3WTTA

Crystal structure of the complex comprised of phosphorylated ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 22
structure length 119
sequence length 119
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wttA00
1T4WA 2BIPA 5A7BA 3QYMA 1TUPA 2BINA 4IBVA 4G83A 2FEJA 2XWRA 1CO1A 3WTVA 3D05A 5LGYA 4A63A 3Q05A 4GUQA 2ADYA 4MZRA 4MZIA 3WTTA 3EXLA 3ZMEA 3WTUA 3QYNA 5AOIA 4L18A 2X0UA 2X0VA 3US0A 4AGNA 2XWCA 4IBSA 4AGQA 1E50A 3VD0A 3WU1A 4GUOA 1KZYA 2BIOA 5ABAA 2AC0A 4IBYA 2J6WA 3WTWA 3VD1A 4LOEA 4IBZA 1EAOA 4KVPA 3IGLA 4AGLA 2IOMA 2BIMA 4QO1B 2OCJA 1HJCA 4HJEA 2P52A 2J1XA 2J1YA 1HJBC 5AOKA 2X0WA 4G82A 3EXJA 4IBQA 4AGMA 5ECGA 1GZHA 4AGOA 3Q01A 1UOLA 4LO9A 2MEJB 4IBWA 5AB9A 2RMNA 1YCSA 2J20A 1EANA 1H9DA 2BIQA 3WTXA 3TS8A 2J1ZA 2VUKA 4LOFA 5G4MA 5AOLA 5BUAA 3WTSA 5KBDA 2GEQA 4IJTA 4L0ZA 2H1LM 5G4NA 2IOOA 3VD2A 5AOJA 4IBTA 5AOMA 4AGPA 2ATAA 2J1WA 4IBUA 2YBGA 2PCXA 3D0AA 3D07A 5G4OA 1EAQA 3Q06A 1CMOA 5LAPA 3WTYA 4L0YA 3KZ8A 3D09A 1GZHC 1HU8A 3D08A 1LJMA 3KMDA 2IOIA 2AHIA 2J21A 2WGXA 3IGKA 3US1A 1TSRA 1IO4C 3D06A 4XR8C
chains in the Genus database with same CATH superfamily
3M1OA 4B53A 1NCDH 5IR1A 2EE0A 3QJFB 3DBXB 1XX9C 2XNAB 3BKCH 3EOAA 3IJ9A 1BFVH 1GGYA 3JWNH 3O6MH 1R24B 2XKNB 3W11D 1SYVB 3TIEA 5IV2A 4U1KA 4LDLB 1HHIA 4JG9A 2YQ3A 4IRJC 2OMNA 4S1SH 3TBSB 2X0UA 3SQRA 4JZJB 3VX0A 5EIIA 4Y1AE 5I74B 4O5LL 1M05B 5A2AA 4X6CA 3L16A 3L3OB 3O11B 3WDJA 4PD4J 2ZUXA 4IBYA 3C6LD 4WVRA 2FSEA 2F7IA 3ATEA 3NAAL 5HHQB 3TCTA 1A6UL 3UTPD 4E9WA 1OWWA 3IFOA 5ITFA 4NKOA 2M8XA 1CIDA 2X4UB 3SPJA 4EI6B 4WW1A 1I9EA 1NBZB 1BEYL 2LGNA 4Q74A 4P23D 4OSUH 2QPFA 1CT8A 3BOVA 3NEOA 3OVUB 4FKKA 5DZLA 3TA3A 3WXWH 4PV8B 1R5VB 2ESVD 3O4OB 1NAKL 4H8QA 1DQVA 1UZGA 2AI0H 2GAZB 3ENEA 2OAAA 3Q2NA 2NUTB 4XP6H 4N5ED 4QRPA 1FVEB 3TH2T 5FF6B 3TZVD 2CGZA 5D7SL 4U6YB 2Q76B 5JHLA 4QRQB 4XTRC 5F7UA 1IBGH 3QUMB 4ZOBA 3SSGA 2V9QA 4N9GB 4E9QA 5GRVL 5J12C 3MREB 4I3RL 1E28A 3HS9A 1C5BH 4HJTA 4NPJA 3W3BA 4GT0A 1M9SA 1DQML 3ZE2F 1RUPL 1DN0A 3UROR 2HT2C 2LAAA 4YC2B 1I9IH 5AL0A 2LLNA 1SZNA 2B16A 5HPMA 1FFPB 1YEKH 1BIHA 1VRSA 2EXSA 2WXOA 2XCMC 2H3NB 4NIYE 2VDOB 3TV3L 3VCLA 2N4IA 3AWGA 4ZPTA 4DN3L 1IGJB 4TL5A 2H47C 1SHXA 4QXUH 1JPGA 4P9HL 2BDNH 1PJ9A 1TKWB 2X9XA 4JRYD 3QXVA 3OAUH 4PLJC 4WU7A 1DEDA 2WIMA 1A8JH 1WO2A 2BY3A 4IHOA 4CADA 1PYWB 4AQZA 4AEIH 4AMXA 1WBXB 4JFXB 3E9TA 4MJID 3UXFA 5HGBB 2HG5B 1BAFH 1UXWB 2NY6C 4OCWH 1EXHA 1FH5L 4MYWB 1W80A 5IJKC 2NQDA 4KTDL 2K6ZA 3WE1A 2P3YA 3KLSA 2BMKA 1FL6B 1UTDA 1VFAB 4Y2NA 3M17A 4JFHE 3FTGB 3BWZA 4YDKH 1EJOH 3GZPA 3W39B 3ZZLA 2W0PA 3AU0A 5CFAA 2H2PC 3SPHA 3AXHA 5CSGA 4RFEA 3PDOA 1BPLB 1U95B 4RX4D 2VITA 3RYMA 4W1TA 3NFSL 4H0HB 5D1ZB 4YXKH 2WIIA 4ODTL 3WTTA 3BP6A 1LYQA 3O6KL 1J0IA 1ZLUK 1OCZB 5C3TA 2DQTL 2EILB 4P2OA 3SDCA 5BVJA 3US0A 3DURB 4C54A 3UEQA 5K9QG 4Y2DA 5CZRA 1DEEA 5KBMA 4LFHD 1G7HA 2XV0A 1RPQA 3KXFE 2B3IA 2FJGA 3O3EA 4PREA 1J8HB 4W9FC 4CDGC 2WUCL 3MJ8A 2WXMA 2TRHA 4E41D 5C92A 1DBMH 1QFUL 3GSOA 4LLWB 1E7UA 3JV6B 2AV7A 2GUYA 2WVVB 4DEUA 5A3IC 4J23A 4M8QB 4ZOAA 5J6HB 3MI6A 2O6CA 1GGCL 1WS8A 4PJCE 1XGRA 3GB7B 1P7QB 1B6UA 3CQQA 4I77H 3HZYB 4HWEL 2ILLA 4TVPL 1IBYA 3Q6GH 4OZFG 3L5IA 1XHHA 1N26A 4LEEA 1H5BA 5T1KD 4D8PB 4RIRA 4WGVB 3MXWH 4TLSA 5F2FA 3HPLA 4TMPA 1B9ZA 3RP1A 5C3IA 4NAQA 1IZJA 4OLVL 4P46D 3TTYA 2WKGA 1P5VA 1RLBA 4ONHB 4EZMA 3ZE0F 3CSPA 3BUDA 4MKTA 3ZT6A 5D2NE 2J88H 1FGVH 2YMXL 4L8DB 3MROB 5DHYA 4ACPA 4R2GD 4QY8B 2H2PD 3VD2A 2RJMA 3QFJA 3STZA 4IBTA 4UZUA 2ZOKA 3G08A 1P84K 2QADC 2X4SB 7TAAA 2DLFH 3DVNB 1WUNT 5JHDD 5C09E 2X53A 4XNZB 1KT2A 2APBA 2QMJA 1AQKL 1VFBA 5FYJD 4IU2B 1CICA 3SPVB 4PSPA 1BFVL 4C4BA 3VX1A 4OFVA 1NZRA 2NW3B 2A6KB 4QXTB 1IQDA 1AQHA 1BVKA 5CN2A 2IQ9H 3Q6FB 4MB4A 3W0WA 5E70A 2IAND 2O26U 5JW4N 4HJGB 5E7BA 3GI9L 3VD3A 5IEKA 1MOEA 1QTSA 4I2XA 5I8OH 3FUIA 2PP7A 1ET7A 3GS4A 1PGRB 4JDVA 4LHJB 1IEBA 2AZAA 1R0AH 2XVKA 5FA4A 4OKVA 1UD6A 