3WTPE

Crystal structure of the heterotypic nucleosome containing human cenp-a and h3.3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
100
structure length
100
Chain Sequence
b'KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3-like centromeric protein A
publication title Crystal structure and stable property of the cancer-associated heterotypic nucleosome containing CENP-A and H3.3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 34
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2014-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wtpE00
4WV4B 5CPIB 5B1LC 3W96B 5B40A 1P3MD 1TZYA 3TU4C 3REJC 3O62A 4H9OA 1P3KC 4NE6A 5DNMB 3LZ1B 3AZKB 4YS3D 4DRBA 4J8VC 4YM6A 3WKJB 4QLCB 3AV1A 1P3AC 3X1VC 3MGRD 3AZLD 1EQZB 2LY8A 1N1JA 5GSUC 5AV9A 3B6FB 3A6NA 3REHB 5BNXA 3VH5T 5JRGB 2HIOA 4JJNC 2L5AA 2CV5D 4CSRA 5GXQA 2F8ND 5CPKD 5AVBD 1P3MB 1P3LD 5B1LA 3AZFD 1S32C 4J8WD 5BNVA 3TU4A 3REJA 3KWQD 4YS3B 2IO5C 1P3KA 4ZBJC 3AFAC 2AROC 3MGRB 3AZLB 4J8VA 2YFWA 1P3AA 1HQ3C 3X1VA 1ID3D 3MGPD 3WAAC 3C1BD 1P3IC 2HUEC 5G49B 5GSUA 4J8XA 5CP6C 5B31G 4H9PB 1M19B 5B1MD 3B0CT 4H9NB 2CV5B 2F8NB 5CPKB 2YFVA 4XUJC 5AVBB 5DNND 3REIC 4WU9C 4JJNA 3V9RA 3AZED 3AZFB 4AWLC 1P34A 4J8WB 4LD9D 1S32A 4KHAB 2CWEA 3AZJC 3W98A 5AY8C 2RVQD 5B33C 2AROA 2BYKA 1P3PC 3AZGD 1ID3B 3MGPB 3AZMC 3C1BB 1HQ3A 4Z5TD 3VH6W 3WAAA 1P3IA 4KGCD 5CPIC 1P3OD 5B1MB 3W96C 4J8UD 4X23C 5CP6A 3REKC 5DNNB 3AYWD 3X1UD 4XUJA 3REIA 4WU9A 3AZKC 4LD9B 1KX3D 3WKJC 4QLCC 1P3BD 3AV2B 4M6BA 3LJAD 1EQZC 3AZJA 3AZGB 3REHC 5JRGC 4KUDD 2NZDD 5B33A 1P3PA 4Z5TB 4Z2MH 3LELD 4KGCB 3B6GC 4G92B 1P3OB 4J8UB 4WU8D 1P3MC 5CPIA 2BYMB 3W96A 4X23A 3X1UB 3REKA 5B0ZC 4YS3C 5B32D 1KX3B 3LZ1A 3AZKA 3C1CD 5CHLB 3MNNB 1P3BB 3UTBD 3MGRC 4CAYB 3AZLC 3LJAB 3WKJA 4QLCA 1ULYA 3R45B 1EQZA 3W97C 4KUDB 2FJ7D 2NZDB 3O62C 4ZUXD 3LELB 3REHA 5JRGA 1M19C 2CV5C 2PYOD 5CPKC 5AVBC 1B67A 4WU8B 3B6GA 1F66D 3AZFC 1P3GD 1P3MA 4J8WC 4HGAB 5B2JC 5B32B 3UTAD 5B0ZA 4YS3A 5CPJD 3UTBB 4R8PC 5GXQC 3MGRA 1ID3C 3C1BC 3AZLA 2FJ7B 5E5AD 3KUYD 1ZLAD 4ZUXB 3W97A 3KSYA 5B1MC 5G49A 2PYOB 5DNNC 4H9RB 4H9PA 1M19A 2CV5A 2F8NA 1F66B 2NQBD 1AOID 5CPKA 1P3GB 5AVBA 3WA9B 3KXBD 1H3OB 4LD9C 3AZFA 5AVCD 3X1TD 4J8WA 1BH8A 5B31D 3MGSD 3UTAB 3X1SD 3AV2C 4KHAA 5B2JA 4J8XC 2RVQC 3AZIC 5CPJB 4Z66D 3AZGC 4R8PA 1TAFB 5E5AB 1ID3A 3KUYB 1ZLAB 3C1BA 5BO0B 4KGCC 1P34C 4G92C 1P3OC 4J8UC 3W99C 4E45A 5B1MA 3MVDD 3W98C 2NQBB 1AOIB 5DNNA 3KXBB 5JA4A 5AVCB 3RELC 1KX3C 3X1TB 1M18D 3MNNC 4LD9A 5B31B 5B40D 3MGSB 3X1SB 1TZYD 3LJAC 4Z66B 3AZND 3AV2A 3AZIA 4KUDC 2NZDC 3AN2C 3NQUB 3AZGA 3LELC 4E44A 4WZSB 1P3LB 4WNNB 5AV8D 4KGCA 5B2ID 3KWQB 1P3OA 5KDMB 4J8UA 4H9QB 3W99A 2BYMA 4HGAC 5B32C 1A7WA 2JSSA 5B0YD 1M18B 1KX5D 5BT1C 3RELA 3UTBC 1KX3A 5B1LD 3MNNA 3AZNB 5GT3D 1P3BA 3WTPD 1BFMA 4CAYA 3LJAA 3TU4D 2F8NK 2FJ7C 3R45A 5B24D 1WWIA 4KUDA 2NZDA 3AN2A 3AZEB 5AV8B 2F8NG 3LELA 4J8VD 5DNMC 3LZ1C 5B2IB 1P3GC 3WA9C 4WU8A 4Z2MG 4XZQD 3UTAC 2F8NH 5B0YB 4UUZB 3B6FC 5B32A 5CPJC 1KX5B 5B1LB 5GT3B 3UTBA 3WTPB 3TU4B 5FUGB 3UT9D 5E5AC 3NQJB 5B24B 3KUYC 2FJ7A 3AYWB 3AFAD 2AROD 2PYOA 2NQBC 5BS7C 4H9RA 5DNMA 3MGQD 1F66A 4EO5B 5AVCC 1P3ID 4XZQB 5AV5D 1P3GA 1H3OA 3VH6T 3WA9A 3VH5A 5B31C 3MGSC 3X1SC 5CP6D 3UTAA 3V9RB 4XUJD 5CPJA 3REID 3B6FA 4WU9D 5F99D 3UT9B 1P3LC 1TAFA 5E5AA 2IO5B 1M1AD 3KUYA 1ZLAA 5BO0A 5AV6D 3AFAB 1U35D 2AROB 5AY8D 3KWQC 1JFIB 3C1CB 3MGQB 1P3FD 1P3PD 1AOIA 2NQBA 3AZMD 4H9SA 5BS7A 1P3IB 5AV5B 3KXBA 5AVCA 5CP6B 3MGPC 3AZNC 5B31A 3MGSA 3W96D 3X1SA 3VH5W 4X23D 4XUJB 3REIB 3REKD 4Z66A 3WTPE 5F99B 4NFTA 4G91B 4H9NA 3NQUA 3AZEC 5AV8C 1M1AB 5AV6B 5B2IC 1P3LA 1U35B 5AY8B 1WWSA 3AZHD 3KWQA 5KDMA 1B6WA 1P3FB 1P3PB 1HTAA 4H9QA 3AZMB 1KX4D 5B32G 3B0BA 5B0YC 1KX5C 1BH9B 3B6GD 1M18A 5GT3C 4Z5TC 3WTPC 4X23B 3MGPA 5GT0D 3REKB 3AZNA 5B24C 1R4VA 3B0CW 3LZ0D 5B0ZD 3AYWC 3X1UC 3AZEA 5AV8A 3AZHB 5B2IA 4EO5C 1P3BC 4XZQC 1KX4B 3W97D 3O62D 1M19D 3B6GB 5B0YA 4UUZA 1KX5A 5GT0B 5C3IB 4YM6D 3AV1D 5GT3A 3UT9C 4Z5TA 3WTPA 4WU8C 3LZ0B 5FUGA 5B0ZB 5B2JD 3NQJA 5AV9D 5B24A 3MVDB 3A6ND 3AYWA 2HIOD 3X1UA 3VH6A 4R8PD 5GXQD 3C1CC 3MGQC 5B40B 5AV5C 3W97B 1TZYB 3O62B 4H9OB 4XZQA 3REJD 1P3KD 4ZUXC 4YM6B 1Q9CA 3AV1B 5F99C 2PYOC 1BH8B 4G91C 1P3AD 3X1VD 1F66C 3UT9A 5B2JB 1M1AC 1N1JB 5AV9B 3A6NB 3B0DB 5BNXB 5AV6C 3AV2D 1U35C 4J8XD 3AZID 5GSUD 2HIOB 3AFAA 4R8PB 5GXQB 4CSRB 1P3FC 4JJND 1JFIA 3C1CA 3MGQA 5AV5A 1P34D 5BNVB 3REJB 1S32D 3W99D 1ZLAC 1P3KB 3W98D 5JA4B 4ZUXA 1F1EA 4J8VB 2YFWB 1P3AB 3RELD 5F99A 3X1VB 1AOIC 4H9SC 4NE3A 3KXBC 3MNND 1HQ3D 1M1AA 4J8XB 3AZIB 5GSUB 3AZHC 3WAAD 3X1TC 5AV6A 1U35A 5AY8A 1KX4C 2YFVB 4Z66C 4JJNB 3AN2D 1P3FA 3AZMA 1P34B 1S32B 1BH9A 3W99B 5GT0C 5C3IC 3W98B 3AZJD 3LZ0C 4ZBJB 2BYKB 3MVDC 3RELB 5B33D 1HQ3B 5BT1D 3WAAB 4DRAA 1M18C 2HUEB 5B40C 3AZHA 3X1TA 1TZYC 5CPID 3AN2B 1KX4A 4WU9B 4NE5A 1KU5A 5DNMD 3LZ1D 4AWLB 3AZKD 4YM6C 3AV1C 3WA9D 3WKJD 5GT0A 3AZJB 4QLCD 4WNNA 5AV9C 3A6NC 1EQZD 3LZ0A 3B0DC 5B33B 3B6FD 3MVDA 2HIOC 3REHD 5JRGD
