3WTTA

Crystal structure of the complex comprised of phosphorylated ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 22
structure length 119
sequence length 119
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wttA00
3VD0A 3IGLA 4QO1B 1H9DA 4L0ZA 2AC0A 5G4NA 4IBYA 4IBZA 4IBUA 3D09A 2AHIA 3WTYA 3Q01A 3US0A 2X0UA 1T4WA 3KMDA 4LO9A 4IBWA 4GUQA 5KBDA 1IO4C 4AGLA 4XR8C 5ABAA 1EAQA 2PCXA 5AOLA 2BIPA 5BUAA 5A7BA 2J1ZA 1YCSA 2J20A 2GEQA 5AOJA 2IOOA 3Q05A 4G82A 4LOFA 5LAPA 4AGOA 4KVPA 3EXJA 2X0VA 3D06A 2IOMA 2J1WA 2FEJA 2BIMA 3KZ8A 4AGQA 3VD2A 2BIQA 2X0WA 3US1A 4GUOA 1KZYA 2BIOA 1CMOA 5G4MA 2WGXA 4A63A 3WTWA 3QYNA 2J1XA 3IGKA 5G4OA 3WTUA 5ECGA 2J6WA 1GZHC 4MZIA 2IOIA 3EXLA 2BINA 2J1YA 4AGNA 2XWCA 4IBQA 2H1LM 2YBGA 1HJBC 1GZHA 2VUKA 4MZRA 3QYMA 4IJTA 2OCJA 4IBTA 4LOEA 1HU8A 5AOMA 3WU1A 4G83A 4IBVA 3WTSA 3ZMEA 5LGYA 1UOLA 2XWRA 5AOIA 1LJMA 2MEJB 2J21A 4L18A 3TS8A 1CO1A 3D05A 3Q06A 4IBSA 5AB9A 3WTTA 2ADYA 4HJEA 3WTXA 1E50A 1EANA 4L0YA 2RMNA 3D08A 3WTVA 5AOKA 2ATAA 1EAOA 1TSRA 4AGPA 3VD1A 3D0AA 4AGMA 1HJCA 1TUPA 3D07A 2P52A
chains in the Genus database with same CATH superfamily
3F04A 4F24A 4QXTB 5C0CA 5I0ZA 2DM4A 4I18B 4CSSA 4NNPH 4KKLC 3VMPA 4MRCA 1WZ1L 4ABUA 5A6IA 4NRXA 4PJ7B 4M1CC 4TULL 3K8LA 4CGUB 4PB9L 4U2ZA 4DN4L 4GEJA 2Y0SA 3MGOA 3DK0A 3ZHKA 4BM7A 3T6WA 3IJ9A 5CSZB 5GS1A 4A6YB 3LX9A 1EO8H 1MCJA 4DOHB 2F8IA 4D3CH 4K3DH 3ATBA 3VYPA 4DO4A 1Z9PA 3CFEA 3Q9QA 2AKRA 3K72A 4U1GC 4IHBA 4ZS6D 1F90L 3VGDA 4S1SH 2PPEA 1A7RH 3OTTA 4PJGB 4Z8FH 2YGVA 1T5WA 5FF6A 1F18A 4AJ0A 3TA3C 1X5FA 2WN3A 4FGMA 4QRPD 3SDAC 4KDVA 3SIKA 5IOPB 1LEIB 5J1AB 2AANA 3OLDA 2DLFL 3MJWA 2O72A 2DEYX 4JFVA 5L4IA 5BV7C 6FABH 1FH2A 3GJFA 1BBDH 3EJSA 4GAYB 1CTNA 4IKKA 1KXTB 2G5BB 4YXHL 3VSVA 4L3EB 5GGTA 43CAA 5L2KD 3TV3H 5E51A 1Q9WB 3S2AA 1Y0LB 1ZHKA 2A0LC 3X11A 4NZDA 3SE3A 3EHBC 3MRCB 4U3CA 5E5LA 3S3JA 3TBYB 3DXAA 4PY7A 3VFPA 2HJLB 5E5MB 1BVNP 4XZUB 4OJFH 2WZ6A 4E36A 3C8KA 1J1XH 2Y06L 1I8LA 4UIKH 2ICWI 2WY3B 3WTUA 4BQ6A 1M4KA 3VTMA 4EN3B 3F12A 4PRAB 1NSNH 5KVEH 1UVQA 4FYTA 3II2A 1YEIH 3LPWA 5FYKE 2KYIA 3H3KA 4GKZB 2Y2YA 4LQFH 3W82A 1TQCB 4PLKC 1MZZA 4UBDD 2HTLD 2X09A 3GZOA 4XODA 3ESNA 3W1ZA 4TQ8A 1E9QB 2GSIB 4GRWE 4X83A 1ZVHA 3SDDB 2AV7A 2WYTA 3DSNB 5BO0D 4X4MA 5AKSA 1K5NB 2IEPA 3L7FA 4HXBL 2V7NA 3S96A 4LGPB 1L3NA 4UCFA 2DQFB 3Q48A 2HFFB 1T1YA 3TCXA 5T1KD 2K70A 3LH9A 1QBLH 2JXMA 2NCMA 4QOKA 3SE4A 4RRPA 4J28A 4JFXB 4WI4A 1FC2D 2Z92B 4DP6X 3NRQA 1PAMA 5DMJB 5E9DD 1U2HA 4X99B 3TEZA 4B9PA 1BQ5A 1OCOB 1DJYA 2WQUA 3PWNB 3IJHA 3TPUB 1KSRA 1YEJL 2GTZB 1MAML 3BRFA 1AKPA 2AVFA 1IGIL 4X9BA 4BFIA 2EKJA 4U4IA 1GC1C 4ODXA 4GG6B 4AENB 1ZIBA 1R3KB 2NXYC 2XBZA 4TXVB 1X7TA 3O6ML 1D3CA 1AO7B 3CHRA 3WG7B 4D0BA 4RRPM 2XHNA 4QHKJ 2V2WA 4ZDHB 2DWXA 2JB5H 3FOLB 1PD1A 1A9BA 3AQXA 4JX0A 3APFA 1L5GB 4F2MB 5KZCD 1WBYB 2Z31A 4G1MB 2E3VA 4PV8B 1G0XA 4F8LA 4HUXA 3VXMD 4BKTC 2PR9A 2VDPH 2NY6B 5B1BB 5SWQA 1FVEA 3KWTA 4XNZB 1J8HA 4JFFD 4HZLB 2NX5D 4DNLA 1KTLB 1SDDA 3IGAB 5GS3A 1I7RA 5F97E 5ITBH 5K9OA 3MA7A 3HAEB 3AGVA 4CVUA 1XCTA 1IMHC 2O1AA 3GLAA 4DP5X 5D8JL 4ALAH 4GO8A 1AJ7H 4GFTB 4KK9C 4XO4A 3BLKA 4XMPH 5D2LF 2BMKA 4ZW7A 1E9OA 2YMOA 3C2AL 3C2SA 3HI5L 4R7LA 4Q74A 2APBA 1UA3A 2VDLH 4KHXH 1ADQL 2IDTA 4BZYA 1AQDA 4JS7A 2IOMA 2J44A 4P2QD 4YN3A 1PSKL 1I1AD 4P46D 1ZTXH 2IPUG 1ONQB 3FB6B 2E8YA 3VVVA 1J9QA 1FNAA 3O8XD 3Q1SL 3UYPA 5JORB 1NGWA 4PTUB 5ADOH 1UWFA 1SMOA 2Z7UA 3A47A 4AH2B 1IAMA 4ELMB 5HVFB 1HK6A 2EEXA 2V2XB 4PGDB 2FB4H 5H37A 2CSPA 2IBZY 2RACA 2W94A 1TO4A 4IKNA 5EF3A 4MTMA 3ZZSA 3H53A 4ETQB 1N7MH 3IWVA 1AGBB 4HGWB 1K5WA 3L3HB 1IFHH 3BH9A 3KEDA 3QJUB 3ECQA 4M8UA 1NBYB 1BZ8A 5E2WL 1QHQA 4HKJA 5HHVH 1R5IB 5FYKU 2XN9E 4R4BA 1JUFA 3HHRB 3QJRB 5DS2A 1JXKA 1MJJA 2WUBH 4OGAD 5JIKA 4ZPTA 3CMOL 2OMWB 3RL1A 3BVVA 1IC1A 5DEJA 3MROB 4WWNA 1PJ9A 3ZTDC 2X70A 4L4TE 4L05A 5C3LD 4G8GD 2IGFH 2E56A 3DVNB 4MQXC 4PLOB 5C7XL 4XX1G 4NO2B 1FJ1A 5SWZB 2FX8H 3MV11 4J4PA 1ILSA 3QDGD 3BEVA 3WFBL 4YJZL 1M2VB 4IBSA 2HH0L 3NT0A 4A1RA 1KFGA 4W4OC 4JE4B 1EANA 3CC1A 1ORSA 3W2DH 1GKEA 1VFBA 4J6RL 2OJ1A 1AE6H 4P0DA 3CFQA 4RQQB 2ATAA 3KWVA 3N5AA 4YDZA 3TIEA 5F6IB 2QMJA 3PL6D 2FQGA 4HSQA 1VB9A 1DEEA 4JVUA 5IQ9B 4RDBA 1QR1B 4Z7UE 2VDRB 5IG7A 4P5RA 5B8CC 4XVSH 1NUDA 4OZFH 4UIMB 5FGRA 2NY2C 1DBML 2R4RH 1IU1A 4Y19E 5JDJA 3RUGE 3P9MB 5DRZB 5EZPA 1CT8B 3AADB 5I17B 1X9UA 3ZLQC 1EDQA 2R0WL 4RSVA 4U1JA 2H0EA 4MCZB 4E5XA 5KVDE 1KCKA 5BUGA 2BOCA 2EIZB 1KXQA 3D48R 3MJ8A 1BP3B 3QZMA 2DM7A 3FUKA 3MODH 1FHNA 1HKFA 2DOCA 4DEWA 3S0PA 1FNGB 1A9EA 4QXVA 4E42A 3ARFC 3MLUH 4KY1H 1A7BA 1P7BA 4TQPA 1WPCA 2CMRH 3CVHH 3H7BB 5D1ZC 3VJ6A 2ZAIA 1V55B 4PJHF 1OM9A 1S9XA 1RK0A 1KTRL 4OLVH 2COQA 1UD5A 1FNLA 4MNQD 1XV8A 2OR7A 4PJBE 3AXLA 2FO4B 3QA3A 5HYJD 3W9EB 1PFCA 2X0WA 1UJTA 3ARDA 4XBEH 4KKNA 1YJDL 2Q8AL 2AERT 2EO1A 4HFUH 1ODUA 2HPTA 1TU2B 1IQDA 3ZDYB 4JFDD 4K23L 4KO7A 4CMMA 3RVUC 1SOQA 4FQHA 3CLWA 3BDBA 1BECA 4NM4L 1ZLWK 4DK3A 3MJ9H 3IVKB 3MACL 1XGQA 4IYKA 4Y16B 1INEL 3IFNL 4GXUN 1UEYA 4CU7A 3QO1B 4M00A 4WSGA 1KELH 4ZUSA 5JHDE 