3WTPE

Crystal structure of the heterotypic nucleosome containing human cenp-a and h3.3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
100
structure length
100
Chain Sequence
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 34
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wtpE00
3MGRD 5B32D 4H9RB 3AZHB 5CPKC 4JJND 5KDMA 5AV6B 2L5AA 3AZGB 5GT3B 4ZUXA 5AVBB 4X23A 3MGRB 3X1SC 5B32B 5B2ID 4YS3A 2AROA 4JJNB 5CHLB 3MGSC 5B33A 3AZIA 1S32C 3WA9D 4H9RA 3AZHA 3MNNC 1R4VA 3KWQA 4EO5B 5B2IB 2HIOC 4J8VA 5GT3A 5GSUC 5AVBA 1AOIC 5B32A 5AV9B 1P3KD 5B31D 3RELD 3WA9B 3AV1A 2NZDC 3UTAD 1M1AC 3KUYD 3AZLC 4CAYB 1WWSA 4KUDA 3REJC 4DRAA 5B2IA 5BS7A 1P3KB 2F8NK 4H9SC 5B31B 3RELB 3MGQC 3LZ1A 1KX5C 5CPJA 3UTAB 3KUYB 1P3GC 4NFTA 3AZMA 3REKC 1H3OB 1TZYD 1F66D 5DNMB 3MVDA 4NE3A 3B6GC 1EQZC 5B1MD 5F99C 5AY8A 1P3KA 5AVCD 5B31A 3RELA 1WWIA 5B1LA 3AYWD 1TZYB 3UTAA 3KUYA 1F66B 5DNND 5B1MB 1M19C 1M18D 1P3OD 5JRGA 5AVCB 1H3OA 4UUZB 3LJAC 4Z2MG 3AZND 3X1TA 1HQ3C 3AYWB 5AV5C 4LD9C 5CPKD 4WU9A 5DNNB 1M18B 1A7WA 4AWLC 1P3OB 1TZYA 4XZQD 4G92B 3AZNB 5B1MA 5AVCA 3KXBC 5CPKB 3REHC 3A6NC 5B0ZC 3AYWA 4XZQB 4J8UA 3AZJA 5DNNA 1M18A 1BH8B 3AFAC 5AV8D 5GSUD 3REIC 1AOID 3UT9C 4WU8C 5CPKA 4KGCD 4WV4B 5AV8B 5GSUB 3X1UB 3AZLD 3X1SA 1AOIB 5GXQC 1P3MC 1BH8A 3MGQD 2NQBC 1HTAA 4KGCB 5G49B 3MGSA 2FJ7C 2CWEA 1S32A 1P3GD 5BT1C 3MNNA 3AN2C 2F8NG 5GSUA 3MGQB 3B6GD 1EQZD 5F99D 1AOIA 3V9RB 1ZLAC 4QLCC 1P3GB 3W99C 4ZUXD 4X23D 3TU4C 1M1AA 3AZLA 3WTPE 3B6GB 4R8PC 5F99B 1M19D 4YS3D 1EQZB 2AROD 4H9OA 4KHAB 5KDMB 4G91C 4H9SA 5B33D 3AZID 3MGQA 2IO5C 4ZUXB 1KX5A 4X23B 3V9RA 1HQ3D 3KWQD 5AV5D 4LD9D 3AZKC 1P3GA 4J8VD 1M19B 4YS3B 2AROB 5B33B 3AZIB 3B6GA 1EQZA 5F99A 3AV1D 3UTBC 1HQ3B 4KHAA 3KWQB 5AV5B 4Z5TC 3KXBD 4LD9B 4J8VB 3WAAC 3WKJC 3A6ND 5B0ZD 4AWLB 4KUDD 1ID3C 3AV2C 4M6BA 1M19A 3AV1B 3AFAD 3LZ1D 3KXBB 1P3PC 2YFWB 3X1VC 5CPJD 3A6NB 5B0ZB 1HQ3A 4KUDB 3AZMD 5AV5A 4LD9A 3MVDD 3AFAB 3LZ1B 1U35C 5AY8D 5GXQD 5CPJB 3LZ0C 4XUJC 3VH5W 5B1LD 3AZMB 2NQBD 3KXBA 2YFWA 5E5AC 3REHA 3MVDB 3A6NA 4H9QB 2FJ7D 4E45A 5B0ZA 1KX3C 5AY8B 5JRGD 1N1JB 5GXQB 2HUEC 3VH5A 4NE6A 3AFAA 4YM6C 5B1LB 3X1TD 3WTPC 2NQBB 3REIA 1ZLAD 3UT9A 4WU9D 2FJ7B 3W99D 4WU8A 5JRGB 3W97C 3R45A 1KX4C 3TU4D 3B6FC 4H9QA 3X1TB 1N1JA 5GXQA 1P3AC 1ZLAB 4WU9B 3AZEC 3W99B 2NQBA 1P3IC 3TU4B 4J8UD 3AZJD 1P34C 2FJ7A 1BFMA 5BO0B 3C1BC 3AN2A 5CPIC 4G91B 3UTBD 1P3LC 1ZLAA 3W96C 4ZBJC 4QLCA 4Z5TD 4J8UB 3AZJB 3W99A 3WKJD 3X1SD 3TU4A 5C3IC 1Q9CA 5BO0A 4R8PA 3UTBB 4Z5TB 3MGSD 1P3PD 3X1VD 3WKJB 2RVQC 1S32D 3X1SB 3MNND 3VH6W 2HIOD 3AZKA 1U35D 4HGAC 1P3PB 3MGSB 5AV6C 3O62C 3X1VB 4Z2MH 1S32B 3LZ0D 3AZGC 3UTBA 3MNNB 2NZDD 3MGRC 3VH6A 4Z5TA 3C1CC 2HIOB 3WAAA 1M1AD 5E5AD 3WKJA 3REJD 1U35B 4JJNC 1ID3A 3AV2A 3LZ0B 1B6WA 2F8ND 2NZDB 4YM6D 1KX5D 5B24C 3W98C 1P3PA 4WZSB 4EO5C 5B2IC 5B0YC 3X1VA 1M1AB 5E5AB 3AZLB 3REJB 4H9OB 3REKD 2HIOA 5AV9C 3W97D 1KX4D 2HUEB 2F8NB 3WA9C 3AZFC 4YM6B 1U35A 1KX5B 5CP6C 4H9NB 3LELC 3LZ0A 4XUJA 3AZED 2NZDA 3REKB 1TAFB 3W97B 1KX4B 5E5AA 4CSRA 3REJA 1KX3A 3VH5T 4E44A 1P3FC 3LJAD 5CPID 3AZEB 2F8NA 4YM6A 3WTPA 1P3BC 4H9NA 4WNNA 3W96D 5DNMC 2YFVB 3REKA 3LJAB 1TAFA 3W97A 1KX4A 5CPIB 1ULYA 2F8NH 3B6FA 1P3AA 3W96B 1F66C 3REHD 3AZEA 3B0BA 5B40C 1P3IA 1P34A 5C3IB 2YFVA 5BNXA 3LJAA 2PYOC 3C1BA 3REID 5CPIA 4J8XC 3REHB 3UT9D 3O62D 1P3OC 1P3LA 4WU8D 3W96A 3C1CD 4G92C 3MGPC 3AZNC 4DRBA 3REIB 4HGAB 3UT9B 3O62B 1P3MD 4WU8B 5B32G 5B24D 3W98D 3R45B 4XZQC 3C1CB 5B0YD 3NQJA 5BT1D 5B2JC 5GT0C 5BNVB 3AN2D 1P3MB 5AV9D 2LY8A 3AZFD 5B24B 3W98B 5CP6D 3B0DC 5AV6A 4QLCD 5B0YB 4Z66C 3O62A 3LELD 3VH6T 3AZGA 3KSYA 5AV8C 3X1UC 3MGRA 3AN2B 3C1CA 3NQUB 3B0CW 4R8PD 3AZFB 4JJNA 5BNVA 5CP6B 1P3FD 4QLCB 3LELB 1P3MA 4KGCC 4J8WC 1P3BD 5B24A 3W98A 5B31G 5B0YA 3AZKD 2CV5C 5DNMD 4R8PB 1P3FB 1BH9B 5AV9A 3NQUA 3WA9A 2IO5B 3AZFA 1P3BB 5CP6A 3LELA 3AZKB 3WAAD 4CAYA 1ID3D 5B40D 3AV2D 4ZUXC 4X23C 1P3FA 1BH9A 2BYMB 2PYOD 4J8XD 3WAAB 1JFIB 1P3BA 4YS3C 2AROC 1ID3B 5B40B 3AV2B 2JSSA 5JA4B 5DNMA 5B33C 3AZIC 3MGPD 3AZHC 3KWQC 2PYOB 4J8XB 4J8VC 4XUJD 5GT3C 5AVBC 2BYMA 5B32C 1F66A 3MGPB 1JFIA 3AV1C 1KX3D 5B2JD 5B40A 4UUZA 1B67A 5JA4A 5GT0D 4XUJB 3WTPD 4KUDC 2PYOA 5BS7C 4J8XA 4Z66D 4CSRB 1KX3B 1P3OA 5B2JB 3X1UD 3LZ1C 5GT0B 5CPJC 3MGPA 3AZNA 3B6FD 3WTPB 3AZMC 4WNNB 1P3AD 1KU5A 3B0DB 4Z66B 3MVDC 4J8WD 4NE5A 5AY8C 1P3KC 4XZQA 5B31C 1P3ID 3B6FB 1P34D 3RELC 2CV5D 5B2JA 5B1LC 5GT0A 1P3AB 3C1BD 3UTAC 3KUYC 4J8WB 2BYKB 5JRGC 1P3LD 4Z66A 1P3IB 1P34B 5FUGB 2CV5B 5BNXB 5AV8A 3X1UA 3X1TC 3C1BB 4WU9C 4H9PB 1P3LB 4ZBJB 1TZYC 5G49A 4KGCA 4J8WA 2BYKA 2RVQD 5B1MC 5AVCC 3B0CT 5FUGA 1F1EA 2CV5A 3AYWC 3AZHD 5AV6D 4J8UC 4H9PA 3AZJC 5DNNC 1M18C 3AZGD 3NQJB 5GT3D 5AVBD