chains in the Genus database with same CATH superfamily
2ZY4A 4WV4B 5CPIB 5B1LC 3W96B 5B40A 1P3MD 1TZYA 3F6TA 3TU4C 3REJC 3O62A 4H9OA 1P3KC 4NE6A 5DNMB 3LZ1B 3AZKB 4YS3D 2F2AC 2FFFB 2ZY5A 4DRBA 4J8VC 4YM6A 3WKJB 4QLCB 3AV1A 1P3AC 3X1VC 3MGRD 3AZLD 1EQZB 2LY8A 3H0RC 1N1JA 5GSUC 5AV9A 3B6FB 3A6NA 2VQRA 3REHB 5BNXA 3VH5T 5JRGB 2DF4C 2HIOA 2Y2OA 2JCHA 3A1KA 4JJNC 2L5AA 2CV5D 4CSRA 5GXQA 2F8ND 5CPKD 1Z2CB 5AVBD 1P3MB 1P3LD 5B1LA 3AZFD 1S32C 4J8WD 5BNVA 3TU4A 3REJA 3KWQD 4YS3B 2IO5C 1P3KA 4ZBJC 3AFAC 2AROC 3MGRB 3AZLB 4J8VA 2YFWA 1P3AA 1HQ3C 3X1VA 2Y2PA 3MGPD 3WAAC 3C1BD 1P3IC 1ID3D 2HUEC 5G49B 5GSUA 4J8XA 5CP6C 5B31G 4H9PB 1M19B 5B1MD 3B0CT 4H9NB 2CV5B 2F8NB 5CPKB 2YFVA 4XUJC 5AVBB 5DNND 3REIC 4WU9C 4JJNA 3V9RA 3AZED 2Y2NA 3AZFB 4AWLC 1P34A 4J8WB 4LD9D 1S32A 4KHAB 2CWEA 2JE5A 3AZJC 3W98A 5AY8C 2RVQD 5B33C 2AROA 2BYKA 1P3PC 3AZGD 1ID3B 3MGPB 3AZMC 3C1BB 1HQ3A 4Z5TD 3VH6W 2G5HC 3WAAA 1P3IA 4KGCD 5CPIC 1P3OD 5B1MB 3W96C 3EPKA 3EPLA 4X23C 5CP6A 4J8UD 3REKC 5DNNB 3AYWD 3X1UD 4XUJA 3REIA 4WU9A 3AZKC 4LD9B 3EPJA 1KX3D 3WKJC 4QLCC 1P3BD 3AV2B 4M6BA 3LJAD 1EQZC 3AZJA 2Y2KA 3AZGB 3REHC 5JRGC 4KUDD 2NZDD 5B33A 1P3PA 2UWXA 4Z5TB 4Z2MH 3LELD 4KGCB 3B6GC 4G92B 1P3OB 4J8UB 4WU8D 1P3MC 2G5IC 5CPIA 2BYMB 3W96A 4X23A 3X1UB 3REKA 5B0ZC 4YS3C 5B32D 2ZY3A 1KX3B 3LZ1A 3AZKA 3C1CD 5CHLB 3MNNB 1P3BB 3UTBD 3MGRC 4CAYB 3AZLC 3LJAB 3WKJA 2XD5A 4QLCA 1ULYA 3R45B 1EQZA 3W97C 4KUDB 2FJ7D 2NZDB 3O62C 4ZUXD 3LELB 3REHA 5JRGA 1M19C 2CV5C 2PYOD 5CPKC 5AVBC 1B67A 4WU8B 3B6GA 1F66D 3AZFC 1P3GD 1P3MA 4J8WC 4WJ3C 4HGAB 5B2JC 5B32B 3UTAD 5B0ZA 4YS3A 5CPJD 2Y2GA 3UTBB 4R8PC 5GXQC 3MGRA 1ID3C 3C1BC 3AZLA 2Y2LA 2FJ7B 5E5AD 3KUYD 1ZLAD 4ZUXB 3P5JB 3W97A 3KSYA 5B1MC 5G49A 2PYOB 5DNNC 4H9RB 4H9PA 1M19A 2BG1A 2CV5A 2F8NA 1F66B 2NQBD 1AOID 3H0LC 5CPKA 1P3GB 5AVBA 3WA9B 3KXBD 1H3OB 4LD9C 3AZFA 5AVCD 3X1TD 4J8WA 1BH8A 5B31D 3MGSD 3UTAB 3X1SD 3AV2C 4KHAA 5B2JA 4J8XC 2RVQC 3AZIC 5CPJB 4Z66D 3AL0C 3AZGC 4R8PA 3KFUG 1TAFB 5E5AB 1ID3A 3KUYB 1ZLAB 3C1BA 5BO0B 4KGCC 1P34C 4G92C 1P3OC 4J8UC 3W99C 4E45A 5B1MA 3MVDD 3W98C 2NQBB 1AOIB 5DNNA 3KXBB 5JA4A 5AVCB 3RELC 1KX3C 3X1TB 1M18D 3MNNC 4LD9A 5B31B 5B40D 3MGSB 3X1SB 1W2EA 1TZYD 3LJAC 4Z66B 3AZND 3AV2A 3AZIA 4KUDC 2NZDC 3AN2C 3NQUB 3AZGA 3LELC 4E44A 4WZSB 1P3LB 4WNNB 5AV8D 4KGCA 5B2ID 3KWQB 1P3OA 5KDMB 4J8UA 4H9QB 3W99A 1PZRA 2BYMA 4DQYB 4HGAC 5B32C 1A7WA 2JSSA 5B0YD 1M18B 1KX5D 5BT1C 3RELA 3UTBC 1KX3A 5B1LD 3MNNA 3AZNB 5GT3D 1P3BA 3WTPD 1BFMA 4CAYA 3LJAA 3TU4D 2F8NK 2FJ7C 3R45A 5B24D 2RIQA 1WWIA 4KUDA 2NZDA 3AN2A 3AZEB 5AV8B 2F8NG 3LELA 4J8VD 5DNMC 3LZ1C 5B2IB 1P3GC 3WA9C 4WU8A 3FDDA 4Z2MG 4XZQD 2W8SA 3UTAC 2F8NH 5B0YB 4UUZB 3B6FC 5B32A 5CPJC 1KX5B 5B1LB 5GT3B 3UTBA 3WTPB 3TU4B 5FUGB 3UT9D 5E5AC 3NQJB 5B24B 3KUYC 2FJ7A 3AYWB 3AFAD 2AROD 2PYOA 2NQBC 2Y2MA 5BS7C 3EG5B 4H9RA 5DNMA 3MGQD 1F66A 4EO5B 5AVCC 1P3ID 4XZQB 5AV5D 1P3GA 1H3OA 3VH6T 3WA9A 3VH5A 5B31C 3MGSC 3X1SC 2Y2JA 5CP6D 3UTAA 3V9RB 4XUJD 5CPJA 3REID 3B6FA 4WU9D 2XD1A 5F99D 3UT9B 2ZY2A 1P3LC 1TAFA 5E5AA 2IO5B 1M1AD 3KUYA 1ZLAA 5BO0A 5AV6D 3AFAB 1U35D 2AROB 5AY8D 3KWQC 1JFIB 3C1CB 3MGQB 1P3FD 1P3PD 1AOIA 2NQBA 3AZMD 4H9SA 5BS7A 1P3IB 3A1IA 5AV5B 3KXBA 3H0MC 5AVCA 5CP6B 3MGPC 3AZNC 5B31A 3MGSA 3W96D 3X1SA 3VH5W 4X23D 4XUJB 3REIB 3REKD 4Z66A 3WTPE 5F99B 4NFTA 4G91B 4H9NA 3NQUA 3AZEC 5AV8C 1M1AB 5AV6B 5B2IC 1P3LA 1U35B 5AY8B 1WWSA 3AZHD 3KWQA 5KDMA 1B6WA 1P3FB 1P3PB 1HTAA 4H9QA 3AZMB 1KX4D 5B32G 3B0BA 5B0YC 1KX5C 1BH9B 3B6GD 1M18A 5GT3C 4Z5TC 3WTPC 4X23B 2Y2HA 3MGPA 5GT0D 3REKB 3AZNA 5B24C 1R4VA 3B0CW 3LZ0D 5B0ZD 3AYWC 3X1UC 3AZEA 5AV8A 3AZHB 5B2IA 4EO5C 1P3BC 4XZQC 1KX4B 3W97D 3O62D 1M19D 3B6GB 5B0YA 4UUZA 1KX5A 4UPKA 5GT0B 5C3IB 4YM6D 3AV1D 5GT3A 3UT9C 4Z5TA 3WTPA 4WU8C 3LZ0B 5FUGA 5B0ZB 5B2JD 3NQJA 5AV9D 5B24A 3MVDB 3A6ND 3AYWA 2HIOD 3X1UA 3VH6A 4R8PD 5GXQD 3C1CC 3MGQC 5B40B 2Y2IA 5AV5C 3W97B 1TZYB 