3ZQ9A 4OM1H 32C2B 3RUGE 3HE6B 3DO4A 1U30A 3FTWA 1BG1A 4M5TA 3KWUA 4LPTA 1RZIA 4NQCD 4YSEA 2CR3A 2OJZL 2GYSA 5GGRB 1C7SA 5L9DL 4NT6A 3VWJA 2OQJB 1WJ3A 4H40A 5FUZL 4D3CH 2G30A 3L8QA 3U9PL 2R2HB 4CU6A 1LO2H 4A63A 3V6FB 3LKSA 3D2UD 1KGJA 1T2QH 4O58H 5A2CA 2NY2D 1UM6L 3VGHA 1KC5H 1DJIA 3GNML 5DMKA 1D9KB 1JGUL 2EINB 4AGNA 5EIIG 3DTXB 3QO0B 4POUB 3H85A 4UYPA 4NSKA 4PIRF 3HKZA 3HNVL 1TPXB 1F3JA 2X7LA 4U1HB 3RY6C 3VXSA 4ZMOA 5CAYB 4YHIB 2J6WA 2XDHA 3O6LL 4YSDA 4J8RB 3B9KD 2Q1EA 2XPGA 3ZKXC 1N8ZA 3PWNB 2ICWI 4GXUN 3KYAA 4PFEA 1IGYB 1YC8A 1K8DA 3WJJC 3EUUA 3BKYH 1FN4B 2VW4A 3VI3F 1A6ZB 1L0XA 2IALA 1P4BL 5L8KB 2ENQA 4KPHH 5ITBL 3B8SA 4XRCA 1I31A 3UERA 1T1ZA 2IXQA 5DUBB 1DQTA 4PQXA 1CFVL 1Z9LA 3KG5A 5DLML 5I26A 1QD0A 5CIPA 4FQIH 3OPZL 3TN0C 2NY5C 1UOLA 1M2VA 5TD4A 1OAKL 2K6YA 1EXGA 2ADJA 4HSQA 3VFWA 4GB9A 4YK4B 3ME0B 1MN4A 4HW6A 5EZPA 3MBEA 1A7RL 2OL3L 3OKDA 5I0XA 3QDGE 2VT0A 4F2FA 1KLFA 4XP4H 5FGBA 4JO4L 1CDCA 4XBPA 5K9KA 4L1SA 2F58L 4FQHB 1YQ2A 4RAHA 3S4SA 5IHLB 2Z7WA 1NCCH 4WUUB 1YY8B 2WN3A 5ANHA 2AEOA 1YZZA 4AM0B 1A4KB 2EEDA 4JN2A 1E6JH 2AZUA 3RHWF 4KKRA 1FYTD 2W0KA 4MQ7B 2PF6A 5DEFB 4XXCC 1LEIA 3SOBH 1WAAE 3IJYB 2OL3A 4HAGA 3KLAA 2HFTA 3QAZB 1JGEA 4GYBA 4HXAL 2NYZA 4ZMTA 3GPSA 5IREA 4HX1A 5C0AD 2HFGL 1OGSA 3LN5A 3EF4A 3MA7A 4K4KA 3V0EA 3T0EB 3FFCB 4K7PY 4PJXE 4PWIA 3WFHA 4N2LA 4ALAC 1FFTB 1GGTA 1I8KB 1QFWH 4LDEB 3NDZE 3MNWA 2P7TA 3CN4A 4IK7A 1YNKL 4KDVA 3IDMA 2JKTM 3FB8A 1NTDA 5T8IA 1I8MA 2VXVL 1IT9H 1IX2A 1HVXA 5JOPD 1CF1A 2H2SD 1A1OA 1TZAA 5FYJL 1CE6A 2CGRL 3QNYB 1XL4A 5CEZH 4NNXA 5AEAA 4HWZB 3WFZA 3ROOB 1UURA 2WGNB 3AJ7A 3PAVA 2OP4H 3D69A 1Q38A 2FECL 4ETQB 2N1TE 3IF1B 4YHOL 3UMNA 4ORGB 1JYNA 1FNGA 2R0KH 2OSLA 4YGVB 4D0CA 5MEOA 1RFDH 4FXKB 4PLJD 4N8UA 3MLSH 4P4KD 2XKSA 3ETBJ 1HCZA 4GW4A 4TNGA 3DUUA 5TDPB 3QO1A 1NGWB 4ANVA 1WIOA 3C9NB 3I2CL 5KSBF 1LDSA 2G2NA 4GRWF 4UT6A 3O3BA 1JTOA 3OKKB 4UT7L 3N0AA 3QHTC 5I82A 3C5ZB 2BW4A 3IBOA 2XV3A 1MFCL 3QRGH 3UOAB 1T1WB 3SJVB 3ESMA 5I2IB 3OZLA 4LNRB 2JCWA 5D72L 4NC1E 4KTGA 1P69B 2EIBA 1U0QA 1MDTA 3CFJB 1HHGA 1OSEA 3QS2A 1PFOA 5KSUA 5I1DA 2CBPA 5FKAB 5GZNC 5DRZA 4BZ2H 3OF6D 5LUMA 2ZJSL 3EOYG 3N85H 4KTEL 5E00B 4F2ME 3HBGA 3O6FD 4KMTL 3MXWL 3P9LB 1NFKA 1UWYA 1MRFH 3H9SA 3VSQA 1X5YA 3PWLA 2CO7B 4I18B 2ETWA 4LQ1A 3TS8A 4GKLA 2VSDA 2IPTH 1IGIL 4F7PA 1T22B 1G43A 3OAWA 3QR1A 3X12B 4Y9EA 3WTSA 4F5CA 1CU4L 3KJ6H 5C9KA 4IJTA 3E1F1 5LKNA 1PZ5B 1PD6A 2YWZA 4U7SA 4A7VA 2WTRB 1TQTA 4GXVL 4NC0B 4AYID 1BYNA 3OX8A 4ZS7L 1F0LA 2BC4A 2OMWB 3E8UL 3BUQA 3IU4L 3SOBL 3BE1L 4HEPG 4IIQB 3AG3B 4AV5A 1S78D 2KBGA 4UZGA 2QVMA 2XN2A 2G3MA 4NN6C 2V3EA 3UGXA 4HIEA 4NJ9H 3QAQA 4ZW6A 4K55A 4PUBL 5TE4L 1NCBH 3CFDB 4XNAA 3ULVF 2P24A 4U0QB 4IRJD 4IRSA 2XZQL 1GGIH 5IF0A 3E3QC 4JRYE 1LO0L 2D8KA 4KDTA 1MCIA 4ZUUB 4HULB 2VLLB 1TJIH 4HEMA 4Z7QE 3F7KA 3AU1B 3VMNA 1QKZL 1X6LA 4NRXA 2Q8AH 5D6CB 2FNBA 1HQRA 4OZHF 5DJ0B 1X9LA 3QUYA 4QTHA 4GAYA 5K69A 3TV3H 4FQ2L 2JB5H 3BRGC 4AC2A 5EO0B 3DSNB 3IKKA 3SDXA 2Z92A 3RIFF 4MZ3A 4NUJB 2APTA 1KJ3L 2WZ0A 4G9FA 3I9GH 4HKZB 1KMGA 4RGOL 4Q52A 3BKYL 3IFPA 3L9YA 2Z8VC 4HG4K 1JGDA 2FGWH 4YFLI 4E5XB 5ANMA 1IGMH 4QF1B 3LXCA 2GQHA 3PXHA 4C4UA 1CGUA 7FABH 4YHPA 1W0WB 4ODTH 3HE6C 3R19A 4FYSA 1G7MB 1AIZA 3SBPA 5E6IA 3RNQB 3GFUA 3KWWB 3O6LH 3U0PA 4G42B 4Z95L 3K2KA 1U8PB 4JZJC 3CFMA 4LCIL 1A66A 3DIFB 3FB6A 3VI3B 2PR4H 5HYSB 2BPBA 3OSVA 3MODL 4QYOA 2B4CC 5AYUH 3JWOC 3UYRH 4A7SA 3HRPA 2WBWB 1D5MB 3PGFL 4Z1PA 1MHHB 4L8SA 5JXAH 3C5SA 1TCRA 4PRPB 1NCGA 2IBBA 1ACYH 1Z1WA 5TDNA 3KJ4C 1QSEA 2N7SA 1U36A 1HTYA 1Q9WA 3ARXA 4AXWB 4P57A 1AJ7H 5ESVA 1NJ9B 3O9WC 4GRLB 2JXMA 3RE0A 2VR4A 43CAB 3EFOA 3E9UA 3MFFB 2K78A 3QQDA 5DR5H 5C0GA 4CN6A 3DJTA 2PWDA 1BD2A 1JHKL 1ZHLB 1OEZW 3A3YB 4NLHA 4RFOL 5DZVA 2VAAA 3GI9H 4UCFA 4YNYB 1JVOA 3KYKL 3P3SA 2NZ9D 2X5PA 4P2RB 3N06B 4LP5A 3CHRA 5C0CD 1HXMA 4X4YA 5JXED 4G80B 3AY4A 3JWNG 4OFYD 2X12A 3SDCD 3V5HA 4NFCA 