chains in the Genus database with same CATH superfamily
3MGRD 5B32D 2ZY2A 4H9RB 3AZHB 5CPKC 4JJND 5KDMA 5AV6B 4DQYB 2Y2LA 2L5AA 3AZGB 5GT3B 4ZUXA 5AVBB 1PZRA 4X23A 3MGRB 3X1SC 5B32B 5B2ID 4YS3A 2AROA 4JJNB 5CHLB 3MGSC 5B33A 3AZIA 1S32C 3WA9D 4H9RA 3AZHA 3MNNC 1R4VA 3KWQA 4EO5B 5B2IB 2HIOC 4J8VA 5GT3A 5GSUC 5AVBA 3H0MC 1AOIC 5B32A 5AV9B 3P5JB 1P3KD 5B31D 3RELD 3WA9B 3AV1A 2NZDC 3UTAD 1M1AC 3KUYD 3AZLC 4CAYB 1WWSA 2Y2PA 4KUDA 3REJC 4DRAA 5B2IA 5BS7A 1P3KB 2F8NK 4H9SC 5B31B 3RELB 2Y2NA 3MGQC 3LZ1A 1KX5C 5CPJA 3UTAB 3KUYB 1P3GC 4NFTA 3AZMA 3REKC 1H3OB 3IP4C 1TZYD 1F66D 5DNMB 3MVDA 4NE3A 3B6GC 1EQZC 5B1MD 5F99C 5AY8A 1P3KA 5AVCD 5B31A 3RELA 1WWIA 5B1LA 2Y2JA 3AYWD 1TZYB 2RIQA 3UTAA 3KUYA 1F66B 5DNND 5B1MB 1M19C 1M18D 2Y2GA 1P3OD 5JRGA 5AVCB 1H3OA 4UUZB 3LJAC 4Z2MG 3AZND 3EPHA 3X1TA 1HQ3C 3AYWB 5AV5C 4LD9C 5CPKD 4WU9A 5DNNB 1M18B 1A7WA 4AWLC 1P3OB 1TZYA 4XZQD 4G92B 3AZNB 5B1MA 5AVCA 3KXBC 5CPKB 3REHC 3A6NC 5B0ZC 3AYWA 4XZQB 4J8UA 3AZJA 5DNNA 1M18A 1BH8B 3AFAC 5AV8D 5GSUD 3REIC 2JCHA 1AOID 3UT9C 2F2AC 4WU8C 5CPKA 4KGCD 4WV4B 5AV8B 5GSUB 3X1UB 3AZLD 3X1SA 1AOIB 5GXQC 1P3MC 1BH8A 3MGQD 2NQBC 1HTAA 4KGCB 5G49B 3MGSA 2FJ7C 2CWEA 1S32A 1P3GD 5BT1C 3MNNA 3AN2C 2F8NG 5GSUA 3MGQB 3B6GD 1EQZD 5F99D 1AOIA 3V9RB 1ZLAC 4QLCC 1P3GB 3W99C 4ZUXD 2G5IC 2ZY5A 4X23D 3TU4C 1M1AA 3AZLA 3WTPE 3B6GB 4R8PC 5F99B 1M19D 4YS3D 1EQZB 2AROD 4H9OA 4KHAB 2DQNC 5KDMB 4G91C 4H9SA 5B33D 3AZID 3MGQA 2IO5C 4ZUXB 1KX5A 4X23B 3V9RA 1HQ3D 3KWQD 5AV5D 4LD9D 3AZKC 1P3GA 4J8VD 1M19B 4YS3B 2AROB 2Y2OA 5B33B 3AZIB 3B6GA 1EQZA 5F99A 3AV1D 3UTBC 1HQ3B 4KHAA 3KWQB 5AV5B 4Z5TC 3KXBD 4LD9B 4J8VB 3WAAC 3WKJC 3A6ND 5B0ZD 4AWLB 4KUDD 1ID3C 3AV2C 4M6BA 1M19A 3H0LC 3AV1B 3AFAD 3LZ1D 3KXBB 1P3PC 2YFWB 3X1VC 5CPJD 3EPLA 3A6NB 5B0ZB 1HQ3A 4KUDB 2ZY4A 5AV5A 3AZMD 4LD9A 3MVDD 3AFAB 3LZ1B 1U35C 5AY8D 5GXQD 5CPJB 3LZ0C 4XUJC 3VH5W 5B1LD 3AZMB 2NQBD 3KXBA 2YFWA 5E5AC 3REHA 3MVDB 3A6NA 4H9QB 2FJ7D 4E45A 5B0ZA 1KX3C 5AY8B 5JRGD 1N1JB 5GXQB 2Y2IA 2HUEC 3VH5A 4NE6A 3AFAA 4YM6C 5B1LB 3X1TD 3WTPC 2NQBB 3REIA 1ZLAD 3UT9A 4WU9D 2FJ7B 3W99D 3F6TA 4WU8A 5JRGB 3W97C 3R45A 2XD1A 1KX4C 3TU4D 3B6FC 4H9QA 3X1TB 1N1JA 5GXQA 1P3AC 1ZLAB 4WU9B 3AZEC 2XD5A 3W99B 2NQBA 1P3IC 3TU4B 4J8UD 3AZJD 1P34C 2FJ7A 1BFMA 5BO0B 1W2EA 3C1BC 3AN2A 2W8SA 4G91B 5CPIC 3UTBD 1P3LC 1ZLAA 3W96C 4ZBJC 4QLCA 4Z5TD 4J8UB 3AZJB 3W99A 3WKJD 3X1SD 3TU4A 5C3IC 1Q9CA 5BO0A 4R8PA 3UTBB 4Z5TB 3MGSD 1P3PD 3X1VD 3WKJB 2RVQC 1S32D 3X1SB 3MNND 3VH6W 2HIOD 3AZKA 1U35D 4HGAC 1P3PB 3MGSB 5AV6C 3O62C 3X1VB 4Z2MH 1S32B 3LZ0D 3AZGC 3UTBA 3MNNB 2NZDD 3MGRC 3VH6A 4Z5TA 3C1CC 2HIOB 3WAAA 1M1AD 5E5AD 3WKJA 3REJD 1U35B 4JJNC 1ID3A 3AV2A 3LZ0B 1B6WA 2F8ND 3EG5B 2NZDB 4YM6D 1KX5D 5B24C 3W98C 1P3PA 4WZSB 4EO5C 5B2IC 5B0YC 3X1VA 1M1AB 5E5AB 3AZLB 3REJB 4H9OB 3REKD 2HIOA 5AV9C 3W97D 1KX4D 2HUEB 2F8NB 3WA9C 3AZFC 4YM6B 2JE5A 1U35A 1KX5B 5CP6C 4H9NB 3LELC 2FFFB 3LZ0A 4XUJA 3AZED 2NZDA 3REKB 1TAFB 3W97B 1KX4B 5E5AA 4CSRA 2UWXA 3REJA 1KX3A 3VH5T 4E44A 1T3UA 3LJAD 1P3FC 5CPID 3AZEB 2F8NA 4YM6A 3WTPA 1P3BC 4H9NA 4WNNA 3W96D 3A1KA 5DNMC 2YFVB 3REKA 3LJAB 1TAFA 2ZY3A 3W97A 1KX4A 5CPIB 1ULYA 2F8NH 3B6FA 3EPKA 1P3AA 3W96B 1F66C 3REHD 3AZEA 3B0BA 2Y2HA 5B40C 1P3IA 1P34A 5C3IB 2YFVA 5BNXA 3LJAA 2PYOC 3C1BA 3REID 5CPIA 2Y2KA 4J8XC 3REHB 3UT9D 3O62D 1P3OC 1P3LA 4WU8D 3W96A 3C1CD 4G92C 3MGPC 3AZNC 4DRBA 3REIB 4HGAB 3UT9B 3O62B 1P3MD 4WU8B 5B32G 5B24D 3W98D 3R45B 4XZQC 3C1CB 5B0YD 1Z2CB 5B2JC 2G5HC 3NQJA 5BT1D 5GT0C 5BNVB 3AN2D 3EPJA 1P3MB 5AV9D 2LY8A 2DF4C 3AZFD 5B24B 3W98B 5CP6D 3B0DC 5AV6A 4QLCD 5B0YB 4Z66C 3O62A 3LELD 3VH6T 3AZGA 3KSYA 5AV8C 3X1UC 3MGRA 3AN2B 3C1CA 3NQUB 3B0CW 4R8PD 3AZFB 4WJ3C 4JJNA 5BNVA 5CP6B 1P3FD 4QLCB 3LELB 1P3MA 4KGCC 4J8WC 1P3BD 5B24A 3W98A 5B31G 5B0YA 3FDDA 3AZKD 2CV5C 5DNMD 4R8PB 1P3FB 1BH9B 2BG1A 5AV9A 3NQUA 3WA9A 2IO5B 3AZFA 1P3BB 5CP6A 3LELA 3AZKB 3WAAD 4CAYA 1ID3D 5B40D 3AV2D 4ZUXC 4X23C 1P3FA 1BH9A 2BYMB 2PYOD 4J8XD 3WAAB 1JFIB 1P3BA 4YS3C 2AROC 1ID3B 5B40B 3AV2B 2JSSA 5JA4B 5DNMA 5B33C 3AZIC 3MGPD 2ZM5A 3AZHC 3KWQC 2PYOB 2Y2QA 4J8XB 4J8VC 4XUJD 5GT3C 5AVBC 2BYMA 