3O62B 4H9OB 4XZQA 3REJD 1T3UA 1P3KD 4ZUXC 4YM6B 1Q9CA 3AV1B 5F99C 2PYOC 1BH8B 2J8PA 4G91C 1P3AD 3X1VD 1F66C 3UT9A 5B2JB 1M1AC 1N1JB 5AV9B 3A6NB 3B0DB 5BNXB 5AV6C 3AV2D 1U35C 4J8XD 3AZID 5GSUD 2HIOB 3AFAA 4R8PB 5GXQB 4CSRB 1P3FC 4JJND 1JFIA 3C1CA 3MGQA 5AV5A 1P34D 5BNVB 3REJB 1S32D 3W99D 1ZLAC 1P3KB 3W98D 5JA4B 4ZUXA 1F1EA 2DQNC 4J8VB 2YFWB 1P3AB 3RELD 5F99A 3X1VB 1AOIC 4H9SC 4NE3A 2Y2QA 3MNND 3KXBC 1HQ3D 1M1AA 4J8XB 3AZIB 5GSUB 3AZHC 3WAAD 3X1TC 5AV6A 1U35A 5AY8A 1KX4C 2YFVB 4Z66C 4JJNB 3AN2D 1P3FA 3AZMA 1P34B 1S32B 1BH9A 3W99B 5GT0C 5C3IC 3W98B 3AZJD 3LZ0C 4ZBJB 2BYKB 2ZM5A 3MVDC 3RELB 5B33D 1HQ3B 5BT1D 3WAAB 4DRAA 1M18C 2HUEB 5B40C 3AZHA 3X1TA 1TZYC 5CPID 3AN2B 1KX4A 4WU9B 3IP4C 4NE5A 1KU5A 5DNMD 3LZ1D 4AWLB 3AZKD 4YM6C 3AV1C 3EPHA 3WA9D 3WKJD 5GT0A 3AZJB 4QLCD 4WNNA 5AV9C 3A6NC 1EQZD 3LZ0A 3B0DC 5B33B 3B6FD 3MVDA 2HIOC 3REHD 5JRGD
chains in the Genus database with same CATH topology
2ZY4A 4WV4B 5CPIB 5B1LC 3W96B 5B40A 1P3MD 1TZYA 3F6TA 3TU4C 3REJC 3O62A 4H9OA 1P3KC 4NE6A 5DNMB 3LZ1B 3AZKB 4YS3D 2F2AC 2FFFB 2ZY5A 4DRBA 4J8VC 4YM6A 3WKJB 4QLCB 3AV1A 1P3AC 3X1VC 3MGRD 3AZLD 1EQZB 2LY8A 3H0RC 1N1JA 5GSUC 5AV9A 3B6FB 3A6NA 2VQRA 3REHB 5BNXA 3VH5T 5JRGB 2DF4C 2HIOA 2Y2OA 2JCHA 3A1KA 4JJNC 2L5AA 2CV5D 4CSRA 5GXQA 2F8ND 5CPKD 1Z2CB 5AVBD 1P3MB 1P3LD 5B1LA 3AZFD 1S32C 4J8WD 5BNVA 3TU4A 3REJA 3KWQD 4YS3B 2IO5C 1P3KA 4ZBJC 3AFAC 2AROC 3MGRB 3AZLB 4J8VA 2YFWA 1P3AA 1HQ3C 3X1VA 2Y2PA 3MGPD 3WAAC 3C1BD 1P3IC 1ID3D 2HUEC 5G49B 5GSUA 4J8XA 5CP6C 5B31G 4H9PB 1M19B 5B1MD 3B0CT 4H9NB 2CV5B 2F8NB 5CPKB 2YFVA 4XUJC 5AVBB 5DNND 3REIC 4WU9C 4JJNA 3V9RA 3AZED 2Y2NA 3AZFB 4AWLC 1P34A 4J8WB 4LD9D 1S32A 4KHAB 2CWEA 2JE5A 3AZJC 3W98A 5AY8C 2RVQD 5B33C 2AROA 2BYKA 1P3PC 3AZGD 1ID3B 3MGPB 3AZMC 3C1BB 1HQ3A 4Z5TD 3VH6W 2G5HC 3WAAA 1P3IA 4KGCD 5CPIC 1P3OD 5B1MB 3W96C 3EPKA 3EPLA 4X23C 5CP6A 4J8UD 3REKC 5DNNB 3AYWD 3X1UD 4XUJA 3REIA 4WU9A 3AZKC 4LD9B 3EPJA 1KX3D 3WKJC 4QLCC 1P3BD 3AV2B 4M6BA 3LJAD 1EQZC 3AZJA 2Y2KA 3AZGB 3REHC 5JRGC 4KUDD 2NZDD 5B33A 1P3PA 2UWXA 4Z5TB 4Z2MH 3LELD 4KGCB 3B6GC 4G92B 1P3OB 4J8UB 4WU8D 1P3MC 2G5IC 5CPIA 2BYMB 3W96A 4X23A 3X1UB 3REKA 5B0ZC 4YS3C 5B32D 2ZY3A 1KX3B 3LZ1A 3AZKA 3C1CD 5CHLB 3MNNB 1P3BB 3UTBD 3MGRC 4CAYB 3AZLC 3LJAB 3WKJA 2XD5A 4QLCA 1ULYA 3R45B 1EQZA 3W97C 4KUDB 2FJ7D 2NZDB 3O62C 4ZUXD 3LELB 3REHA 5JRGA 1M19C 2CV5C 2PYOD 5CPKC 5AVBC 1B67A 4WU8B 3B6GA 1F66D 3AZFC 1P3GD 1P3MA 4J8WC 4WJ3C 4HGAB 5B2JC 5B32B 3UTAD 5B0ZA 4YS3A 5CPJD 2Y2GA 3UTBB 4R8PC 5GXQC 3MGRA 1ID3C 3C1BC 3AZLA 2Y2LA 2FJ7B 5E5AD 3KUYD 1ZLAD 4ZUXB 3P5JB 3W97A 3KSYA 5B1MC 5G49A 2PYOB 5DNNC 4H9RB 4H9PA 1M19A 2BG1A 2CV5A 2F8NA 1F66B 2NQBD 1AOID 3H0LC 5CPKA 1P3GB 5AVBA 3WA9B 3KXBD 1H3OB 4LD9C 3AZFA 5AVCD 3X1TD 4J8WA 1BH8A 5B31D 3MGSD 3UTAB 3X1SD 3AV2C 4KHAA 5B2JA 4J8XC 2RVQC 3AZIC 5CPJB 4Z66D 3AL0C 3AZGC 4R8PA 3KFUG 1TAFB 5E5AB 1ID3A 3KUYB 1ZLAB 3C1BA 5BO0B 4KGCC 1P34C 4G92C 1P3OC 4J8UC 3W99C 4E45A 5B1MA 3MVDD 3W98C 2NQBB 1AOIB 5DNNA 3KXBB 5JA4A 5AVCB 3RELC 1KX3C 3X1TB 1M18D 3MNNC 4LD9A 5B31B 5B40D 3MGSB 3X1SB 1W2EA 1TZYD 3LJAC 4Z66B 3AZND 3AV2A 3AZIA 4KUDC 2NZDC 3AN2C 3NQUB 3AZGA 3LELC 4E44A 4WZSB 1P3LB 4WNNB 5AV8D 4KGCA 5B2ID 3KWQB 1P3OA 5KDMB 4J8UA 4H9QB 3W99A 1PZRA 2BYMA 4DQYB 4HGAC 5B32C 1A7WA 2JSSA 5B0YD 1M18B 1KX5D 5BT1C 3RELA 3UTBC 1KX3A 5B1LD 3MNNA 3AZNB 5GT3D 1P3BA 3WTPD 1BFMA 4CAYA 3LJAA 3TU4D 2F8NK 2FJ7C 3R45A 5B24D 2RIQA 1WWIA 4KUDA 2NZDA 3AN2A 3AZEB 5AV8B 2F8NG 3LELA 4J8VD 5DNMC 3LZ1C 5B2IB 1P3GC 3WA9C 4WU8A 3FDDA 4Z2MG 4XZQD 2W8SA 3UTAC 2F8NH 5B0YB 4UUZB 3B6FC 5B32A 5CPJC 1KX5B 5B1LB 5GT3B 3UTBA 3WTPB 3TU4B 5FUGB 3UT9D 5E5AC 3NQJB 5B24B 3KUYC 2FJ7A 3AYWB 3AFAD 2AROD 2PYOA 2NQBC 2Y2MA 5BS7C 3EG5B 4H9RA 5DNMA 3MGQD 1F66A 4EO5B 5AVCC 1P3ID 4XZQB 5AV5D 1P3GA 1H3OA 3VH6T 3WA9A 3VH5A 5B31C 3MGSC 3X1SC 2Y2JA 5CP6D 3UTAA 3V9RB 4XUJD 5CPJA 3REID 3B6FA 4WU9D 2XD1A 5F99D 3UT9B 2ZY2A 1P3LC 1TAFA 5E5AA 2IO5B 1M1AD 3KUYA 1ZLAA 5BO0A 5AV6D 3AFAB 1U35D 2AROB 5AY8D 3KWQC 1JFIB 3C1CB 3MGQB 1P3FD 1P3PD 1AOIA 2NQBA 3AZMD 4H9SA 5BS7A 1P3IB 3A1IA 5AV5B 3KXBA 3H0MC 5AVCA 5CP6B 3MGPC 3AZNC 5B31A 3MGSA 3W96D 3X1SA 3VH5W 4X23D 4XUJB 3REIB 3REKD 4Z66A 3WTPE 5F99B 4NFTA 4G91B 4H9NA 3NQUA 3AZEC 5AV8C 1M1AB 5AV6B 5B2IC 1P3LA 1U35B 5AY8B 1WWSA 3AZHD 3KWQA 5KDMA 1B6WA 1P3FB 1P3PB 1HTAA 4H9QA 3AZMB 1KX4D 5B32G 3B0BA 5B0YC 1KX5C 1BH9B 3B6GD 1M18A 5GT3C 4Z5TC 3WTPC 4X23B 2Y2HA 3MGPA 5GT0D 3REKB 3AZNA 