAB 5CPIA 3AV2A 5C3IC 5B40B 3LZ0B 3AZIB 3X1UC 1H3OA 3UTBD 3WAAA 5B0YA 3AZGB 3AZHC 2CV5B 5F99C 3B6FA 4HGAC 1P3MC 4G92B 1P3IC 5B24A 1P34B 4NFTA 5DNNB 3VH5W 3AZJD 4WNNA 1M19B 4R8PC 3X1UA 2F8NK 5FUGA
chains in the Genus database with same CATH superfamily
1P3KB 4X23C 1TZYC 3TU4A 3AZHA 4J8XA 3X1TB 5F99A 4DRAA 1P3MA 5GT0C 3MVDA 1P3IA 1ZLAD 1P3OD 3MGQD 4DRBA 2F8NA 2ZY3A 2HIOB 4UPKA 1TZYA 5B33C 1KX4B 5GT0A 1F66B 5GSUA 3AZJC 3KWQC 4Z5TB 2YFVB 3IP4C 4YM6B 1BH8A 1KX3A 3AZID 4KUDB 5CPJC 5B33A 3MGQC 3WTPB 3KXBB 3AZJA 3W97A 3KWQA 4ZBJB 3X1SB 5B31D 4ZUXC 1P3FD 3A1KA 5CPJA 1P3BB 5G49A 2Y2OA 1M1AB 2F2AC 3LJAC 2ZY5A 5B31G 3AZMD 3LZ0C 3AZIC 3C1BD 3EG5B 4ZUXA 2Y2JA 4Z2MG 2G5IC 1PZRA 3WKJA 3EPJA 4G92C 1ID3B 3WA9A 5DNNC 2XD5A 3LJAA 5AV8D 5B40A 3LZ0A 3AZIA 2J8PA 3W96D 3AZGA 3MNNB 1P3KC 4J8UB 1P3LD 4XUJD 2CV5A 4H9RB 3X1TC 5B0ZD 3W98D 3AZLB 5BO0B 3KSYA 5AV6D 5DNNA 3MGRB 3AZMC 1P34A 3C1BC 1M19A 3MGPB 3VH5T 2HIOC 3REIB 4J8VB 1P3KA 3X1TA 1KX4C 4CAYB 4J8WB 3B6GD 1B67A 5AV5B 1AOIB 3C1CD 5B32B 3X1VB 3W96C 2HIOA 3REHB 1P3LC 4E44A 2FJ7D 5CPKD 5AV6C 1KX4A 3NQUB 1F66A 3AN2D 4Z5TA 2YFVA 4ZBJC 5GXQD 1U35B 4YM6A 4WJ3C 4KUDA 1P3BC 3KUYB 3B6GC 5CPID 1EQZB 5AV9B 3WTPA 3KXBA 3C1CC 1M1AC 3WAAD 3AZEB 5B0YD 3X1SA 1R4VA 4Z2MH 2VQRA 2FJ7C 3B6FD 5CHLB 3AZFB 1P3BA 5CP6B 5B24D 1ID3C 5BNVB 1P3GB 1M1AA 3X1UD 3UTAB 3H0LC 5AV5D 3TU4D 4J8XD 2NQBB 5F99D 2FJ7A 5B2IB 3MVDD 1P3ID 1ULYA 1ID3A 2F8ND 5B0YC 3LZ1B 3EPHA 1TZYD 5GT0D 5GSUD 3B0CT 4H9RA 4G91B 2IO5B 4J8WC 3AZLA 5BO0A 4H9PB 5AV5C 3TU4C 3MGRA 1KX3D 4J8XC 3X1VC 3AL0C 4Z66B 4E45A 5B33D 3REIA 3UT9B 3MVDC 4J8VA 4JJNB 3AZFD 2JSSA 1HQ3B 3R45B 2Y2IA 4CAYA 3KWQD 4J8WA 3W97D 3EPKA 5AV5A 1AOIA 1P3GD 5B32A 1P3AB 5CPJD 3X1VA 3UTAD 5GSUC 3REHA 3KUYC 4KGCB 1EQZC 3NQUA 1KX3C 1HTAA 4KHAB 3O62B 4ZUXD 4H9NB 5AVBB 3AZNB 1U35A 3WKJD 5JRGB 3AZFC 3B0DB 5CP6C 3KUYA 3W97C 3WA9D 1A7WA 3LJAD 3AZKB 1EQZA 3B0BA 5AVCB 5B40D 5AV9A 3LZ0D 1P3GC 3VH6A 3AZEA 3AZGD 3UTAC 1BH9B 2CV5D 2NQBC 3EPLA 5B2IC 3AZFA 5CP6A 1P34D 5DNND 5BNVA 1M19D 1P3GA 1KX5B 5AY8B 3LZ1C 1M18B 3WKJC 1S32B 3UTAA 1P3KD 2ZY4A 2NQBA 3X1TD 2PYOB 5B2IA 3WA9C 4H9SA 5B40C 4G91C 2IO5C 3AZGC 2HIOD 3LZ1A 2CV5C 2BYMB 3REKB 5B2JB 4LD9B 3AV1B 4QLCB 2AROB 4JJNC 4WU8B 1P34C 1KX4D 1F66D 4EO5B 1M19C 1HQ3C 4Z5TD 4H9PA 4YM6D 4KUDD 4XZQB 3LELB 1P3AC 2Y2GA 4Z66A 3UT9A 3RELB 5B1LB 4WU9B 2L5AA 3WTPD 3KXBD 4JJNA 5E5AB 1HQ3A 4KGCC 3R45A 5BT1D 1WWIA 3X1SD 3AYWB 1P3AA 1M18D 1P3BD 2Y2KA 1F66C 3B0DC 5JA4B 1M1AD 2CWEA 3REJB 4Z5TC 4KGCA 4YM6C 3H0MC 3AFAB 4KUDC 5KDMB 4DQYB 4KHAA 3O62A 4H9NA 5AVBA 4M6BA 3AZNA 5JRGA 3WTPC 3KXBC 5B2JD 1ID3D 3MGSB 5BT1C 4QLCD 3AV1D 4WU8D 3AZKA 3X1SC 5AVCA 1KX5C 5AY8C 1M18C 2YFWB 5BS7C 3MNND 4J8UD 1BH9A 1W2EA 1TAFB 3RELD 3AZLD 3MGRD 4HGAB 1P3MB 1KX5A 2LY8A 3MGPD 5AY8A 3REID 1M18A 1S32A 4J8VD 5BS7A 3AYWD 3REKC 5B2JC 4R8PB 2PYOA 2ZY2A 3AV1C 4QLCC 4WU8C 4J8WD 4X23B 1AOID 1Z2CB 4WV4B 5B32D 3REJD 3X1VD 3MNNC 4J8UC 3REHD 3LELC 1B6WA 2BYMA 5BNXB 5B2JA 3REKA 3UTBB 3RELC 2NZDB 3AZLC 5B1LC 3NQJB 4QLCA 2AROA 2Y2QA 4WU8A 3MGRC 3AV1A 5B32G 5E5AC 3MGPC 3REIC 1U35D 4J8VC 3MNNA 3AYWC 4J8UA 4XZQA 3LELA 2F8NG 2JCHA 3P5JB 3KUYD 3RELA 5B1LA 4WU9A 1AOIC 2Y2LA 4AWLB 5AV9D 1EQZD 1N1JB 5B32C 3REJC 3A6NB 4UUZB 5E5AA 3AZED 3MGPA 1ZLAB 3AFAC 1P3OB 3MGQB 3REHC 3AYWA 2Y2PA 5CP6D 5JA4A 3REJA 1U35C 3AFAA 3VH5A 5KDMA 2BYKB 2NQBD 5B2ID 1P3PB 5AV9C 3MGSA 3AZEC 2NZDD 3LZ1D 3A1IA 5DNMB 1BFMA 2YFWA 2W8SA 3FDDA 5B31B 1P3FB 1TAFA 3A6ND 4Z66D 3UT9D 3AZMB 4H9QB 4H9SC 3C1BB 4NE5A 4JJND 3UTBC 5B1MB 4R8PA 2NZDC 1HQ3D 4X23A 3VH6W 2HUEB 1P3AD 5AV8B 2F8NH 3UTBA 5BNXA 3W96B 1P3PD 2NZDA 4YS3B 3H0RC 3NQJA 1P3LB 4H9OB 4XUJB 4AWLC 4KGCD 3A6NC 3O62D 5B0ZB 4Z66C 3UT9C 1ZLAC 3W98B 5AV6B 1P3OC 3AZND 5AVBD 5DNMD 5JRGD 5GT3B 4CSRB 3AZKD 5AVCD 1N1JA 3WTPE 3A6NA 4UUZA 3B6GB 1ZLAA 1P3OA 2JE5A 3MGQA 3C1CB 1P3PC 1JFIB 2FJ7B 