2Y7SA 3EFOB 1OE1A 3DX3A 4F7PA 1T1XB 4AZUA 1THCA 5F6HJ 5BW7C 1EGJL 5D1QB 1EPFA 2GHZA 3EYFB 3TT1H 1OT4A 2AMGA 2CKBL 4I0PC 3EOBB 3ZIMA 2W9DL 3IPFA 4DZ8A 3DVGB 1U4EA 2V3EA 1KYFA 3GI9L 3LJ3A 5EBMA 1AR1B 4FYQA 1A25A 1KLFB 4OCRL 3ZKQD 1W8OA 3ETBJ 3B9VA 3FUEA 2K4WA 3I6LE 5ISZB 1MQ8A 1OCCB 3B2XA 3ZJAA 4IMKA 1BVZA 5TDNA 2A6IB 4OT1H 4K73A 4PI2A 4XMLL 5DJXB 1B90A 2UVEA 4ZFFB 2AQRA 1NFDA 3HMWH 2EDXA 4Q0XH 4LCIH 1FG9C 1CFNB 2FR4B 3MNZA 1A3ZA 2I07A 4PGCB 2ZP9A 3NJHA 2NCEA 3VM7A 5LDUA 1GGCL 4UT9L 1KV3A 4XPGH 1JHKH 1YAIA 2VNCA 2WINB 2Q2LA 4JO3L 3F7RA 3O6FB 4LSQH 3OHXB 4Q6IA 3WJMB 4WHCA 5I8CA 4IBYA 1QA9A 2K9UA 2JK5A 3KM2A 4LCWD 1VPOH 2VWEE 3B8YA 2V5SA 4WTZG 5EFIB 5D4JA 5IHWA 3D2TA 1O5DT 3LKPA 5PCYA 3JUZA 4AK2A 3TJEL 1B6DA 4GMSH 1BHGA 5J5EA 1MWAH 1Z3RA 3EOYG 1WQVT 1OGTB 3WBDA 4JMXA 1NGPL 4JG1H 5CJXA 2VTFA 3MRMA 4HX1B 1MHHB 2A5UA 2DLIA 1WAPA 4LLYA 5DC2A 4HOWA 4PJEE 5BXFA 3WXWH 1MG2C 2Q76B 2XFXA 2ZSVB 4XP9L 5D7JC 5B1AB 1WS8A 2F7RA 4IRZL 3QQDA 4G11A 2VMFA 5F96L 5HHMB 3MLSL 3IMTA 5CF3A 1SN2A 3QDAA 1YNTB 1YRKA 1ZKAA 4NRYB 5BZWA 5HDBB 1CF1A 1XD0A 3ASOB 3KXFB 2K3HA 4PBWD 3RZCC 1J11A 2LOEA 4KH2A 4D7BA 3I3BA 1WFOA 1OAUH 4R3SB 4JDZA 4F33A 4NQDE 3L4TA 3U7WL 5C8JB 2GJRA 2ESVD 1WFMA 3HRZB 4PJFF 1OK8A 5KVGE 1IV8A 1G43A 3KAAA 4E41D 2FLMA 5LCVA 2FLBT 2DWYA 3EO1B 4PCKA 3BH4A 4WI3A 3E8VA 4HOZA 5IIEB 3KWUA 1NJ9A 2J7LA 2E59A 3N6YA 2YBGA 4JKWA 2CO7B 4YC2C 4MZRA 3GUFA 4HUUB 5B1CA 2GITA 3VI3A 4AEIH 2BY1A 5F1SA 1XF4B 2DQEH 2GJ6A 1A0QH 3QDJB 4ICXA 4ICWA 3U30C 4IS6B 5DZAA 5J6HA 2Y36H 4XMZA 4XOEA 4N0UE 1EMTL 1V7NH 1LVEA 4GKOA 5JHLL 1G0YR 1GOGA 4MAZA 3FT9A 3VGHA 4OTXL 5GRJH 5BVJA 5C97A 4BSWA 2XOTA 4V2BA 2DIEA 4LE8A 1OP3H 4I4WB 4N0FA 1T5XB 2WHVA 2CDEA 2TSAA 2UXFA 3BP7B 4RWYH 5K9QG 3EUUA 3V4LA 3PUCA 5E03A 5I28A 1WJ3A 4HS8H 2Q87A 2KKQA 4MJIE 1KB9K 2YRZA 3N43B 2ZYRA 1YSOA 2G75B 3FQWB 4J1UA 3L13A 4RETB 2CDGB 3W81A 4JDEA 2NUPA 2HTKD 3KPMA 3I6GA 1M05B 1P5UC 2FJGA 3MBEA 2AJVL 4RGNE 1JGEA 1LO4L 3TT3L 3R7QA 1PD0A 3U0WL 3RGVC 4X8GA 3LHAA 5EU5A 2AC0A 3DX9B 2GC7C 1F2QA 2UUDH 3RX7A 4R5XA 3RVXC 3WUWB 4Y1AE 3Q0HA 4OGYL 4B9KC 2IQAB 5FM8A 5H35B 4NQCA 3LNHA 3WFHB 2I26N 2IAAC 4K2UL 2B59B 3O0RH 2VN5A 3Q9PA 4RMSA 1NTDA 1MCIA 4WFFD 1G9NH 4PRID 4YGVB 3SKMB 4D8OA 3PS6A 1OSZB 2BOBB 3CG8A 4FQXA 5E23A 1R24A 3FU6A 4LKXB 4AI7A 3DX6A 5J9PB 2VDMH 1R5VA 2DQGL 2R7EB 1I7UA 4YHPA 1WZLA 4UM9B 3U9WA 4QT5A 1LM8V 1SXZA 2OCFD 3ULUH 2YAQA 1U8MA 4G1EA 3PLYA 3P9LA 3K5RA 4OCSH 5IVXF 4LF3B 4Y4KB 5DFAA 3H9SE 4PSPA 3WDHA 3T65B 2IWFA 3QG7L 1PEWA 5FEBA 2KLRA 3VD2A 4BFOA 2FECL 3HPLB 4XI5D 3X17A 2B5IB 3P4MB 2BNQD 4JPWH 1I85C 3S8FB 3ECBA 5LN4A 5ANMA 2DI9A 1CMOA 1SF5A 1UYWL 2C7FA 1EEZA 2ZOKB 3MGTB 3RY6A 3OGCA 2FYYA 3DOHA 4G6AC 2OL3L 1MFAH 4CDHA 4LCUB 4MAYD 4OQTL 5CSGA 2ZPKH 1VGEH 3PV6A 4AGNA 2O6PA 4HEPA 3UZQA 3AWEA 4R4FL 5D70L 4MGXA 3CZEA 5AW1B 5T3XH 3UTZB 4KK8C 4ZFOL 2NDGA 5I1EH 2YUWA 2Y1YA 4M62L 1SFDA 2B1HL 2DWTA 3FSAA 3TNMA 3ARBD 4YUEH 2OS7A 3MMEA 1QSEA 1HH6A 4Y2DD 5D96B 5F7MC 3ULVD 4M43H 3IRPX 3M46A 4MJ6A 5JW5A 1PD6A 2QGCA 2H4EA 4LPUA 5IB2A 5E8NA 4UV4H 5DR5L 3CZSA 1HESA 3IKCB 3ASNB 5DJ6A 1KDJA 3JQOB 4PG9A 1CL7L 4HJUA 1FE8H 4UT6A 3GI8L 1DBAL 4KTYA 4A7VA 3KYMA 1QKZL 4K4KA 3CHQA 5D5ME 1UVQB 3O2DH 2LFEA 4MYWB 2A9NL 1EHLH 5HYIA 3EH3B 2OZ4L 5I1HH 4J7RA 1BM3L 1WFJA 5AW4B 1OXYA 3K74B 3CU7A 4JFTA 5F1OB 2AV7B 1MQKH 1RZQA 4G5AA 3AY2A 3LD8B 4X6EB 1GR7A 3RTQA 5EEUA 1EAJA 4NGHH 3BQVA 4XPTL 2V7NB 2NT1A 1DSYA 2Y24A 3CSTA 4WO4B 1AKJB 2YHGA 4AZ8A 2WPGA 3MBWB 4QOKB 1O7VA 3WJJA 1L3WA 2I9LB 2JKIS 4QF1A 5C0EB 2NZIA 2YD9A 2G9KA 4GW4B 5C08B 5EU7C 3AROA 4XH2A 5BJTA 4DHLA 1GZPB 5JW4Q 5GSVA 5HPMB 4NN5B 3NSYA 2BWIA 2K45A 1M7IB 4JFEE 4NFBA 1OSPL 4RDQF 2RR3A 1AIZA 5AVVB 3U6RB 2D03H 5C0BD 3MOBL 2P5WA 4ZNEA 5KBNC 4DN3H 1XGYH 4P23B 3K0WA 2EUWA 4IHOA 3RVWC 3VSQA 1RK1A 3JWOC 5JIIA 1HKLH 3QULB 4P57A 2IV8A 5DA0B 4U1NB 1MI5A 2DIBA 2O5YH 1FYHB 1C16A 4WU5B 5AOZA 4Q2ZA 2KZBA 3O2DA 5TDPB 2ED8A 4MMZB 3RA7H 1NGQH 1XBRA 2N7BA 2VR9A 3KL3A 5DVLA 1FL6A 5I9QC 1K4CB 4DGIL 3HS8A 1OAZH 3RY5A 1LEGB 5MEOB 4GG8A 1XIWB 4A7QA 3IDMA 1WG3A 4NPJA 4FI8A 4NLAA 5T5NF 1XCTB 3DX1A 1LGVA 3H8NA 2R2HB 3E3QC 2EH8L 4NI3A 5IW1B 3C6LB 4BFNA 2H1LM 2VDOH 2R69H 4CVXA 3R0MA 3SDYH 1RFDL 3ABZA 2JB6B 4WHDA 4LSTL 3SPIA 1LMIA 3ATDA 3CH1B 4XN2A 4N5ED 4D9QE 5MI0B 1B0GB 2EDDA 3ARWA 4LIQH 4Z23A 1BGXH 2YD3A 3PYCA 4KUCF 3SPCA 1OPGL 2AXJA 2EIDA 1IGML 1AH1A 1HZHH 3WO3B 4H8QA 1UTDA 4Z0XA 2WCSA 2CAKA 4ZS7H 4BQ9A 4A2DA 5ID0B 4LKCA 3OGOE 4MX7B 1ILUA 1I8KA 4JFWA 4ZW8A 5DHYB 1TTAA 2A83A 2L3BA 3TS8A 3GJFK 4HC1A 4OW6A 1T2JA 5DA4A 5CR1A 1PQZB 4U1IB 4P5TB 2IH8A 3WTTA 3PHQA 3P77B 3N50A 1IBBA 5I8KL 4XC1L 2WLJA 5DZ9A 4FQLL 3EGDA 2HFGL 2PO6C 4FQ2H 4POYA 4YSUA 1BG1A 5FIEA 3UTPD 1BBJA 1SLXA 2VXSL 5ID1A 3Q6GH 5I5IA 3UZVB 4MRBA 4YPGA 2VDPB 4NC2B 4Y5YC 3FNKA 1CDUA 4QXWA 4A39A 2ZKXA 4KXDA 3CBRA 1NKGA 1FZMB 2FQFA 3EYOA 5F1NB 1JMZA 2DMKA 3QUGA 1Z5HA 1NCWH 2CJUL 4D9LL 2HKHL 4HH8A 1F3DJ 1KFAL 1N2RB 3T04D 25C8L 2A9DA 1FGNL 3QJVB 4XAWL 3GUTB 4JPSA 4DVRL 3DUSA 3TN0D 1VACB 5ICYA 1J05A 1HILA 1TVBB 3D8MA 