5B24C 1R4VA 3B0CW 3LZ0D 5B0ZD 3AYWC 3X1UC 3AZEA 5AV8A 3AZHB 5B2IA 4EO5C 1P3BC 4XZQC 1KX4B 3W97D 3O62D 1M19D 3B6GB 5B0YA 4UUZA 1KX5A 4UPKA 5GT0B 5C3IB 4YM6D 3AV1D 5GT3A 3UT9C 4Z5TA 3WTPA 4WU8C 3LZ0B 5FUGA 5B0ZB 5B2JD 3NQJA 5AV9D 5B24A 3MVDB 3A6ND 3AYWA 2HIOD 3X1UA 3VH6A 4R8PD 5GXQD 3C1CC 3MGQC 5B40B 2Y2IA 5AV5C 3W97B 1TZYB 3O62B 4H9OB 4XZQA 3REJD 1T3UA 1P3KD 4ZUXC 4YM6B 1Q9CA 3AV1B 5F99C 2PYOC 1BH8B 2J8PA 4G91C 1P3AD 3X1VD 1F66C 3UT9A 5B2JB 1M1AC 1N1JB 5AV9B 3A6NB 3B0DB 5BNXB 5AV6C 3AV2D 1U35C 4J8XD 3AZID 5GSUD 2HIOB 3AFAA 4R8PB 5GXQB 4CSRB 1P3FC 4JJND 1JFIA 3C1CA 3MGQA 5AV5A 1P34D 5BNVB 3REJB 1S32D 3W99D 1ZLAC 1P3KB 3W98D 5JA4B 4ZUXA 1F1EA 2DQNC 4J8VB 2YFWB 1P3AB 3RELD 5F99A 3X1VB 1AOIC 4H9SC 4NE3A 2Y2QA 3MNND 3KXBC 1HQ3D 1M1AA 4J8XB 3AZIB 5GSUB 3AZHC 3WAAD 3X1TC 5AV6A 1U35A 5AY8A 1KX4C 2YFVB 4Z66C 4JJNB 3AN2D 1P3FA 3AZMA 1P34B 1S32B 1BH9A 3W99B 5GT0C 5C3IC 3W98B 3AZJD 3LZ0C 4ZBJB 2BYKB 2ZM5A 3MVDC 3RELB 5B33D 1HQ3B 5BT1D 3WAAB 4DRAA 1M18C 2HUEB 5B40C 3AZHA 3X1TA 1TZYC 5CPID 3AN2B 1KX4A 4WU9B 3IP4C 4NE5A 1KU5A 5DNMD 3LZ1D 4AWLB 3AZKD 4YM6C 3AV1C 3EPHA 3WA9D 3WKJD 5GT0A 3AZJB 4QLCD 4WNNA 5AV9C 3A6NC 1EQZD 3LZ0A 3B0DC 5B33B 3B6FD 3MVDA 2HIOC 3REHD 5JRGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WV4 B;  5CPI B;  5B1L C;  3W96 B;  5B40 A;  1P3M D;  1TZY A;  3TU4 C;  3REJ C;  3O62 A;  4H9O A;  1P3K C;  4NE6 A;  5DNM B;  3LZ1 B;  3AZK B;  4YS3 D;  4DRB A;  4J8V C;  4YM6 A;  3WKJ B;  4QLC B;  3AV1 A;  1P3A C;  3X1V C;  3MGR D;  3AZL D;  1EQZ B;  2LY8 A;  1N1J A;  5GSU C;  5AV9 A;  3B6F B;  3A6N A;  3REH B;  5BNX A;  3VH5 T;  5JRG B;  2HIO A;  4JJN C;  2L5A A;  2CV5 D;  4CSR A;  5GXQ A;  2F8N D;  5CPK D;  5AVB D;  1P3M B;  1P3L D;  5B1L A;  3AZF D;  1S32 C;  4J8W D;  5BNV A;  3TU4 A;  3REJ A;  3KWQ D;  4YS3 B;  2IO5 C;  1P3K A;  4ZBJ C;  3AFA C;  2ARO C;  3MGR B;  3AZL B;  4J8V A;  2YFW A;  1P3A A;  1HQ3 C;  3X1V A;  1ID3 D;  3MGP D;  3WAA C;  3C1B D;  1P3I C;  2HUE C;  5G49 B;  5GSU A;  4J8X A;  5CP6 C;  5B31 G;  4H9P B;  1M19 B;  5B1M D;  3B0C T;  4H9N B;  2CV5 B;  2F8N B;  5CPK B;  2YFV A;  4XUJ C;  5AVB B;  5DNN D;  3REI C;  4WU9 C;  4JJN A;  3V9R A;  3AZE D;  3AZF B;  4AWL C;  1P34 A;  4J8W B;  4LD9 D;  1S32 A;  4KHA B;  2CWE A;  3AZJ C;  3W98 A;  5AY8 C;  2RVQ D;  5B33 C;  2ARO A;  2BYK A;  1P3P C;  3AZG D;  1ID3 B;  3MGP B;  3AZM C;  3C1B B;  1HQ3 A;  4Z5T D;  3VH6 W;  3WAA A;  1P3I A;  4KGC D;  5CPI C;  1P3O D;  5B1M B;  3W96 C;  4J8U D;  4X23 C;  5CP6 A;  3REK C;  5DNN B;  3AYW D;  3X1U D;  4XUJ A;  3REI A;  4WU9 A;  3AZK C;  4LD9 B;  1KX3 D;  3WKJ C;  4QLC C;  1P3B D;  3AV2 B;  4M6B A;  3LJA D;  1EQZ C;  3AZJ A;  3AZG B;  3REH C;  5JRG C;  4KUD D;  2NZD D;  5B33 A;  1P3P A;  4Z5T B;  4Z2M H;  3LEL D;  4KGC B;  3B6G C;  4G92 B;  1P3O B;  4J8U B;  4WU8 D;  1P3M C;  5CPI A;  2BYM B;  3W96 A;  4X23 A;  3X1U B;  3REK A;  5B0Z C;  4YS3 C;  5B32 D;  1KX3 B;  3LZ1 A;  3AZK A;  3C1C D;  5CHL B;  3MNN B;  1P3B B;  3UTB D;  3MGR C;  4CAY B;  3AZL C;  3LJA B;  3WKJ A;  4QLC A;  1ULY A;  3R45 B;  1EQZ A;  3W97 C;  4KUD B;  2FJ7 D;  2NZD B;  3O62 C;  4ZUX D;  3LEL B;  3REH A;  5JRG A;  1M19 C;  2CV5 C;  2PYO D;  5CPK C;  5AVB C;  1B67 A;  4WU8 B;  3B6G A;  1F66 D;  3AZF C;  1P3G D;  1P3M A;  4J8W C;  4HGA B;  5B2J C;  5B32 B;  3UTA D;  5B0Z A;  4YS3 A;  5CPJ D;  3UTB B;  4R8P C;  5GXQ C;  3MGR A;  1ID3 C;  3C1B C;  3AZL A;  2FJ7 B;  5E5A D;  3KUY D;  1ZLA D;  4ZUX B;  3W97 A;  3KSY A;  5B1M C;  5G49 A;  2PYO B;  5DNN C;  4H9R B;  4H9P A;  1M19 A;  2CV5 A;  2F8N A;  1F66 B;  2NQB D;  1AOI D;  5CPK A;  1P3G B;  5AVB A;  3WA9 B;  3KXB D;  1H3O B;  4LD9 C;  3AZF A;  5AVC D;  3X1T D;  4J8W A;  1BH8 A;  5B31 D;  3MGS D;  3UTA B;  3X1S D;  3AV2 C;  4KHA A;  5B2J A;  4J8X C;  2RVQ C;  3AZI C;  5CPJ B;  4Z66 D;  3AZG C;  4R8P A;  1TAF B;  5E5A B;  1ID3 A;  3KUY B;  1ZLA B;  3C1B A;  5BO0 B;  4KGC C;  1P34 C;  4G92 C;  1P3O C;  4J8U C;  3W99 C;  4E45 A;  5B1M A;  3MVD D;  3W98 C;  2NQB B;  1AOI B;  5DNN A;  3KXB B;  5JA4 A;  5AVC B;  3REL C;  1KX3 C;  3X1T B;  1M18 D;  3MNN C;  4LD9 A;  5B31 B;  5B40 D;  3MGS B;  3X1S B;  1TZY D;  3LJA C;  4Z66 B;  3AZN D;  3AV2 A;  3AZI A;  4KUD C;  2NZD C;  3AN2 C;  3NQU B;  3AZG A;  3LEL C;  4E44 A;  4WZS B;  1P3L B;  4WNN B;  5AV8 D;  4KGC A;  5B2I D;  3KWQ B;  1P3O A;  5KDM B;  4J8U A;  4H9Q B;  3W99 A;  2BYM A;  4HGA C;  