2Y2MA 5B32C 1F66A 3MGPB 2VQRA 1JFIA 3KFUG 3AV1C 1KX3D 5B2JD 5B40A 4UUZA 1B67A 5JA4A 5GT0D 4XUJB 3WTPD 4KUDC 2PYOA 5BS7C 4J8XA 4Z66D 4CSRB 1KX3B 1P3OA 5B2JB 3X1UD 3LZ1C 5GT0B 3H0RC 5CPJC 3MGPA 3AZNA 3B6FD 3WTPB 3AZMC 4WNNB 1P3AD 1KU5A 3B0DB 4Z66B 3MVDC 4J8WD 4NE5A 5AY8C 1P3KC 4UPKA 3A1IA 4XZQA 5B31C 1P3ID 3B6FB 1P34D 3RELC 2CV5D 5B2JA 5B1LC 5GT0A 1P3AB 3C1BD 3UTAC 3KUYC 3AL0C 4J8WB 2BYKB 5JRGC 1P3LD 4Z66A 1P3IB 1P34B 5FUGB 2CV5B 5BNXB 5AV8A 3X1UA 3X1TC 3C1BB 4WU9C 4H9PB 1P3LB 4ZBJB 1TZYC 5G49A 4KGCA 2J8PA 4J8WA 2BYKA 2RVQD 5B1MC 5AVCC 3B0CT 5FUGA 1F1EA 2CV5A 3AYWC 3AZHD 5AV6D 4J8UC 4H9PA 3AZJC 5DNNC 1M18C 3AZGD 3NQJB 5GT3D 5AVBD
chains in the Genus database with same CATH topology
3MGRD 5B32D 2ZY2A 4H9RB 3AZHB 5CPKC 4JJND 5KDMA 5AV6B 4DQYB 2Y2LA 2L5AA 3AZGB 5GT3B 4ZUXA 5AVBB 1PZRA 4X23A 3MGRB 3X1SC 5B32B 5B2ID 4YS3A 2AROA 4JJNB 5CHLB 3MGSC 5B33A 3AZIA 1S32C 3WA9D 4H9RA 3AZHA 3MNNC 1R4VA 3KWQA 4EO5B 5B2IB 2HIOC 4J8VA 5GT3A 5GSUC 5AVBA 3H0MC 1AOIC 5B32A 5AV9B 3P5JB 1P3KD 5B31D 3RELD 3WA9B 3AV1A 2NZDC 3UTAD 1M1AC 3KUYD 3AZLC 4CAYB 1WWSA 2Y2PA 4KUDA 3REJC 4DRAA 5B2IA 5BS7A 1P3KB 2F8NK 4H9SC 5B31B 3RELB 2Y2NA 3MGQC 3LZ1A 1KX5C 5CPJA 3UTAB 3KUYB 1P3GC 4NFTA 3AZMA 3REKC 1H3OB 3IP4C 1TZYD 1F66D 5DNMB 3MVDA 4NE3A 3B6GC 1EQZC 5B1MD 5F99C 5AY8A 1P3KA 5AVCD 5B31A 3RELA 1WWIA 5B1LA 2Y2JA 3AYWD 1TZYB 2RIQA 3UTAA 3KUYA 1F66B 5DNND 5B1MB 1M19C 1M18D 2Y2GA 1P3OD 5JRGA 5AVCB 1H3OA 4UUZB 3LJAC 4Z2MG 3AZND 3EPHA 3X1TA 1HQ3C 3AYWB 5AV5C 4LD9C 5CPKD 4WU9A 5DNNB 1M18B 1A7WA 4AWLC 1P3OB 1TZYA 4XZQD 4G92B 3AZNB 5B1MA 5AVCA 3KXBC 5CPKB 3REHC 3A6NC 5B0ZC 3AYWA 4XZQB 4J8UA 3AZJA 5DNNA 1M18A 1BH8B 3AFAC 5AV8D 5GSUD 3REIC 2JCHA 1AOID 3UT9C 2F2AC 4WU8C 5CPKA 4KGCD 4WV4B 5AV8B 5GSUB 3X1UB 3AZLD 3X1SA 1AOIB 5GXQC 1P3MC 1BH8A 3MGQD 2NQBC 1HTAA 4KGCB 5G49B 3MGSA 2FJ7C 2CWEA 1S32A 1P3GD 5BT1C 3MNNA 3AN2C 2F8NG 5GSUA 3MGQB 3B6GD 1EQZD 5F99D 1AOIA 3V9RB 1ZLAC 4QLCC 1P3GB 3W99C 4ZUXD 2G5IC 2ZY5A 4X23D 3TU4C 1M1AA 3AZLA 3WTPE 3B6GB 4R8PC 5F99B 1M19D 4YS3D 1EQZB 2AROD 4H9OA 4KHAB 2DQNC 5KDMB 4G91C 4H9SA 5B33D 3AZID 3MGQA 2IO5C 4ZUXB 1KX5A 4X23B 3V9RA 1HQ3D 3KWQD 5AV5D 4LD9D 3AZKC 1P3GA 4J8VD 1M19B 4YS3B 2AROB 2Y2OA 5B33B 3AZIB 3B6GA 1EQZA 5F99A 3AV1D 3UTBC 1HQ3B 4KHAA 3KWQB 5AV5B 4Z5TC 3KXBD 4LD9B 4J8VB 3WAAC 3WKJC 3A6ND 5B0ZD 4AWLB 4KUDD 1ID3C 3AV2C 4M6BA 1M19A 3H0LC 3AV1B 3AFAD 3LZ1D 3KXBB 1P3PC 2YFWB 3X1VC 5CPJD 3EPLA 3A6NB 5B0ZB 1HQ3A 4KUDB 2ZY4A 5AV5A 3AZMD 4LD9A 3MVDD 3AFAB 3LZ1B 1U35C 5AY8D 5GXQD 5CPJB 3LZ0C 4XUJC 3VH5W 5B1LD 3AZMB 2NQBD 3KXBA 2YFWA 5E5AC 3REHA 3MVDB 3A6NA 4H9QB 2FJ7D 4E45A 5B0ZA 1KX3C 5AY8B 5JRGD 1N1JB 5GXQB 2Y2IA 2HUEC 3VH5A 4NE6A 3AFAA 4YM6C 5B1LB 3X1TD 3WTPC 2NQBB 3REIA 1ZLAD 3UT9A 4WU9D 2FJ7B 3W99D 3F6TA 4WU8A 5JRGB 3W97C 3R45A 2XD1A 1KX4C 3TU4D 3B6FC 4H9QA 3X1TB 1N1JA 5GXQA 1P3AC 1ZLAB 4WU9B 3AZEC 2XD5A 3W99B 2NQBA 1P3IC 3TU4B 4J8UD 3AZJD 1P34C 2FJ7A 1BFMA 5BO0B 1W2EA 3C1BC 3AN2A 2W8SA 4G91B 5CPIC 3UTBD 1P3LC 1ZLAA 3W96C 4ZBJC 4QLCA 4Z5TD 4J8UB 3AZJB 3W99A 3WKJD 3X1SD 3TU4A 5C3IC 1Q9CA 5BO0A 4R8PA 3UTBB 4Z5TB 3MGSD 1P3PD 3X1VD 3WKJB 2RVQC 1S32D 3X1SB 3MNND 3VH6W 2HIOD 3AZKA 1U35D 4HGAC 1P3PB 3MGSB 5AV6C 3O62C 3X1VB 4Z2MH 1S32B 3LZ0D 3AZGC 3UTBA 3MNNB 2NZDD 3MGRC 3VH6A 4Z5TA 3C1CC 2HIOB 3WAAA 1M1AD 5E5AD 3WKJA 3REJD 1U35B 4JJNC 1ID3A 3AV2A 3LZ0B 1B6WA 2F8ND 3EG5B 2NZDB 4YM6D 1KX5D 5B24C 3W98C 1P3PA 4WZSB 4EO5C 5B2IC 5B0YC 3X1VA 1M1AB 5E5AB 3AZLB 3REJB 4H9OB 3REKD 2HIOA 5AV9C 3W97D 1KX4D 2HUEB 2F8NB 3WA9C 3AZFC 4YM6B 2JE5A 1U35A 1KX5B 5CP6C 4H9NB 3LELC 2FFFB 3LZ0A 4XUJA 3AZED 2NZDA 3REKB 1TAFB 3W97B 1KX4B 5E5AA 4CSRA 2UWXA 3REJA 1KX3A 3VH5T 4E44A 1T3UA 3LJAD 1P3FC 5CPID 3AZEB 2F8NA 4YM6A 3WTPA 1P3BC 4H9NA 4WNNA 3W96D 3A1KA 5DNMC 2YFVB 3REKA 3LJAB 1TAFA 2ZY3A 3W97A 1KX4A 5CPIB 1ULYA 2F8NH 3B6FA 3EPKA 1P3AA 3W96B 1F66C 3REHD 3AZEA 3B0BA 2Y2HA 5B40C 1P3IA 1P34A 5C3IB 2YFVA 5BNXA 3LJAA 2PYOC 3C1BA 3REID 5CPIA 2Y2KA 4J8XC 3REHB 3UT9D 3O62D 1P3OC 1P3LA 4WU8D 3W96A 3C1CD 4G92C 3MGPC 3AZNC 4DRBA 3REIB 4HGAB 3UT9B 3O62B 1P3MD 4WU8B 5B32G 5B24D 3W98D 3R45B 4XZQC 3C1CB 5B0YD 1Z2CB 5B2JC 2G5HC 3NQJA 5BT1D 5GT0C 5BNVB 3AN2D 3EPJA 1P3MB 5AV9D 2LY8A 2DF4C 3AZFD 5B24B 3W98B 5CP6D 3B0DC 5AV6A 4QLCD 5B0YB 4Z66C 3O62A 3LELD 3VH6T 3AZGA 3KSYA 5AV8C 3X1UC 3MGRA 3AN2B 3C1CA 3NQUB 3B0CW 4R8PD 3AZFB 4WJ3C 4JJNA 5BNVA 5CP6B 1P3FD 4QLCB 3LELB 1P3MA 4KGCC 