5B1MD 3O62C 1KX5D 5CPKB 5AY8D 3AZNC 5AVBC 1S32D 5DNMC 3AN2B 5JRGC 3V9RB 2BYKA 3W99B 1Q9CA 2PYOD 5GXQB 1P3PA 5B31C 3AZKC 1P3FC 5AVCC 3B0CW 4YS3D 5CPIB 3AV2B 2RVQD 5DNMA 1H3OB 3WAAB 3REKD 5B0YB 2DF4C 4NE6A 4LD9D 2AROD 5B31A 3B6FB 5B1MC 5GT3D 1P3FA 5B24B 1F1EA 1S32C 4WNNB 5C3IB 2HUEC 3X1UB 2DQNC 5FUGB 4XZQD 3LELD 2PYOC 5AV8C 2ZM5A 2RIQA 3TU4B 3AZHB 5B1LD 4WU9D 3AZMA 4H9QA 2G5HC 3C1BA 4J8XB 5F99B 5B1MA 5E5AD 4YS3C 2FFFB 3MVDB 1P3IB 4XUJC 2RVQC 5B0ZC 2F8NB 3W98C 2Y2MA 3VH6T 4LD9C 5AV8A 2AROC 1TZYB 2BG1A 4EO5C 5GT3C 3W99D 2Y2NA 3W96A 5GT0B 5GSUB 4YS3A 1P3LA 4NE3A 3AFAD 4H9OA 4XUJA 4XZQC 5B0ZA 3W98A 5AV6A 1BH8B 3AV2D 4WU9C 1KX3B 4LD9A 2XD1A 5GT3A 5B33B 3MGSD 1WWSA 4CSRA 3AZJB 2Y2HA 5CPKC 3W97B 3KWQB 3B6GA 3AN2C 3C1CA 3W99C 5CPJB 5GXQC 5G49B 1JFIA 3AZHD 1P3MD 3F6TA 5CPIC 5CPKA 4WZSB 3AV2C 3AN2A 3WAAC 1T3UA 3V9RA 4ZUXB 4R8PD 3MGSC 3W99A 3WKJB 5GXQA 4X23D 3B6FC 2UWXA 1KU5A 5B24C 3WA9B 3LJAB 5CPIA 3AV2A 5C3IC 5B40B 3LZ0B 3AZIB 3X1UC 1H3OA 3UTBD 3WAAA 5B0YA 3AZGB 3AZHC 2CV5B 5F99C 3B6FA 4HGAC 1P3MC 4G92B 1P3IC 5B24A 1P34B 4NFTA 5DNNB 3VH5W 3AZJD 4WNNA 1M19B 4R8PC 3X1UA 2F8NK 5FUGA 3KFUG
chains in the Genus database with same CATH topology
1P3KB 4X23C 1TZYC 3TU4A 3AZHA 4J8XA 3X1TB 5F99A 4DRAA 1P3MA 5GT0C 3MVDA 1P3IA 1ZLAD 1P3OD 3MGQD 4DRBA 2F8NA 2ZY3A 2HIOB 4UPKA 1TZYA 5B33C 1KX4B 5GT0A 1F66B 5GSUA 3AZJC 3KWQC 4Z5TB 2YFVB 3IP4C 4YM6B 1BH8A 1KX3A 3AZID 4KUDB 5CPJC 5B33A 3MGQC 3WTPB 3KXBB 3AZJA 3W97A 3KWQA 4ZBJB 3X1SB 5B31D 4ZUXC 1P3FD 3A1KA 5CPJA 1P3BB 5G49A 2Y2OA 1M1AB 2F2AC 3LJAC 2ZY5A 5B31G 3AZMD 3LZ0C 3AZIC 3C1BD 3EG5B 4ZUXA 2Y2JA 4Z2MG 2G5IC 1PZRA 3WKJA 3EPJA 4G92C 1ID3B 3WA9A 5DNNC 2XD5A 3LJAA 5AV8D 5B40A 3LZ0A 3AZIA 2J8PA 3W96D 3AZGA 3MNNB 1P3KC 4J8UB 1P3LD 4XUJD 2CV5A 4H9RB 3X1TC 5B0ZD 3W98D 3AZLB 5BO0B 3KSYA 5AV6D 5DNNA 3MGRB 3AZMC 1P34A 3C1BC 1M19A 3MGPB 3VH5T 2HIOC 3REIB 4J8VB 1P3KA 3X1TA 1KX4C 4CAYB 4J8WB 3B6GD 1B67A 5AV5B 1AOIB 3C1CD 5B32B 3X1VB 3W96C 2HIOA 3REHB 1P3LC 4E44A 2FJ7D 5CPKD 5AV6C 1KX4A 3NQUB 1F66A 3AN2D 4Z5TA 2YFVA 4ZBJC 5GXQD 1U35B 4YM6A 4WJ3C 4KUDA 1P3BC 3KUYB 3B6GC 5CPID 1EQZB 5AV9B 3WTPA 3KXBA 3C1CC 1M1AC 3WAAD 3AZEB 5B0YD 3X1SA 1R4VA 4Z2MH 2VQRA 2FJ7C 3B6FD 5CHLB 3AZFB 1P3BA 5CP6B 5B24D 1ID3C 5BNVB 1P3GB 1M1AA 3X1UD 3UTAB 3H0LC 5AV5D 3TU4D 4J8XD 2NQBB 5F99D 2FJ7A 5B2IB 3MVDD 1P3ID 1ULYA 1ID3A 2F8ND 5B0YC 3LZ1B 3EPHA 1TZYD 5GT0D 5GSUD 3B0CT 4H9RA 4G91B 2IO5B 4J8WC 3AZLA 5BO0A 4H9PB 5AV5C 3TU4C 3MGRA 1KX3D 4J8XC 3X1VC 3AL0C 4Z66B 4E45A 5B33D 3REIA 3UT9B 3MVDC 4J8VA 4JJNB 3AZFD 2JSSA 1HQ3B 3R45B 2Y2IA 4CAYA 3KWQD 4J8WA 3W97D 3EPKA 5AV5A 1AOIA 1P3GD 5B32A 1P3AB 5CPJD 3X1VA 3UTAD 5GSUC 3REHA 3KUYC 4KGCB 1EQZC 3NQUA 1KX3C 1HTAA 4KHAB 3O62B 4ZUXD 4H9NB 5AVBB 3AZNB 1U35A 3WKJD 5JRGB 3AZFC 3B0DB 5CP6C 3KUYA 3W97C 3WA9D 1A7WA 3LJAD 3AZKB 1EQZA 3B0BA 5AVCB 5B40D 5AV9A 3LZ0D 1P3GC 3VH6A 3AZEA 3AZGD 3UTAC 1BH9B 2CV5D 2NQBC 3EPLA 5B2IC 3AZFA 5CP6A 1P34D 5DNND 5BNVA 1M19D 1P3GA 1KX5B 5AY8B 3LZ1C 1M18B 3WKJC 1S32B 3UTAA 1P3KD 2ZY4A 2NQBA 3X1TD 2PYOB 5B2IA 3WA9C 4H9SA 5B40C 4G91C 2IO5C 3AZGC 2HIOD 3LZ1A 2CV5C 2BYMB 3REKB 5B2JB 4LD9B 3AV1B 4QLCB 2AROB 4JJNC 4WU8B 1P34C 1KX4D 1F66D 4EO5B 1M19C 1HQ3C 4Z5TD 4H9PA 4YM6D 4KUDD 4XZQB 3LELB 1P3AC 2Y2GA 4Z66A 3UT9A 3RELB 5B1LB 4WU9B 2L5AA 3WTPD 3KXBD 4JJNA 5E5AB 1HQ3A 4KGCC 3R45A 5BT1D 1WWIA 3X1SD 3AYWB 1P3AA 1M18D 1P3BD 2Y2KA 1F66C 3B0DC 5JA4B 1M1AD 2CWEA 3REJB 4Z5TC 4KGCA 4YM6C 3H0MC 3AFAB 4KUDC 5KDMB 4DQYB 4KHAA 3O62A 4H9NA 5AVBA 4M6BA 3AZNA 5JRGA 3WTPC 3KXBC 5B2JD 1ID3D 3MGSB 5BT1C 4QLCD 3AV1D 4WU8D 3AZKA 3X1SC 5AVCA 1KX5C 5AY8C 1M18C 2YFWB 5BS7C 3MNND 4J8UD 1BH9A 1W2EA 1TAFB 3RELD 3AZLD 3MGRD 4HGAB 1P3MB 1KX5A 2LY8A 3MGPD 5AY8A 3REID 1M18A 1S32A 4J8VD 5BS7A 3AYWD 3REKC 5B2JC 4R8PB 2PYOA 2ZY2A 3AV1C 4QLCC 4WU8C 4J8WD 4X23B 1AOID 1Z2CB 4WV4B 5B32D 