5B32 C;  1A7W A;  2JSS A;  5B0Y D;  1M18 B;  1KX5 D;  5BT1 C;  3REL A;  3UTB C;  1KX3 A;  5B1L D;  3MNN A;  3AZN B;  5GT3 D;  1P3B A;  3WTP D;  1BFM A;  4CAY A;  3LJA A;  3TU4 D;  2F8N K;  2FJ7 C;  3R45 A;  5B24 D;  1WWI A;  4KUD A;  2NZD A;  3AN2 A;  3AZE B;  5AV8 B;  2F8N G;  3LEL A;  4J8V D;  5DNM C;  3LZ1 C;  5B2I B;  1P3G C;  3WA9 C;  4WU8 A;  4Z2M G;  4XZQ D;  3UTA C;  2F8N H;  5B0Y B;  4UUZ B;  3B6F C;  5B32 A;  5CPJ C;  1KX5 B;  5B1L B;  5GT3 B;  3UTB A;  3WTP B;  3TU4 B;  5FUG B;  3UT9 D;  5E5A C;  3NQJ B;  5B24 B;  3KUY C;  2FJ7 A;  3AYW B;  3AFA D;  2ARO D;  2PYO A;  2NQB C;  5BS7 C;  4H9R A;  5DNM A;  3MGQ D;  1F66 A;  4EO5 B;  5AVC C;  1P3I D;  4XZQ B;  5AV5 D;  1P3G A;  1H3O A;  3VH6 T;  3WA9 A;  3VH5 A;  5B31 C;  3MGS C;  3X1S C;  5CP6 D;  3UTA A;  3V9R B;  4XUJ D;  5CPJ A;  3REI D;  3B6F A;  4WU9 D;  5F99 D;  3UT9 B;  1P3L C;  1TAF A;  5E5A A;  2IO5 B;  1M1A D;  3KUY A;  1ZLA A;  5BO0 A;  5AV6 D;  3AFA B;  1U35 D;  2ARO B;  5AY8 D;  3KWQ C;  1JFI B;  3C1C B;  3MGQ B;  1P3F D;  1P3P D;  1AOI A;  2NQB A;  3AZM D;  4H9S A;  5BS7 A;  1P3I B;  5AV5 B;  3KXB A;  5AVC A;  5CP6 B;  3MGP C;  3AZN C;  5B31 A;  3MGS A;  3W96 D;  3X1S A;  3VH5 W;  4X23 D;  4XUJ B;  3REI B;  3REK D;  4Z66 A;  3WTP E;  5F99 B;  4NFT A;  4G91 B;  4H9N A;  3NQU A;  3AZE C;  5AV8 C;  1M1A B;  5AV6 B;  5B2I C;  1P3L A;  1U35 B;  5AY8 B;  1WWS A;  3AZH D;  3KWQ A;  5KDM A;  1B6W A;  1P3F B;  1P3P B;  1HTA A;  4H9Q A;  3AZM B;  1KX4 D;  5B32 G;  3B0B A;  5B0Y C;  1KX5 C;  1BH9 B;  3B6G D;  1M18 A;  5GT3 C;  4Z5T C;  3WTP C;  4X23 B;  3MGP A;  5GT0 D;  3REK B;  3AZN A;  5B24 C;  1R4V A;  3B0C W;  3LZ0 D;  5B0Z D;  3AYW C;  3X1U C;  3AZE A;  5AV8 A;  3AZH B;  5B2I A;  4EO5 C;  1P3B C;  4XZQ C;  1KX4 B;  3W97 D;  3O62 D;  1M19 D;  3B6G B;  5B0Y A;  4UUZ A;  1KX5 A;  5GT0 B;  5C3I B;  4YM6 D;  3AV1 D;  5GT3 A;  3UT9 C;  4Z5T A;  3WTP A;  4WU8 C;  3LZ0 B;  5FUG A;  5B0Z B;  5B2J D;  3NQJ A;  5AV9 D;  5B24 A;  3MVD B;  3A6N D;  3AYW A;  2HIO D;  3X1U A;  3VH6 A;  4R8P D;  5GXQ D;  3C1C C;  3MGQ C;  5B40 B;  5AV5 C;  3W97 B;  1TZY B;  3O62 B;  4H9O B;  4XZQ A;  3REJ D;  1P3K D;  4ZUX C;  4YM6 B;  1Q9C A;  3AV1 B;  5F99 C;  2PYO C;  1BH8 B;  4G91 C;  1P3A D;  3X1V D;  1F66 C;  3UT9 A;  5B2J B;  1M1A C;  1N1J B;  5AV9 B;  3A6N B;  3B0D B;  5BNX B;  5AV6 C;  3AV2 D;  1U35 C;  4J8X D;  3AZI D;  5GSU D;  2HIO B;  3AFA A;  4R8P B;  5GXQ B;  4CSR B;  1P3F C;  4JJN D;  1JFI A;  3C1C A;  3MGQ A;  5AV5 A;  1P34 D;  5BNV B;  3REJ B;  1S32 D;  3W99 D;  1ZLA C;  1P3K B;  3W98 D;  5JA4 B;  4ZUX A;  1F1E A;  4J8V B;  2YFW B;  1P3A B;  3REL D;  5F99 A;  3X1V B;  1AOI C;  4H9S C;  4NE3 A;  3KXB C;  3MNN D;  1HQ3 D;  1M1A A;  4J8X B;  3AZI B;  5GSU B;  3AZH C;  3WAA D;  3X1T C;  5AV6 A;  1U35 A;  5AY8 A;  1KX4 C;  2YFV B;  4Z66 C;  4JJN B;  3AN2 D;  1P3F A;  3AZM A;  1P34 B;  1S32 B;  1BH9 A;  3W99 B;  5GT0 C;  5C3I C;  3W98 B;  3AZJ D;  3LZ0 C;  4ZBJ B;  2BYK B;  3MVD C;  3REL B;  5B33 D;  1HQ3 B;  5BT1 D;  3WAA B;  4DRA A;  1M18 C;  2HUE B;  5B40 C;  3AZH A;  3X1T A;  1TZY C;  5CPI D;  3AN2 B;  1KX4 A;  4WU9 B;  4NE5 A;  1KU5 A;  5DNM D;  3LZ1 D;  4AWL B;  3AZK D;  4YM6 C;  3AV1 C;  3WA9 D;  3WKJ D;  5GT0 A;  3AZJ B;  4QLC D;  4WNN A;  5AV9 C;  3A6N C;  1EQZ D;  3LZ0 A;  3B0D C;  5B33 B;  3B6F D;  3MVD A;  2HIO C;  3REH D;  5JRG D; 
#chains in the Genus database with same CATH topology
 2ZY4 A;  4WV4 B;  5CPI B;  5B1L C;  3W96 B;  5B40 A;  1P3M D;  1TZY A;  3F6T A;  3TU4 C;  3REJ C;  3O62 A;  4H9O A;  1P3K C;  4NE6 A;  5DNM B;  3LZ1 B;  3AZK B;  4YS3 D;  2F2A C;  2FFF B;  2ZY5 A;  4DRB A;  4J8V C;  4YM6 A;  3WKJ B;  4QLC B;  3AV1 A;  1P3A C;  3X1V C;  3MGR D;  3AZL D;  1EQZ B;  2LY8 A;  3H0R C;  1N1J A;  5GSU C;  5AV9 A;  3B6F B;  3A6N A;  2VQR A;  3REH B;  5BNX A;  3VH5 T;  5JRG B;  2DF4 C;  2HIO A;  2Y2O A;  2JCH A;  3A1K A;  4JJN C;  2L5A A;  2CV5 D;  4CSR A;  5GXQ A;  2F8N D;  5CPK D;  1Z2C B;  5AVB D;  1P3M B;  1P3L D;  5B1L A;  3AZF D;  1S32 C;  4J8W D;  5BNV A;  3TU4 A;  3REJ A;  3KWQ D;  4YS3 B;  2IO5 C;  1P3K A;  4ZBJ C;  3AFA C;  2ARO C;  3MGR B;  3AZL B;  4J8V A;  2YFW A;  1P3A A;  1HQ3 C;  3X1V A;  2Y2P A;  3MGP D;  3WAA C;  3C1B D;  1P3I C;  1ID3 D;  2HUE C;  5G49 B;  5GSU A;  4J8X A;  5CP6 C;  5B31 G;  4H9P B;  1M19 B;  5B1M D;  3B0C T;  4H9N B;  2CV5 B;  2F8N B;  5CPK B;  2YFV