2K0RA 4M93B 4GG8A 3RGBA 1AMYA 4WTZG 3QUXD 2OMTA 3D0LA 3CCHB 4RAUA 3NP3A 5C09B 3ULVH 1FA4A 1TNMA 3CZJA 5DFAA 1JGVH 1Z9SB 5IMOB 1VJSA 4I0PA 4M7LL 4TNWK 2AW2A 4FOMA 5HHXL 1TZHA 5CD3A 3QXAA 1C1EH 3WY1A 5CEYB 1JDDA 5F1IA 1SRDA 3A4FA 1E8YA 1QKZH 4JW3A 3KPMB 4N0CD 5D71H 4TVPE 1NUFA 3HUJE 3LEXA 2EVFA 3ECWA 3A4DA 1RPKA 2D3NA 4MA1B 4Y16C 1QLEL 3P3UA 3X1BA 5J7CC 1A6UH 4LLVB 5HGAA 1I7TB 4AE1A 3QDMD 1CFSB 4ZNCD 1R46A 2BXZA 4QRSB 2XBTA 1GGCH 3DX6B 3BIBX 1T0NB 4YSQA 2E74C 2QDWA 4JY5H 4DCQA 2VE6A 3EXLA 3D0VA 25C8L 1N3NA 3WEXB 3ZE1E 5KSBB 1S9XB 5EU6E 3B7YA 5I9QB 4FNQA 3RUGA 3RJDA 1E2WA 2DQIH 3BLBA 5TGBA 3U83A 3MLXL 4PRDA 1WCBA 2HRHA 2ZOWA 3R1GH 3NH7L 4QTIH 3NCXA 4MJ6B 3AACA 4MMXA 4HSAC 3QPXH 1N0LB 1URLA 3REWA 1M7IA 1UACL 2IANE 3FFDA 4N8VB 4QJ4B 3H9HB 2UV3A 3S3SA 1WFOA 1T1XA 3L45A 15C8H 3P02A 5KYWB 1ZVYA 1OQXA 5CJBA 1AR1C 2XVGA 4A7GA 1FFOA 4N2CA 3BIKB 2DWEB 4MA1C 4HOXA 3FPYA 4U1MB 3NJLA 3NSDA 4TYUA 5IOPA 2J5LC 4ABVA 1JV2A 3H8NA 1JK8B 3QZWA 1KCUL 2VDKH 2WLIB 3OAZK 1J8SA 4UILH 2DI7A 3Q44A 4L4VB 3GMOB 3DETC 4WWOA 5E08L 2QVFB 5A6LA 5IFHH 1OD9A 5CUSH 5CD5D 3SDDC 1HHHB 1LTXA 3P4LA 5IQLA 5BS0E 5BRZA 1MCNA 2UZPA 1MLBB 5I0WA 3PWJB 3CH1A 1KLGA 5LAXB 4Y2DC 3DBSA 4K71B 1TQVA 1ZV5A 5D7HA 3ZUCA 5I0YA 1BGXH 5JORA 2DV6A 2AANA 3IMUA 3OG6B 4PP1D 4RA0C 3CX2A 2L7JA 2I9LB 1ZHKB 5J13C 3R8QA 5FUZH 1OF0A 3RNKA 8FABB 1FRGH 1VHPA 3NIDF 1SJMA 3QK0A 4P2QE 4ECNA 3MRFB 4AVIA 4AIZA 2EIMB 4BQBA 3HBQA 2Q3ZA 2E7LA 3NUKA 3P69A 4O2EB 4YHYC 1X5KA 2ZXCA 1KV3A 2QLYA 3I74A 1U8OA 3KD4A 3QHFH 2HLAA 4JQIL 4ZDHA 2CMRH 2HRLA 1E5YA 2OA9A 3GIZH 1ORSB 1TR7A 4QHUA 5EBGA 4DTGL 3C8KB 5IEHB 2DKUA 2YAPA 3G5ZB 3VYPA 2OMXB 2YPKA 2KC0A 1IEAB 5ISZD 4WFHE 4PBDA 4M3HA 4HJUA 1E4KA 4HF5L 4HJ0D 2AXFB 3TPKA 5IM7A 4WO4C 4XCNB 1ZVSB 4Q6IC 5GS0L 2XYBA 1BMZA 5F9OL 2XQYA 3WKPA 2DQFA 3SJVD 3HC0B 3P0YL 1MFNA 3G6AA 4YDVB 1FBIH 1GCFA 1FO0A 3F5WA 5DO8A 5F72S 5CWSA 1R47A 1YEIL 4WENB 3QEQE 3IDIB 3ZKNC 1WAAF 5E6ZA 2UYLA 5EEXA 1B4JL 4TULL 4LEBA 4RGNC 4PJ9B 3ARBA 3RQ3A 2R4RL 4R0LC 4JJ5A 3NPZB 4H88L 4DP6X 1M7DA 4WI3A 4FQXD 4ZD3L 5IW6A 4TSCH 5IB3B 1CURA 4OLVH 1QLRB 3UAFA 1VEOA 4ODHL 3BP5B 4K7FB 5LGHH 4K3DH 3L4XA 2YAMA 3FO2B 3X3GL 1XB6A 3EYOA 1MFCH 2BNUB 3GDBA 5CEZD 2KLTA 4QDGA 4X9FA 3KPOB 1XF3A 2XN9A 4I0KA 3BLPX 2ED9A 4KI1A 4NZFA 2RACA 3E3QE 4JCWA 4P4RB 2OTUB 4ZFZA 3VXPA 4QNPF 3ZIMA 1J87A 4XT1C 1GZHA 3N2JA 5BZZA 3T1FB 3Q9QA 4NEHB 3DOHA 1ETJA 4Y16A 3FTZA 3TH4T 1OCRB 3A24A 5L2JB 4FXGC 4BM7A 5F9JB 4DO5A 4OZGF 2BIQA 2B77A 3V7MA 2VUKA 4WHYG 5MP6H 4HUUA 4IRJB 5IBUB 1UFGA 1ZT4A 3AB0B 4Q58C 3BWUF 1LD9B 4JZOB 4KZEL 3RGVB 4IRSD 3CFIC 5IB4B 3BQUA 1X7SA 1T1YB 2VMEA 2OJEA 2XWTB 1WHOA 1EO5A 2WHVA 3HZ3A 4X2UA 3GSNH 3LNIA 4OGAD 1JG9A 3SYPA 4UUJB 4Y19E 4B0MB 5FAAA 3MOBL 1EAQA 1XGZA 3RY5A 2O4EA 4L3EB 1MHEB 4EKJA 1L0YA 3O3UN 4JFPA 4JRLA 4OCRH 1NBYB 3DSFL 3FU0A 3P30L 3UTQA 5CEXB 4M3JA 4XP9L 3ULUC 3AC0A 4J3VA 3HR5B 3IT8D 4J3OH 1IL1B 2VDRH 3O3DB 3D85A 2Z4QB 4ICXA 1NDTA 1SBSL 4JLRB 1NUNB 3CSGA 3DO7B 5EF3A 4U4IA 1MCSA 5HJBA 3IFNL 1S3KL 4JB9H 4GBXB 1RJLB 5I6PA 3FQUA 1A7BA 1A6AB 1OAZL 3RZCA 2HKAA 2QHRH 1EDHA 5DWPA 1SOQA 3T6WA 3P11H 3QIUD 1UUSA 3RVXC 4ZUVB 3MRMB 7PCYA 5AYUL 5I71B 1H8SA 4Z7UF 4ZO6A 3MV8B 1RXLA 4PS7A 2KQMA 2HVJB 3VXOB 1QLFB 5GHWH 5C07E 5CCGE 4KK8C 2CDGA 3DRTB 2EDRA 1HL5A 4HWUA 2DJSA 3ZMEA 4XNYL 1S7WB 2QV2A 2HAZA 5MEND 5EEVA 1A14L 1OAQL 3OXRA 3H0TB 3O4LE 4EN2A 1FGNL 2ALAA 3KGUA 4UDUA 2O6DA 4CVZA 2RQEA 2D9QB 1Q9KA 2ENPA 3L5WA 3VQ2C 4ZD3H 3MSPA 2GTWB 2X4OB 1RIUL 3FF7A 1P2CB 4OUUB 1B2WH 2CUIA 4FMKA 1IBZA 4EUPH 4N1EA 4DP5X 2Z3FA 1R4XA 4WFGD 2X70B 3WL9B 5AVUB 4GAGL 3NJXA 4AQEB 1IC4L 4MB1A 1EFXD 4PGEB 4DW2L 4WKXA 1LILA 2W0FB 2N01B 3SQBB 3MN8A 2GK0B 4WI7A 4RMVA 5CO1A 3UTSE 5AL8A 2HX7A 2X10A 4XPBL 1PZDA 1XCQB 4ZJ9A 1LP9E 3MR9B 4AV4A 1PLAA 3FPXA 1QO3B 2XG4B 4Q9RH 2X2IA 3MLTA 4NPYA 2HPTA 5FLUA 2WQXA 4UAOC 1N64H 3GHEL 1XF4B 4DPBX 5DZ9A 3ABLB 1GZPA 1JWMA 5I30H 2ARJQ 