3REJD 3X1VD 3MNNC 4J8UC 3REHD 3LELC 1B6WA 2BYMA 5BNXB 5B2JA 3REKA 3UTBB 3RELC 2NZDB 3AZLC 5B1LC 3NQJB 4QLCA 2AROA 2Y2QA 4WU8A 3MGRC 3AV1A 5B32G 5E5AC 3MGPC 3REIC 1U35D 4J8VC 3MNNA 3AYWC 4J8UA 4XZQA 3LELA 2F8NG 2JCHA 3P5JB 3KUYD 3RELA 5B1LA 4WU9A 1AOIC 2Y2LA 4AWLB 5AV9D 1EQZD 1N1JB 5B32C 3REJC 3A6NB 4UUZB 5E5AA 3AZED 3MGPA 1ZLAB 3AFAC 1P3OB 3MGQB 3REHC 3AYWA 2Y2PA 5CP6D 5JA4A 3REJA 1U35C 3AFAA 3VH5A 5KDMA 2BYKB 2NQBD 5B2ID 1P3PB 5AV9C 3MGSA 3AZEC 2NZDD 3LZ1D 3A1IA 5DNMB 1BFMA 2YFWA 2W8SA 3FDDA 5B31B 1P3FB 1TAFA 3A6ND 4Z66D 3UT9D 3AZMB 4H9QB 4H9SC 3C1BB 4NE5A 4JJND 3UTBC 5B1MB 4R8PA 2NZDC 1HQ3D 4X23A 3VH6W 2HUEB 1P3AD 5AV8B 2F8NH 3UTBA 5BNXA 3W96B 1P3PD 2NZDA 4YS3B 3H0RC 3NQJA 1P3LB 4H9OB 4XUJB 4AWLC 4KGCD 3A6NC 3O62D 5B0ZB 4Z66C 3UT9C 1ZLAC 3W98B 5AV6B 1P3OC 3AZND 5AVBD 5DNMD 5JRGD 5GT3B 4CSRB 3AZKD 5AVCD 1N1JA 3WTPE 3A6NA 4UUZA 3B6GB 1ZLAA 1P3OA 2JE5A 3MGQA 3C1CB 1P3PC 1JFIB 2FJ7B 5B1MD 3O62C 1KX5D 5CPKB 5AY8D 3AZNC 5AVBC 1S32D 5DNMC 3AN2B 5JRGC 3V9RB 2BYKA 3W99B 1Q9CA 2PYOD 5GXQB 1P3PA 5B31C 3AZKC 1P3FC 5AVCC 3B0CW 4YS3D 5CPIB 3AV2B 2RVQD 5DNMA 1H3OB 3WAAB 3REKD 5B0YB 2DF4C 4NE6A 4LD9D 2AROD 5B31A 3B6FB 5B1MC 5GT3D 1P3FA 5B24B 1F1EA 1S32C 4WNNB 5C3IB 2HUEC 3X1UB 2DQNC 5FUGB 4XZQD 3LELD 2PYOC 5AV8C 2ZM5A 2RIQA 3TU4B 3AZHB 5B1LD 4WU9D 3AZMA 4H9QA 2G5HC 3C1BA 4J8XB 5F99B 5B1MA 5E5AD 4YS3C 2FFFB 3MVDB 1P3IB 4XUJC 2RVQC 5B0ZC 2F8NB 3W98C 2Y2MA 3VH6T 4LD9C 5AV8A 2AROC 1TZYB 2BG1A 4EO5C 5GT3C 3W99D 2Y2NA 3W96A 5GT0B 5GSUB 4YS3A 1P3LA 4NE3A 3AFAD 4H9OA 4XUJA 4XZQC 5B0ZA 3W98A 5AV6A 1BH8B 3AV2D 4WU9C 1KX3B 4LD9A 2XD1A 5GT3A 5B33B 3MGSD 1WWSA 4CSRA 3AZJB 2Y2HA 5CPKC 3W97B 3KWQB 3B6GA 3AN2C 3C1CA 3W99C 5CPJB 5GXQC 5G49B 1JFIA 3AZHD 1P3MD 3F6TA 5CPIC 5CPKA 4WZSB 3AV2C 3AN2A 3WAAC 1T3UA 3V9RA 4ZUXB 4R8PD 3MGSC 3W99A 3WKJB 5GXQA 4X23D 3B6FC 2UWXA 1KU5A 5B24C 3WA9B 3LJAB 5CPIA 3AV2A 5C3IC 5B40B 3LZ0B 3AZIB 3X1UC 1H3OA 3UTBD 3WAAA 5B0YA 3AZGB 3AZHC 2CV5B 5F99C 3B6FA 4HGAC 1P3MC 4G92B 1P3IC 5B24A 1P34B 4NFTA 5DNNB 3VH5W 3AZJD 4WNNA 1M19B 4R8PC 3X1UA 2F8NK 5FUGA 3KFUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3K B;  4X23 C;  1TZY C;  3TU4 A;  3AZH A;  4J8X A;  3X1T B;  5F99 A;  4DRA A;  1P3M A;  5GT0 C;  3MVD A;  1P3I A;  1ZLA D;  1P3O D;  3MGQ D;  4DRB A;  2F8N A;  2HIO B;  1TZY A;  5B33 C;  1KX4 B;  5GT0 A;  1F66 B;  5GSU A;  3AZJ C;  3KWQ C;  4Z5T B;  2YFV B;  4YM6 B;  1BH8 A;  1KX3 A;  3AZI D;  4KUD B;  5CPJ C;  5B33 A;  3MGQ C;  3WTP B;  3KXB B;  3AZJ A;  3W97 A;  3KWQ A;  4ZBJ B;  3X1S B;  5B31 D;  4ZUX C;  1P3F D;  5CPJ A;  1P3B B;  5G49 A;  1M1A B;  3LJA C;  5B31 G;  3AZM D;  3LZ0 C;  3AZI C;  3C1B D;  4ZUX A;  4Z2M G;  3WKJ A;  1ID3 B;  4G92 C;  3WA9 A;  5DNN C;  3LJA A;  5AV8 D;  5B40 A;  3LZ0 A;  3AZI A;  3W96 D;  3AZG A;  3MNN B;  1P3K C;  4J8U B;  1P3L D;  4XUJ D;  2CV5 A;  4H9R B;  3X1T C;  5B0Z D;  3W98 D;  3AZL B;  5BO0 B;  3KSY A;  5AV6 D;  5DNN A;  3MGR B;  3AZM C;  1P34 A;  3C1B C;  1M19 A;  3MGP B;  3VH5 T;  2HIO C;  3REI B;  4J8V B;  1P3K A;  3X1T A;  1KX4 C;  4CAY B;  4J8W B;  3B6G D;  1B67 A;  5AV5 B;  1AOI B;  3C1C D;  5B32 B;  3X1V B;  3W96 C;  2HIO A;  3REH B;  1P3L C;  4E44 A;  2FJ7 D;  5CPK D;  5AV6 C;  1KX4 A;  3NQU B;  1F66 A;  3AN2 D;  4Z5T A;  2YFV A;  4ZBJ C;  5GXQ D;  1U35 B;  4YM6 A;  4KUD A;  1P3B C;  3KUY B;  3B6G C;  5CPI D;  1EQZ B;  5AV9 B;  3WTP A;  3KXB A;  3C1C C;  1M1A C;  3WAA D;  3AZE B;  5B0Y D;  3X1S A;  1R4V A;  4Z2M H;  2FJ7 C;  3B6F D;  5CHL B;  3AZF B;  1P3B A;  5CP6 B;  5B24 D;  1ID3 C;  5BNV B;  1P3G B;  1M1A A;  3X1U D;  3UTA B;  5AV5 D;  3TU4 D;  4J8X D;  2NQB B;  5F99 D;  2FJ7 A;  5B2I B;  3MVD D;  1P3I D;  1ULY A;  1ID3 A;  2F8N D;  5B0Y C;  3LZ1 B;  1TZY D;  5GT0 D;  5GSU D;  3B0C T;  4H9R A;  4G91 B;  2IO5 B;  4J8W C;  3AZL A;  5BO0 A;  4H9P