4J8WC 1P3BD 5B24A 3W98A 5B31G 5B0YA 3FDDA 3AZKD 2CV5C 5DNMD 4R8PB 1P3FB 1BH9B 2BG1A 5AV9A 3NQUA 3WA9A 2IO5B 3AZFA 1P3BB 5CP6A 3LELA 3AZKB 3WAAD 4CAYA 1ID3D 5B40D 3AV2D 4ZUXC 4X23C 1P3FA 1BH9A 2BYMB 2PYOD 4J8XD 3WAAB 1JFIB 1P3BA 4YS3C 2AROC 1ID3B 5B40B 3AV2B 2JSSA 5JA4B 5DNMA 5B33C 3AZIC 3MGPD 2ZM5A 3AZHC 3KWQC 2PYOB 2Y2QA 4J8XB 4J8VC 4XUJD 5GT3C 5AVBC 2BYMA 2Y2MA 5B32C 1F66A 3MGPB 2VQRA 1JFIA 3KFUG 3AV1C 1KX3D 5B2JD 5B40A 4UUZA 1B67A 5JA4A 5GT0D 4XUJB 3WTPD 4KUDC 2PYOA 5BS7C 4J8XA 4Z66D 4CSRB 1KX3B 1P3OA 5B2JB 3X1UD 3LZ1C 5GT0B 3H0RC 5CPJC 3MGPA 3AZNA 3B6FD 3WTPB 3AZMC 4WNNB 1P3AD 1KU5A 3B0DB 4Z66B 3MVDC 4J8WD 4NE5A 5AY8C 1P3KC 4UPKA 3A1IA 4XZQA 5B31C 1P3ID 3B6FB 1P34D 3RELC 2CV5D 5B2JA 5B1LC 5GT0A 1P3AB 3C1BD 3UTAC 3KUYC 3AL0C 4J8WB 2BYKB 5JRGC 1P3LD 4Z66A 1P3IB 1P34B 5FUGB 2CV5B 5BNXB 5AV8A 3X1UA 3X1TC 3C1BB 4WU9C 4H9PB 1P3LB 4ZBJB 1TZYC 5G49A 4KGCA 2J8PA 4J8WA 2BYKA 2RVQD 5B1MC 5AVCC 3B0CT 5FUGA 1F1EA 2CV5A 3AYWC 3AZHD 5AV6D 4J8UC 4H9PA 3AZJC 5DNNC 1M18C 3AZGD 3NQJB 5GT3D 5AVBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGR D;  5B32 D;  4H9R B;  3AZH B;  5CPK C;  4JJN D;  5KDM A;  5AV6 B;  2L5A A;  3AZG B;  5GT3 B;  4ZUX A;  5AVB B;  4X23 A;  3MGR B;  3X1S C;  5B32 B;  5B2I D;  4YS3 A;  2ARO A;  4JJN B;  5CHL B;  3MGS C;  5B33 A;  3AZI A;  1S32 C;  3WA9 D;  4H9R A;  3AZH A;  3MNN C;  1R4V A;  3KWQ A;  4EO5 B;  5B2I B;  2HIO C;  4J8V A;  5GT3 A;  5GSU C;  5AVB A;  1AOI C;  5B32 A;  5AV9 B;  1P3K D;  5B31 D;  3REL D;  3WA9 B;  3AV1 A;  2NZD C;  3UTA D;  1M1A C;  3KUY D;  3AZL C;  4CAY B;  1WWS A;  4KUD A;  3REJ C;  4DRA A;  5B2I A;  5BS7 A;  1P3K B;  2F8N K;  4H9S C;  5B31 B;  3REL B;  3MGQ C;  3LZ1 A;  1KX5 C;  5CPJ A;  3UTA B;  3KUY B;  1P3G C;  4NFT A;  3AZM A;  3REK C;  1H3O B;  1TZY D;  1F66 D;  5DNM B;  3MVD A;  4NE3 A;  3B6G C;  1EQZ C;  5B1M D;  5F99 C;  5AY8 A;  1P3K A;  5AVC D;  5B31 A;  3REL A;  1WWI A;  5B1L A;  3AYW D;  1TZY B;  3UTA A;  3KUY A;  1F66 B;  5DNN D;  5B1M B;  1M19 C;  1M18 D;  1P3O D;  5JRG A;  5AVC B;  1H3O A;  4UUZ B;  3LJA C;  4Z2M G;  3AZN D;  3X1T A;  1HQ3 C;  3AYW B;  5AV5 C;  4LD9 C;  5CPK D;  4WU9 A;  5DNN B;  1M18 B;  1A7W A;  4AWL C;  1P3O B;  1TZY A;  4XZQ D;  4G92 B;  3AZN B;  5B1M A;  5AVC A;  3KXB C;  5CPK B;  3REH C;  3A6N C;  5B0Z C;  3AYW A;  4XZQ B;  4J8U A;  3AZJ A;  5DNN A;  1M18 A;  1BH8 B;  3AFA C;  5AV8 D;  5GSU D;  3REI C;  1AOI D;  3UT9 C;  4WU8 C;  5CPK A;  4KGC D;  4WV4 B;  5AV8 B;  5GSU B;  3X1U B;  3AZL D;  3X1S A;  1AOI B;  5GXQ C;  1P3M C;  1BH8 A;  3MGQ D;  2NQB C;  1HTA A;  4KGC B;  5G49 B;  3MGS A;  2FJ7 C;  2CWE A;  1S32 A;  1P3G D;  5BT1 C;  3MNN A;  3AN2 C;  2F8N G;  5GSU A;  3MGQ B;  3B6G D;  1EQZ D;  5F99 D;  1AOI A;  3V9R B;  1ZLA C;  4QLC C;  1P3G B;  3W99 C;  4ZUX D;  4X23 D;  3TU4 C;  1M1A A;  3AZL A;  3WTP E;  3B6G B;  4R8P C;  5F99 B;  1M19 D;  4YS3 D;  1EQZ B;  2ARO D;  4H9O A;  4KHA B;  5KDM B;  4G91 C;  4H9S A;  5B33 D;  3AZI D;  3MGQ A;  2IO5 C;  4ZUX B;  1KX5 A;  4X23 B;  3V9R A;  1HQ3 D;  3KWQ D;  5AV5 D;  4LD9 D;  3AZK C;  1P3G A;  4J8V D;  1M19 B;  4YS3 B;  2ARO B;  5B33 B;  3AZI B;  3B6G A;  1EQZ A;  5F99 A;  3AV1 D;  3UTB C;  1HQ3 B;  4KHA A;  3KWQ B;  5AV5 B;  4Z5T C;  3KXB D;  4LD9 B;  4J8V B;  3WAA C;  3WKJ C;  3A6N D;  5B0Z D;  4AWL B;  4KUD D;  1ID3 C;  3AV2 C;  4M6B A;  1M19 A;  3AV1 B;  3AFA D;  3LZ1 D;  3KXB B;  1P3P C;  2YFW B;  3X1V C;  5CPJ D;  3A6N B;  5B0Z B;  1HQ3 A;  4KUD B;  3AZM D;  5AV5 A;  4LD9 A;  3MVD D;  3AFA B;  3LZ1 B;  1U35 C;  5AY8 D;  5GXQ D;  5CPJ B;  3LZ0 C;  4XUJ C;  3VH5 W;  5B1L D;  3AZM B;  2NQB D;  3KXB A;  2YFW A;  5E5A C;  3REH A;  3MVD B;  3A6N A;  4H9Q B;  2FJ7 D;  4E45 A;  5B0Z A;  1KX3 C;  5AY8 B;  5JRG D;  1N1J B;  5GXQ B;  2HUE C;  3VH5 A;  4NE6 A;  3AFA A;  4YM6 C;  5B1L B;  3X1T D;  3WTP C;  2NQB B;  3REI A;  1ZLA D;  3UT9 A;  4WU9 D;  2FJ7 B;  3W99 D;  4WU8 A;  5JRG B;  3W97 C;  3R45 A;  1KX4 C;  3TU4 D;  3B6F C;  4H9Q A;  3X1T B;  1N1J A;  5GXQ A;  1P3A C;  1ZLA B;  4WU9 B;  3AZE C;  3W99 B;  2NQB A;  1P3I C;  3TU4 B;  4J8U D;  3AZJ D;  1P34 C;  2FJ7 A;  1BFM A;  5BO0 B;  3C1B C;  3AN2 A;  5CPI C;  4G91 B;  3UTB D;  1P3L C;  1ZLA A;  3W96 C;  4ZBJ C;  4QLC A;  4Z5T D;  4J8U B;  3AZJ B;  3W99 A;  3WKJ D;  3X1S D;  3TU4 A;  5C3I C;  1Q9C A;  5BO0 A;  4R8P A;  3UTB B;  4Z5T B;  3MGS