2F7OA 4HK0A 3EYFA 4TVUA 1J12A 2Z8RA 4NJ9L 4WWKB 1Q4NX 5HJ3B 2IGFH 1G9ML 3BVNA 4PMEA 1T21B 4WIQA 1SJXA 3U30C 2VH5H 3OB0H 1CLOL 3DARA 4Z76B 3V6OA 4X80H 4I0PD 3C60A 3F7LA 4L9LB 2WTPA 2AQNA 4G1MA 3VXRD 1IGFL 4XVSH 1ASPA 4DUXA 2F18A 3VRIB 5I1AA 3DV4A 4LVOB 1RUAH 1A6TA 3T6QC 2X4QB 1KTLB 4EN3A 1E9QB 4RFNC 2R8SH 3Q06A 2WBJD 3LEVH 4IDJL 1OT4A 4DKAA 1X3DA 3ESVF 5J6SA 5AD0A 3BIAX 3B2VL 2X2HA 4XNQA 5KBPA 1R3KB 2QTVA 4Q6KA 4KO9A 4NHUA 3T09A 5GS2D 1FZOB 5JIMA 2J56A 3IBEA 1CYXA 1VGKA 3S8GB 3W9DA 1FUNA 3LJ3A 1QI5A 3L3IB 5BNXD 4UAOB 1IAIL 5TE7H 2YSSA 1JZ6A 2B20A 3KBHE 3TURA 1IAIM 1AGFB 1MW2A 1RURL 2C26A 2GABA 4XN5A 4KMTH 4MD4B 2H8PB 4MWFB 3U4EA 5CD5C 3HEIB 4HISA 3DVGB 3CVCA 5A3ID 1G7IA 3Q8BA 2F5AH 3F85A 5TTRA 3HI1A 1P7QD 3ABKB 1EO8L 4LSUH 4PG9A 1ODAA 2DWYA 3FH7A 3EYQD 1N4XH 1UHVA 3Q05A 1RL1A 3HI6L 3QIBA 3QDME 1HYRC 2P5EE 1B3JA 5FECA 2DH3A 5F7BA 2OW7A 3JV4B 1RMFL 1TYJA 3V4PB 4ESKA 2H7WA 3GO1L 2D4DA 4TF4A 5C7XH 1JMZA 2O5NA 1AGDB 3U4BL 1QFWM 3AQXA 4I3SL 3UZQB 4GRMA 3U2IA 1OY3B 3GD1C 1LO4L 2YKLH 3BZ4B 4WW2F 3TL5A 3QXUA 2WNWA 3C87A 3IPBA 4RISH 4MJ5A 1JOIA 2NYYD 1YJDL 1A1MA 2VW6A 4K7PH 1KULA 1ZIAA 5IFAH 4TRPH 2OFQA 1SXCA 4UQDA 4BEIA 2W07B 3PS6A 2ADFH 2EICA 4TLTA 5ID0A 3CXHK 2FHFA 2YR3A 3KVQA 5ECGA 1PL3A 4KRMB 5ESQB 3GJEB 1AZZC 3MLYL 4I0CC 2ICEB 2XWJA 1MHPH 4UIMB 3TYFB 4JFOB 2G5BB 3NH7H 3MBED 2CXKA 1JVKA 1H9DA 1GKEA 1KZQA 3EJUA 1N59A 4MA8L 1BMWA 3ZO9A 1R3LB 2P8LB 4LARH 2ATKB 2DEWX 2XN1A 2UY7B 1CJYA 1OM3L 2EYRB 3CQPA 4QHNB 3N42F 3VD5A 2HT2D 1YEJL 4D9QD 1FYTA 1J05A 3DDGA 4QRUB 2A6IA 5ICZA 1O9WA 3VMOA 4GAJL 3MV9B 3RPKA 2OMZA 4YL9A 3P0VH 1AH1A 5FO9A 4IDLA 2H1XA 4OLWH 4PI2A 5DYOA 1KXVC 1SLXA 1F97A 1ZWIA 5E8NB 5KN5B 1YECL 3HC3H 5IUCA 1ZTXE 3ZHFA 4TNWF 1H9VA 3EUDA 4ZYKA 5H4ZA 3B1TA 4TSAH 3UYPB 4M62L 2EE3A 4R7NB 5LQBL 1U41A 3KVPA 5DJZB 2WJ7A 5EOCJ 3WXVH 1SXAA 4FYTA 5C0RH 4DKTA 5D7IF 4TQPA 5CCJA 3US1A 5TE6H 1RK0B 5AQ0A 2KL6A 2X6BA 1G7LB 3UADA 4FQIL 5C0EA 1JUFB 5EBWB 5EF2A 4FNLH 2AEWA 4ZMAT 4AKPA 3MACL 5DHDA 5AG8A 4ZQTA 4YOKA 5IJDC 1XXDC 4G6AC 2E8YA 4N0UB 3GBNL 4S1QH 1FRGL 1DJGA 5JNYA 4DOHE 3V6OC 3QE5A 2J57A 2JELL 2F7PA 3ATFA 4PP2B 3B9KC 5BQ7B 1DVZA 3GGWA 4MSWA 5F7EL 2B59B 4PWEA 1ASQA 1I9JL 3VWKD 2EDOA 2RH0A 1VESA 5I15L 3OM3B 5IB5A 4NGHL 3PF2A 4PVNA 3LS5H 3ZE2E 5A1AA 3HC4L 3CZSA 5GGSA 4U49A 5CCKL 4D0DA 4GAGH 3ARVA 5CFHA 3FN9A 5C0AA 5I1JH 1DDTA 3A47A 3LQMA 2WQSA 4UNTA 4DPCX 1C5BL 2CO1A 3KPQA 2JVUA 3L6FB 1CL7H 5CINL 3ARDA 4EZJA 1BREA 1F6LL 2DI8A 1LO2L 3L3KA 1DQMH 1HL8A 4NKIH 1PZ3A 2WD0A 4YHLH 5EORH 2ZSVB 4UT6H 4L8CA 3U48A 3FQTA 4XC1L 5CBAB 2AQSA 1VLXA 2NXZD 4PRIA 5CKAA 5JPMB 2YD9A 2EQDA 1BJ8A 1GYCA 3OF6A 2ZT9C 1AZCA 4JZNB 3ARBD 5I8CB 4KVNH 2JKWA 2JKIS 2P8MB 3H9SD 3HFFA 1SDAB 5IQ7L 4EZKA 3PV6A 5IUSA 3ARRA 4FZ8H 3KLHC 3S98A 3RBSA 2RMNA 1J1XH 1KUMA 2FYYA 2G9KA 2VQ4A 5IGXL 2GK2A 1NINA 1L7IH 3ES6A 4JFDE 4LOFA 3QDAA 1U33A 4RCAA 2I9TA 1A25A 4OZFA 1UC6A 3EYVB 5GZOD 3ERXA 3OKEB 3UCQA 3RZWA 5HYQA 2D7QA 1ZT7A 2AEPH 4HIHB 2WWKT 3HE7C 4J28A 4G59C 3V4VL 1L0QA 3WDHA 1A2YA 3WFDH 5AG9A 3V9FA 3TGXA 2FX8H 1MRCH 1ZTXH 3S5YA 2EJ1A 4OV6F 3I6GA 1CXFA 1E6OH 2CG9X 3HLAB 3V0IA 2JQAA 5D9SA 4B9FA 5DJAB 5LAPA 3RIKA 1DVTA 3V52L 3LS4H 4OLXH 1ESOA 4LL1A 2UZYA 1QP1A 3PDGA 5B4MC 1SVZA 4J39A 4LLYA 2VJ8A 2YPVA 1U6AH 2Y24A 3IMRA 3GMNB 4JO4H 1JTTA 2JLPA 2ZP9A 1IBBA 2ZX7A 1OP3K 1I7RA 3KAAA 1IC7L 1L5GA 4LSQH 3SY0B 4KNQA 2NLJA 3QZPA 1WZ1L 1RZ8B 4KOBA 5AZ2H 3CFUA 2WY3B 3QUGA 1A3RH 1ORQB 3GBML 4YH6A 5EO1B 3RWFB 3D06A 1JGLH 3OG4B 3RVUC 5FHAL 2EABA 2ADGB 3X1GA 2EP6A 5AVZB 2BHZA 5AWNL 5D7JA 2DQEH 9CGTA 1I7UB 5ALCL 4ANKA 4TRPL 1QNZL 5EUKA 2EO7A 5LB1A 4YBQC 4HXBH 1IKFH 1B90A 1UA6L 4X6BA 3MGTB 5EC1B 3TWCL 3ETSA 4Q9CA 1RJZB 2ERJB 4OTXL 3WHE0 1QBLL 3DX7A 5E8DH 4I9WD 1J1OL 4D9QE 3TVMB 1AE6H 5JW3H 2B7DT 2HXAA 2W81C 3V4UH 1F90H 2FECI 3E0GA 3IM1A 4MQXC 3UACA 1E40A 4HGMA 1MFDH 5DJCA 4N1CA 4GSQA 4NQUA 1NGXA 1TJHH 4Q6IB 3KYOA 1O9VA 