B;  5AV5 C;  3TU4 C;  3MGR A;  1KX3 D;  4J8X C;  3X1V C;  4Z66 B;  4E45 A;  5B33 D;  3REI A;  3UT9 B;  3MVD C;  4J8V A;  4JJN B;  3AZF D;  2JSS A;  1HQ3 B;  3R45 B;  4CAY A;  3KWQ D;  4J8W A;  3W97 D;  5AV5 A;  1AOI A;  1P3G D;  5B32 A;  1P3A B;  5CPJ D;  3X1V A;  3UTA D;  5GSU C;  3REH A;  3KUY C;  4KGC B;  1EQZ C;  3NQU A;  1KX3 C;  1HTA A;  4KHA B;  3O62 B;  4ZUX D;  4H9N B;  5AVB B;  3AZN B;  1U35 A;  3WKJ D;  5JRG B;  3AZF C;  3B0D B;  5CP6 C;  3KUY A;  3W97 C;  3WA9 D;  1A7W A;  3LJA D;  3AZK B;  1EQZ A;  3B0B A;  5AVC B;  5B40 D;  5AV9 A;  3LZ0 D;  1P3G C;  3VH6 A;  3AZE A;  3AZG D;  3UTA C;  1BH9 B;  2CV5 D;  2NQB C;  5B2I C;  3AZF A;  5CP6 A;  1P34 D;  5DNN D;  5BNV A;  1M19 D;  1P3G A;  1KX5 B;  5AY8 B;  3LZ1 C;  1M18 B;  3WKJ C;  1S32 B;  3UTA A;  1P3K D;  2NQB A;  3X1T D;  2PYO B;  5B2I A;  3WA9 C;  4H9S A;  5B40 C;  4G91 C;  2IO5 C;  3AZG C;  2HIO D;  3LZ1 A;  2CV5 C;  2BYM B;  3REK B;  5B2J B;  4LD9 B;  3AV1 B;  4QLC B;  2ARO B;  4JJN C;  4WU8 B;  1P34 C;  1KX4 D;  1F66 D;  4EO5 B;  1M19 C;  1HQ3 C;  4Z5T D;  4H9P A;  4YM6 D;  4KUD D;  4XZQ B;  3LEL B;  1P3A C;  4Z66 A;  3UT9 A;  3REL B;  5B1L B;  4WU9 B;  2L5A A;  3WTP D;  3KXB D;  4JJN A;  5E5A B;  1HQ3 A;  4KGC C;  3R45 A;  5BT1 D;  1WWI A;  3X1S D;  3AYW B;  1P3A A;  1M18 D;  1P3B D;  1F66 C;  3B0D C;  5JA4 B;  1M1A D;  2CWE A;  3REJ B;  4Z5T C;  4KGC A;  4YM6 C;  3AFA B;  4KUD C;  5KDM B;  4KHA A;  3O62 A;  4H9N A;  5AVB A;  4M6B A;  3AZN A;  5JRG A;  3WTP C;  3KXB C;  5B2J D;  1ID3 D;  3MGS B;  5BT1 C;  4QLC D;  3AV1 D;  4WU8 D;  3AZK A;  3X1S C;  5AVC A;  1KX5 C;  5AY8 C;  1M18 C;  2YFW B;  5BS7 C;  3MNN D;  4J8U D;  1BH9 A;  1TAF B;  3REL D;  3AZL D;  3MGR D;  4HGA B;  1P3M B;  1KX5 A;  2LY8 A;  3MGP D;  5AY8 A;  3REI D;  1M18 A;  1S32 A;  4J8V D;  5BS7 A;  3AYW D;  3REK C;  5B2J C;  4R8P B;  2PYO A;  3AV1 C;  4QLC C;  4WU8 C;  4J8W D;  4X23 B;  1AOI D;  4WV4 B;  5B32 D;  3REJ D;  3X1V D;  3MNN C;  4J8U C;  3REH D;  3LEL C;  1B6W A;  2BYM A;  5BNX B;  5B2J A;  3REK A;  3UTB B;  3REL C;  2NZD B;  3AZL C;  5B1L C;  3NQJ B;  4QLC A;  2ARO A;  3AV1 A;  4WU8 A;  3MGR C;  5B32 G;  5E5A C;  3MGP C;  3REI C;  1U35 D;  4J8V C;  3MNN A;  3AYW C;  4J8U A;  4XZQ A;  3LEL A;  2F8N G;  3KUY D;  3REL A;  5B1L A;  4WU9 A;  1AOI C;  1EQZ D;  4AWL B;  5AV9 D;  1N1J B;  5B32 C;  3REJ C;  3A6N B;  4UUZ B;  5E5A A;  3AZE D;  3MGP A;  1ZLA B;  3AFA C;  1P3O B;  3MGQ B;  3REH C;  3AYW A;  5CP6 D;  5JA4 A;  3REJ A;  1U35 C;  3AFA A;  3VH5 A;  5KDM A;  2BYK B;  2NQB D;  5B2I D;  1P3P B;  5AV9 C;  3MGS A;  3AZE C;  2NZD D;  3LZ1 D;  5DNM B;  1BFM A;  2YFW A;  5B31 B;  1P3F B;  1TAF A;  3A6N D;  4Z66 D;  3UT9 D;  3AZM B;  4H9Q B;  4H9S C;  3C1B B;  4NE5 A;  4JJN D;  3UTB C;  5B1M B;  4R8P A;  2NZD C;  1HQ3 D;  4X23 A;  3VH6 W;  2HUE B;  1P3A D;  5AV8 B;  2F8N H;  3UTB A;  5BNX A;  3W96 B;  1P3P D;  2NZD A;  4YS3 B;  1P3L B;  3NQJ A;  4KGC D;  4H9O B;  4XUJ B;  4AWL C;  3A6N C;  3O62 D;  5B0Z B;  4Z66 C;  3UT9 C;  1ZLA C;  3W98 B;  5AV6 B;  1P3O C;  3AZN D;  5AVB D;  5DNM D;  5JRG D;  5GT3 B;  4CSR B;  3AZK D;  5AVC D;  1N1J A;  3WTP E;  3A6N A;  4UUZ A;  3B6G B;  1ZLA A;  1P3O A;  3MGQ A;  3C1C B;  1P3P C;  1JFI B;  2FJ7 B;  5B1M D;  3O62 C;  1KX5 D;  5CPK B;  5AY8 D;  3AZN C;  5AVB C;  1S32 D;  5DNM C;  3AN2 B;  5JRG C;  3V9R B;  2BYK A;  3W99 B;  1Q9C A;  2PYO D;  5GXQ B;  1P3P A;  5B31 C;  3AZK C;  1P3F C;  5AVC C;  3B0C W;  4YS3 D;  5CPI B;  3AV2 B;  2RVQ D;  5DNM A;  1H3O B;  3WAA B;  3REK D;  5B0Y B;  4NE6 A;  4LD9 D;  2ARO D;  5B31 A;  3B6F B;  5B1M C;  5GT3 D;  1P3F A;  5B24 B;  1F1E A;  1S32 C;  4WNN B;  5C3I B;  2HUE C;  3X1U B;  5FUG B;  4XZQ D;  3LEL D;  2PYO C;  5AV8 C;  3TU4 B;  3AZH B;  5B1L D;  4WU9 D;  3AZM A;  4H9Q A;  3C1B A;  