4M7ZB 5CP7A 3FAXA 1ND0A 4I85A 1RY7B 2VDLB 3RNKA 4KJWC 4BSVA 3SJVA 4F91B 2HMIC 2OI9C 5CWSA 4JHUA 4LFHD 1LLAA 2X6UA 4R7DB 1VFBB 3G04A 1KTDB 2B1OA 3MRFA 4Z76B 2R8SH 5KSAA 2R0KH 2L7UA 1H3XA 1D9KA 1Z0MA 4UQEA 3TO4B 4AGOA 5L6YH 3NCYP 1KCSH 2EEDA 1MW2A 4M7LL 1JZ8A 4JUTA 3ZE1F 1KGYE 1JZ2A 5C09D 1JK9A 2GBVA 3OKLB 4LVNB 4L29B 5HYEA 5DGQA 4J3OC 1FYTB 4WV1A 5C0FA 2WANA 5BMFH 4B5EA 3FUNA 1S5IH 4Y5VB 3VXUE 3MRKB 2BDNL 2GJPA 4XVOA 3T6XA 1FRGL 2P5ED 1IRAY 4I77H 3ZKND 2H0JA 2ZOTA 4ES9A 3O3DB 4L8BA 2BOCB 2A99A 2OMTA 2WM0A 2DKSA 1I1YA 5FUCC 4PY8J 1JWMA 1QRNE 1EH9A 3B3BA 4XBMA 4MKMA 1F1DA 1CI3M 5KS9E 2IAMA 4N26A 3FQNB 5I1GH 4M7KL 1TJIL 4OFDA 3DYMA 3ZE0F 3TYGH 4CBZA 4JQIH 4AL8H 4JCWA 3GKWH 2HA1A 1S9XB 5E00A 3KBPA 1PLAA 1FC1A 3HC3L 2FNBA 5EU3B 2VR6A 3QW9A 4NLHA 4QHLA 2DI8A 2O5ZH 3AXLB 4YSEA 2UV3A 1R0AH 5DC9B 2XDHA 4ZS6C 3HC2A 4LSUL 1QLFA 1S7SA 3LVTA 1F6FB 1S5HA 4PUBL 2JSFA 2DW5A 1UM6L 4TRPH 4WY7L 3SQOH 5KWYC 4QRPE 3BDYL 1RHFA 3WS3B 5AENA 5JLZA 4ZO9A 5A40E 2FHBA 4FQHB 3NCCB 2GBAA 2WLMA 3DMMD 3PNWB 4LLVA 1DUZA 4Z18A 1AHWB 1P2CA 3EBGA 4GRWH 4OZFB 1EZSA 5I5MA 3R19A 2F15A 4ZT1A 4M4PA 3DX8A 1E40A 4KI5E 1S9KC 5F9OH 4LHUA 4NHUB 5F7DB 4AEHL 1E5UI 2WTPA 5JOPD 5IMMA 3ULVL 1RH8A 1BZ7B 3GSUA 2AEPH 4X7EC 4DPRA 3PWUA 1YN6B 3S3PA 2GY5A 1DBJH 3LQAL 3X14A 3GMOB 1RZ7H 1U8OA 1W72L 4PMFA 4IGBD 3SDAA 2COVD 3FO2B 1ANUA 2HTLC 3CVHB 1ZLWH 4NKQB 3AREA 4GUQA 1EJOL 5INCA 4AGLA 5SX4H 3BJ91 2CHXA 4KX7A 4BE6A 3W39A 3LHPH 3P30L 2I69A 5EZOL 3FT3A 1J5HA 4UMGA 2OJZH 2MTAA 2VR7A 1CJYA 4JHAH 4AG4L 1MCLA 3PY9A 3AAZB 4W6XB 1K8DB 1JF5A 3JVFC 3PAVA 4QYOA 4NT6B 2I07B 3V6OE 1AACA 4LOFA 3ARPA 4L1DA 4O02H 3A22A 3EJQA 4NQXB 3DTXB 2Z93B 3ARGD 3FO0L 5IW6B 3WIIL 4X5PA 5DJCB 4ZTPL 1RURH 3B37A 4B9IA 2WCPA 5IB4B 5F7UA 5IB1A 2FUQA 4BH7A 1I8IA 1NC2A 3P4OB 5E9DE 1KENH 4XMWA 4DKEL 3FZUD 4QYAA 1BD2E 4HEPG 1NAKH 4PWEA 5EOTB 1OGAB 1AQKH 2C1OB 4PVMA 3ZDZB 1EXUB 4V1DA 4YX2H 3RP1A 2YUZA 4DO5A 3MUGB 1AZRA 4ODHH 1NM4A 2FH6A 2K8QA 4MHHI 1WIOA 3WO4C 3S48A 4YNYB 3O6KH 5ADPL 3T71A 4ANUA 2MSPA 3GXNA 4G7RB 4KAQL 4ZQKA 3NIDF 3RWHA 1GS6X 5BRPA 1EEYB 4F7EB 3QQ9D 3WIFA 3VXME 1T03H 4LPCA 4MXQD 3V5DA 1IKFH 1ZEAL 4DTGH 5EC2B 1DP0A 4AQZA 5DVNA 3FCTB 4JFFE 4CJ1A 5IF0A 2VR8A 2XWRA 3L4ZA 4ZMNA 1AAJA 5EZLB 4Z7IA 1Z9LA 3NZ8A 2HUEA 4GFXA 2ROXA 3ZQXA 2CQVA 2WO3B 3U79A 3CXHJ 3FTGA 4BEIA 3CNKA 1BLNA 3UZEC 5EWIH 3VXSE 3C5ZD 4YVUA 2X4OB 3X12A 2IQ9L 4FJZA 4HA1A 4I3SH 4TQIA 4YO0B 5TE4H 4E9YA 2F08A 2ZTBA 2B0SH 2DKUA 3T8XB 3W0WD 2V3FA 5CLXA 3DOIA 1I1AC 1SBSL 4P46C 4HMDA 1P6FA 4P2QE 1O7DE 4IDLA 2C3VB 5CP3A 3FTZA 2PXYB 1AS6A 5TQ2L 1OQXA 2QQKH 1WRFA 2XKUA 3O8XC 3BUBA 3J2PA 1D7DA 1MAKA 5DI8A 4X7SL 4FN0A 5DYOA 5CMAB 1CGSL 1MWAB 3QR1A 3KGRA 3PWLA 2NR6D 1U6AH 4YXLH 5I73C 1FZOA 1R46A 2JCCF 4YSCA 5KAQF 2XG4B 1N68A 4OZIB 5IMLA 1LEKB 4BSWB 4G70B 5J1SC 1K3ZA 4DP0X 2IPTH 1M7DA 4Z95L 5CCJA 3PREA 2CRZA 2WBJA 3FB8A 1G7JA 3V4UL 2YN5A 2XXMB 3HZYB 5CNHA 1NFKA 2XNAA 1HL4A 1JPFB 2GJZB 3F58H 4F7TB 4WNSA 3BISA 4ODTH 1DZBA 2ZWYA 3QCVL 4KWUA 1BX2A 1IZJA 3STZB 4JY5H 3V52L 4WI8A 3WE1A 3C87A 2IXQA 1RVFH 3B9KD 3KCPA 3RAJL 4ZMOA 4GINA 1KT2A 2P47B 3HKFA 4GYBA 5L7XL 5JIMA 4AK1A 1L0PA 4MCNA 4R9HA 5AVUB 4AQ8C 1KJ2A 2L8AA 1C08A 5HGHA 1XEDA 3NEXA 2PW1B 1BF2A 2WXKA 1YUHB 1B2WH 2OXHB 5DJAA 2XN9A 4QJ5B 1ZE3C 5FPIA 5HDWA 2OQJB 4AQAA 3PL6C 4X80H 3ZYIA 1A6TA 3QUYC 3V4PH 2B2XL 3WN6A 5DJ0A 4L4TA 4OI7A 4F2EA 1FWXA 1X3DA 3CVBA 4LLWA 2OSLB 1UADC 5DD1L 5JYMA 2J73A 4PJ7F 1CLYH 3U6XA 2WBXA 4NIYE 2IV9A 5F7LB 2JKRM 3NFPA 4GAJH 1XXFC 4KJQD 1I9RL 1A14H 3C60D 2JI3A 4PD4K 1JF6A 5K33A 3DO3A 3G9AB 1O9VA 4BQCA 7PAZA 1NAMA 4X5XA 1T89C 4GKLA 4XNXL 3DIVA 4HWBL 4JR9H 3HBQA 5TE7H 4EAEA 3BPLB 1TZGL 1RUAL 1GKOA 3TNNA 3O4LE 3ZKMD 3QFDB 1KLGA 1YNKL 3VWJA 1IL1A 2FWOA 3IXAA 1MLBB 2WNWA 1YEFL 4G9FA 4Z7UA 2G0KA 4N2AA 1RUMH 1CLZL 3ECBB 4ZOEA 1AGDA 3SGKC 2QHRL 4HWNA 2VXQA 4FJ6A 35C8L 3O45A 2FYYB 4L9LC 4Y19A 3WHXB 1SEBA 3BZ4A 2AXFB 3GWJA 5D2NC 3RUGA 3GSOB 3ARZA 3TZVC 3BUYA 3TVMA 3AXIA 1Z5LA 5D2NE 4U4BA 1JWUA 1AD9B 3UZQB 4AE1A 4Y4FD 5EO0B 2CO2A 3D1MC 1EFXA 4PREB 3L6FA 3H4FA 2NMSA 1A6VL 2VLJB 3VD1A 2ADFH 2HRPL 1NGZB 3BPCB 3NFNB 1RZFH 5DRWB 3HR6A 1F6LL 2QSVA 4XP1H 3VMOA 3KPNA 2OJEB 1LO5B 3HFMH 1TZAA 2NTFA 3QNXA 1I4FA 2D7OA 2AI0L 4JFDE 4U1LA 5TPWL 5IB2B 4EUPA 2A6KB 4GB9A 2AHIA 2VDMB 4NERA 4PJBA 4F5CE 3SCMC 2X0UA 2NY0B 2YD7A 4AVKA 1N26A 5LAXA 4TSBL 3U2SA 3U0PA 5AZEL 2XKSA 5LLIC 2L0DA 4KJPC 4PVLA 3MV9D 1PZCA 3GDBA 5JDSB 4HV8A 4P2OB 4BCXA 3UTQB 3DIFB 2O6FA 12E8H 3RPKA 3ABLB 2A77H 3G5ZB 3MLXL 5DHMC 1SYSB 4FFYA 1ZK9A 4NUGL 1YC7A 2K9FB 1J1OL 3E1F1 1EXGA 4G6ML 1PZDA 4QRUA 3VFOA 5JHDA 2IBZX 2NY3B 4GG6F 2CJ3A 3M88A 2QL1A 1JGVL 4XPHH 3AXHA 1G7LB 5T1MA 5I71C 5DCCA 1FG2B 5BW7A 3QWNA 2Y2TA 1PZUB 1U8QB 1B0RA 4L3ED 3ZU8A 3P11L 4HIHB 4PJHE 5CINH 4CC4C 3L7EA 5GIRA 3LZLA 1RERA 4KUZH 1S46A 4X5WB 3QUXB 2ZNWA 4G9DB 4JG5A 1TLKA 1DQQA 1UQSA 2D2OA 3MRBA 1EHAA 3OKMA 2XBDA 3D52A 1V7ML 3EJPA 3GEFA 1XF2A 4EN3D 5IMOA 5JW3H 2I25N 2FH8A 2P8LA 4K71C 3EOTH 3BZEB 1F4YL 5ACLA 1G1CA 4RNRB 2YAMA 1KGJA 1IEAA 5DVOA 1JGDB 