4QHMA 3NIGB 1Z7JA 2DLHA 2WUBH 4H20L 2FBRA 1CQYA 1KXQE 5FUOL 2ZKXA 3FT0A 4OD3L 3KW7A 4O02B 4ODVL 5BO1L 3U6XS 2RCSL 2Y06H 2CLRA 4WU5B 1D3CA 2D0FA 2H6UA 1NKOA 3PL6A 3SE3A 3N43B 5C0BA 3OAUL 4UF7C 1EFXA 2H1PL 3ARYA 4ZMVA 4XBGA 3MUHL 5IESH 1GMIA 2GJJA 4Z3EA 2GITB 5HXMA 1JRHI 1NAMA 2XSKA 3AMKA 3AWEA 3L4CA 3SE8H 1BJMA 4Y4KC 4JBSA 1RI8A 4X7SL 5KG9B 5F96H 4JDZB 1B0GA 1OE3A 4MCZB 4XXWC 4OFYA 1I1YA 3ESNA 2FGZA 4PR5A 3N9GH 1DDHA 4WUKL 1G7PB 1MF2L 2VLRD 2I07A 4RZCA 1K6QH 1GYUA 1AKJD 1PEWA 2XZAH 4HZAA 1JNHA 4M6ML 3OKNB 3S4SG 2X4RB 2N0MA 5BXFB 5FYLE 5E5RB 4IYKA 1PS3A 4POYA 4N6RB 5EOTB 2BWDA 2DYRB 2O6PA 4MA7H 3SGKC 1ND0A 4U05A 3V0AC 3WJJA 1N2RB 1Q72H 3LZQA 1MJ7H 2V8LA 4XAKE 1BWWA 4MAUL 1T0MB 4YLQT 1E4XL 1JF5A 2DB8A 3AQYA 4A7UA 5AWNH 3BX7C 3QUHA 3IDNB 2F74B 3A67H 3IETA 3CTTA 1X5GA 2VXSH 1UFUA 3QBTB 1DQQB 1HDMB 3MLPA 4YLBA 2XOTA 5KVEL 2V17H 1JV5A 3MBEC 3RG1C 4PRPD 3P9WB 3BAJA 1SJEB 2XX1A 2B0SH 3K72B 2JKJA 4F80A 4UTAL 1BVLB 2XT1B 2FJSA 4JPKH 1NCTA 1UB6A 3CZGA 1CBJA 5HYJB 3VAEA 5D2LE 2DD8L 4BCYA 1A6WL 1UYWH 3QISA 2WAQA 2BVOB 1JFQH 1YPZF 1JWUB 4Y5VB 1GGBL 4I89A 3UABA 5DGRA 5HGHB 1LE5B 4G8GA 3EIFA 4BQ8A 1WA2X 2NR6D 1WEJH 4G7VL 2F7QA 3EHBC 3VXUA 1U8KB 4L9LC 4A2LA 2KH2B 2BNQE 1IE5A 1F18A 5FDWA 3ZZSA 1KIQB 2EEBA 4G7SB 3WI9A 1PNDA 4MJ4A 2IPKB 2IANA 3H54A 5T3XD 1I82A 1JD7A 5IW1B 2VR9A 5AOKA 5HSFA 4NDMA 1UD4A 1XR8B 2VIRA 1HSBB 1OAZH 5F88A 3VTAA 5IQ7H 5I66B 3A4AA 5K1JA 3M1BB 3WELA 3VG0H 5E9DA 1V3LA 4OM0H 4FFWC 3B5HA 5B22A 3S48A 3K81A 1EANA 1NGZA 3QULB 4NOBA 2QADD 4YDNA 1GSMA 4XN2A 1ED3A 4CJ0A 4NI6A 4L4JA 1HK6A 2B1AL 4WQOA 1Y18B 5C0BE 1OSZB 1BQKA 1BQHA 5F96L 3VM5A 2E56A 3MLUL 3PQYA 1YRKA 3CPLA 4P2YA 4KNSA 5I17B 4JFSA 4FZEL 3OJ2C 4XVJL 4X7EC 4Z8FL 4JPVL 1YEFL 1XSKA 2CKBA 4X9BA 3RKDD 3L7FB 3EO9H 1HHKB 2BNRD 4HA1A 5IHWA 1B0IA 3TNMA 3U36A 4B5ZA 3D07A 4MAYB 1TQUA 1W0VA 4NUGL 4AIEA 4ATTA 4C55A 4DZBA 3FS9A 2VDQL 2R29L 2F5AL 2VUOA 2DQDL 3GSVB 3HS0A 2FR4B 2ZX8A 2NNAB 3L3GA 3S37H 5ACZA 1LE9B 3UDWC 4BA0A 4X9GA 1F4YH 1YMMB 3ZTCC 1XF2A 3DDFA 1KTBA 5FM8A 1AG0A 1ETA1 4OCLC 3BAIA 4KMLB 2V0AA 1NIBA 5MEPB 4Z3HA 2DM4A 1GMEA 1ZSDA 1WZKA 1EEZB 2EDXA 5B38A 1OF2A 1RUMH 2BSRB 4X6DB 2DTMH 4HFWB 4Z7AA 4E0RB 4QRTA 4TTGA 3LEYH 2YWYA 4K2UH 3T4YB 3HKFA 3PP3K 3ARBC 3F3HA 5A2BA 3V4UL 3F7RA 3OQRA 4C56D 1EDQA 4NKDB 1CR9L 3PL6C 4H5SB 3FZUD 4HFUL 2F5BH 3WS3B 1KGWA 5AUMA 5D93B 4DIXA 5E08H 1H6EA 4W9HC 2HJLA 2ADYA 2F8VA 1KTJA 1WBYB 1BAWA 4G7YL 1A1NA 4I1RA 4OTXH 3VFTB 1S7UB 5AENA 3AAZA 1U8NB 4XPAH 2QVIA 2ZXEB 1G7JB 4RQQA 3NMEA 1CZ8L 4KQ3H 3V7AG 2DIBA 4OZIE 2ROXA 3FMGH 3UPRB 5ABAA 4KKQA 3T2OA 3IDJB 2ZUUA 4MMYB 2B08A 2Z65C 4QCIB 4W6WB 1G9NC 5I76A 1RU9L 2XY1A 3BRDA 4P23A 2VN6A 4CMHC 2UWEF 4LARL 4X98B 3S3DB 3BAWA 4UDTB 1MAKA 3I3BA 3S5LB 2Y4SA 4BFJA 4RDQF 2BHUA 2Y22A 1MIMH 1NEZG 4NRZB 2MHAA 3L3OC 3LPGA 4BELD 3GMMA 3OXSA 1NPJA 4B3EA 1OCOB 1YY9C 1JTPA 3QZNA 5ISZA 4M43H 4PJFF 4P5MA 4BCZA 4NQEE 3TZVA 3C75A 3BHBA 3L3JB 2GC7C 4YDLB 1DUZB 1EZLA 3OL2A 4H25B 1V55B 4BE6A 4PGCA 3LZPA 3OWEA 4FZ8L 1LQSR 2MNUA 3DMMB 3RL2A 1DLHB 4WK4B 1P4LA 1YN7A 5I16B 2ZOLB 1UKQA 3ECBA 4GKZB 4PJ7A 5GGQH 4UM8A 3HAEA 4MNQA 4YIQA 1X6NA 3V9CA 2EDJA 3HMXA 3GK8H 4U1SB 1E9PA 3JTSA 4Z7UB 5B39G 2QSVA 2O6FA 2X9WA 4YBLB 1OAJA 4UT6L 4UOJA 3UG4A 1R5WB 1HQ4B 1CF8L 3IJHB 4YFDB 1W72H 4HSCX 4G1EA 4KNUA 2OXHA 1J11A 2QGBA 2DWDB 2GSIB 1NMBH 4IRZH 4OF5A 5CR1A 3QQ4B 4FTVA 2I60H 4ONOA 1J1PL 1QATA 2QPEB 3IGAB 2QPUA 4JR9L 3VYNA 4XH2A 2NOYA 2D4FA 3N5AA 4M5ZL 5E2WH 1G9MC 3V4VH 2XQYG 3EBAA 1X44A 4ZFOB 3VFRA 1F4HA 2VJ0A 3BT2H 5D55A 1QR1B 3KE0A 2YKLL 3B3IB 3C6LA 3BFWA 2NQ3A 1YC7A 1N7ML 1CYWA 3NEXA 4KV5F 3QXTA 3TFKD 2FRGP 1V3MA 4ZXBA 4Y5XA 1QOKA 4WEEA 3PGFH 2CO4A 1TTGA 2WZ6A 4GSXA 4PJ5A 1BFSA 4WWPA 5E2JA 4GEJA 1TPXC 1AD9B 5IZ7A 2ESVA 3GXUB 4NM8H 3SD2A 4L8BB 4TSBL 1E8XA 1GGBH 4PTUA 2LE9A 3GWJA 4HS3B 4C58B 2FHCA 1Q0XH 3TM6A 2B2XH 1QLEB 2PW1A 3E6FA 3MNZA 3CIAA 1XVSA 1YAZA 3LZOA 