A;  4XUJ C;  5AVB B;  5DNN D;  3REI C;  4WU9 C;  4JJN A;  3V9R A;  3AZE D;  2Y2N A;  3AZF B;  4AWL C;  1P34 A;  4J8W B;  4LD9 D;  1S32 A;  4KHA B;  2CWE A;  2JE5 A;  3AZJ C;  3W98 A;  5AY8 C;  2RVQ D;  5B33 C;  2ARO A;  2BYK A;  1P3P C;  3AZG D;  1ID3 B;  3MGP B;  3AZM C;  3C1B B;  1HQ3 A;  4Z5T D;  3VH6 W;  2G5H C;  3WAA A;  1P3I A;  4KGC D;  5CPI C;  1P3O D;  5B1M B;  3W96 C;  3EPK A;  3EPL A;  4X23 C;  5CP6 A;  4J8U D;  3REK C;  5DNN B;  3AYW D;  3X1U D;  4XUJ A;  3REI A;  4WU9 A;  3AZK C;  4LD9 B;  3EPJ A;  1KX3 D;  3WKJ C;  4QLC C;  1P3B D;  3AV2 B;  4M6B A;  3LJA D;  1EQZ C;  3AZJ A;  2Y2K A;  3AZG B;  3REH C;  5JRG C;  4KUD D;  2NZD D;  5B33 A;  1P3P A;  2UWX A;  4Z5T B;  4Z2M H;  3LEL D;  4KGC B;  3B6G C;  4G92 B;  1P3O B;  4J8U B;  4WU8 D;  1P3M C;  2G5I C;  5CPI A;  2BYM B;  3W96 A;  4X23 A;  3X1U B;  3REK A;  5B0Z C;  4YS3 C;  5B32 D;  2ZY3 A;  1KX3 B;  3LZ1 A;  3AZK A;  3C1C D;  5CHL B;  3MNN B;  1P3B B;  3UTB D;  3MGR C;  4CAY B;  3AZL C;  3LJA B;  3WKJ A;  2XD5 A;  4QLC A;  1ULY A;  3R45 B;  1EQZ A;  3W97 C;  4KUD B;  2FJ7 D;  2NZD B;  3O62 C;  4ZUX D;  3LEL B;  3REH A;  5JRG A;  1M19 C;  2CV5 C;  2PYO D;  5CPK C;  5AVB C;  1B67 A;  4WU8 B;  3B6G A;  1F66 D;  3AZF C;  1P3G D;  1P3M A;  4J8W C;  4WJ3 C;  4HGA B;  5B2J C;  5B32 B;  3UTA D;  5B0Z A;  4YS3 A;  5CPJ D;  2Y2G A;  3UTB B;  4R8P C;  5GXQ C;  3MGR A;  1ID3 C;  3C1B C;  3AZL A;  2Y2L A;  2FJ7 B;  5E5A D;  3KUY D;  1ZLA D;  4ZUX B;  3P5J B;  3W97 A;  3KSY A;  5B1M C;  5G49 A;  2PYO B;  5DNN C;  4H9R B;  4H9P A;  1M19 A;  2BG1 A;  2CV5 A;  2F8N A;  1F66 B;  2NQB D;  1AOI D;  3H0L C;  5CPK A;  1P3G B;  5AVB A;  3WA9 B;  3KXB D;  1H3O B;  4LD9 C;  3AZF A;  5AVC D;  3X1T D;  4J8W A;  1BH8 A;  5B31 D;  3MGS D;  3UTA B;  3X1S D;  3AV2 C;  4KHA A;  5B2J A;  4J8X C;  2RVQ C;  3AZI C;  5CPJ B;  4Z66 D;  3AL0 C;  3AZG C;  4R8P A;  3KFU G;  1TAF B;  5E5A B;  1ID3 A;  3KUY B;  1ZLA B;  3C1B A;  5BO0 B;  4KGC C;  1P34 C;  4G92 C;  1P3O C;  4J8U C;  3W99 C;  4E45 A;  5B1M A;  3MVD D;  3W98 C;  2NQB B;  1AOI B;  5DNN A;  3KXB B;  5JA4 A;  5AVC B;  3REL C;  1KX3 C;  3X1T B;  1M18 D;  3MNN C;  4LD9 A;  5B31 B;  5B40 D;  3MGS B;  3X1S B;  1W2E A;  1TZY D;  3LJA C;  4Z66 B;  3AZN D;  3AV2 A;  3AZI A;  4KUD C;  2NZD C;  3AN2 C;  3NQU B;  3AZG A;  3LEL C;  4E44 A;  4WZS B;  1P3L B;  4WNN B;  5AV8 D;  4KGC A;  5B2I D;  3KWQ B;  1P3O A;  5KDM B;  4J8U A;  4H9Q B;  3W99 A;  1PZR A;  2BYM A;  4DQY B;  4HGA C;  5B32 C;  1A7W A;  2JSS A;  5B0Y D;  1M18 B;  1KX5 D;  5BT1 C;  3REL A;  3UTB C;  1KX3 A;  5B1L D;  3MNN A;  3AZN B;  5GT3 D;  1P3B A;  3WTP D;  1BFM A;  4CAY A;  3LJA A;  3TU4 D;  2F8N K;  2FJ7 C;  3R45 A;  5B24 D;  2RIQ A;  1WWI A;  4KUD A;  2NZD A;  3AN2 A;  3AZE B;  5AV8 B;  2F8N G;  3LEL A;  4J8V D;  5DNM C;  3LZ1 C;  5B2I B;  1P3G C;  3WA9 C;  4WU8 A;  3FDD A;  4Z2M G;  4XZQ D;  2W8S A;  3UTA C;  2F8N H;  5B0Y B;  4UUZ B;  3B6F C;  5B32 A;  5CPJ C;  1KX5 B;  5B1L B;  5GT3 B;  3UTB A;  3WTP B;  3TU4 B;  5FUG B;  3UT9 D;  5E5A C;  3NQJ B;  5B24 B;  3KUY C;  2FJ7 A;  3AYW B;  3AFA D;  2ARO D;  2PYO A;  2NQB C;  2Y2M A;  5BS7 C;  3EG5 B;  4H9R A;  5DNM A;  3MGQ D;  1F66 A;  4EO5 B;  5AVC C;  1P3I D;  4XZQ B;  5AV5 D;  1P3G A;  1H3O A;  3VH6 T;  3WA9 A;  3VH5 A;  5B31 C;  3MGS C;  3X1S C;  2Y2J A;  5CP6 D;  3UTA A;  3V9R B;  4XUJ D;  5CPJ A;  3REI D;  3B6F A;  4WU9 D;  2XD1 A;  5F99 D;  3UT9 B;  2ZY2 A;  1P3L C;  1TAF A;  5E5A A;  2IO5 B;  1M1A D;  3KUY A;  1ZLA A;  5BO0 A;  5AV6 D;  3AFA B;  1U35 D;  2ARO B;  5AY8 D;  3KWQ C;  1JFI B;  3C1C B;  3MGQ B;  1P3F D;  1P3P D;  1AOI A;  2NQB A;  3AZM D;  4H9S A;  5BS7 A;  1P3I B;  3A1I A;  5AV5 B;  3KXB A;  3H0M C;  5AVC A;  5CP6 B;  3MGP C;  3AZN C;  5B31 A;  3MGS A;  3W96 D;  3X1S A;  3VH5 W;  4X23 D;  4XUJ B;  3REI B;  3REK D;  4Z66 A;  3WTP E;  5F99 B;  4NFT A;  4G91 B;  4H9N A;  3NQU A;  3AZE C;  5AV8 C;  1M1A B;  5AV6 B;  5B2I C;  1P3L A;  1U35 B;  5AY8 B;  1WWS A;  3AZH D;  3KWQ A;  5KDM A;  1B6W A;  1P3F B;  1P3P B;  1HTA A;  4H9Q A;  3AZM B;  1KX4 D;  5B32 G;  3B0B A;  5B0Y C;  1KX5 C;  1BH9 B;  3B6G D;  1M18 A;  5GT3 C;  4Z5T C;  3WTP C;  4X23 B;  2Y2H A;  3MGP A;  5GT0 D;  3REK B;  3AZN A;  5B24 C;  1R4V A;  3B0C W;  3LZ0 D;  5B0Z D;  3AYW C;  3X1U C;  3AZE A;  5AV8 A;  3AZH B;  5B2I A;  4EO5 C;  1P3B C;  4XZQ C;  1KX4 B;  3W97 D;  3O62 D;  1M19 