2XWJA 4WF7A 5JA8B 1ZA3A 4DW2L 4FTVB 1ZV2A 3HUJB 4KY2A 4XP6H 4PRNB 1B4JL 3TF4A 1KTKE 5C3IA 1DYZA 5DFTA 1HTYA 1SLUA 2EDHA 2A9BA 2G9HB 3SDDD 2V37A 3S4SA 5EZJB 3N1GC 3OPUA 4OB5L 4EO5A 4PW9A 4AV4A 2ERJB 3QFJB 5D7KD 1PDKB 4M1DH 4K3JL 3WUZA 1WD8A 3IFOB 3OKKA 3U4EB 1JHLH 3ENEA 4KJYB 4QRTB 2CCVA 4AUUA 3DGGA 3UTSE 3LZFH 4ELMF 1XGRB 1J0YA 4YIQA 2CIKA 3MRIA 2V9QA 4KNSA 3V4VA 4R97C 2P7TB 4JN2A 1ZHBB 4RFNB 3QZWG 4OZGB 2ESVE 4AEEA 1U92B 3GGWA 3MCLH 3MLWL 5A16A 3U4AA 1X7SA 4C83A 1RUKL 3QXVA 4TNGA 2RALA 5FO2A 4F8PA 4PLNC 4HEME 1YUKB 1E8ZA 4Y9EA 4ZMWA 5FV2A 4FKKA 1AO7D 3TCTA 4AM0A 4P99A 2YKLL 1MRFL 3LNDA 5EEVA 1OGSA 1ZK5A 4ZUWA 3OG4B 4MA1C 5F9JA 3L95B 4HBQA 4NQDA 1VJSA 4GXVH 5FYJE 5IR1A 1BFVH 2NY6D 4GQQA 3RWJA 1DBKH 1KEMH 1EHKB 2J1ZA 4XP5H 1NLBL 3NJIA 3E8UL 2ZP0T 1BQHG 1OHZA 5J1TC 1S7WB 1A7QL 3BSZH 1KPRB 4FJYA 2CCLA 2ZJSH 3TH2T 1YEEL 3RWFA 1GL4B 5IEHA 4NSKB 4QRSA 1S7VB 4ZAKD 5LXGL 5AVXB 5J13B 4EPSA 5FGCB 4B3EA 4H5SB 4TLUA 4TQHA 4PRPB 1VZHA 1XSJA 2R56L 3QJHA 3T2OA 4S1QH 4UNVA 4MCYA 1ZXKA 3SKNB 2L4OA 2Z91B 5AD0A 3QUZB 2XQ0A 3KVQA 1R34A 5DVKA 1U4FA 2VDOB 3CGTA 3D25B 3BWAB 2CLZB 3MLZH 3L2MA 3QJZA 4JFZH 1UJ3C 5IQ7L 1KPVB 2EDKA 1C12B 4LVHB 2VE6A 3DX7B 1REIA 3SEPA 4M1GH 5JUEL 1UATA 1B4LA 1LL1A 3S88L 1G0DA 1CTOA 1OZUA 4P2RE 1A1NA 3RFZC 4WENB 4QRQB 2DZEA 3RWEB 5AVYB 4TNWK 4D94A 3E2HB 3SDCB 3TBWB 1LNUB 2PP9A 4B0MM 5FKAB 1T7YA 3IMSA 4LEEA 4PJFE 3APCA 5IJCC 3HHSB 1YN7A 1U8CA 7TAAA 5L8JB 4MJIA 4RZCB 3IDYC 3D39B 4FMFA 4K3EH 1X5YA 4LSDA 3WKNA 4ZFGH 1R9FA 2ZUWA 4PRIE 5C0FB 5I15H 5BS0E 1P7KB 4IKJA 4RMQA 1E4JA 4OIIH 1NEZA 2HG5A 5I18H 1P5UA 3MREA 4I3GA 1FZJA 4XBGB 1V8HA 4WI6A 3O2VH 3VCLA 5SWZD 4EVNA 1AZCA 1E27B 1A4KB 2AABH 2ADGB 3DO7B 2DDQH 2IGTA 4AEFA 2IAMB 1TQBC 5F0MB 4KGLA 4UB0L 4S2SA 2V5YA 3JXAA 4JZOA 3OAUH 1Q0YH 1G9HA 4Z3IA 3IU3B 2Y7MA 4WW2C 5JTWA 2BNQE 1FFNA 2NNAA 2C7UA 2XFGB 3P0YH 2FGWH 3MNMA 4GBXD 2W0FB 3MA9H 3AFLA 4H26B 4MAYC 1YMME 3MRRB 3WIAA 4FL4C 2E27L 1P4BL 3Q1EA 1VKXA 3NFSH 2Y3AA 1S7SB 1ZSDA 3H9SA 2R1WA 3CFBB 3BGMB 5F3FA 3AG2B 1S5HB 3WFZA 2YPVL 3ARBC 3R0NA 4HIXH 4Y2DC 2GT9A 2ZG2A 2J6EH 4F27A 2UZPA 1KJVB 1IC0A 1H15B 2W0PA 2YK1H 1WBXB 3GK8L 3ULVE 1I85A 5IV2A 3I6KB 4R90L 2XZCH 3P40A 3LQAC 1CICB 5AOJA 2F53E 5HJ3B 3VFUA 3GMLA 5FYJU 2AK1H 3FS9A 4P5MA 1P1ZB 4LL4A 1TF4A 4PMEA 1EO7A 1N59B 2WZPA 5KBLA 2WXIA 5IB3B 5GGVY 1PS3A 2FIRT 4KXZI 3UEZA 1WLHA 4LRNH 1KPUB 3ML8A 4ZMXA 4KVCH 3OAZK 5BCAA 4UF7C 2ZKMX 1IZKA 3PWUB 3RIKA 1TYJA 3HFFA 3QXUA 2RHEA 4IEFB 4S1RH 3X14B 5IZ7A 3REWB 1KN2H 1QG3A 3JT2A 3JV4B 4JB9L 1BYNA 5EU6A 3GXMA 5AWNH 3FRPB 4KK6D 4YWGH 3ZL2A 4L8DB 5IHZB 2R15A 3D3VD 4QCIA 2CHWA 4IRSA 4M6OH 3K1DA 3QHZL 5IVXE 3B9EA 5C0ND 5BZDA 4Z5RB 4EI5B 1F4AA 3PWJB 3QORD 4FULA 3Q3GB 2XQYG 4U6XA 1ACYH 2J56A 2IFFL 4YFLF 2A4ZA 3H1ZA 2CO4A 3U9PH 3VQLA 4RFEB 1TJMA 4MB3A 4PB0H 1K4DB 5K39A 5JA9A 1E67A 4P2AA 4H8WH 5JR1L 5ILTL 5D1QD 4KHTH 4APXA 4IW4C 5DEFB 1KCRH 2E4FA 2WLIA 2YQ2A 2ICCA 3N55A 4GRWB 4MQSB 4X8JB 2OMUA 3BW9A 4XVTH 1QUNA 1DFXA 4PTTB 5C0BE 2DWSA 1AR1D 1MCRA 1MJUL 4ORGB 1GPOH 4P3WA 2J12B 4TPRL 2VZOA 1RJLB 4U1SB 1HDMA 4JREB 3NTCL 1BPLB 5HHPB 3H9HA 4JFPB 1V3LA 2EDBA 1DLHA 1T0NB 1L0XA 2Q7YA 4G6FB 3Q2CA 4ZSOE 2ZXAA 1BQLL 2W07A 5E4EB 1D2OA 3RWHB 2YFOA 3ECUA 4QHNA 2CA3A 5EPMA 2G4EA 2ZG1A 4K9EL 4DEPC 1CF8H 4QTIL 4NWTH 5DK0B 2JE8A 3MRGA 3WN5C 1QSFE 5IF0B 4OJCA 4QHUA 2YPLE 5EOCL 1THAA 3UPAA 3WKQA 3O6FD 2WVVA 2Q1EA 3Q8FA 5DC4B 2YPKA 3VSUA 2F1AA 4JG0H 3A4DA 4M5ZH 4O5LH 1KB5A 4N5EC 3H6AA 3HJ0A 4O02B 3LIZL 4Z7QF 3B6SA 1XX9C 3IJEA 1BVLB 3DX4A 3WEMA 1NCDH 3HVNA 3TEXA 4QTHA 3IBEA 3F7VB 3VG9B 3KS0J 3TBTA 5FYLH 4L8SC 2E4TA 1PKQB 3BESR 4KRNA 2A6DB 2QV2A 3JT0A 4FFVD 3SOBH 1XSIA 3IDGB 2HXAA 5TF1H 1MVUA 1NANH 1R3LA 2HJFB 3FTWA 5M95B 4LSSH 4H88H 2AK4D 5DI8B 1ADQA 1JG9A 2F74B 4UM8B 5FHAH 1XF5B 3WNJA 3RWGB 4GW5B 1CK0L 5HI3D 2VM9A 5ABZA 4D0DA 1RU9H 2HP4A 5HHMD 2QSCL 3OX8A 1NM9A 2V9RA 3KWWA 3U83A 1P4IL 5EN2A 4ERSH 4EIGB 5E6IA 2LAAA 1FORL 2A2QT 5AVZB 6PCYA 3UTPE 4PR5A 3APNA 2J5WA 3DURA 3ZN6A 1ZLDA 5HDOA 1M7DB 3F7YA 2X1XR 3WFEH 3P2DA 1C7SA 4HCFA 4PFEA 1P4LB 3VD4A 4QXUH 1VHPA 4OD2B 1X5ZA 2B16A 1YY9C 3FTSA 2F54B 1GZHA 4GRMB 4H20L 3KVPA 3ZTCC 4KO9A 4PH8A 3MRJA 1SVCP 1UOVA 4JPKL 5LUMA 4UAOB 2CLVA 1CXKA 1KLUA 2LU4A 3ZMEA 5K9JH 1CUOA 1GIGL 3L3IB 3KL0A 4GKSB 2E7DA 3QDJD 5JXEA 3AM8C 3INUH 4K5OA 1UXWB 2NTSP 1U8KA 2CHZA 2HLFD 1HQRB 3OL2A 1CI5A 2PWEA 5LNEA 1FLRH 3HZVB 3VXTB 1I8MB 1JHTB 4L4TB 2QADB 2IDUA 3M17A 2KI6A 3ULSB 3KH4A 3UTTD 3MYZA 5JIQA 2K78A 1OTUC 3NFPB 3DJRA 2ZKHH 3UIYA 4UTAA 5C09E 4XN8A 4R6UA 4X6DB 2ZX6A 1BXUA 3G08A 2YC1A 4WI0B 4G8IA 4IRJA 1GYVA 4K5MA 4M4RB 2G3MA 4X5XB 3KPPA 1RUQH 4X4KA 4LCYA 4U6HA 2N0MA 2PP7A 1AANA 1Q0XH 1SXCA 2YUXA 5BRZE 4TTDC 3O41A 1QQDB 4HS6A 3SGJA 5CEYA 4AW4A 3ISWA 3U7YH 3PWVA 2XQBH 1MDAA 1BMZA 4R7NB 2BVOB 1UEMA 2C5DC 3L4WA 3SPJA 3FRUB 2J3SA 2M1KA 3L1FA 1ZT4A 1T3FB 4NN7C 5D72H 5FR3A 3GBLA 1P7HL 2CJSA 3VXUA 3GJEB 3TVMB 4TUJA 4RFOL 3UG3A 1KCBA 5E4IA 4Q58C 1E6JL 1QFWM 3AG1B 3P0GB 4AJWA 1A5FH 1JTPA 3A6OA 2YXWA 1OOAA 1C5BL 3GNML 4K07A 4O58H 2A73A 