4J8X B;  5F99 B;  5B1M A;  5E5A D;  4YS3 C;  3MVD B;  1P3I B;  4XUJ C;  2RVQ C;  5B0Z C;  2F8N B;  3W98 C;  3VH6 T;  4LD9 C;  5AV8 A;  2ARO C;  1TZY B;  4EO5 C;  5GT3 C;  3W99 D;  3W96 A;  5GT0 B;  5GSU B;  4YS3 A;  1P3L A;  4NE3 A;  3AFA D;  4H9O A;  4XUJ A;  4XZQ C;  5B0Z A;  3W98 A;  5AV6 A;  1BH8 B;  3AV2 D;  4WU9 C;  1KX3 B;  4LD9 A;  5GT3 A;  5B33 B;  3MGS D;  1WWS A;  4CSR A;  3AZJ B;  5CPK C;  3W97 B;  3KWQ B;  3B6G A;  3AN2 C;  3C1C A;  3W99 C;  5CPJ B;  5GXQ C;  5G49 B;  1JFI A;  3AZH D;  1P3M D;  5CPK A;  5CPI C;  4WZS B;  3AV2 C;  3AN2 A;  3WAA C;  3V9R A;  4ZUX B;  4R8P D;  3MGS C;  3W99 A;  3WKJ B;  5GXQ A;  4X23 D;  3B6F C;  1KU5 A;  5B24 C;  3WA9 B;  3LJA B;  5CPI A;  3AV2 A;  5C3I C;  5B40 B;  3LZ0 B;  3AZI B;  3X1U C;  1H3O A;  3UTB D;  3WAA A;  5B0Y A;  3AZG B;  3AZH C;  2CV5 B;  5F99 C;  3B6F A;  4HGA C;  1P3M C;  4G92 B;  1P3I C;  5B24 A;  1P34 B;  4NFT A;  5DNN B;  3VH5 W;  3AZJ D;  4WNN A;  1M19 B;  4R8P C;  3X1U A;  2F8N K;  5FUG A; 
#chains in the Genus database with same CATH topology
 1P3K B;  4X23 C;  1TZY C;  3TU4 A;  3AZH A;  4J8X A;  3X1T B;  5F99 A;  4DRA A;  1P3M A;  5GT0 C;  3MVD A;  1P3I A;  1ZLA D;  1P3O D;  3MGQ D;  4DRB A;  2F8N A;  2ZY3 A;  2HIO B;  4UPK A;  1TZY A;  5B33 C;  1KX4 B;  5GT0 A;  1F66 B;  5GSU A;  3AZJ C;  3KWQ C;  4Z5T B;  2YFV B;  3IP4 C;  4YM6 B;  1BH8 A;  1KX3 A;  3AZI D;  4KUD B;  5CPJ C;  5B33 A;  3MGQ C;  3WTP B;  3KXB B;  3AZJ A;  3W97 A;  3KWQ A;  4ZBJ B;  3X1S B;  5B31 D;  4ZUX C;  1P3F D;  3A1K A;  5CPJ A;  1P3B B;  5G49 A;  2Y2O A;  1M1A B;  2F2A C;  3LJA C;  2ZY5 A;  5B31 G;  3AZM D;  3LZ0 C;  3AZI C;  3C1B D;  3EG5 B;  4ZUX A;  2Y2J A;  4Z2M G;  2G5I C;  1PZR A;  3WKJ A;  3EPJ A;  4G92 C;  1ID3 B;  3WA9 A;  5DNN C;  2XD5 A;  3LJA A;  5AV8 D;  5B40 A;  3LZ0 A;  3AZI A;  2J8P A;  3W96 D;  3AZG A;  3MNN B;  1P3K C;  4J8U B;  1P3L D;  4XUJ D;  2CV5 A;  4H9R B;  3X1T C;  5B0Z D;  3W98 D;  3AZL B;  5BO0 B;  3KSY A;  5AV6 D;  5DNN A;  3MGR B;  3AZM C;  1P34 A;  3C1B C;  1M19 A;  3MGP B;  3VH5 T;  2HIO C;  3REI B;  4J8V B;  1P3K A;  3X1T A;  1KX4 C;  4CAY B;  4J8W B;  3B6G D;  1B67 A;  5AV5 B;  1AOI B;  3C1C D;  5B32 B;  3X1V B;  3W96 C;  2HIO A;  3REH B;  1P3L C;  4E44 A;  2FJ7 D;  5CPK D;  5AV6 C;  1KX4 A;  3NQU B;  1F66 A;  3AN2 D;  4Z5T A;  2YFV A;  4ZBJ C;  5GXQ D;  1U35 B;  4YM6 A;  4WJ3 C;  4KUD A;  1P3B C;  3KUY B;  3B6G C;  5CPI D;  1EQZ B;  5AV9 B;  3WTP A;  3KXB A;  3C1C C;  1M1A C;  3WAA D;  3AZE B;  5B0Y D;  3X1S A;  1R4V A;  4Z2M H;  2VQR A;  2FJ7 C;  3B6F D;  5CHL B;  3AZF B;  1P3B A;  5CP6 B;  5B24 D;  1ID3 C;  5BNV B;  1P3G B;  1M1A A;  3X1U D;  3UTA B;  3H0L C;  5AV5 D;  3TU4 D;  4J8X D;  2NQB B;  5F99 D;  2FJ7 A;  5B2I B;  3MVD D;  1P3I D;  1ULY A;  1ID3 A;  2F8N D;  5B0Y C;  3LZ1 B;  3EPH A;  1TZY D;  5GT0 D;  5GSU D;  3B0C T;  4H9R A;  4G91 B;  2IO5 B;  4J8W C;  3AZL A;  5BO0 A;  4H9P B;  5AV5 C;  3TU4 C;  3MGR A;  1KX3 D;  4J8X C;  3X1V C;  3AL0 C;  4Z66 B;  4E45 A;  5B33 D;  3REI A;  3UT9 B;  3MVD C;  4J8V A;  4JJN B;  3AZF D;  2JSS A;  1HQ3 B;  3R45 B;  2Y2I A;  4CAY A;  3KWQ D;  4J8W A;  3W97 D;  3EPK A;  5AV5 A;  1AOI A;  1P3G D;  5B32 A;  1P3A B;  5CPJ D;  3X1V A;  3UTA D;  5GSU C;  3REH A;  3KUY C;  4KGC B;  1EQZ C;  3NQU A;  1KX3 C;  1HTA A;  4KHA B;  3O62 B;  4ZUX D;  4H9N B;  5AVB B;  3AZN B;  1U35 A;  3WKJ D;  5JRG B;  3AZF C;  3B0D B;  5CP6 C;  3KUY A;  3W97 C;  3WA9 D;  1A7W A;  3LJA D;  3AZK B;  1EQZ A;  3B0B A;  5AVC B;  5B40 D;  5AV9 A;  3LZ0 D;  1P3G C;  3VH6 A;  3AZE A;  3AZG D;  3UTA C;  1BH9 B;  2CV5 D;  2NQB C;  3EPL A;  5B2I C;  3AZF A;  5CP6 A;  1P34 D;  5DNN D;  5BNV A;  1M19 D;  1P3G A;  1KX5 B;  5AY8 B;  3LZ1 C;  1M18 B;  3WKJ C;  1S32 B;  3UTA A;  1P3K D;  2ZY4 A;  2NQB A;  3X1T D;  