4OLWL 3F83A 1CUOA 5GS3A 5JXEC 2R15A 3VXTB 2ZUQC 3Q7JA 4ZI8A 1MY7A 3CHXA 3P3TA 3PJLA 2PWFA 1BQLL 4G8IB 1SGKA 3MJ9L 3G6JE 3DIVA 3B2MA 1T5KA 4Y5VC 2VNCA 3V0VA 1UATA 5D7JC 1XH3A 4LCVA 3CXDL 3M86A 3RZCD 1P84J 5F8QC 1NBQA 5TQ0L 3FJTA 5C7ZA 5J9PB 3UBXB 4Z7WE 4IBQA 2VL5B 5I30L 4HC1H 3JTTA 4UV4L 4HUWA 2AJYL 4KZCA 1I8LA 4TUJA 1CG9A 3VO0A 5TE4H 2C1OB 4W9IC 3L3HB 4Y2LA 5IVXF 3O3AB 4UQEA 4X80L 2XZQH 5F7DB 3VG9C 4FQJL 5CLXA 1GRWA 2H9GB 5JDSB 2J8UB 1IGFH 1Y6NR 4KJWD 4XVSL 4WTZA 4LCWD 5I75B 3L1EA 1YEIH 3DA0A 2JCCA 1K2DA 3D39E 2ZYHA 3FO1A 4U1IA 5HDQH 1XGQA 3BAEH 4PG2A 1SOSA 3FT2B 4RDQG 4X5RA 5AVQB 3CFBA 3D0AA 2NSQA 1H3UA 5G4OA 4Y1TA 1UJ3A 1J5CA 3WUWG 3BN3B 4N87A 4GQZA 4K3GA 4LLQB 4NQCB 4DEWA 2VLME 3FRUB 4OF0A 1Q9OB 3EOBB 4N68A 4RX4A 1KCBA 4AZ8B 1Z9MA 3D2UB 3FQ4A 5IQNA 1ZGLB 3ZDZE 2VABB 5BQDA 1ZDQA 4WLCA 2EECA 5GPRA 2AV1A 4U1JB 4F7KA 3BO8B 1NCWL 2VLRA 4JHAH 4LMQE 1XAUA 3U79A 2A99A 3WV0A 2DQJL 1J9CT 2LLGA 3K2UH 2VDLL 3L9RA 1QHOA 4GUPB 4XVTL 2R1XB 2X4TB 3LH9A 5EU3A 4DO6A 2ZCLL 1IKOP 4KUZH 2CNYA 1DBKL 4P9HH 5I28A 2CR0A 2ZUWA 2EDFA 2N59A 1A9BA 1XT5A 4YX2L 1RZ7L 3SE3C 3VD4A 3F00A 3OJDB 3WFBL 4UOW0 3EJZD 4N90E 5I8OL 1UXSA 1QSFB 2WNXA 4HV8A 1WFJA 4YE4L 5GGUB 4PH8A 4N2FA 5I19H 3WFEH 1RV6X 3A6BH 3VFVB 2QQLL 2C9SA 3E2HB 3N44F 2Z91B 2HA1A 4EZLA 2EEAA 3KW8A 3DXAA 3E38A 5FCSH 4UTAA 3LN4B 3FU7B 4F7EA 2B15A 3SKMA 1OK0A 5DT1H 3QH3A 1W72A 4YDJB 2WLMA 4ISVA 4LPVA 1L6PA 3MUY1 3QPKA 3KHOA 4MNGE 1ZEAL 1XBDA 2XFXA 3MA9H 1SY6H 3QZOA 4LASL 4PJHA 3LDBC 3V95A 3OKOA 3GJFA 3ZMNA 4DERA 1U92A 1U3YA 4WEBL 1MI5E 1H6UA 3CMOH 4H1LA 5DEGA 3R7RA 2BP0A 3TVMD 3MAWA 3BJLA 3VM7A 1EGJA 1FZJB 5EIQA 4MX7B 5KOMC 1XCTA 3B9DA 4J1UA 3GSNB 2GPZA 5EIVA 3EO0B 5FUCC 3WNMA 3MUGB 1NBCA 5D1XA 3U9UA 3ZZ1A 4F7CB 1GC1C 4XE0A 1OCCB 3T6ZA 4YEFA 1Q0EA 3PAUA 4PLOB 1WLHA 2FUTA 2EDHA 4H8WC 3PWVB 1BDYA 4H26B 5A2JH 4ETYA 4TKWA 5AAWC 1IU1A 2WLNA 4KKAD 3MRKB 5DZPA 3RDTC 4Y19B 3CZLA 1BQHG 3ZN6A 1JZ5A 1FAIH 2PP9A 3H3BC 5SWQB 3KPLB 1VERA 1S78C 5DJ6B 4FKEA 2PYFB 2APSA 5KYNA 3T0ED 2DDQH 3O6ML 3HVDA 3HZMB 3PIQA 2XU9A 1UWEH 1OAXH 2EDWA 2QLVB 1FBIL 3L17A 3F7QA 4WWKC 1NCIA 1ZAGA 3WIHL 1AGCB 4NO2A 3PNWA 4ZK8A 5AKTA 5DVPA 4MFHA 2Q3XA 3MX0B 5HHXH 3L2LA 2CDFA 1UQSA 2A6JB 1XGPB 4GXUM 1QFPA 3FO9B 2AJSH 5DS8A 1KB9J 2LT9A 1SNRA 2R9HD 4R7VA 1TJXA 1P1ZB 3EJCA 1W16A 3VXRB 3OKLA 3UAJD 1P1VA 2IO5A 2F0CA 3BISA 5HHMD 3HG5A 4O4YL 4ES8A 1VF5C 3CDYA 4XPFL 1NAMH 1SEBB 2DEXX 3CFKA 2HCZX 2XWRA 3NJHA 4R7DB 4P8QA 3MRNB 1D5XB 2UZXA 4WFEE 4LQFH 4JJOA 4X4XB 4I1PA 3D3VB 4P23C 4X50A 1KXHA 2TRYA 2GHZA 2L3BA 1FORH 5MERB 2GJRA 5IKCB 4JDEA 1PSKH 1AGEB 3LS5L 5JHDB 5MEQA 3CVHH 3AG2B 5LWYL 2ZG2A 1U3HA 2GC4C 1ET8A 3D4GA 3GIZL 1P6WA 2LOEA 3TZVC 4APXA 4HEPA 5IROA 3BH9B 3P11L 5A7EA 4J4PA 2V2XB 5J11C 5ADOL 1MCRA 1V10A 5HJDA 1ULVA 1LO5B 2CIKB 3DRQB 3QDJA 2HPOA 5IB1A 4GXFA 4AI7A 4UIKL 1IKNA 4MVBC 2FIRT 4JY4A 2V2TA 2NPLX 4OD2A 2J8HA 1XD0A 4AYMC 1AYOA 1YEHH 3L9BA 1F4WH 2A1WL 3F84A 5F0JB 5PAZA 3V79C 4X6EB 1IVTA 2ZOTA 2FO4B 4WUKH 5T33L 1HWHB 3KPPA 4EUPB 5LHDA 3IRPX 4LP4A 3RWEA 1CFTB 1FNHA 1T5WB 5HYSG 3C6SA 2J8UF 3VFOB 3INUL 1G6RA 3CZFA 3IFLH 4IU3B 3EJSA 4DH2A 5B8CA 2PCPA 5D7SH 4C56A 4P2QA 3HZKB 1IM3D 2RALA 3WKQA 4MDIB 4GINA 1PCSA 4NUMA 2RIKA 3BT0A 3PGCB 3BGMA 3QIUC 4NNPL 3IJEB 4R4FH 3N40F 2ZXDA 1IGML 4Y4HD 2Q6WA 4GW5A 1CXIA 4MMZA 4D7BA 1P7KA 1HYSD 4LLMA 5BUPA 5FR3A 3VW3L 1EEYB 1RY7B 1M6OA 4FXKC 4N3TA 4KO7A 4TTDD 3PPSA 3OLGA 2A6DA 2RR3A 3CGTA 1IJNA 3T77B 3OLDA 2E9JA 2NUPB 2LABA 4L3AA 2FX9H 2VN5A 4DFIA 4JPKL 4LIQE 3BH8A 3LRSA 2ZXBA 1HZLA 1YNTB 2J73A 3RTLA 1JPEA 4TNFA 4Y1AB 5GS1A 3SPCA 1JGLL 3OGOE 2X42A 2ZOOA 4JAMA 5ABZA 3ZTNL 3QR2A 1MJ8H 3S34H 4U2ZA 2VRQA 3QEQA 1MRFL 2DLTA 3LVEA 3QJQB 4FI7A 4MNHB 2L04A 3Q2VA 1UOKA 1WG3A 3CVIH 1I8UA 1IKFL 2YUWA 4A7GF 4PBXA 2P28B 5HHNB 1RZGB 2ORBL 2NXZB 2R7EB 1BVOA 1NOFA 3MMEA 3N6YA 3AREA 5IIEB 1W0YT 5GS1C 2GTQA 1ADQL 1E8ZA 3N44B 3LSOA 4GIPD 4TUUA 