D;  1P3P D;  3X1V D;  3WKJ B;  2RVQ C;  1S32 D;  3X1S B;  3MNN D;  3VH6 W;  2HIO D;  3AZK A;  1U35 D;  4HGA C;  1P3P B;  3MGS B;  5AV6 C;  3O62 C;  3X1V B;  4Z2M H;  1S32 B;  3LZ0 D;  3AZG C;  3UTB A;  3MNN B;  2NZD D;  3MGR C;  3VH6 A;  4Z5T A;  3C1C C;  2HIO B;  3WAA A;  1M1A D;  5E5A D;  3WKJ A;  3REJ D;  1U35 B;  4JJN C;  1ID3 A;  3AV2 A;  3LZ0 B;  1B6W A;  2F8N D;  2NZD B;  4YM6 D;  1KX5 D;  5B24 C;  3W98 C;  1P3P A;  4WZS B;  4EO5 C;  5B2I C;  5B0Y C;  3X1V A;  1M1A B;  5E5A B;  3AZL B;  3REJ B;  4H9O B;  3REK D;  2HIO A;  5AV9 C;  3W97 D;  1KX4 D;  2HUE B;  2F8N B;  3WA9 C;  3AZF C;  4YM6 B;  1U35 A;  1KX5 B;  5CP6 C;  4H9N B;  3LEL C;  3LZ0 A;  4XUJ A;  3AZE D;  2NZD A;  3REK B;  1TAF B;  3W97 B;  1KX4 B;  5E5A A;  4CSR A;  3REJ A;  1KX3 A;  3VH5 T;  4E44 A;  1P3F C;  3LJA D;  5CPI D;  3AZE B;  2F8N A;  4YM6 A;  3WTP A;  1P3B C;  4H9N A;  4WNN A;  3W96 D;  5DNM C;  2YFV B;  3REK A;  3LJA B;  1TAF A;  3W97 A;  1KX4 A;  5CPI B;  1ULY A;  2F8N H;  3B6F A;  1P3A A;  3W96 B;  1F66 C;  3REH D;  3AZE A;  3B0B A;  5B40 C;  1P3I A;  1P34 A;  5C3I B;  2YFV A;  5BNX A;  3LJA A;  2PYO C;  3C1B A;  3REI D;  5CPI A;  4J8X C;  3REH B;  3UT9 D;  3O62 D;  1P3O C;  1P3L A;  4WU8 D;  3W96 A;  3C1C D;  4G92 C;  3MGP C;  3AZN C;  4DRB A;  3REI B;  4HGA B;  3UT9 B;  3O62 B;  1P3M D;  4WU8 B;  5B32 G;  5B24 D;  3W98 D;  3R45 B;  4XZQ C;  3C1C B;  5B0Y D;  3NQJ A;  5BT1 D;  5B2J C;  5GT0 C;  5BNV B;  3AN2 D;  1P3M B;  5AV9 D;  2LY8 A;  3AZF D;  5B24 B;  3W98 B;  5CP6 D;  3B0D C;  5AV6 A;  4QLC D;  5B0Y B;  4Z66 C;  3O62 A;  3LEL D;  3VH6 T;  3AZG A;  3KSY A;  5AV8 C;  3X1U C;  3MGR A;  3AN2 B;  3C1C A;  3NQU B;  3B0C W;  4R8P D;  3AZF B;  4JJN A;  5BNV A;  5CP6 B;  1P3F D;  4QLC B;  3LEL B;  1P3M A;  4KGC C;  4J8W C;  1P3B D;  5B24 A;  3W98 A;  5B31 G;  5B0Y A;  3AZK D;  2CV5 C;  5DNM D;  4R8P B;  1P3F B;  1BH9 B;  5AV9 A;  3NQU A;  3WA9 A;  2IO5 B;  3AZF A;  1P3B B;  5CP6 A;  3LEL A;  3AZK B;  3WAA D;  4CAY A;  1ID3 D;  5B40 D;  3AV2 D;  4ZUX C;  4X23 C;  1P3F A;  1BH9 A;  2BYM B;  2PYO D;  4J8X D;  3WAA B;  1JFI B;  1P3B A;  4YS3 C;  2ARO C;  1ID3 B;  5B40 B;  3AV2 B;  2JSS A;  5JA4 B;  5DNM A;  5B33 C;  3AZI C;  3MGP D;  3AZH C;  3KWQ C;  2PYO B;  4J8X B;  4J8V C;  4XUJ D;  5GT3 C;  5AVB C;  2BYM A;  5B32 C;  1F66 A;  3MGP B;  1JFI A;  3AV1 C;  1KX3 D;  5B2J D;  5B40 A;  4UUZ A;  1B67 A;  5JA4 A;  5GT0 D;  4XUJ B;  3WTP D;  4KUD C;  2PYO A;  5BS7 C;  4J8X A;  4Z66 D;  4CSR B;  1KX3 B;  1P3O A;  5B2J B;  3X1U D;  3LZ1 C;  5GT0 B;  5CPJ C;  3MGP A;  3AZN A;  3B6F D;  3WTP B;  3AZM C;  4WNN B;  1P3A D;  1KU5 A;  3B0D B;  4Z66 B;  3MVD C;  4J8W D;  4NE5 A;  5AY8 C;  1P3K C;  4XZQ A;  5B31 C;  1P3I D;  3B6F B;  1P34 D;  3REL C;  2CV5 D;  5B2J A;  5B1L C;  5GT0 A;  1P3A B;  3C1B D;  3UTA C;  3KUY C;  4J8W B;  2BYK B;  5JRG C;  1P3L D;  4Z66 A;  1P3I B;  1P34 B;  5FUG B;  2CV5 B;  5BNX B;  5AV8 A;  3X1U A;  3X1T C;  3C1B B;  4WU9 C;  4H9P B;  1P3L B;  4ZBJ B;  1TZY C;  5G49 A;  4KGC A;  4J8W A;  2BYK A;  2RVQ D;  5B1M C;  5AVC C;  3B0C T;  5FUG A;  1F1E A;  2CV5 A;  3AYW C;  3AZH D;  5AV6 D;  4J8U C;  4H9P A;  3AZJ C;  5DNN C;  1M18 C;  3AZG D;  3NQJ B;  5GT3 D;  5AVB D; 
#chains in the Genus database with same CATH topology
 3MGR D;  5B32 D;  2ZY2 A;  4H9R B;  3AZH B;  5CPK C;  4JJN D;  5KDM A;  5AV6 B;  4DQY B;  2Y2L A;  2L5A A;  3AZG B;  5GT3 B;  4ZUX A;  5AVB B;  1PZR A;  4X23 A;  3MGR B;  3X1S C;  5B32 B;  5B2I D;  4YS3 A;  2ARO A;  4JJN B;  5CHL B;  3MGS C;  5B33 A;  3AZI A;  1S32 C;  3WA9 D;  4H9R A;  3AZH A;  3MNN C;  1R4V A;  3KWQ A;  4EO5 B;  5B2I B;  2HIO C;  4J8V A;  5GT3 A;  5GSU C;  5AVB A;  3H0M C;  1AOI C;  5B32 A;  5AV9 B;  3P5J B;  1P3K D;  5B31 D;  3REL D;  3WA9 B;  3AV1 A;  2NZD C;  3UTA D;  1M1A C;  3KUY D;  3AZL C;  4CAY B;  1WWS A;  2Y2P A;  4KUD A;  3REJ C;  4DRA A;  5B2I A;  5BS7 A;  1P3K B;  2F8N K;  4H9S C;  5B31 B;  3REL B;  2Y2N A;  3MGQ C;  3LZ1 A;  1KX5 C;  5CPJ A;  3UTA B;  3KUY B;  1P3G C;  4NFT A;  3AZM A;  3REK C;  1H3O B;  3IP4 C;  1TZY D;  1F66 D;  5DNM B;  3MVD A;  4NE3 A;  3B6G C;  1EQZ C;  5B1M D;  5F99 C;  5AY8 A;  1P3K A;  5AVC D;  5B31 A;  3REL A;  1WWI A;  5B1L A;  2Y2J A;  3AYW D;  1TZY B;  2RIQ A;  3UTA A;  3KUY A;  1F66 B;  5DNN D;  5B1M B;  1M19 C;  1M18 D;  2Y2G A;  1P3O D;  5JRG A;  