D;  3B6G B;  5B0Y A;  4UUZ A;  1KX5 A;  4UPK A;  5GT0 B;  5C3I B;  4YM6 D;  3AV1 D;  5GT3 A;  3UT9 C;  4Z5T A;  3WTP A;  4WU8 C;  3LZ0 B;  5FUG A;  5B0Z B;  5B2J D;  3NQJ A;  5AV9 D;  5B24 A;  3MVD B;  3A6N D;  3AYW A;  2HIO D;  3X1U A;  3VH6 A;  4R8P D;  5GXQ D;  3C1C C;  3MGQ C;  5B40 B;  2Y2I A;  5AV5 C;  3W97 B;  1TZY B;  3O62 B;  4H9O B;  4XZQ A;  3REJ D;  1T3U A;  1P3K D;  4ZUX C;  4YM6 B;  1Q9C A;  3AV1 B;  5F99 C;  2PYO C;  1BH8 B;  2J8P A;  4G91 C;  1P3A D;  3X1V D;  1F66 C;  3UT9 A;  5B2J B;  1M1A C;  1N1J B;  5AV9 B;  3A6N B;  3B0D B;  5BNX B;  5AV6 C;  3AV2 D;  1U35 C;  4J8X D;  3AZI D;  5GSU D;  2HIO B;  3AFA A;  4R8P B;  5GXQ B;  4CSR B;  1P3F C;  4JJN D;  1JFI A;  3C1C A;  3MGQ A;  5AV5 A;  1P34 D;  5BNV B;  3REJ B;  1S32 D;  3W99 D;  1ZLA C;  1P3K B;  3W98 D;  5JA4 B;  4ZUX A;  1F1E A;  2DQN C;  4J8V B;  2YFW B;  1P3A B;  3REL D;  5F99 A;  3X1V B;  1AOI C;  4H9S C;  4NE3 A;  2Y2Q A;  3MNN D;  3KXB C;  1HQ3 D;  1M1A A;  4J8X B;  3AZI B;  5GSU B;  3AZH C;  3WAA D;  3X1T C;  5AV6 A;  1U35 A;  5AY8 A;  1KX4 C;  2YFV B;  4Z66 C;  4JJN B;  3AN2 D;  1P3F A;  3AZM A;  1P34 B;  1S32 B;  1BH9 A;  3W99 B;  5GT0 C;  5C3I C;  3W98 B;  3AZJ D;  3LZ0 C;  4ZBJ B;  2BYK B;  2ZM5 A;  3MVD C;  3REL B;  5B33 D;  1HQ3 B;  5BT1 D;  3WAA B;  4DRA A;  1M18 C;  2HUE B;  5B40 C;  3AZH A;  3X1T A;  1TZY C;  5CPI D;  3AN2 B;  1KX4 A;  4WU9 B;  3IP4 C;  4NE5 A;  1KU5 A;  5DNM D;  3LZ1 D;  4AWL B;  3AZK D;  4YM6 C;  3AV1 C;  3EPH A;  3WA9 D;  3WKJ D;  5GT0 A;  3AZJ B;  4QLC D;  4WNN A;  5AV9 C;  3A6N C;  1EQZ D;  3LZ0 A;  3B0D C;  5B33 B;  3B6F D;  3MVD A;  2HIO C;  3REH D;  5JRG D; 
#chains in the Genus database with same CATH homology
 2ZY4 A;  4WV4 B;  5CPI B;  5B1L C;  3W96 B;  5B40 A;  1P3M D;  1TZY A;  3F6T A;  3TU4 C;  3REJ C;  3O62 A;  4H9O A;  1P3K C;  4NE6 A;  5DNM B;  3LZ1 B;  3AZK B;  4YS3 D;  2F2A C;  2FFF B;  2ZY5 A;  4DRB A;  4J8V C;  4YM6 A;  3WKJ B;  4QLC B;  3AV1 A;  1P3A C;  3X1V C;  3MGR D;  3AZL D;  1EQZ B;  2LY8 A;  3H0R C;  1N1J A;  5GSU C;  5AV9 A;  3B6F B;  3A6N A;  2VQR A;  3REH B;  5BNX A;  3VH5 T;  5JRG B;  2DF4 C;  2HIO A;  2Y2O A;  2JCH A;  3A1K A;  4JJN C;  2L5A A;  2CV5 D;  4CSR A;  5GXQ A;  2F8N D;  5CPK D;  1Z2C B;  5AVB D;  1P3M B;  1P3L D;  5B1L A;  3AZF D;  1S32 C;  4J8W D;  5BNV A;  3TU4 A;  3REJ A;  3KWQ D;  4YS3 B;  2IO5 C;  1P3K A;  4ZBJ C;  3AFA C;  2ARO C;  3MGR B;  3AZL B;  4J8V A;  2YFW A;  1P3A A;  1HQ3 C;  3X1V A;  2Y2P A;  3MGP D;  3WAA C;  3C1B D;  1P3I C;  1ID3 D;  2HUE C;  5G49 B;  5GSU A;  4J8X A;  5CP6 C;  5B31 G;  4H9P B;  1M19 B;  5B1M D;  3B0C T;  4H9N B;  2CV5 B;  2F8N B;  5CPK B;  2YFV A;  4XUJ C;  5AVB B;  5DNN D;  3REI C;  4WU9 C;  4JJN A;  3V9R A;  3AZE D;  2Y2N A;  3AZF B;  4AWL C;  1P34 A;  4J8W B;  4LD9 D;  1S32 A;  4KHA B;  2CWE A;  2JE5 A;  3AZJ C;  3W98 A;  5AY8 C;  2RVQ D;  5B33 C;  2ARO A;  2BYK A;  1P3P C;  3AZG D;  1ID3 B;  3MGP B;  3AZM C;  3C1B B;  1HQ3 A;  4Z5T D;  3VH6 W;  2G5H C;  3WAA A;  1P3I A;  4KGC D;  5CPI C;  1P3O D;  5B1M B;  3W96 C;  3EPK A;  3EPL A;  4X23 C;  5CP6 A;  4J8U D;  3REK C;  5DNN B;  3AYW D;  3X1U D;  4XUJ A;  3REI A;  4WU9 A;  3AZK C;  4LD9 B;  3EPJ A;  1KX3 D;  3WKJ C;  4QLC C;  1P3B D;  3AV2 B;  4M6B A;  3LJA D;  1EQZ C;  3AZJ A;  2Y2K A;  3AZG B;  3REH C;  5JRG C;  4KUD D;  2NZD D;  5B33 A;  1P3P A;  2UWX A;  4Z5T B;  4Z2M H;  3LEL D;  4KGC B;  3B6G C;  4G92 B;  1P3O B;  4J8U B;  4WU8 D;  1P3M C;  2G5I C;  5CPI A;  2BYM B;  3W96 A;  4X23 A;  3X1U B;  3REK A;  5B0Z C;  4YS3 C;  5B32 D;  2ZY3 A;  1KX3 B;  3LZ1 A;  3AZK A;  3C1C D;  5CHL B;  3MNN B;  1P3B B;  3UTB D;  3MGR C;  4CAY B;  3AZL C;  3LJA B;  3WKJ A;  2XD5 A;  4QLC A;  1ULY A;  3R45 B;  1EQZ A;  3W97 C;  4KUD B;  2FJ7 D;  2NZD B;  3O62 C;  4ZUX D;  3LEL B;  3REH A;  5JRG A;  1M19 C;  2CV5 C;  2PYO D;  5CPK C;  5AVB C;  1B67 A;  4WU8 B;  3B6G A;  1F66 D;  3AZF C;  1P3G D;  1P3M A;  4J8W C;  4WJ3 C;  4HGA B;  5B2J C;  5B32 B;  3UTA D;  5B0Z A;  4YS3 A;  5CPJ D;  2Y2G A;  3UTB B;  4R8P C;  5GXQ C;  3MGR A;  1ID3 C;  3C1B C;  3AZL A;  2Y2L A;  2FJ7 B;  5E5A D;  3KUY D;  1ZLA D;  4ZUX B;  3P5J B;  3W97 A;  3KSY A;  5B1M C;  5G49 A;  2PYO B;  5DNN C;  4H9R B;  4H9P A;  1M19 A;  2BG1 A;  2CV5 A;  2F8N A;  1F66 B;  2NQB D;  1AOI D;  3H0L C;  5CPK A;  1P3G B;  5AVB A;  3WA9 B;  3KXB D;  1H3O B;  4LD9 C;  3AZF A;  