3ZXAC 4AUJA 1F1GA 2ZYIA 4FQJL 1E3FA 4HPOL 3V4PB 4HMCA 4RMUA 2SEBA 1XBDA 3L4VA 4A7GA 2NTFB 4PRDB 3DMMC 4CW1A 1N64L 1F8TL 2V4LA 4FX5A 1IAIL 2I9TA 2VDRL 4GP5B 2V17L 4GRLA 1E9PA 4Z9KB 3NN8B 3P0VH 4JVWA 5F0JB 2DM3A 4HF5L 3H42H 2H1PL 3HR5A 4JDTL 2P45B 4I0KA 2EDFA 3AUVA 3ZE1E 3WL9B 4Z0BH 2QVIA 1AI1H 4FZ8L 1ZXQA 2B7DT 5T1DL 4O2CB 4QRPA 1QATA 4IGBC 3U36B 5J56B 1CU4L 2VZSA 3ATEA 4TN9A 2MKWA 3MLRH 2ZOLA 4TVPD 5F3BB 5FLUA 5EDXA 3LZRA 1OARL 1NLDH 2BXYA 4R5TA 1CD0A 3AQYA 5HD8D 3B5GA 4HG4K 1UXSA 3MOAH 4HUWA 4UTBL 3QAQA 1YQVH 4PJIF 3P3SA 2DWDA 3MZTA 2XLLA 3ARGC 5DZJA 3GO1H 4XTRD 2HKFH 1W0YT 1DUYA 3DJ9A 5IVOA 3U4BL 4H8PA 1D2PA 3DXAD 4B5ZA 3B8SA 3D08A 5C0AE 4ZXBB 3GHEL 3Q5YA 3RI5K 5CUSH 4FCHA 3WTVA 1KYDA 2F68X 4X9HA 5DMIH 4UT9A 1YEHL 1XF2B 4NC1E 1S7XA 4I3RH 1IGJB 1T1WA 3GRWH 1QAWA 5BRQA 2VZVA 2WIIB 3MLYL 2YQ3A 2D7NA 1ZA3B 4UDTB 3V6OA 1PZ5A 4OF7A 3RU8L 5T1KA 2J57A 5DQ9B 4NM8L 3T08A 4MASA 2OMXA 3QQ9C 4OLUL 1RJCA 5E9DA 3UP1A 2HPOA 4MXQC 2WJ7A 3UAAA 3ZY7A 4WO4D 1AKJD 1NC4B 5ABAA 4I9XA 3UBXI 2BIPA 5I75B 2X2JA 4QOKD 2IWEA 5A7BA 3LRMA 5F7WC 4JKMA 3IJYB 4D0CB 3CZFB 4YE4L 3GZKA 1DJHA 2ODIA 4RSYA 5C08D 4APQB 2A3TA 1XCQA 4Z7WF 1SPDA 4XMKH 4MXWH 1GW6A 1CDHA 4JZJC 2DJSA 5FX3A 4PJEB 3C5ZC 3DHUA 3D9AL 5D4IA 3HN8A 1OP5H 2GQHA 4P23D 3DV6B 3GGWB 1FO0A 4ZW6A 3A21A 2WXOA 5DHEA 3VXMA 1NDGB 5KAQG 2CJTA 5GJSH 2NDFA 4JFFA 4BDVA 2VAJA 2Z31D 4JQXC 1IAII 5MP6H 5MEQA 4NQDB 3X1BA 4OM0H 3VE0B 3JBG7 3SDXA 2NR6C 1EZUA 4UV7L 4CSZA 3VXSA 4NO3B 4DP2X 4LSPH 4MJ2A 1KCWA 1HOCB 1MHPH 2B4CC 4Q8BA 3UZEA 3QG6B 1I1RA 4G43B 1RZJL 3AGWA 4JQVC 4NIKB 1RZIA 1WAAA 2RA1A 4QRSB 4ZUVB 4QNPE 1E5YA 3C6LD 4XAKE 1LK2A 2E7CA 3M1CA 5CBEA 3T0VA 4P2QA 1JCVA 3HPJA 4HUVA 2W60B 3CMGA 3OC5A 4MCYB 5FFGA 2DL9A 5JHLA 4QY8A 3BZFB 2AQNA 2J8UE 3QEUA 4ZTOL 1MNUH 3CQPA 8FABA 3IJ8A 3SO3B 3O8XA 1W9XA 5KBMA 1JPTH 1DVSA 5EBGA 3TBSA 1NCCL 3E6HA 3B9KC 3N42B 3M1OA 4N0UB 1DEDA 1DBBH 5DDHB 1W16A 2BC4B 1KNOB 4KQ3H 3VSTA 4S0HA 3FSOA 3IJ7A 1W0WB 5L88L 4HT1L 1UUNA 3FQXB 3SD5A 4P5TD 4N2DA 2WMPA 4DPCX 1CZ8H 3QHFL 3LV3A 3VO0A 2XWEA 2DD8H 3WLWD 1F58L 3U2IA 2HLAA 3ALXA 4FLQA 5GRXG 2BNRB 1TPXB 4IOIA 5CCHE 5FOBA 4QUOA 5E2TL 2H8PA 2AQ3A 4MJIB 2EILB 2W80C 5F7EH 5FKPA 5FA4A 3KYKH 5TGBA 4BFJA 4UU9B 1E28B 4S1DD 2YD1A 3PNRB 1ASPA 4KJQC 5CD3B 3C60C 2JJTC 3PABB 3MLVL 3T0EB 1NCAH 4K94L 4RGNB 1E4XH 4ANVA 5EO1A 4LO9A 5D1XE 3E1ZA 4AQ8A 5ICZB 4ODWA 1FZJB 3RDJA 2E9JA 4DGYL 5E7BA 3L5XL 3N40F 3ZKMC 2DQDH 1MPAL 2CIIB 4Y1AB 1YPZE 3K2UH 3HI1A 3B2VL 2E7HA 3FFDA 3G9VA 5DHVH 2WCGA 3K1KC 3PL6A 4QRBA 1PY9A 2JCCE 5DD0L 2XTSA 1NL0H 2P8PA 4BA8A 2HVKB 3GSNH 2DQTH 3A3YB 2CLRA 3GFUA 3C09C 3K4DA 1E2VA 1JNJA 1N9PA 2BP3A 3TO4D 4KRPD 2DLHA 3UBHA 5JPNC 1RPQA 3EJCA 3QYCA 5EEWA 3WMQA 4YHYB 2QLVB 3TXAA 5FUOL 3SE6A 5HGDA 3L4CA 1SJHB 2MKLC 2NY5C 3LEYH 1IC5L 3BD5A 2JJVA 3MUHL 1ASQA 4JM4L 2UZYA 3POHA 4OUOA 3STLB 2WQRA 3O0LA 4P07A 2AQSA 1RUPH 4LASH 2DQIH 5ECGA 2GT9B 3EOAB 4I48B 3EFDL 4L8CA 4NKMB 3UC2A 4P4RB 4GQ9L 4P8QA 1JDCA 4EBQL 4ZFOA 4Y2LA 3F01A 3K5SA 3L3OA 4QJ4B 2KZKA 2XTJE 2X3BA 3FMGH 4HU8A 3TOPA 4P5MB 1ZLVH 2H2SD 2VDQL 4OLWL 5D2NA 3QWOB 2IDQA 3OQ3B 2ALWA 2FHFA 5CFHA 4Q14A 5CFAA 2OW6A 3T3MF 3I75B 5E70A 3A4FA 3V6ZA 4PJ7E 3FQYA 1HYRC 1JYVA 3RJQB 2AEQH 1A3LH 2FBJL 1AGCB 2FT7A 3WE6A 2R51A 1A6PA 1JS4A 3JWDL 4F7CA 4JFDA 3GSNA 4DOHE 3OKNA 3ROLA 1JI1A 1W15A 3N91A 3QO0B 4TNVF 1MF2H 2E7LC 2VW4A 2ZUTA 3P3YA 4PJGE 5CJBA 4JRLA 2IADB 4IJ3B 3LN5B 3ZDZF 1OE2A 2YJLA 1DQDH 2OP4H 3K8MA 2ZXQA 3X3FH 4U6XB 4MKTA 1XCWA 5T1LB 1N0XL 3WS6C 2VO8A 4LNRB 5D5MB 5LWYL 4TVPL 3T2NL 3H0TA 4U6YA 1I9JH 4IU3B 1JZ7A 2Y6SC 2EEBA 3EG9B 4N6RB 3IYLW 4GP4B 3ZDXB 3ZO9A 3G5YA 4MQ7B 5IB5B 4J3OG 3TYFA 1Y6KR 3B56A 1SEQH 1D5XB 5E6RB 3ZTNL 1TVDA 4HFWB 1KIUA 5GGTL 4GAAA 5FGBC 4RISH 5FECA 2PPDA 4K9EC 4M6ML 3O3EB 4EOWH 3ME0B 3NACH 5A6MA 1SNRA 4XN4A 3F3HA 1IC7L 2ICEB 3SB3A 1Q72L 2P24B 3MBXH 4NUJB 3CIAA 1U8JB 3FSZA 4M48L 1S9VB 1RD6A 4PJHA 1JZEA 1EFQA 3SDDC 3IFPB 2GTWA 2VH5H 3FCSA 4J6IA 3UP6A 3N9GH 4Y9GA 4PBVC 4JFEB 4NNPL 1RZGA 3GSRB 4P4KB 2X1WL 4ZG1A 5C0JA 3TM6A 5B1KA 1MEXH 1F4XH 1NWOA 2DMCA 4JLRB 5FYJH 1QLRB 3ZUCA 1BAFL 2CK0H 3ZBMA 4AYID 1F02I 4RIRA 4K3DL 3T0AA 3VFWB 4NPYB 2HFEA 4JW3A 3ZMRA 4S1SL 4YHOH 1A7RL 3IJEB 4Z8FL 3BDXA 4OZIF 2AS5M 1TMQA 3HG2A 1U95A 2I5YH 1JZGA 4L5FE 3F7QA 4GG6E 4UOW1 4FYSA 4DUXA 3FONA 6FABL 4HLZG 1HEZB 3HNVL 3X1EA 4G83A 2HWZH 1I75A 1F13A 2AXGA 4U1MA 3P9WB 3II3A 3UTSA 3BKMH 1XB3A 3TV3L 4F2ME 4MD4B 2X4PA 1DVTA 2XWBB 2NY6C 4G7VH 1SMDA 2OMVA 2ESVA 5GRVL 4X7DC 2P1YA 3FN0H 3WHE0 1KULA 4UIKL 4AQ1A 2C3HA 3AU1A 4MNGB 1OW0C 2ZWZA 4ZAKC 4J8RA 2VXTL 4HEMA 4PU2A 1YEIL 1TITA 2BLFA 3OB8A 4HJEA 3O3AA 4ZW3A 3QQNA 2O61A 1GTFA 4GW1B 2BCMA 3NK3A 4G6JH 4UDUB 2CDFA 3BGAA 4MJ5B 4YZFF 5F1IA 1FI8C 3DI3B 5TDOB 5FB8B 1AIFB 5BQDA 3JTSA 1IGTB 3DRQA 4Y9CA 1RJYA 5E6UB 4XX5A 1ZDQA 3UJIH 3MRJB 2VLLA 3MXVH 3QGVA 1N3NA 4MSWB 2ARWA 1PL3A 3G5XA 5I66A 3D6GA 2A74A 1QBLL 5DSCB 4OLEA 1BXXA 1S7UA 3SPHA 4B9ZA 3WTYA 5JO5B 4ELME 5C07E 4CNIB 3OAYK 3QEQB 2GCYB 3OC8A 5IUCA 4N9GB 2NW2A 5HY9B 4PJ9B 4FXGB 1KB3A 1NWPA 