5AVC B;  1H3O A;  4UUZ B;  3LJA C;  4Z2M G;  3AZN D;  3EPH A;  3X1T A;  1HQ3 C;  3AYW B;  5AV5 C;  4LD9 C;  5CPK D;  4WU9 A;  5DNN B;  1M18 B;  1A7W A;  4AWL C;  1P3O B;  1TZY A;  4XZQ D;  4G92 B;  3AZN B;  5B1M A;  5AVC A;  3KXB C;  5CPK B;  3REH C;  3A6N C;  5B0Z C;  3AYW A;  4XZQ B;  4J8U A;  3AZJ A;  5DNN A;  1M18 A;  1BH8 B;  3AFA C;  5AV8 D;  5GSU D;  3REI C;  2JCH A;  1AOI D;  3UT9 C;  2F2A C;  4WU8 C;  5CPK A;  4KGC D;  4WV4 B;  5AV8 B;  5GSU B;  3X1U B;  3AZL D;  3X1S A;  1AOI B;  5GXQ C;  1P3M C;  1BH8 A;  3MGQ D;  2NQB C;  1HTA A;  4KGC B;  5G49 B;  3MGS A;  2FJ7 C;  2CWE A;  1S32 A;  1P3G D;  5BT1 C;  3MNN A;  3AN2 C;  2F8N G;  5GSU A;  3MGQ B;  3B6G D;  1EQZ D;  5F99 D;  1AOI A;  3V9R B;  1ZLA C;  4QLC C;  1P3G B;  3W99 C;  4ZUX D;  2G5I C;  2ZY5 A;  4X23 D;  3TU4 C;  1M1A A;  3AZL A;  3WTP E;  3B6G B;  4R8P C;  5F99 B;  1M19 D;  4YS3 D;  1EQZ B;  2ARO D;  4H9O A;  4KHA B;  2DQN C;  5KDM B;  4G91 C;  4H9S A;  5B33 D;  3AZI D;  3MGQ A;  2IO5 C;  4ZUX B;  1KX5 A;  4X23 B;  3V9R A;  1HQ3 D;  3KWQ D;  5AV5 D;  4LD9 D;  3AZK C;  1P3G A;  4J8V D;  1M19 B;  4YS3 B;  2ARO B;  2Y2O A;  5B33 B;  3AZI B;  3B6G A;  1EQZ A;  5F99 A;  3AV1 D;  3UTB C;  1HQ3 B;  4KHA A;  3KWQ B;  5AV5 B;  4Z5T C;  3KXB D;  4LD9 B;  4J8V B;  3WAA C;  3WKJ C;  3A6N D;  5B0Z D;  4AWL B;  4KUD D;  1ID3 C;  3AV2 C;  4M6B A;  1M19 A;  3H0L C;  3AV1 B;  3AFA D;  3LZ1 D;  3KXB B;  1P3P C;  2YFW B;  3X1V C;  5CPJ D;  3EPL A;  3A6N B;  5B0Z B;  1HQ3 A;  4KUD B;  2ZY4 A;  5AV5 A;  3AZM D;  4LD9 A;  3MVD D;  3AFA B;  3LZ1 B;  1U35 C;  5AY8 D;  5GXQ D;  5CPJ B;  3LZ0 C;  4XUJ C;  3VH5 W;  5B1L D;  3AZM B;  2NQB D;  3KXB A;  2YFW A;  5E5A C;  3REH A;  3MVD B;  3A6N A;  4H9Q B;  2FJ7 D;  4E45 A;  5B0Z A;  1KX3 C;  5AY8 B;  5JRG D;  1N1J B;  5GXQ B;  2Y2I A;  2HUE C;  3VH5 A;  4NE6 A;  3AFA A;  4YM6 C;  5B1L B;  3X1T D;  3WTP C;  2NQB B;  3REI A;  1ZLA D;  3UT9 A;  4WU9 D;  2FJ7 B;  3W99 D;  3F6T A;  4WU8 A;  5JRG B;  3W97 C;  3R45 A;  2XD1 A;  1KX4 C;  3TU4 D;  3B6F C;  4H9Q A;  3X1T B;  1N1J A;  5GXQ A;  1P3A C;  1ZLA B;  4WU9 B;  3AZE C;  2XD5 A;  3W99 B;  2NQB A;  1P3I C;  3TU4 B;  4J8U D;  3AZJ D;  1P34 C;  2FJ7 A;  1BFM A;  5BO0 B;  1W2E A;  3C1B C;  3AN2 A;  2W8S A;  4G91 B;  5CPI C;  3UTB D;  1P3L C;  1ZLA A;  3W96 C;  4ZBJ C;  4QLC A;  4Z5T D;  4J8U B;  3AZJ B;  3W99 A;  3WKJ D;  3X1S D;  3TU4 A;  5C3I C;  1Q9C A;  5BO0 A;  4R8P A;  3UTB B;  4Z5T B;  3MGS D;  1P3P D;  3X1V D;  3WKJ B;  2RVQ C;  1S32 D;  3X1S B;  3MNN D;  3VH6 W;  2HIO D;  3AZK A;  1U35 D;  4HGA C;  1P3P B;  3MGS B;  5AV6 C;  3O62 C;  3X1V B;  4Z2M H;  1S32 B;  3LZ0 D;  3AZG C;  3UTB A;  3MNN B;  2NZD D;  3MGR C;  3VH6 A;  4Z5T A;  3C1C C;  2HIO B;  3WAA A;  1M1A D;  5E5A D;  3WKJ A;  3REJ D;  1U35 B;  4JJN C;  1ID3 A;  3AV2 A;  3LZ0 B;  1B6W A;  2F8N D;  3EG5 B;  2NZD B;  4YM6 D;  1KX5 D;  5B24 C;  3W98 C;  1P3P A;  4WZS B;  4EO5 C;  5B2I C;  5B0Y C;  3X1V A;  1M1A B;  5E5A B;  3AZL B;  3REJ B;  4H9O B;  3REK D;  2HIO A;  5AV9 C;  3W97 D;  1KX4 D;  2HUE B;  2F8N B;  3WA9 C;  3AZF C;  4YM6 B;  2JE5 A;  1U35 A;  1KX5 B;  5CP6 C;  4H9N B;  3LEL C;  2FFF B;  3LZ0 A;  4XUJ A;  3AZE D;  2NZD A;  3REK B;  1TAF B;  3W97 B;  1KX4 B;  5E5A A;  4CSR A;  2UWX A;  3REJ A;  1KX3 A;  3VH5 T;  4E44 A;  1T3U A;  3LJA D;  1P3F C;  5CPI D;  3AZE B;  2F8N A;  4YM6 A;  3WTP A;  1P3B C;  4H9N A;  4WNN A;  3W96 D;  3A1K A;  5DNM C;  2YFV B;  3REK A;  3LJA B;  1TAF A;  2ZY3 A;  3W97 A;  1KX4 A;  5CPI B;  1ULY A;  2F8N H;  3B6F A;  3EPK A;  1P3A A;  3W96 B;  1F66 C;  3REH D;  3AZE A;  3B0B A;  2Y2H A;  5B40 C;  1P3I A;  1P34 A;  5C3I B;  2YFV A;  5BNX A;  3LJA A;  2PYO C;  3C1B A;  3REI D;  5CPI A;  2Y2K A;  4J8X C;  3REH B;  3UT9 D;  3O62 D;  1P3O C;  1P3L A;  4WU8 D;  3W96 A;  3C1C D;  4G92 C;  3MGP C;  3AZN C;  4DRB A;  3REI B;  4HGA B;  3UT9 B;  3O62 B;  1P3M D;  4WU8 B;  5B32 G;  5B24 D;  3W98 D;  3R45 B;  4XZQ C;  3C1C B;  5B0Y D;  1Z2C B;  5B2J C;  2G5H C;  3NQJ A;  5BT1 D;  5GT0 C;  5BNV B;  3AN2 D;  3EPJ A;  1P3M B;  5AV9 D;  2LY8 A;  2DF4 C;  3AZF D;  5B24 B;  3W98 B;  5CP6 D;  3B0D C;  5AV6 A;  4QLC D;  5B0Y B;  4Z66 C;  3O62 A;  3LEL D;  3VH6 T;  3AZG A;  3KSY A;  5AV8 C;  3X1U C;  3MGR A;  3AN2 B;  3C1C A;  3NQU B;  3B0C W;  4R8P D;  3AZF B;  4WJ3 C;  4JJN A;  5BNV A;  5CP6 B;  1P3F D;  