5AVC D;  3X1T D;  4J8W A;  1BH8 A;  5B31 D;  3MGS D;  3UTA B;  3X1S D;  3AV2 C;  4KHA A;  5B2J A;  4J8X C;  2RVQ C;  3AZI C;  5CPJ B;  4Z66 D;  3AL0 C;  3AZG C;  4R8P A;  3KFU G;  1TAF B;  5E5A B;  1ID3 A;  3KUY B;  1ZLA B;  3C1B A;  5BO0 B;  4KGC C;  1P34 C;  4G92 C;  1P3O C;  4J8U C;  3W99 C;  4E45 A;  5B1M A;  3MVD D;  3W98 C;  2NQB B;  1AOI B;  5DNN A;  3KXB B;  5JA4 A;  5AVC B;  3REL C;  1KX3 C;  3X1T B;  1M18 D;  3MNN C;  4LD9 A;  5B31 B;  5B40 D;  3MGS B;  3X1S B;  1W2E A;  1TZY D;  3LJA C;  4Z66 B;  3AZN D;  3AV2 A;  3AZI A;  4KUD C;  2NZD C;  3AN2 C;  3NQU B;  3AZG A;  3LEL C;  4E44 A;  4WZS B;  1P3L B;  4WNN B;  5AV8 D;  4KGC A;  5B2I D;  3KWQ B;  1P3O A;  5KDM B;  4J8U A;  4H9Q B;  3W99 A;  1PZR A;  2BYM A;  4DQY B;  4HGA C;  5B32 C;  1A7W A;  2JSS A;  5B0Y D;  1M18 B;  1KX5 D;  5BT1 C;  3REL A;  3UTB C;  1KX3 A;  5B1L D;  3MNN A;  3AZN B;  5GT3 D;  1P3B A;  3WTP D;  1BFM A;  4CAY A;  3LJA A;  3TU4 D;  2F8N K;  2FJ7 C;  3R45 A;  5B24 D;  2RIQ A;  1WWI A;  4KUD A;  2NZD A;  3AN2 A;  3AZE B;  5AV8 B;  2F8N G;  3LEL A;  4J8V D;  5DNM C;  3LZ1 C;  5B2I B;  1P3G C;  3WA9 C;  4WU8 A;  3FDD A;  4Z2M G;  4XZQ D;  2W8S A;  3UTA C;  2F8N H;  5B0Y B;  4UUZ B;  3B6F C;  5B32 A;  5CPJ C;  1KX5 B;  5B1L B;  5GT3 B;  3UTB A;  3WTP B;  3TU4 B;  5FUG B;  3UT9 D;  5E5A C;  3NQJ B;  5B24 B;  3KUY C;  2FJ7 A;  3AYW B;  3AFA D;  2ARO D;  2PYO A;  2NQB C;  2Y2M A;  5BS7 C;  3EG5 B;  4H9R A;  5DNM A;  3MGQ D;  1F66 A;  4EO5 B;  5AVC C;  1P3I D;  4XZQ B;  5AV5 D;  1P3G A;  1H3O A;  3VH6 T;  3WA9 A;  3VH5 A;  5B31 C;  3MGS C;  3X1S C;  2Y2J A;  5CP6 D;  3UTA A;  3V9R B;  4XUJ D;  5CPJ A;  3REI D;  3B6F A;  4WU9 D;  2XD1 A;  5F99 D;  3UT9 B;  2ZY2 A;  1P3L C;  1TAF A;  5E5A A;  2IO5 B;  1M1A D;  3KUY A;  1ZLA A;  5BO0 A;  5AV6 D;  3AFA B;  1U35 D;  2ARO B;  5AY8 D;  3KWQ C;  1JFI B;  3C1C B;  3MGQ B;  1P3F D;  1P3P D;  1AOI A;  2NQB A;  3AZM D;  4H9S A;  5BS7 A;  1P3I B;  3A1I A;  5AV5 B;  3KXB A;  3H0M C;  5AVC A;  5CP6 B;  3MGP C;  3AZN C;  5B31 A;  3MGS A;  3W96 D;  3X1S A;  3VH5 W;  4X23 D;  4XUJ B;  3REI B;  3REK D;  4Z66 A;  3WTP E;  5F99 B;  4NFT A;  4G91 B;  4H9N A;  3NQU A;  3AZE C;  5AV8 C;  1M1A B;  5AV6 B;  5B2I C;  1P3L A;  1U35 B;  5AY8 B;  1WWS A;  3AZH D;  3KWQ A;  5KDM A;  1B6W A;  1P3F B;  1P3P B;  1HTA A;  4H9Q A;  3AZM B;  1KX4 D;  5B32 G;  3B0B A;  5B0Y C;  1KX5 C;  1BH9 B;  3B6G D;  1M18 A;  5GT3 C;  4Z5T C;  3WTP C;  4X23 B;  2Y2H A;  3MGP A;  5GT0 D;  3REK B;  3AZN A;  5B24 C;  1R4V A;  3B0C W;  3LZ0 D;  5B0Z D;  3AYW C;  3X1U C;  3AZE A;  5AV8 A;  3AZH B;  5B2I A;  4EO5 C;  1P3B C;  4XZQ C;  1KX4 B;  3W97 D;  3O62 D;  1M19 D;  3B6G B;  5B0Y A;  4UUZ A;  1KX5 A;  4UPK A;  5GT0 B;  5C3I B;  4YM6 D;  3AV1 D;  5GT3 A;  3UT9 C;  4Z5T A;  3WTP A;  4WU8 C;  3LZ0 B;  5FUG A;  5B0Z B;  5B2J D;  3NQJ A;  5AV9 D;  5B24 A;  3MVD B;  3A6N D;  3AYW A;  2HIO D;  3X1U A;  3VH6 A;  4R8P D;  5GXQ D;  3C1C C;  3MGQ C;  5B40 B;  2Y2I A;  5AV5 C;  3W97 B;  1TZY B;  3O62 B;  4H9O B;  4XZQ A;  3REJ D;  1T3U A;  1P3K D;  4ZUX C;  4YM6 B;  1Q9C A;  3AV1 B;  5F99 C;  2PYO C;  1BH8 B;  2J8P A;  4G91 C;  1P3A D;  3X1V D;  1F66 C;  3UT9 A;  5B2J B;  1M1A C;  1N1J B;  5AV9 B;  3A6N B;  3B0D B;  5BNX B;  5AV6 C;  3AV2 D;  1U35 C;  4J8X D;  3AZI D;  5GSU D;  2HIO B;  3AFA A;  4R8P B;  5GXQ B;  4CSR B;  1P3F C;  4JJN D;  1JFI A;  3C1C A;  3MGQ A;  5AV5 A;  1P34 D;  5BNV B;  3REJ B;  1S32 D;  3W99 D;  1ZLA C;  1P3K B;  3W98 D;  5JA4 B;  4ZUX A;  1F1E A;  2DQN C;  4J8V B;  2YFW B;  1P3A B;  3REL D;  5F99 A;  3X1V B;  1AOI C;  4H9S C;  4NE3 A;  2Y2Q A;  3MNN D;  3KXB C;  1HQ3 D;  1M1A A;  4J8X B;  3AZI B;  5GSU B;  3AZH C;  3WAA D;  3X1T C;  5AV6 A;  1U35 A;  5AY8 A;  1KX4 C;  2YFV B;  4Z66 C;  4JJN B;  3AN2 D;  1P3F A;  3AZM A;  1P34 B;  1S32 B;  1BH9 A;  3W99 B;  5GT0 C;  5C3I C;  3W98 B;  3AZJ D;  3LZ0 C;  4ZBJ B;  2BYK B;  2ZM5 A;  3MVD C;  3REL B;  5B33 D;  1HQ3 B;  5BT1 D;  3WAA B;  4DRA A;  1M18 C;  2HUE B;  5B40 C;  3AZH A;  3X1T A;  1TZY C;  5CPI D;  3AN2 B;  1KX4 A;  4WU9 B;  3IP4 C;  4NE5 A;  1KU5 A;  5DNM D;  3LZ1 D;  4AWL B;  3AZK D;  4YM6 C;  3AV1 C;  3EPH A;  3WA9 D;  3WKJ D;  5GT0 A;  3AZJ B;  4QLC D;  4WNN A;  5AV9 C;  3A6N C;  1EQZ D;  3LZ0 A;  3B0D C;  5B33 B;  3B6F D;  3MVD A;  2HIO C;  3REH D;  5JRG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...