4QEGA 5BV7H 3BQUA 4MNHA 2AJZB 5HHOB 2XU9A 5AW7B 2KMWA 4HJ1A 5DFWH 1BVKA 1Q0EA 3PV7A 2FEEI 3RB7A 3HN3A 4PRHB 3VDCA 2FL5B 4IU2B 2JJSC 3BH8A 2EINB 3D0VA 1WGVA 4YFEA 4X0KA 2NNFA 2JB5L 3OAWA 5KSUA 2R9HD 4P3CL 2FYVA 4PJ8A 2FGZA 2DQJH 2B14A 3A6CH 1EUUA 4YGAB 2DWEB 1QWUA 2XKNB 3SQBA 4PI0A 4ISVB 3NESA 3NRFA 2RFXB 1EAPA 1PU0A 3VH8B 3L2LA 3RFZA 3HG5A 3OBAA 2ID5A 2HT2D 4HS6B 1PG7W 2YD0A 5SWZE 1ZWIB 4YBLB 3NPZB 1ZMYA 1RJZA 4FI6A 3ZR6A 4F9PA 4KOCA 4EZMA 5B7FA 3SSGA 1N8OE 1NBZA 1JAEA 5FO7A 2FO8A 4ZOAA 3FPYA 1KCVH 4PRIA 3VRIA 4G7YL 1IGYA 4XWOD 4GBXC 5SX5H 1AJ7L 1NCIA 5F6IC 4TUJB 4XMPL 4OM1H 3WNOA 4PJAB 2OULB 4S11A 3CJJA 4YLCA 2VJ0A 1DVFC 3ULUF 4N8VG 1XWVA 2VDLL 4KHXL 3PHOB 1L6ZA 4QHPA 1IAKB 1WSST 1QRNB 3SO5A 1IQWL 4FHJA 2AJYH 1ZTXL 4PLJD 5KS9B 4XNBA 3MPCA 3R06A 2VLME 1UWXH 5EBWA 4EJ1C 3NJNA 3D0LA 4BKLA 2X4UB 3N85H 4ZUUB 3BXNA 4F58H 2BNQA 4JCLA 3RB5A 2NYZA 4C4KO 5AKRA 1JF1B 5JW4R 4O4YH 4OGQC 1GC1H 1MFBL 1UFUA 2H32H 4X7TA 4WW2A 3HBZA 1LO0L 2FB4L 3EYUL 3P2TA 5K9QI 3RBGA 1YMMA 3FT4A 4KC3B 4NN6C 3AZUA 1E9PB 1L9QA 1EWHA 1FNSH 1E30A 5TD4A 1N7ML 1PLGH 5EUKB 1IFHL 2EVJA 4N1CA 4CN4A 1F3DH 1NCGA 4NAMA 4XP4L 3OMAB 4K9JA 1GJUA 1PYWA 1CFTA 1HL5A 1EAOA 1OO2A 3Q43A 4RA3A 5B1JC 5KTEH 1TSRA 3ATAA 4WJ5A 3TFKD 1K2DB 3RGHA 2FVNA 1KGIA 3LEVL 3GMMA 4KK6C 1FSKB 3UEQA 5CEXA 3ES6B 2F53A 2IGFL 2VLJD 3QIBB 1HHJB 1I82A 5I1KH 2FX8L 3QH3A 4WEMB 3F5WA 3KPOB 3QORC 4JG9A 4Z7NF 4GJTB 5EU4B 1JN6A 3IAGC 2DMGA 3KMDA 3JWNE 4MXVF 2BVUA 3GBMH 3W2DL 1Y1UA 5KVFH 4H25A 4CADB 3E6FB 1IO4C 3I50H 3OB0K 4BFRA 4EQ3A 2FJHA 3D2UB 1JBJA 4OCMC 2MQ0A 2NY0D 1A8ZA 2W65B 2ITDB 2WTOA 3INOA 5D1QC 3ULUD 3B2UC 2H3NA 2N7SA 1WH0A 1Y7VA 4WU7A 3ARYA 2H32A 2VOTA 1J18A 3NZSA 5C9JA 2CRIA 5HI5C 1G6RH 2P3YA 4XVSL 3S36L 5IVXA 4P2OD 4P3DA 1FVDA 2Q3AA 1TR7A 1QUPA 1HHHB 4XCFH 1M71A 1TKWB 4HWZB 2R4RL 5FA3B 3GC3A 4U0RC 3WFCH 4BV1A 3Q2VA 3DHJA 3D18B 2WAQA 4Z77A 3FQTB 5HTSA 1SQ2N 3QC5X 5ISZE 4FNLH 4M3HA 1T1ZB 4KK5D 5E8EA 4Z7VF 1IEBA 2NY3D 2R59A 3DA0A 1P7QB 3ELAT 3MODL 4FI7A 3B7RL 4ONGH 3LEXA 4Y4HB 5F7FA 1QACA 4U7SA 4N20A 2D0HA 4X9GA 5FK9B 2X4SB 5H8DA 2VMDA 3OM3B 3Q8AA 1BD2B 2VAAA 4Z1PA 5C0BA 4Y2OB 3HE6B 4OLVL 3O6FC 3OHXC 1NCJA 4E9QA 4WDIB 3QUXD 1DQMH 1DJSA 4HETA 1WC7A 3V5HA 1C9SA 1N18A 4MLIA 1JRHH 2P5WD 4ZSOA 5A7EA 1IT9H 1OTSD 4W9GC 2J88H 3BKJL 3K6DA 1ET8A 3L3KB 3AACA 1L9MA 3MR9A 3UIZA 3VNZA 4JPVH 3ZHLA 2HVJB 1XEUA 4FFVC 3DECA 4WI9A 2KLSA 4NZ8A 4AX3A 5J12B 3IJSB 4WUUB 3OR7A 5DEGA 4K0OA 3EGSA 2YPLA 4JZNB 5D9SB 1I53A 3MJ9L 3SOTA 4GY4A 5CILL 1F00I 3NDZE 2VW6A 4AC2A 1QEWA 2FD6L 1WUNT 1U3HB 2QPEB 3QFJD 4O9HH 1HI6A 3WGUB 5JPMB 2BHZA 3FQRB 5HHME 3TT1L 2A1WH 2XIIA 5HDBE 3C6SB 3KXFE 1AMXA 5IGXH 3ETSA 4XNQA 1VERA 3QQ4B 2OYKA 1AD0B 4XT1C 3BMVA 4ACPA 3H56A 3BUTA 4L8SA 3ZRCC 4DKAA 5HGAB 1WV7T 2CRYA 3DBXA 2QZQA 1C5CL 2UZXB 2VL5A 1E42A 3KDPB 3BRDA 3EUDA 3PJLA 1NANI 3LS4H 3VFGH 1U93A 3LAFA 32C2B 5I1LA 4HKZB 2H26A 1GSKA 2X7LB 3E6HB 3HS0A 3MX0A 4OFYD 3VRJB 3BAEH 4R0LB 3HMWL 3ETTA 3NCJH 4Q0XL 4EDXA 4LCIL 1N8ZA 2YUVA 4DJMA 1FDLH 3AW5A 1CYWA 4HJGB 5LCVL 3WDIA 4WKXA 1JERA 5B39G 4P2YA 4TF4A 3JV0A 4XPGL 1JHKL 3MO1A 2IBBA 1BM7A 1V3KA 4FNSA 3TBCA 1QPPA 2XV3A 2NQDA 2HLFC 2HLAB 1FH5H 2YLHA 5CBAA 3WAKA 6PAZA 3ZOAA 1G1KA 2MHAB 4NQVB 3MV01 2DKMA 4O51A 5FOBB 3CFJB 5HSFA 2DTMH 1XMWA 5FCUH 5FKPB 1CD8A 3O9WA 4PRPD 2MJWA 4JO1H 2XX1A 2XY2A 1EO5A 1SY6H 3CVIL 3TN0A 1MFEH 1YY8A 4X6FB 1QFHA 3X13A 2Z34A 1Q9LA 2ADIB 2BSED 3QUZD 3FL7A 5HHNB 3WXWL 2VJ8A 3D85B 5CR8A 5AL8A 1I9IH 1P6AB 2C9RA 2PP8A 2GAZB 3PXLA 4OJAA 2FIKA 1NCUA 1UOKA 1NBQA 1ZANH 3AM8A 4JL1A 3HE7B 2EXWD 4IBQA 1HVXA 5E8PA 5AYQA 3UGEA 5KG9B 3QIWB 4DO6A 1ERNA 5D2LB 5EV7A 3Q2NA 1UH3A 1Z66A 1OAQL 1SLVA 4QHKI 5DD5L 3WU1A 2ZXWB 4XZ4A 3MJ7A 4JM2B 1OAUL 5C09A 5GSRB 1L0YA 3SDCD 1HINH 4OFKA 4M56A 4RBPH 4WFED 1D9KD 1FAIH 1KBGH 1WTLA 5EHFA 1YYLH 2A6JB 3TU6A 1CFBA 4LGRB 4N90D 3HN5A 4FQQB 3D39D 5BRZA 4A2FA 3TH4T 3D7PA 3O4LB 3QS2A 3S5LG 3VFRA 1KEGL 4XCNA 1F3RB 1SOXA 3K71A 3G6AB 1RIVH 1J9SA 1D6EB 1WWBX 5A2FA 3ET9F 4CUCA 1RHHA 5GGSB 3T6VA 3S98A 2H6UA 1YEDA 5KW9L 1CE1H 4BK5A 5D6DA 2DQEL 2W81C 1A0QL 4YHNA 4YZWA 3L3OB 3U6XS 4PJ5B 1L7TH 1JZ5A 3B5HA 3ELQA 2Y36L 4FFWD 3BFWA 2IAMD 1LMKA 3JWDC 1NGXB 4K7FA 1V7NL 2O5XH 4OVUA 2J72A 5I74B 1MKFA 4XVUC 5GRJL 4QO1B 4LB8A 4HKBA 2WB7A 3EDDA 2QTEA 1I3GH 1L7IH 5GS1C 2BS8A 2XSKA 5DHVB 2E7BA 4L4VB 3MUJA 3FCUB 4RWYL 5DJ8A 4F7CB 1TQUA 1IGCH 5HGBB 3JTBA 3GSNB 5CN2A 1FNFA 1IAOA 4FKHA 5CIPH 1XQ4A 3IDNB 1QMUA 2APWA 4TVPE 3TPKA 2ZCKH 1VENA 3LRLA 4KMTH 1WFNA 3DO4A 2DMBA 4PQXA 5FV1L 4YHLH 5DJDA 4QXGH 5HD8C 1C8QA 3SKJH 4KKBD 1T04B 2ATPB 4GIPD 4KVPA 2H6PB 3CFCH 4IIQB 2BRRH 4LCCB 4Y5XB 4BZ1H 5I0YA 3CC5B 5ELIA 4MHHG 2LLLA 4G7SB 4L1LA 3SE3C 3OR6A 2K3TA 1CGUA 4AGQA 5E5UB 5TQ0L 2V5MA 1R75A 3DSFH 2RD0A 3QJSB 3NCFB 1Y6MR 1I8LC 2EDTA 1O9WA 1S7QB 2Z4QA 4EI6B 3DROB 4UQ3A 2NQCA 2EXSA 4HJ0D 2VISB 4ZTEA 1S7TA 3P73A 2J1XA 4WTQA 1LDPH 4N87A 5IQMA 4MDRA 1N0LA 4CVZB 3ARED 3MGAA 3HTLX 4L2YA 3GHBL 4OR1A 2ITCB 1TNNA 2KZ1B 3P2BA 4OCSL 1LE5A 2G2PA 2R2EA 1DLFH 1OAJA 3VGAC 2CO6B 3LD8C 3L9RB 