2PYO B;  5B2I A;  3WA9 C;  4H9S A;  5B40 C;  4G91 C;  2IO5 C;  3AZG C;  2HIO D;  3LZ1 A;  2CV5 C;  2BYM B;  3REK B;  5B2J B;  4LD9 B;  3AV1 B;  4QLC B;  2ARO B;  4JJN C;  4WU8 B;  1P34 C;  1KX4 D;  1F66 D;  4EO5 B;  1M19 C;  1HQ3 C;  4Z5T D;  4H9P A;  4YM6 D;  4KUD D;  4XZQ B;  3LEL B;  1P3A C;  2Y2G A;  4Z66 A;  3UT9 A;  3REL B;  5B1L B;  4WU9 B;  2L5A A;  3WTP D;  3KXB D;  4JJN A;  5E5A B;  1HQ3 A;  4KGC C;  3R45 A;  5BT1 D;  1WWI A;  3X1S D;  3AYW B;  1P3A A;  1M18 D;  1P3B D;  2Y2K A;  1F66 C;  3B0D C;  5JA4 B;  1M1A D;  2CWE A;  3REJ B;  4Z5T C;  4KGC A;  4YM6 C;  3H0M C;  3AFA B;  4KUD C;  5KDM B;  4DQY B;  4KHA A;  3O62 A;  4H9N A;  5AVB A;  4M6B A;  3AZN A;  5JRG A;  3WTP C;  3KXB C;  5B2J D;  1ID3 D;  3MGS B;  5BT1 C;  4QLC D;  3AV1 D;  4WU8 D;  3AZK A;  3X1S C;  5AVC A;  1KX5 C;  5AY8 C;  1M18 C;  2YFW B;  5BS7 C;  3MNN D;  4J8U D;  1BH9 A;  1W2E A;  1TAF B;  3REL D;  3AZL D;  3MGR D;  4HGA B;  1P3M B;  1KX5 A;  2LY8 A;  3MGP D;  5AY8 A;  3REI D;  1M18 A;  1S32 A;  4J8V D;  5BS7 A;  3AYW D;  3REK C;  5B2J C;  4R8P B;  2PYO A;  2ZY2 A;  3AV1 C;  4QLC C;  4WU8 C;  4J8W D;  4X23 B;  1AOI D;  1Z2C B;  4WV4 B;  5B32 D;  3REJ D;  3X1V D;  3MNN C;  4J8U C;  3REH D;  3LEL C;  1B6W A;  2BYM A;  5BNX B;  5B2J A;  3REK A;  3UTB B;  3REL C;  2NZD B;  3AZL C;  5B1L C;  3NQJ B;  4QLC A;  2ARO A;  2Y2Q A;  4WU8 A;  3MGR C;  3AV1 A;  5B32 G;  5E5A C;  3MGP C;  3REI C;  1U35 D;  4J8V C;  3MNN A;  3AYW C;  4J8U A;  4XZQ A;  3LEL A;  2F8N G;  2JCH A;  3P5J B;  3KUY D;  3REL A;  5B1L A;  4WU9 A;  1AOI C;  2Y2L A;  4AWL B;  5AV9 D;  1EQZ D;  1N1J B;  5B32 C;  3REJ C;  3A6N B;  4UUZ B;  5E5A A;  3AZE D;  3MGP A;  1ZLA B;  3AFA C;  1P3O B;  3MGQ B;  3REH C;  3AYW A;  2Y2P A;  5CP6 D;  5JA4 A;  3REJ A;  1U35 C;  3AFA A;  3VH5 A;  5KDM A;  2BYK B;  2NQB D;  5B2I D;  1P3P B;  5AV9 C;  3MGS A;  3AZE C;  2NZD D;  3LZ1 D;  3A1I A;  5DNM B;  1BFM A;  2YFW A;  2W8S A;  3FDD A;  5B31 B;  1P3F B;  1TAF A;  3A6N D;  4Z66 D;  3UT9 D;  3AZM B;  4H9Q B;  4H9S C;  3C1B B;  4NE5 A;  4JJN D;  3UTB C;  5B1M B;  4R8P A;  2NZD C;  1HQ3 D;  4X23 A;  3VH6 W;  2HUE B;  1P3A D;  5AV8 B;  2F8N H;  3UTB A;  5BNX A;  3W96 B;  1P3P D;  2NZD A;  4YS3 B;  3H0R C;  3NQJ A;  1P3L B;  4H9O B;  4XUJ B;  4AWL C;  4KGC D;  3A6N C;  3O62 D;  5B0Z B;  4Z66 C;  3UT9 C;  1ZLA C;  3W98 B;  5AV6 B;  1P3O C;  3AZN D;  5AVB D;  5DNM D;  5JRG D;  5GT3 B;  4CSR B;  3AZK D;  5AVC D;  1N1J A;  3WTP E;  3A6N A;  4UUZ A;  3B6G B;  1ZLA A;  1P3O A;  2JE5 A;  3MGQ A;  3C1C B;  1P3P C;  1JFI B;  2FJ7 B;  5B1M D;  3O62 C;  1KX5 D;  5CPK B;  5AY8 D;  3AZN C;  5AVB C;  1S32 D;  5DNM C;  3AN2 B;  5JRG C;  3V9R B;  2BYK A;  3W99 B;  1Q9C A;  2PYO D;  5GXQ B;  1P3P A;  5B31 C;  3AZK C;  1P3F C;  5AVC C;  3B0C W;  4YS3 D;  5CPI B;  3AV2 B;  2RVQ D;  5DNM A;  1H3O B;  3WAA B;  3REK D;  5B0Y B;  2DF4 C;  4NE6 A;  4LD9 D;  2ARO D;  5B31 A;  3B6F B;  5B1M C;  5GT3 D;  1P3F A;  5B24 B;  1F1E A;  1S32 C;  4WNN B;  5C3I B;  2HUE C;  3X1U B;  2DQN C;  5FUG B;  4XZQ D;  3LEL D;  2PYO C;  5AV8 C;  2ZM5 A;  2RIQ A;  3TU4 B;  3AZH B;  5B1L D;  4WU9 D;  3AZM A;  4H9Q A;  2G5H C;  3C1B A;  4J8X B;  5F99 B;  5B1M A;  5E5A D;  4YS3 C;  2FFF B;  3MVD B;  1P3I B;  4XUJ C;  2RVQ C;  5B0Z C;  2F8N B;  3W98 C;  2Y2M A;  3VH6 T;  4LD9 C;  5AV8 A;  2ARO C;  1TZY B;  2BG1 A;  4EO5 C;  5GT3 C;  3W99 D;  2Y2N A;  3W96 A;  5GT0 B;  5GSU B;  4YS3 A;  1P3L A;  4NE3 A;  3AFA D;  4H9O A;  4XUJ A;  4XZQ C;  5B0Z A;  3W98 A;  5AV6 A;  1BH8 B;  3AV2 D;  4WU9 C;  1KX3 B;  4LD9 A;  2XD1 A;  5GT3 A;  5B33 B;  3MGS D;  1WWS A;  4CSR A;  3AZJ B;  2Y2H A;  5CPK C;  3W97 B;  3KWQ B;  3B6G A;  3AN2 C;  3C1C A;  3W99 C;  5CPJ B;  5GXQ C;  5G49 B;  1JFI A;  3AZH D;  1P3M D;  3F6T A;  5CPI C;  5CPK A;  4WZS B;  3AV2 C;  3AN2 A;  3WAA C;  1T3U A;  3V9R A;  4ZUX B;  4R8P D;  3MGS C;  3W99 A;  3WKJ B;  5GXQ A;  4X23 D;  3B6F C;  2UWX A;  1KU5 A;  5B24 C;  3WA9 B;  3LJA B;  5CPI A;  3AV2 A;  5C3I C;  5B40 B;  3LZ0 B;  3AZI B;  3X1U C;  1H3O A;  3UTB D;  3WAA A;  5B0Y A;  3AZG B;  3AZH C;  2CV5 B;  5F99 C;  3B6F A;  4HGA C;  1P3M C;  4G92 B;  1P3I C;  5B24 A;  1P34 B;  4NFT A;  5DNN B;  3VH5 W;  3AZJ D;  4WNN A;  1M19 B;  4R8P C;  3X1U A;  2F8N K;  5FUG A;  3KFU G; 