4QLC B;  3LEL B;  1P3M A;  4KGC C;  4J8W C;  1P3B D;  5B24 A;  3W98 A;  5B31 G;  5B0Y A;  3FDD A;  3AZK D;  2CV5 C;  5DNM D;  4R8P B;  1P3F B;  1BH9 B;  2BG1 A;  5AV9 A;  3NQU A;  3WA9 A;  2IO5 B;  3AZF A;  1P3B B;  5CP6 A;  3LEL A;  3AZK B;  3WAA D;  4CAY A;  1ID3 D;  5B40 D;  3AV2 D;  4ZUX C;  4X23 C;  1P3F A;  1BH9 A;  2BYM B;  2PYO D;  4J8X D;  3WAA B;  1JFI B;  1P3B A;  4YS3 C;  2ARO C;  1ID3 B;  5B40 B;  3AV2 B;  2JSS A;  5JA4 B;  5DNM A;  5B33 C;  3AZI C;  3MGP D;  2ZM5 A;  3AZH C;  3KWQ C;  2PYO B;  2Y2Q A;  4J8X B;  4J8V C;  4XUJ D;  5GT3 C;  5AVB C;  2BYM A;  2Y2M A;  5B32 C;  1F66 A;  3MGP B;  2VQR A;  1JFI A;  3KFU G;  3AV1 C;  1KX3 D;  5B2J D;  5B40 A;  4UUZ A;  1B67 A;  5JA4 A;  5GT0 D;  4XUJ B;  3WTP D;  4KUD C;  2PYO A;  5BS7 C;  4J8X A;  4Z66 D;  4CSR B;  1KX3 B;  1P3O A;  5B2J B;  3X1U D;  3LZ1 C;  5GT0 B;  3H0R C;  5CPJ C;  3MGP A;  3AZN A;  3B6F D;  3WTP B;  3AZM C;  4WNN B;  1P3A D;  1KU5 A;  3B0D B;  4Z66 B;  3MVD C;  4J8W D;  4NE5 A;  5AY8 C;  1P3K C;  4UPK A;  3A1I A;  4XZQ A;  5B31 C;  1P3I D;  3B6F B;  1P34 D;  3REL C;  2CV5 D;  5B2J A;  5B1L C;  5GT0 A;  1P3A B;  3C1B D;  3UTA C;  3KUY C;  3AL0 C;  4J8W B;  2BYK B;  5JRG C;  1P3L D;  4Z66 A;  1P3I B;  1P34 B;  5FUG B;  2CV5 B;  5BNX B;  5AV8 A;  3X1U A;  3X1T C;  3C1B B;  4WU9 C;  4H9P B;  1P3L B;  4ZBJ B;  1TZY C;  5G49 A;  4KGC A;  2J8P A;  4J8W A;  2BYK A;  2RVQ D;  5B1M C;  5AVC C;  3B0C T;  5FUG A;  1F1E A;  2CV5 A;  3AYW C;  3AZH D;  5AV6 D;  4J8U C;  4H9P A;  3AZJ C;  5DNN C;  1M18 C;  3AZG D;  3NQJ B;  5GT3 D;  5AVB D; 
#chains in the Genus database with same CATH homology
 3MGR D;  5B32 D;  2ZY2 A;  4H9R B;  3AZH B;  5CPK C;  4JJN D;  5KDM A;  5AV6 B;  4DQY B;  2Y2L A;  2L5A A;  3AZG B;  5GT3 B;  4ZUX A;  5AVB B;  1PZR A;  4X23 A;  3MGR B;  3X1S C;  5B32 B;  5B2I D;  4YS3 A;  2ARO A;  4JJN B;  5CHL B;  3MGS C;  5B33 A;  3AZI A;  1S32 C;  3WA9 D;  4H9R A;  3AZH A;  3MNN C;  1R4V A;  3KWQ A;  4EO5 B;  5B2I B;  2HIO C;  4J8V A;  5GT3 A;  5GSU C;  5AVB A;  3H0M C;  1AOI C;  5B32 A;  5AV9 B;  3P5J B;  1P3K D;  5B31 D;  3REL D;  3WA9 B;  3AV1 A;  2NZD C;  3UTA D;  1M1A C;  3KUY D;  3AZL C;  4CAY B;  1WWS A;  2Y2P A;  4KUD A;  3REJ C;  4DRA A;  5B2I A;  5BS7 A;  1P3K B;  2F8N K;  4H9S C;  5B31 B;  3REL B;  2Y2N A;  3MGQ C;  3LZ1 A;  1KX5 C;  5CPJ A;  3UTA B;  3KUY B;  1P3G C;  4NFT A;  3AZM A;  3REK C;  1H3O B;  3IP4 C;  1TZY D;  1F66 D;  5DNM B;  3MVD A;  4NE3 A;  3B6G C;  1EQZ C;  5B1M D;  5F99 C;  5AY8 A;  1P3K A;  5AVC D;  5B31 A;  3REL A;  1WWI A;  5B1L A;  2Y2J A;  3AYW D;  1TZY B;  2RIQ A;  3UTA A;  3KUY A;  1F66 B;  5DNN D;  5B1M B;  1M19 C;  1M18 D;  2Y2G A;  1P3O D;  5JRG A;  5AVC B;  1H3O A;  4UUZ B;  3LJA C;  4Z2M G;  3AZN D;  3EPH A;  3X1T A;  1HQ3 C;  3AYW B;  5AV5 C;  4LD9 C;  5CPK D;  4WU9 A;  5DNN B;  1M18 B;  1A7W A;  4AWL C;  1P3O B;  1TZY A;  4XZQ D;  4G92 B;  3AZN B;  5B1M A;  5AVC A;  3KXB C;  5CPK B;  3REH C;  3A6N C;  5B0Z C;  3AYW A;  4XZQ B;  4J8U A;  3AZJ A;  5DNN A;  1M18 A;  1BH8 B;  3AFA C;  5AV8 D;  5GSU D;  3REI C;  2JCH A;  1AOI D;  3UT9 C;  2F2A C;  4WU8 C;  5CPK A;  4KGC D;  4WV4 B;  5AV8 B;  5GSU B;  3X1U B;  3AZL D;  3X1S A;  1AOI B;  5GXQ C;  1P3M C;  1BH8 A;  3MGQ D;  2NQB C;  1HTA A;  4KGC B;  5G49 B;  3MGS A;  2FJ7 C;  2CWE A;  1S32 A;  1P3G D;  5BT1 C;  3MNN A;  3AN2 C;  2F8N G;  5GSU A;  3MGQ B;  3B6G D;  1EQZ D;  5F99 D;  1AOI A;  3V9R B;  1ZLA C;  4QLC C;  1P3G B;  3W99 C;  4ZUX D;  2G5I C;  2ZY5 A;  4X23 D;  3TU4 C;  1M1A A;  3AZL A;  3WTP E;  3B6G B;  4R8P C;  5F99 B;  1M19 D;  4YS3 D;  1EQZ B;  2ARO D;  4H9O A;  4KHA B;  2DQN C;  5KDM B;  4G91 C;  4H9S A;  5B33 D;  3AZI D;  3MGQ A;  2IO5 C;  4ZUX B;  1KX5 A;  4X23 B;  3V9R A;  1HQ3 D;  3KWQ D;  5AV5 D;  4LD9 D;  3AZK C;  1P3G A;  4J8V D;  1M19 B;  4YS3 B;  2ARO B;  2Y2O A;  5B33 B;  3AZI B;  3B6G A;  1EQZ A;  5F99 A;  3AV1 D;  3UTB C;  1HQ3 B;  4KHA A;  3KWQ B;  5AV5 B;  4Z5T C;  3KXB D;  4LD9 B;  4J8V B;  3WAA C;  3WKJ C;  3A6N D;  5B0Z D;  4AWL B;  4KUD D;  1ID3 C;  3AV2 C;  4M6B A;  1M19 A;  3H0L C;  3AV1 B;  3AFA D;  3LZ1 D;  3KXB B;  1P3P C;  2YFW B;  3X1V C;  5CPJ D;  3EPL A;  3A6N B;  5B0Z B;  1HQ3 A;  4KUD B;  2ZY4 A;  5AV5 A;  3AZM D;  4LD9 A;  3MVD D;  3AFA B;  3LZ1 B;  1U35 C;  5AY8 D;  5GXQ D;  5CPJ B;  3LZ0 C;  4XUJ C;  3VH5 W;  