5I16A 5D6CB 4EI5D 1EJ6A 5C0AA 4JUSA 4WO4C 2ARJA 4H8UA 4JPWL 3SE4C 2D3VA 2OW7A 5F7AA 2EO7A 3EYQD 2XN1A 5DYFA 5FYKD 2X4TA 2RH0A 2V2TB 1TCRA 1FZKB 1MFAL 5C08E 5E8OA 4WJG3 2D7QA 2ZPKL 2IPKB 1WA0X 1PCSA 3TTSA 4UNTA 5D7HA 3MRDA 5LBSA 4B7LA 2V8MA 4P23C 4PJXA 1T2XA 2IMMA 3L4UA 1NCTA 2JKWA 3EJUA 5I1EL 2DQ6A 3FSVA 4I1RA 5CXPA 4UYQA 5KN5A 4YSPA 1GY2A 1BEYH 5EC1B 3QRBA 9CGTA 3VXRB 4NJ9L 2ICWA 3E7JA 4ZYKA 4FKEA 2Z31C 3F84A 1I3RB 1S9YB 4YDJA 1HJCA 2DBLH 4G6FD 1A3RH 1BJ1J 1MUJA 2QVMA 4X4YB 5KVEE 4WW1A 4CKQA 3CZLA 1BSIA 3GB7A 1G7PB 4G2AA 5DUJA 5DMGD 1FE8L 5LGJB 3L3GA 1E5BA 5DD3L 4PB9H 4FZEH 1NCHA 1TT6A 1SLWA 2CM6A 2XACC 1AXTH 3TCLB 3O2DL 3V6FB 3JVGA 1JSYA 4XWGL 5MI0C 1F90H 1T6BX 2ZYHA 3LKOB 5EOCJ 4AYSA 2KT6A 5I1HL 3T4AB 2Z7WA 1Q94A 1QVOB 1AQMA 3TA4D 4YDKH 1QLEL 3DLQR 4XRCA 4GQPH 1HH9A 3RNQA 1XGTB 2I32A 4X2UA 5A2BA 1J8KA 2DLFH 2BWDA 1FN4A 4NGHL 5GGSY 2PPFA 2MFNA 2L7EA 3NJVA 3QPQD 3VD9A 1MCPH 3VDAA 1F3JA 2YRLA 4YXHH 1FLTX 4OFPA 5H2BA 2WZ5A 3WLWC 5MENB 4JFQB 5I6XB 3ESMA 5DJZA 4Z7WE 4F15C 2J8UA 2Y06H 3WIHA 2BK8A 5IT2L 1HCVA 4YS4A 2D0GA 3FOMA 2Y5EA 2D03L 2XA8H 4FMKA 5T8IA 4DN3L 1XGYL 2XWDA 2IVFC 4HC1L 3LQZA 1BVKB 4AT6A 4JHWL 3IE4A 4S1DC 4TNEA 2V7HB 2DY2A 2V5TA 4U3XA 3B9KA 2YA0A 5E8DH 3O2WH 2UY7B 4JE0A 3VM5A 4PJ8B 3WTSA 1H5BA 4P2RB 4W93A 5C70A 5A3IC 1XL6A 3D69B 4DAGH 3H2WA 2YAOA 1ETZA 1XR8A 2KC0A 5AOIA 1NGQL 2YWYA 3RA7L 2H9GA 2O93L 5B38G 4PJFB 4O2EA 1J5CA 4QLRA 4TYUA 3VWKA 1MRDH 3MCKB 2JLPA 2ZSWA 4MZ3A 3UO1H 4P05A 3TH3T 3K4AA 4FEMA 1NBZB 2B8OT 5K1NA 3GM8A 2ZXGA 1E7UA 1G1OA 4N0CD 4UUJB 5CGTA 1ZS8B 2VDOL 3VXNA 2XN9D 5BS0B 1JK8A 2WYHA 3BUPA 4MB1A 2OMYB 4KRPC 3TO4C 4Q9RH 2RMNA 1ORQB 5GS2H 4U1GB 5KYUA 3T2PA 2J4WL 2Y25A 5KYXA 4HISA 3RZWA 4L4TD 1E4XI 4JFYA 2QGBA 3QZWB 4JANB 2VUYA 3CUPA 4MAUL 3TA3B 1HZHL 1XSKA 1X44A 4YVNA 1JWSA 1YPZA 4WWKA 3AT9A 4YAQB 4ZS7L 3WJLA 2EUVA 1S8DA 2B3IA 2F5AL 1VZGA 3U9UA 1PLBA 5BV7B 2LTQC 3FDWA 4HKXA 1FYTE 2JCCA 3BEWB 4YBHA 3SYQA 5ECJE 3SGDI 1QABA 1ZVNA 3ZKXC 4GIOA 2DN7A 3PQYB 1OGPA 2ZAGA 2OMZA 2DLGA 3EHBB 5F3HA 3JWOH 1YMMB 2H2SC 3ESOA 3NJJA 3PCYA 3S3BB 4FQ2L 2IALA 5DK2A 5C6TL 5JPNA 4GT7A 1BQHB 1T0MB 1VGKB 3CPLA 5E1AA 3RWDA 3S5YA 3KPSB 2AJXL 3Q6GL 6TAAA 4Y4FA 2HRLA 4HCRA 3HI6L 3SYAA 1LWRA 1FVCA 3TVMD 3TJPA 2ATKA 1NEPA 2X12A 3PXJA 1H8SA 4XXDB 3HI5H 1JV5A 3KNBB 1NCWL 3I84A 1AZZC 5CHNB 5EO9A 2DQUH 2H6OA 3DOSB 3ARDC 4XE0A 2RQ8A 1PSKH 2YBRA 5DURB 3S7GA 4Y0GA 3ISYA 5CJ8A 3BHBA 2E6PA 4M7JH 4LMQI 5E0QA 4A2GA 5I2IA 3R4DA 2C9PA 4QXTA 2MOGA 4WHTB 2B9AA 3SY0B 4W4NA 4I18A 2YFNA 3IB4A 2IJ0C 2AEIT 1U8LA 2RBLA 4A63A 4BZ2H 3BSGA 2WNKA 1Z9SB 1UXMA 4PJ7A 2Z8SA 3GMRB 4XNYH 3K0YA 2VN7A 3KJ4C 2R0KL 3IFLH 3MCYA 2XWCA 3NJXA 4MJHA 5CSZA 5D7IF 4NO0B 4A6YA 5L6YL 2QKIB 3QSKB 1KCSL 1EHNA 3MJGX 3SY6A 4IJTA 2B39A 1EERB 3KBEA 3OD3A 2H32B 4PJGA 1T7ZA 5IJVB 3PRZA 4U6TA 5IOPA 1LEIA 1S5IL 5J1AA 1CIUA 4DPAX 2XZAL 4CBPA 4U05A 2J8HA 5IJDC 1ETB1 1H6EA 5JMRA 3FH8A 4OD1H 1AY1H 4IMKC 4I77L 4JO4H 2PN5A 3UG5A 4GAYA 5KJ4A 2ZYSA 5AB1A 1KXTA 2G5BA 2BS71 3KLDA 4L3EA 4LSRL 3WFBH 2R27A 4YR6A 3K2MC 5JHDD 1Q9WA 4RAHA 4L37B 2IG2H 3MRCA 3LYRA 5I1GL 1MFCH 3TBYA 3HG3A 2YOCA 2HJLA 5E5MA 4XZUA 3TYGL 3V0JA 4JQIL 4AL8L 3CFDB 5K9KB 2X28A 3ABMB 4H8HA 4J6RH 1J9RA 4EN3A 3T3ME 4PRAA 4Q6IC 1BQSA 1AGEB 3CTTA 3BLPX 4ZXBD 3QEGL 2NRDA 1E9QA 1BOGB 5GS0L 5SWSB 1HWHB 2GSIA 1AC6A 1DBMH 4WEBH 5I0XA 5JXAH 3S34L 3FQ2A 5FYKL 1K5NA 1OGAE 4TRPL 1SRDA 5GRZA 4JKPL 2R0WH 5CJXC 3ZDZE 1MJ7L 3GSXB 1M6OB 4RGOL 1QSFB 2DQFA 1OD9A 2HFFA 3RE0A 1J5OH 1G6RB 2YPLB 3TIDA 2C9SA 1TQTA 4JFXA 2Z92A 2IFGA 5JYLA 2D7PA 1ZGLP 4KVNH 2BSSB 4X99A 3N42F 1PNDA 2ICES 5CO1A 1MY5A 1QFOA 3PWNA 3TPUA 4N8UA 1JGLL 4K55A 4I1NB 2GTZA 3VB9A 4C4KT 2GBTA 1AP2B 1XR9B 1UOWA 4APQD 3C75A 4GG6A 4NZUL 4AENA 1NCOA 1RZ7L 2G5UA 1OCRB 1D5ZB 1R3KA 2F5BH 4HD5A 1ZT7B 4MLSA 2YGQA 3NA4A 3DGDA 1AO7A 4ZDHA 2FWSA 3FOLA 3QZLA 1L5GA 4F2MA 2B20A 1WBYA 4G1MA 1KB9J 4PV8A 3J27A 3LHPL 1MCWM 5EEXA 2OJZL 4JHAL 1AHMA 5DZOA 1X6NA 3EAKA 4RMRA 1E3ZA 4EDXB 2ZOOA 2KERA 3RVTD 4HZLA 1N8ZB 4ODSH 5HDQH 8PAZA 1KTLA 2WB1A 1WHOA 3IGAA 4PP2B 4XO5A 4YHIB 3T1WA 4H1LG 1INEH 3IS1X 3KD4A 4O02L 3HAEA 1M1XB 5KJ7E 2NXZC 4NQDD 4JO2L 1L9PA 1LO2L 3X1NA 4FLSA 5DZNA 2GC4C 1DVQA 3VB8A 1TLMA 2CKBH 1P4UA 1BCIA 3CSBA 1NAKL 4HLZH 4OZIE 1AQKL 4AYGA 2NY2B 3G6DH 4PP1C 3ZUNC 1A4CA 1OCZB 4TVSa 3TBVB 4ZOBA 5DMKB 1ONQA 3M7OA 3FB6A 4BFKA 2DEWX 4ODHL 4QPEA 4TSCH 4JDVB 2R9HC 5DZLA 1NGYB 5C6WH 4UINL 3O6KL 2XY1A 5JORA 1KZQA 4PTUA 4GOSA 4F57H 4ELMA 4AH2A 2OV0A 2CPUA 2V2XA 2DAVA 2VABB 4PGDA 5C0IB 3ARFB 1T03L 4TV3A 1H3GA 2Q86A 3U4KA 4DTGL 5D1ZB 2OSXA 5BUAA 5E4OA 1AGBA 4HGWA 3L3HA 1ET7A 3OMZA 3MFFB 1NBYA 4G8AC 2MH4A 2WKOA 3KS0H 1JNHA 4N2OA 4XWOC 5FFLA 1CXEA 2H0PA 3UACA 1J87A 1R5IA 3FFOA 1A21A 5EWIL 3FU5A 2VW7A 5TE4L 1UCBL 4WZ9A 2OMWA 1KJ2L 4MJID 4YZFE 3DUUB 3MROA 3TJEH 1HT6A 2BY0A 1R3JB 4FG6D 5IHUH 3DVNA 1L4IA 4NO2A 5SWZA 3ZTJG 1R47A 3AT8A 1UH4A 4RGND 1M2VA 2QQKL 4KU1A 1QWNA 3RL2B 4K7PH 5DFVD 2V9TA 1CG9A 2YMTA 3MQIA 1TVHB 4IRZH 3GXDA 3COOA 4OY9A 4J3SA 5G2NA 4Y1AD 1OP4A 3MLSH 1CFQB 2XPZA 