#chains in the Genus database with same CATH homology
 1P3K B;  4X23 C;  1TZY C;  3TU4 A;  3AZH A;  4J8X A;  3X1T B;  5F99 A;  4DRA A;  1P3M A;  5GT0 C;  3MVD A;  1P3I A;  1ZLA D;  1P3O D;  3MGQ D;  4DRB A;  2F8N A;  2ZY3 A;  2HIO B;  4UPK A;  1TZY A;  5B33 C;  1KX4 B;  5GT0 A;  1F66 B;  5GSU A;  3AZJ C;  3KWQ C;  4Z5T B;  2YFV B;  3IP4 C;  4YM6 B;  1BH8 A;  1KX3 A;  3AZI D;  4KUD B;  5CPJ C;  5B33 A;  3MGQ C;  3WTP B;  3KXB B;  3AZJ A;  3W97 A;  3KWQ A;  4ZBJ B;  3X1S B;  5B31 D;  4ZUX C;  1P3F D;  3A1K A;  5CPJ A;  1P3B B;  5G49 A;  2Y2O A;  1M1A B;  2F2A C;  3LJA C;  2ZY5 A;  5B31 G;  3AZM D;  3LZ0 C;  3AZI C;  3C1B D;  3EG5 B;  4ZUX A;  2Y2J A;  4Z2M G;  2G5I C;  1PZR A;  3WKJ A;  3EPJ A;  4G92 C;  1ID3 B;  3WA9 A;  5DNN C;  2XD5 A;  3LJA A;  5AV8 D;  5B40 A;  3LZ0 A;  3AZI A;  2J8P A;  3W96 D;  3AZG A;  3MNN B;  1P3K C;  4J8U B;  1P3L D;  4XUJ D;  2CV5 A;  4H9R B;  3X1T C;  5B0Z D;  3W98 D;  3AZL B;  5BO0 B;  3KSY A;  5AV6 D;  5DNN A;  3MGR B;  3AZM C;  1P34 A;  3C1B C;  1M19 A;  3MGP B;  3VH5 T;  2HIO C;  3REI B;  4J8V B;  1P3K A;  3X1T A;  1KX4 C;  4CAY B;  4J8W B;  3B6G D;  1B67 A;  5AV5 B;  1AOI B;  3C1C D;  5B32 B;  3X1V B;  3W96 C;  2HIO A;  3REH B;  1P3L C;  4E44 A;  2FJ7 D;  5CPK D;  5AV6 C;  1KX4 A;  3NQU B;  1F66 A;  3AN2 D;  4Z5T A;  2YFV A;  4ZBJ C;  5GXQ D;  1U35 B;  4YM6 A;  4WJ3 C;  4KUD A;  1P3B C;  3KUY B;  3B6G C;  5CPI D;  1EQZ B;  5AV9 B;  3WTP A;  3KXB A;  3C1C C;  1M1A C;  3WAA D;  3AZE B;  5B0Y D;  3X1S A;  1R4V A;  4Z2M H;  2VQR A;  2FJ7 C;  3B6F D;  5CHL B;  3AZF B;  1P3B A;  5CP6 B;  5B24 D;  1ID3 C;  5BNV B;  1P3G B;  1M1A A;  3X1U D;  3UTA B;  3H0L C;  5AV5 D;  3TU4 D;  4J8X D;  2NQB B;  5F99 D;  2FJ7 A;  5B2I B;  3MVD D;  1P3I D;  1ULY A;  1ID3 A;  2F8N D;  5B0Y C;  3LZ1 B;  3EPH A;  1TZY D;  5GT0 D;  5GSU D;  3B0C T;  4H9R A;  4G91 B;  2IO5 B;  4J8W C;  3AZL A;  5BO0 A;  4H9P B;  5AV5 C;  3TU4 C;  3MGR A;  1KX3 D;  4J8X C;  3X1V C;  3AL0 C;  4Z66 B;  4E45 A;  5B33 D;  3REI A;  3UT9 B;  3MVD C;  4J8V A;  4JJN B;  3AZF D;  2JSS A;  1HQ3 B;  3R45 B;  2Y2I A;  4CAY A;  3KWQ D;  4J8W A;  3W97 D;  3EPK A;  5AV5 A;  1AOI A;  1P3G D;  5B32 A;  1P3A B;  5CPJ D;  3X1V A;  3UTA D;  5GSU C;  3REH A;  3KUY C;  4KGC B;  1EQZ C;  3NQU A;  1KX3 C;  1HTA A;  4KHA B;  3O62 B;  4ZUX D;  4H9N B;  5AVB B;  3AZN B;  1U35 A;  3WKJ D;  5JRG B;  3AZF C;  3B0D B;  5CP6 C;  3KUY A;  3W97 C;  3WA9 D;  1A7W A;  3LJA D;  3AZK B;  1EQZ A;  3B0B A;  5AVC B;  5B40 D;  5AV9 A;  3LZ0 D;  1P3G C;  3VH6 A;  3AZE A;  3AZG D;  3UTA C;  1BH9 B;  2CV5 D;  2NQB C;  3EPL A;  5B2I C;  3AZF A;  5CP6 A;  1P34 D;  5DNN D;  5BNV A;  1M19 D;  1P3G A;  1KX5 B;  5AY8 B;  3LZ1 C;  1M18 B;  3WKJ C;  1S32 B;  3UTA A;  1P3K D;  2ZY4 A;  2NQB A;  3X1T D;  2PYO B;  5B2I A;  3WA9 C;  4H9S A;  5B40 C;  4G91 C;  2IO5 C;  3AZG C;  2HIO D;  3LZ1 A;  2CV5 C;  2BYM B;  3REK B;  5B2J B;  4LD9 B;  3AV1 B;  4QLC B;  2ARO B;  4JJN C;  4WU8 B;  1P34 C;  1KX4 D;  1F66 D;  4EO5 B;  1M19 C;  1HQ3 C;  4Z5T D;  4H9P A;  4YM6 D;  4KUD D;  4XZQ B;  3LEL B;  1P3A C;  2Y2G A;  4Z66 A;  3UT9 A;  3REL B;  5B1L B;  4WU9 B;  2L5A A;  3WTP D;  3KXB D;  4JJN A;  5E5A B;  1HQ3 A;  4KGC C;  3R45 A;  5BT1 D;  1WWI A;  3X1S D;  3AYW B;  1P3A A;  1M18 D;  1P3B D;  2Y2K A;  1F66 C;  3B0D C;  