5B1L D;  3AZM B;  2NQB D;  3KXB A;  2YFW A;  5E5A C;  3REH A;  3MVD B;  3A6N A;  4H9Q B;  2FJ7 D;  4E45 A;  5B0Z A;  1KX3 C;  5AY8 B;  5JRG D;  1N1J B;  5GXQ B;  2Y2I A;  2HUE C;  3VH5 A;  4NE6 A;  3AFA A;  4YM6 C;  5B1L B;  3X1T D;  3WTP C;  2NQB B;  3REI A;  1ZLA D;  3UT9 A;  4WU9 D;  2FJ7 B;  3W99 D;  3F6T A;  4WU8 A;  5JRG B;  3W97 C;  3R45 A;  2XD1 A;  1KX4 C;  3TU4 D;  3B6F C;  4H9Q A;  3X1T B;  1N1J A;  5GXQ A;  1P3A C;  1ZLA B;  4WU9 B;  3AZE C;  2XD5 A;  3W99 B;  2NQB A;  1P3I C;  3TU4 B;  4J8U D;  3AZJ D;  1P34 C;  2FJ7 A;  1BFM A;  5BO0 B;  1W2E A;  3C1B C;  3AN2 A;  2W8S A;  4G91 B;  5CPI C;  3UTB D;  1P3L C;  1ZLA A;  3W96 C;  4ZBJ C;  4QLC A;  4Z5T D;  4J8U B;  3AZJ B;  3W99 A;  3WKJ D;  3X1S D;  3TU4 A;  5C3I C;  1Q9C A;  5BO0 A;  4R8P A;  3UTB B;  4Z5T B;  3MGS D;  1P3P D;  3X1V D;  3WKJ B;  2RVQ C;  1S32 D;  3X1S B;  3MNN D;  3VH6 W;  2HIO D;  3AZK A;  1U35 D;  4HGA C;  1P3P B;  3MGS B;  5AV6 C;  3O62 C;  3X1V B;  4Z2M H;  1S32 B;  3LZ0 D;  3AZG C;  3UTB A;  3MNN B;  2NZD D;  3MGR C;  3VH6 A;  4Z5T A;  3C1C C;  2HIO B;  3WAA A;  1M1A D;  5E5A D;  3WKJ A;  3REJ D;  1U35 B;  4JJN C;  1ID3 A;  3AV2 A;  3LZ0 B;  1B6W A;  2F8N D;  3EG5 B;  2NZD B;  4YM6 D;  1KX5 D;  5B24 C;  3W98 C;  1P3P A;  4WZS B;  4EO5 C;  5B2I C;  5B0Y C;  3X1V A;  1M1A B;  5E5A B;  3AZL B;  3REJ B;  4H9O B;  3REK D;  2HIO A;  5AV9 C;  3W97 D;  1KX4 D;  2HUE B;  2F8N B;  3WA9 C;  3AZF C;  4YM6 B;  2JE5 A;  1U35 A;  1KX5 B;  5CP6 C;  4H9N B;  3LEL C;  2FFF B;  3LZ0 A;  4XUJ A;  3AZE D;  2NZD A;  3REK B;  1TAF B;  3W97 B;  1KX4 B;  5E5A A;  4CSR A;  2UWX A;  3REJ A;  1KX3 A;  3VH5 T;  4E44 A;  1T3U A;  3LJA D;  1P3F C;  5CPI D;  3AZE B;  2F8N A;  4YM6 A;  3WTP A;  1P3B C;  4H9N A;  4WNN A;  3W96 D;  3A1K A;  5DNM C;  2YFV B;  3REK A;  3LJA B;  1TAF A;  2ZY3 A;  3W97 A;  1KX4 A;  5CPI B;  1ULY A;  2F8N H;  3B6F A;  3EPK A;  1P3A A;  3W96 B;  1F66 C;  3REH D;  3AZE A;  3B0B A;  2Y2H A;  5B40 C;  1P3I A;  1P34 A;  5C3I B;  2YFV A;  5BNX A;  3LJA A;  2PYO C;  3C1B A;  3REI D;  5CPI A;  2Y2K A;  4J8X C;  3REH B;  3UT9 D;  3O62 D;  1P3O C;  1P3L A;  4WU8 D;  3W96 A;  3C1C D;  4G92 C;  3MGP C;  3AZN C;  4DRB A;  3REI B;  4HGA B;  3UT9 B;  3O62 B;  1P3M D;  4WU8 B;  5B32 G;  5B24 D;  3W98 D;  3R45 B;  4XZQ C;  3C1C B;  5B0Y D;  1Z2C B;  5B2J C;  2G5H C;  3NQJ A;  5BT1 D;  5GT0 C;  5BNV B;  3AN2 D;  3EPJ A;  1P3M B;  5AV9 D;  2LY8 A;  2DF4 C;  3AZF D;  5B24 B;  3W98 B;  5CP6 D;  3B0D C;  5AV6 A;  4QLC D;  5B0Y B;  4Z66 C;  3O62 A;  3LEL D;  3VH6 T;  3AZG A;  3KSY A;  5AV8 C;  3X1U C;  3MGR A;  3AN2 B;  3C1C A;  3NQU B;  3B0C W;  4R8P D;  3AZF B;  4WJ3 C;  4JJN A;  5BNV A;  5CP6 B;  1P3F D;  4QLC B;  3LEL B;  1P3M A;  4KGC C;  4J8W C;  1P3B D;  5B24 A;  3W98 A;  5B31 G;  5B0Y A;  3FDD A;  3AZK D;  2CV5 C;  5DNM D;  4R8P B;  1P3F B;  1BH9 B;  2BG1 A;  5AV9 A;  3NQU A;  3WA9 A;  2IO5 B;  3AZF A;  1P3B B;  5CP6 A;  3LEL A;  3AZK B;  3WAA D;  4CAY A;  1ID3 D;  5B40 D;  3AV2 D;  4ZUX C;  4X23 C;  1P3F A;  1BH9 A;  2BYM B;  2PYO D;  4J8X D;  3WAA B;  1JFI B;  1P3B A;  4YS3 C;  2ARO C;  1ID3 B;  5B40 B;  3AV2 B;  2JSS A;  5JA4 B;  5DNM A;  5B33 C;  3AZI C;  3MGP D;  2ZM5 A;  3AZH C;  3KWQ C;  2PYO B;  2Y2Q A;  4J8X B;  4J8V C;  4XUJ D;  5GT3 C;  5AVB C;  2BYM A;  2Y2M A;  5B32 C;  1F66 A;  3MGP B;  2VQR A;  1JFI A;  3KFU G;  3AV1 C;  1KX3 D;  5B2J D;  5B40 A;  4UUZ A;  1B67 A;  5JA4 A;  5GT0 D;  4XUJ B;  3WTP D;  4KUD C;  2PYO A;  5BS7 C;  4J8X A;  4Z66 D;  4CSR B;  1KX3 B;  1P3O A;  5B2J B;  3X1U D;  3LZ1 C;  5GT0 B;  3H0R C;  5CPJ C;  3MGP A;  3AZN A;  3B6F D;  3WTP B;  3AZM C;  4WNN B;  1P3A D;  1KU5 A;  3B0D B;  4Z66 B;  3MVD C;  4J8W D;  4NE5 A;  5AY8 C;  1P3K C;  4UPK A;  3A1I A;  4XZQ A;  5B31 C;  1P3I D;  3B6F B;  1P34 D;  3REL C;  2CV5 D;  5B2J A;  5B1L C;  5GT0 A;  1P3A B;  3C1B D;  3UTA C;  3KUY C;  3AL0 C;  4J8W B;  2BYK B;  5JRG C;  1P3L D;  4Z66 A;  1P3I B;  1P34 B;  5FUG B;  2CV5 B;  5BNX B;  5AV8 A;  3X1U A;  3X1T C;  3C1B B;  4WU9 C;  4H9P B;  1P3L B;  4ZBJ B;  1TZY C;  5G49 A;  4KGC A;  2J8P A;  4J8W A;  2BYK A;  2RVQ D;  5B1M C;  5AVC C;  3B0C T;  5FUG A;  1F1E A;  2CV5 A;  3AYW C;  3AZH D;  5AV6 D;  4J8U C;  4H9P A;  3AZJ C;  5DNN C;  1M18 C;  3AZG D;  3NQJ B;  5GT3 D;  5AVB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...