5E6YA 2FX8L 4ZODA 3ZBMA 3O9WD 4GQRA 1WT5A 1CD1A 4LPUA 3F7VB 2DZEA 3GXTA 4Z77A 4MD5A 3W82A 2P8PA 3C5JB 4FLQA 4FABL 1U3ZA 3NFPB 4IEFA 2OPCA 4XMLH 5K39B 4FERA 3QWOB 1DE4B 1O7DC 3DTDA 1EIBA 2Y2WA 4QI3A 1I85A 1OGTB 2VZTA 3TYGH 1SY6L 5F3HA 5E5LA 3BWAB 4J2XA 3OGCA 2AGJL 3IXTB 4LT7A 2K7QA 3ZYZA 5T33H 3VSTA 1JPST 1KTDB 1YQVH 2CPCA 2ICEC 2JJTA 4ILDA 4J3OD 1JXDA 3KR3H 5C86A 1A3RL 3FK3A 3L4WA 4ZO8A 5F0PB 1J10A 2Y06L 2ZWSA 4ZO7A 5BMFL 2FE0A 1QBMH 2Y5TB 2A9NL 1JZGA 2NTFB 3BD3A 4X6CE 1QHPA 2I32A 5DMIL 4IOIB 4YE0A 1B0RB 4IGBB 2ZWZA 1E27B 3A4EA 4BH7B 2BDNL 3ULSB 5JZ7D 4OGXL 1SFDA 3U7YH 1V7ML 5JW4Q 2VR5A 1SJHA 5E1QA 2NY7L 4FLSA 5HVGB 3ZDZB 1GJWA 3MRRA 3APFA 2NY1C 2X44D 3SO3B 2HWZH 4JO2H 2Z31D 3AXLB 3KCWA 4PJGF 1HAWA 1PVHA 3BSHA 2A77L 3FQNA 4FI8A 1OW0A 5T1KA 3ZDWA 1UEYA 4Z95H 5F9DC 1F6AB 1MI5A 4HT1L 2AJXL 2FJUB 3CDCA 2HRPH 2NY5L 3O2DA 3KCPA 1C16A 5E1HB 3VTTA 1S5HA 3TBBA 1XH0A 1ROCA 1P9MA 2NR6C 1P5UB 2Q7YB 1ETZB 1XDTT 3BQUC 1QSED 3BP4B 3IK2A 4M8VA 4XCFH 4EI5D 2ED7A 3DECA 1NC2B 2F54D 4NRYB 15C8L 2NMSA 4OUOA 5EFIB 4M4RA 3EGDA 3WLBA 4TPRH 2G3ZA 4GG6B 4OGYL 2AK4B 4PJGA 1JXKA 1USZA 2KQNA 2O1AA 5D1QA 2A9MH 3MFGB 3RWIA 3VXNA 3W1ZA 3RIFK 1GOGA 3MU3A 4O2CB 4UNVA 4PJEB 1E7VA 3L5XH 4PGBA 1U2YA 4XWOC 4BFIB 2ITFA 1RHHA 4XXWA 4URKA 1RJYB 3WTVA 4BH8A 1CFQA 1JPFB 4GQQA 1T7VA 4IJ3C 4XPTH 4PG2C 4ZAKB 1MREH 2EVIA 4QWWC 3WE6B 1CDJA 2BNQD 2PYEA 3GXNA 4PJFA 3H55A 1MRDL 4NKMB 4EIGB 3U4AA 2Z35A 4MQXD 5KSAB 4OZ4B 4LCWA 4BKLB 3K91A 1C12B 3B9VA 1EEUA 4OZGA 2VDMH 3NN8A 1N68A 3BPCA 1YMHB 3BUYB 3VFSA 1VKXA 5FHAH 1AKJA 3EFFA 2HT4D 2YEZB 5HY9A 1S4IA 5DI8A 2IPUK 4EN3D 4WHYH 2VDLH 1KLUB 4L4TA 1F11B 3P1VA 1E65A 1ZLDA 4JPWH 3BAYA 3HRZB 4HJEA 3KS0H 1EHAA 43C9B 4CVXB 4E42B 3WMSA 2AJZB 2AF2A 3LXUX 4X0KB 3N3EA 2CLVA 3MGOB 3RL1B 1PX3A 1SJVA 4ZMPA 3KXFD 3KR3L 2XG5A 3R06A 1BPVA 4XPGH 4M8RA 1M56B 5HHVL 1NEUA 3VXMB 1SYSB 3VXQB 1YJDC 3ZIYA 2AVGA 4NQCE 4PS4L 3ZPDA 5H94B 3KYMB 1TO5A 1GW0A 2IQAB 4PJ9D 1KB3A 5JOEA 3PLYA 3GMQA 4PLKC 4MNGA 1T4KB 3F7YA 3KDMB 3AT9A 1CU4H 2CXGA 3KJ6L 1SDDA 1TU2A 2I69A 5KVGL 3LH8A 4HMCA 4WNQB 3SKJL 1C8QA 4DGWC 3UMTA 1HI6A 1F4XL 1P9MC 1ACYL 1S7TA 1XSJA 4E5XG 5BUGA 1HILB 1QUPA 1OT1A 4DSYA 1I1AB 2Q3AA 3FAWA 1MXGA 2NSXA 5I73B 1N7MH 2CHWA 4M7LT 5F1OB 4EDXA 4P3DB 2XPZA 1AZUA 3QFDA 1JWSA 2EDTA 5T1DH 1JK9B 4F8OA 2YEVB 5INCA 5T1LB 4Z7WB 4LPWA 2GSMB 2X05A 2F1EA 3EJZC 3UZEC 5IHZA 1E5ZA 4I5BB 3D08A 5E94B 3BZFB 5C0IA 4S1RL 2PW2A 1QBBA 2ZOUA 2L4OA 4HCRH 1UZ8A 2NY0D 3NOIA 3ZTNH 4CSSA 2EKSA 3DYOA 2PTTB 2FNWA 1J0ZA 1BZ9B 3FQWA 5EWIL 3RFZA 3JV5A 1E4XI 3V4PL 5IHUH 5JHBA 2WSDA 1BYPA 1YPZB 1NIDA 1NSNL 1VZIA 3O4LD 3QFGA 3QORD 5IROC 1NEZB 4JHVA 1VADA 4KKLC 4PS3A 5ICXB 4G9FE 2EDQA 2XA3A 3EGXA 1EO8H 5D1XD 4NKIL 5ESAA 3NIDB 4PM1A 5CSBA 1YDPA 5IW3A 2NY4B 2CUHA 1A5FH 1XV8A 4X8JB 4A7TA 1RULL 2ATPB 3UO8B 3TVMC 4JFYA 3GJFK 3KGSA 4HJSA 4AGQA 2YGVA 2XRAH 2DAVA 1L3WA 2DW5A 4N0FA 3QG7H 1BIIA 2Q8BH 3EGSA 4YFLF 3WTWA 4ZMQA 2AC0A 4LBEB 1PZCA 4PJIB 1BM3H 4JUSA 3UJTH 3MLRL 4ONFH 2WLLB 1HXYA 3APCA 4WTQA 2G2RB 4WI0A 3LAFA 1SHWA 2WCGA 4FQCL 3T8XA 3UTPE 3ARUA 3G04B 2EE9A 2WWMC 1DQJA 4KAQH 2FD6H 3NIDE 3ALWA 3QZWG 5K5YA 2L0DA 4HJJL 1AYRA 1AVAA 4PS4H 2PUQT 4LDCA 1BOGA 4U1GB 1M71A 3DPBA 2WXHA 1JNNH 1G4RA 3QUYC 4YDKL 3MO1A 3NGBC 4XNDA 3LRLA 3MRLB 2VLJB 3IXAA 5LGJA 1EV2E 3UTSB 1QUNA 3GXDA 1SQ2N 3FXIC 5C0CE 3TNNB 1ZA6A 4MQSB 4RDBA 3RB5A 4MJHA 3CMGA 4UM9B 3QUKA 4AG4L 3RDTA 4I85A 1J86A 4G9DB 1I8IA 2D31B 1WQVT 3FOLB 4Z7OF 2IEPA 4LHUB 4KX9A 1A5FL 2ZCZA 3TA4D 2NRDA 2WQUA 3KDPB 2H32A 2CBQA 1AXSB 2DWSA 3OHXA 2XWXA 2OR8A 4JY6A 5I18H 2XTJD 1OE2A 4BBWA 1OCWL 1E42A 3S35L 4HS6B 1O9ZA 4WI6A 2PPAA 4FQXA 4YZFF 3BVVA 1H0DB 1HHJA 3JT0A 3RWGA 2DQCL 2FH8A 1K8IB 4B95C 1MFEH 3QIUB 3FQRB 3QDGA 4FYQA 4KI5C 3IWUA 2CM5A 4D0BB 2YAHA 5DRNA 5J1AA 2OXGA 3EBGA 2CK2A 1GZHC 4BUHA 1DANT 3RPIB 1M1XA 4OCWL 3HZVA 5DK3A 2YA2A 2XX0A 3QA3B 3UAEA 2X38A 4WW2A 3WUZA 5JR1H 5HDBF 