3CHPA 3N41B 4JFOB 1MHCB 2N4IA 1GCFA 2E9GA 4PG2A 2G30A 2HN7B 1QW8A 4I0PB 3QS3A 5IQ9A 1NAML 3BWUF 2NW3B 2JKXA 3IETB 1QR1A 1RIHL 3MUZ1 1N4XH 3RY6C 3L9YA 1E6OH 4N2IA 2IPTL 4B9CA 4FFZH 4UIMA 3TFKC 3L3DB 1ZLUH 3P9MA 5DRZA 1CT8A 3ZDXF 3QJFB 2ZXEB 5I17A 2R0ZL 4ODTL 3UPCA 4OFIA 1PKOA 1R6VA 4KV5F 5DJ2B 2XVLA 3CFMA 4XN1A 5CS7A 3H7LA 1JFHA 1UZ8B 2VXQL 1RVFL 4HQQH 1WAEA 2VLJE 4U1KB 1GH7A 1FNGA 4JRXB 1CDCA 3M8OL 4QHMA 1FFQA 4Z7OB 4W1TA 5KVDL 4G3YH 3H7BA 3VFMB 5JZ7D 4YE0A 1UOLA 4U7KA 3AS2A 1EMTH 3ZT7A 4HUMB 4UWQB 5B1JA 5IK3B 2WZPD 4J2QA 4C59B 1F1AA 2VXUH 3FFCB 4X80L 2CUHA 3FULA 2LABA 4FLHA 1MCNA 2FO4A 4N4YB 3OJVC 2QR0B 3W9EA 3QUMH 3ULUE 2AQQA 5F0PB 4C4UA 1CLYL 4OKVB 2FLRT 4LP8A 1EDYA 3VFTA 5F9DC 4KXAA 1OAKL 1A14L 1MXDA 1TU2A 1CD1B 3QR2A 3ZE0B 3DX2A 1CBJA 2ZONA 3RFRA 1DQJB 5D7JB 4L23A 5J7CC 4IRSD 1YDPA 2WOBA 3IVKA 5IM7B 1QNIA 4Y16A 4W6WB 5BQ7B 3RTQC 3POCA 3QO1A 5AB2A 4K8RC 5C0AB 1GAFH 3EFOA 4ZX6A 1FF5A 1T1XA 2I7SA 3RZCB 1T5KA 2BP0B 5D1QA 5HDRA 3WJJC 5CIPB 5T3XE 5KANI 3EYFA 1JZJA 4IBZA 4LT7A 4IBUA 2VRAA 3EOBA 2E9WA 4MD0B 4NXKA 4OGYH 3MRQB 1UM5H 2WLLB 2VKXA 3QUXC 1KLFA 4W9JC 4XMUA 5IVZB 5ISZA 4L1BA 5DQDL 3V6BR 1YO4A 5EA0L 3BZDA 4LGSB 1V10A 2WXLA 5AZ2H 2ADFL 2X6CA 2A6IA 1TZHB 4XP1L 2ZWSA 5I30L 2Z1PA 1H0DB 4ZFFA 1DQLL 3HFML 4XMVA 4Z7NE 1LP9F 1ECYA 3QE5A 4LDLB 4FTVE 2FR4A 3HUJE 3U30B 4PGCA 1TNMA 1U0QA 7CGTA 2OTPA 4PGZA 2WINA 4LLMB 3O6FA 2ERJC 3OHXA 3A0OA 4HJJL 4JFED 3WJMA 4AWJC 1WWWX 3OSKA 4P4KD 1KTCA 1D5MB 3RKDD 5FO8B 3QFJE 3VXQB 3EDEA 1ROCA 5EFIA 1NOAA 1ACXA 2OL3H 1B9KA 5LVEA 3TO2B 1H3WM 5LO7A 3HG1E 4OQTH 3N40P 4JJHA 2A77L 5D70H 1OGTA 4HLEA 2CO3A 5J6GB 1VFAB 3VACA 2YEQA 1MHHA 3LVEA 2FRGP 1FNEB 2EE9A 2Q76A 3CZGA 4NJAL 2ZSVA 1T21B 4XRCB 5LNGA 4I89A 4CL7A 1JTOA 3EF4A 5AW6B 4LK4A 4XPHL 4K5LA 4W9CC 3AS1A 2CALA 1YNTA 4MZ2A 3RGVB 3KXFA 5DR5H 4HSAC 2JWYA 3V0HA 3WGVB 5CINL 3S35H 4Y89A 4KUZL 5C8JA 3FUJA 4FLRA 4AMKL 4D9QD 3HRZA 3WNIA 3CVCA 5E6ID 3DPDA 1MCOL 5CGBA 5D1ZI 1PW3A 3EF7A 3EOTL 4BHUA 2WXQA 3EO1A 3NIDB 2GUYA 5FGCE 1J5DA 5KVGL 4UILH 1MY7A 4PRPE 3M1BB 2OZ4H 4XP6L 4NKDB 5F7NC 2ZD0A 3RX9A 4HUUA 3CH8A 4HDIB 3FU7A 1JCKA 1XF4A 3QDJA 3PJSB 4IS6A 3BAYA 3OXRA 4XPTH 2EXWC 5IEKB 1ADWA 2YMXH 3KEHA 4NDMB 3EZ8A 4M1DL 3QJQB 3US0A 5FGSA 4FQCH 2ZSWB 3GM0A 4BGLA 4LIQE 4LXFA 5FYLD 5JXED 5DUBB 1UACL 4XPBL 4R96A 4W9HC 1FV1B 4HVBA 1AZBA 2V9UA 3SDCC 1NFDF 4I4WA 1D9KC 4PJ9D 1F41A 1OSPH 1A4JB 3HC4L 5TH2A 5BUPA 1T5XA 5D1XB 4PV1C 4WFEE 3BP7A 2ZCLH 5I1AA 1JI2A 3BUIA 3MCLL 1GY1A 1IM9B 5ALBL 2WNGA 2EYRB 5KYYB 2EDRA 3D39E 5B4MD 3VFVB 3U9UB 1JXGA 2CDGA 4FP8H 1TQWA 5F89B 3V7AE 1DR9A 3L8QA 3MV7B 3N3EA 4IRJD 5EMYA 1M05A 3BT0A 4LDEB 1SJVA 4WRLA 1NUFA 5AL0A 4XNDA 1WBZA 3QJXA 4AYFA 2ED6A 1BFVL 2OTUB 4NZJA 1KEML 3DX9A 2EZ0C 4XP5L 3WUWA 4FFWC 3KGTA 2IAMC 1KF9B 2IQAA 5H35A 1CDBA 1RULH 2ZJSL 5F1KC 1QEXA 2EH8H 2MQ3A 2B59A 5CM1A 3SKMA 4YGVA 2ENYA 3U1SH 1JZIA 3HMXA 4XO3A 5CCKH 1OSZA 2BOBA 2PWDA 1FVCB 2OMBA 4LKXA 4LOEA 3I9GL 1S9WB 3CZJA 3ROOB 3NABL 2R7EA 3FF7A 4UM9A 2OCCB 3VVWA 1OPGH 2G60H 2G4GA 1NCNA 5IROD 3N1MC 4AUYA 2IANE 1NBVH 1QRND 2C9XA 4X8CA 4JFZL 3IMBA 5C2BH 3HOGA 1EZLA 4LF3A 5CLTA 4Y4KA 3LS5H 2J21A 4XE5B 4NBZB 3T65A 1UT2A 4YFDB 4KKBC 4ZO7A 5AVSB 2JTYA 4M1GL 4X4XB 4KI1A 5JHMA 3HPLA 1X9LA 2QLYA 5IFAL 1U8LB 3P4MA 4EIZC 4S0SD 4I9WD 3GMQB 5I8KH 1A6WL 4XC1H 2JIXB 4CSTA 4CVWA 2ZOKA 2D9CA 3MGTA 4C8XA 4WCYH 4GRLD 4ORZC 4PCTA 1KJMB 4LCUA 4HK3N 3NGBB 4LAQL 4KTDH 4HGKC 4ZMYA 5DHXB 3UTZA 2BSTB 4K3EL 3MC0A 3UBXG 2WYIA 4BWTA 3FB5B 2P52A 4ZFGL 1QZ1A 1AMYA 2D7TH 5I15L 4ZD3L 2IH3B 1RZ8A 4AL8C 2A9ML 4OIIL 3AREC 25C8H 5E2VL 1FGNH 4XAWH 3UC0L 1PPIA 2ROYA 4DVRH 2F19H 4KI5D 3QIBD 4URKA 5I9QB 4YR6B 4HIIB 2AABL 4HK0B 3IKCA 2DDQL 1AR2A 3GSVB 1E5CA 3OAUL 1Q0YL 1YCSA 2CR0A 4CU6A 5GS0C 3EYQC 4LZKA 3CHSA 2NPLX 3GSQB 3PP3K 3FN9A 3D2UD 4BUGA 4G5ZL 3ALPA 3GMPB 3P0YL 2YA2A 3DC0A 4NQQA 2EP6A 2XWZA 3ARXA 3V0EA 3GTNA 2JI1A 3WSQH 4NQEB 3I9IA 4NX0A 2Q3ZA 3NAAH 3NFSL 1JPEA 1PBYA 3D87B 4TQEL 3R7RA 3QNYB 2JMRA 2XWTA 4ZMZA 2VLRB 4HIXL 3ALWA 1KBVA 3I3DA 4BH8B 4X6EA 2VMEA 2J6EL 4BBWA 2VT0A 4WO4A 1AKJA 2ZOWA 3KH3A 4NXSA 4HXAL 5DEZA 3MBWA 2EDNA 1KY6A 2MCPL 3TIDB 2I9LA 4YDLC 5C0EA 1NFAA 1DO5A 4QRRB 3G5VB 3DHPA 4GW4A 5C08A 2AK1L 2PO6B 3NEOA 3QPXH 1TJIH 1GZPA 5DMGC 3EBIA 4XPAL 2F58L 3I9AA 4BFBD 5HPMA 1JDDA 1URIA 1GGTA 3CVDA 1M7IA 1BD2D 3U6RA 4LRNL 4Y5YB 4KVCL 3HE6D 4OJEH 4P23A 3HC3H 4DCQB 2QMKA 1MCHA 3C5SB 3S37H 4S1RL 3IBOA 1KN2L 3QULA 5AWNL 4YWGL 4U1NA 5KSVB 3WMSA 3CSGA 4PIRF 4WU5A 1UA6L 3C6EA 1XGPB 2AV1B 2C1PB 5TDPA 1OQOA 5JQHC 2QPSA 2UVFA 4WY7H 4MMZA 4M93C 3V0AC 1PKQE 3QPQC 1K4CA 3ETBF 3B3IB 1AC0A 2OI9B 2XX0A 1JGUL 1KB5L 3RQ3A 1LEGA 3UBGA 3U9PL 3BCFA 3LN4B 5MEOA 1XIWA 2KLTA 4PB0L 3V5KB 5LDSA 1FP5A 5IW1A 2R2HA 3ZSSA 3C6LA 1KGCE 3MYJA 4H8WL 1U3HD 1S6NA 3VXSD 2WQVA 3FHQA 2JB6A 4KHTL 4POUB 2FBOJ 1ZOXA 3CH1A 1B0GA 4ZW5A 1OT1A 5C1MB 4NYLB 7FABL 5K5YA 3HIZA 2WP3O 3JYBA 1SFHA 2ZCZA 4WNJA 4JM2F 1GPOL 1W72H 1A7OH 4JGMA 4UOJA 4PD4J 4P5KB 5ID0A 2WBJC 5FM5M 5LBVA 4MX7A 2FEDD 1BQUA 1EUTA 5EIIG 4QIRA 5DHYA 3UAFA