5JA4 B;  1M1A D;  2CWE A;  3REJ B;  4Z5T C;  4KGC A;  4YM6 C;  3H0M C;  3AFA B;  4KUD C;  5KDM B;  4DQY B;  4KHA A;  3O62 A;  4H9N A;  5AVB A;  4M6B A;  3AZN A;  5JRG A;  3WTP C;  3KXB C;  5B2J D;  1ID3 D;  3MGS B;  5BT1 C;  4QLC D;  3AV1 D;  4WU8 D;  3AZK A;  3X1S C;  5AVC A;  1KX5 C;  5AY8 C;  1M18 C;  2YFW B;  5BS7 C;  3MNN D;  4J8U D;  1BH9 A;  1W2E A;  1TAF B;  3REL D;  3AZL D;  3MGR D;  4HGA B;  1P3M B;  1KX5 A;  2LY8 A;  3MGP D;  5AY8 A;  3REI D;  1M18 A;  1S32 A;  4J8V D;  5BS7 A;  3AYW D;  3REK C;  5B2J C;  4R8P B;  2PYO A;  2ZY2 A;  3AV1 C;  4QLC C;  4WU8 C;  4J8W D;  4X23 B;  1AOI D;  1Z2C B;  4WV4 B;  5B32 D;  3REJ D;  3X1V D;  3MNN C;  4J8U C;  3REH D;  3LEL C;  1B6W A;  2BYM A;  5BNX B;  5B2J A;  3REK A;  3UTB B;  3REL C;  2NZD B;  3AZL C;  5B1L C;  3NQJ B;  4QLC A;  2ARO A;  2Y2Q A;  4WU8 A;  3MGR C;  3AV1 A;  5B32 G;  5E5A C;  3MGP C;  3REI C;  1U35 D;  4J8V C;  3MNN A;  3AYW C;  4J8U A;  4XZQ A;  3LEL A;  2F8N G;  2JCH A;  3P5J B;  3KUY D;  3REL A;  5B1L A;  4WU9 A;  1AOI C;  2Y2L A;  4AWL B;  5AV9 D;  1EQZ D;  1N1J B;  5B32 C;  3REJ C;  3A6N B;  4UUZ B;  5E5A A;  3AZE D;  3MGP A;  1ZLA B;  3AFA C;  1P3O B;  3MGQ B;  3REH C;  3AYW A;  2Y2P A;  5CP6 D;  5JA4 A;  3REJ A;  1U35 C;  3AFA A;  3VH5 A;  5KDM A;  2BYK B;  2NQB D;  5B2I D;  1P3P B;  5AV9 C;  3MGS A;  3AZE C;  2NZD D;  3LZ1 D;  3A1I A;  5DNM B;  1BFM A;  2YFW A;  2W8S A;  3FDD A;  5B31 B;  1P3F B;  1TAF A;  3A6N D;  4Z66 D;  3UT9 D;  3AZM B;  4H9Q B;  4H9S C;  3C1B B;  4NE5 A;  4JJN D;  3UTB C;  5B1M B;  4R8P A;  2NZD C;  1HQ3 D;  4X23 A;  3VH6 W;  2HUE B;  1P3A D;  5AV8 B;  2F8N H;  3UTB A;  5BNX A;  3W96 B;  1P3P D;  2NZD A;  4YS3 B;  3H0R C;  3NQJ A;  1P3L B;  4H9O B;  4XUJ B;  4AWL C;  4KGC D;  3A6N C;  3O62 D;  5B0Z B;  4Z66 C;  3UT9 C;  1ZLA C;  3W98 B;  5AV6 B;  1P3O C;  3AZN D;  5AVB D;  5DNM D;  5JRG D;  5GT3 B;  4CSR B;  3AZK D;  5AVC D;  1N1J A;  3WTP E;  3A6N A;  4UUZ A;  3B6G B;  1ZLA A;  1P3O A;  2JE5 A;  3MGQ A;  3C1C B;  1P3P C;  1JFI B;  2FJ7 B;  5B1M D;  3O62 C;  1KX5 D;  5CPK B;  5AY8 D;  3AZN C;  5AVB C;  1S32 D;  5DNM C;  3AN2 B;  5JRG C;  3V9R B;  2BYK A;  3W99 B;  1Q9C A;  2PYO D;  5GXQ B;  1P3P A;  5B31 C;  3AZK C;  1P3F C;  5AVC C;  3B0C W;  4YS3 D;  5CPI B;  3AV2 B;  2RVQ D;  5DNM A;  1H3O B;  3WAA B;  3REK D;  5B0Y B;  2DF4 C;  4NE6 A;  4LD9 D;  2ARO D;  5B31 A;  3B6F B;  5B1M C;  5GT3 D;  1P3F A;  5B24 B;  1F1E A;  1S32 C;  4WNN B;  5C3I B;  2HUE C;  3X1U B;  2DQN C;  5FUG B;  4XZQ D;  3LEL D;  2PYO C;  5AV8 C;  2ZM5 A;  2RIQ A;  3TU4 B;  3AZH B;  5B1L D;  4WU9 D;  3AZM A;  4H9Q A;  2G5H C;  3C1B A;  4J8X B;  5F99 B;  5B1M A;  5E5A D;  4YS3 C;  2FFF B;  3MVD B;  1P3I B;  4XUJ C;  2RVQ C;  5B0Z C;  2F8N B;  3W98 C;  2Y2M A;  3VH6 T;  4LD9 C;  5AV8 A;  2ARO C;  1TZY B;  2BG1 A;  4EO5 C;  5GT3 C;  3W99 D;  2Y2N A;  3W96 A;  5GT0 B;  5GSU B;  4YS3 A;  1P3L A;  4NE3 A;  3AFA D;  4H9O A;  4XUJ A;  4XZQ C;  5B0Z A;  3W98 A;  5AV6 A;  1BH8 B;  3AV2 D;  4WU9 C;  1KX3 B;  4LD9 A;  2XD1 A;  5GT3 A;  5B33 B;  3MGS D;  1WWS A;  4CSR A;  3AZJ B;  2Y2H A;  5CPK C;  3W97 B;  3KWQ B;  3B6G A;  3AN2 C;  3C1C A;  3W99 C;  5CPJ B;  5GXQ C;  5G49 B;  1JFI A;  3AZH D;  1P3M D;  3F6T A;  5CPI C;  5CPK A;  4WZS B;  3AV2 C;  3AN2 A;  3WAA C;  1T3U A;  3V9R A;  4ZUX B;  4R8P D;  3MGS C;  3W99 A;  3WKJ B;  5GXQ A;  4X23 D;  3B6F C;  2UWX A;  1KU5 A;  5B24 C;  3WA9 B;  3LJA B;  5CPI A;  3AV2 A;  5C3I C;  5B40 B;  3LZ0 B;  3AZI B;  3X1U C;  1H3O A;  3UTB D;  3WAA A;  5B0Y A;  3AZG B;  3AZH C;  2CV5 B;  5F99 C;  3B6F A;  4HGA C;  1P3M C;  4G92 B;  1P3I C;  5B24 A;  1P34 B;  4NFT A;  5DNN B;  3VH5 W;  3AZJ D;  4WNN A;  1M19 B;  4R8P C;  3X1U A;  2F8N K;  5FUG A;  3KFU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...