2YD0A 1FZMA 1PZUB 2R27A 2NY3C 3O9WA 3BDBA 1L9QA 4G8AC 2WINA 4NZJA 4YSTA 3MC0A 2BSBA 3SE9L 2ICES 5ETUB 2VDQH 3CG8A 3RWCA 1ZS2A 5E5MA 4OZIB 1T3FB 4K23L 3F64A 5F93C 4L37B 1S3RA 3TPUB 3RY6A 1KIUA 4IGBD 4LRNH 3FT4B 3VRLE 4F57H 1GSKA 2RQ8A 3LRMA 1UXMA 1RULH 3GRWH 3VE0B 1E9OB 2Z7YA 3FTYA 3H2QA 4LASH 5IHBA 4JRFA 1NBVL 3G5YB 4OLEA 4UQBA 3QIWD 3K6DA 3IFNH 4BD4A 4JGUA 2OMVA 4G6FD 1QBML 1HOCB 5DGQA 4ZUSA 5CP7A 3BQVA 3C5ZD 3CUPA 3HPJB 4KC3B 5EF1A 4KVCL 1YPZE 3SODB 1MCBA 2EYTB 3HTLX 2ZTBA 4I3SH 3FHQA 5E2TH 2IPUG 3ZZQA 5L4MA 5J6GB 4XP9H 4L23A 4IMLB 4E9VA 1BBJA 3HHSB 4ELDA 2XTJC 3GXIA 3LH2H 2VDRL 5EHFA 4PJAF 3WY3A 3AZUA 4Q2ZB 2VWEE 4ODWB 4HHAB 3MCLL 2J5WA 2EC9U 3D87B 3I6KB 5DD1H 3VFMB 3SYAA 4UQAA 3MYJA 2VO8A 5D5MB 1KN4H 2Y6SC 1I9RL 5IR1B 1EZVX 4N2NA 1F41A 3QJHA 4AW7A 2WXKA 5EZJB 1PU0A 3W0WE 5DHVB 4YFEA 4QXGH 1ONQA 5IV2B 2J88L 4K8RH 4POZD 3AY2A 1OARL 3NCCB 4K94L 3HN5A 4QKXB 5ACMA 3APDA 3L3OA 1C5CH 3O11A 4H8WH 4OLUL 1CLVA 4HAKA 4DFHA 3D4CA 4WCYL 3RVTD 4LF3A 3LB6C 4NQXA 1T03H 2VTFA 2FSEB 4EXKA 1XD1A 3IFOB 3RRQA 3V0WH 1QG3A 2HVKB 3GLZA 3IJSB 5D2LF 5L88H 4HQQH 2GCYA 3U0TA 4WW1B 1NBZA 3OWRA 3ROLB 3WN5B 4B97A 1I1AD 2O72A 5F7FA 2OZ4A 2E75C 1TFPA 2VMFA 1G5AA 4FFZL 1Y1DA 4NX0A 3X3FL 5D70H 2R29A 2RA1A 2BNQA 2NNXA 4PJ8B 4UQCA 2MCPH 2NUTA 4TULH 2GB2A 5E1AB 3WSQH 2YS4A 3NSXA 4DTGH 3GINA 3VXSE 3DVFA 2XA8H 1CGWA 1S2EA 3QI9A 4G71B 3PFUA 3QUXA 4X6DE 2AABL 1NUGA 4ZPVA 4NIKB 3IYLW 4IM8A 3TN0A 3PAZA 1A3ZA 2AJXH 2G9HA 4MKMA 3VGDA 3WNPA 1T2XA 2WMPB 4JFVA 5GS2H 5IQMA 1XTLA 2ZCKH 3PL6D 1DSWA 1YMME 1M42A 2AEIT 2P45B 4H8PA 4R97C 4AVKA 4EOWH 5JIQA 2BSSA 4NQDE 5G5DA 5K1NA 2CJUL 3HNSL 1X5JA 2YJLA 4K15A 5DSCA 1DYZA 4NQEB 4XO3A 3KXFA 2V9TA 1AR1D 5I1LB 4YSCA 2UY6A 1Q72L 1RIHH 2IFFH 5EA0H 6PCYA 3R0NA 3CN1A 3RA7L 4PVBA 5H2BB 4KH2A 4JREC 4ERSL 5DMIH 2C4FU 3V0FA 1PG7L 3T4AC 3L5XL 4FCAA 3SGDI 2BHFA 2IDCA 5DVMA 5T3ZH 5ADPL 1X5MA 4AYFB 4YN3A 5I1KL 1N5YH 3DJRA 4ZUWB 4JFFE 4L4VE 4RMTA 5HGBA 3OLEA 5EBMB 1BFOB 3GSQA 1EEQA 4R7LA 5C07B 3WHXB 1WBZB 1N9PA 2E3VA 3A6CH 3DROB 1DVSA 3R0MA 3WAKA 1FL6A 3CHQA 4FULA 5D7KD 2P46B 3WY4A 1T89C 4UT9L 5ENWA 3FRPA 4P5KA 4NJAL 1KN2H 4HKXA 1T20A 2DBLH 3VWKB 3GEWB 4WKZA 5D2NB 5B1BB 3CD4A 5JIKA 1CFMA 3CHSA 4L4TD 1HEJC 3PDOB 5IB2A 2HH0H 1U8LA 2ZCKL 1VZHA 2BRRH 1II4E 2WWKO 3VFPA 4S10A 4F91B 4S1RH 1HH6A 1T66D 4PWGA 2FB4L 2BIIA 1U8IB 2KLRA 3CBJB 4K3DL 2VXQA 2D03H 5JW5B 2ADIA 4TVPH 4TNVF 5EOCL 1QWUA 4NM8L 1EZVY 4QRRA 4F7TA 4FQLH 3CK0H 2ZYIA 1SF5A 3AS0A 4U6XB 3OMAB 1MCPH 3OMNB 5MENE 1I53A 2Y9RT 1KWGA 3O6FC 3SEPA 1NSNH 1P7HL 1DVXA 2YRLA 3K4DA 1J7VR 3LVTA 4PV9A 1KXQA 3NCEB 4UWQB 4YO0B 2PPEA 1NPUA 1QVOA 1TMQA 1YYCA 1DVFA 4KRPB 1OPGH 3VWJD 5DJXA 3NZHH 1P7QA 3K6SB 5H37G 4QOKA 1PIGA 1LO3L 1WGOA 2FEEL 4G8FB 3DX8A 4Z7NB 4LNVA 4MA3A 1BVNT 1FFQA 4IJ3B 4U3SA 5F9AC 4OZHB 4N25A 1XIWA 3RGHA 4I48A 2OV0A 3QG6A 4XTRD 4NP9A 3O0RH 4XMZA 1EAPA 1A4JB 2QDVA 3V8OA 2VQTA 5EPMB 1OE1A 3UAJA 4KV5E 2CBTA 1P5VB 4N0CC 4ONHA 2AXWA 3TASA 1LK3L 3GHBH 1A7QH 1MFBL 5DS2A 4XGZB 1XCWA 2A5UA 1AO7A 2BINA 4Z7OB 1EHLH 3HI5H 1G5GA 4L8DA 1AG6A 2Z9TA 1MFEL 3OPUA 4K3EL 1JPSH 1OSYA 4QHKI 3OJMB 2J4WH 1GR7A 3DGCR 3KHQA 3TIDB 4APQB 3UH8A 3MGAA 1JERA 4DK6A 1TJGL 4KX8A 3REVB 3ECVA 4KFMA 5I6XB 1S9WB 5KS9A 2UXGA 1FIGL 3L54A 2X4NB 1B4RA 3E6HB 4KI5D 4PRHB 4BCXA 2R2BA 1B2YA 3DUSA 4R96A 1BSIA 2V5SA 4GEIA 1AP2B 2E4FA 2NNFA 5F0MB 4GW1B 1FFNB 2W60B 1P0SE 1EJOL 3T65A 1SHMA 3VU2A 3V52H 1BWMA 2R1YA 3QJOA 1CE1H 1W8EA 2P5PA 2CRYA 1TEFA 1DN2A 2GTZB 3BDYH 3INOA 1H5BC 3UGEA 4QAWA 4A2GA 5EEZA 7PAZA 1U8HB 2Y72A 3U2SB 4YBHA 2NYKA 5HGDA 1V7NH 1IC7H 3A5VA 2FL5B 4KDTC 5KVGE 3GZKA 2HX8A 2CCVA 4L9DA 5EU6B 4YXLH 2FWUA 1TETL 1QYGH 4PB0L 5LBSH 1U8CA 2ENYA 4NWUL 4LP8A 3QXDB 4DN3H 3UO1L 2J6EA 2BJML 4A66A 1AD0A 2OK0H 1ZS8A 4E68A 2C3XA 3D1MC 2AQRA 3RTQA 1VCBC 1HSAA 4YPGA 4A39A 2XN9D 4M7KH 4NO3A 5DMKB 5IG7A 1SVCP 4Y4HA 1FH5H 1FG2A 1MNUL 5F70A 4HOZA 2X7LB 4JQXC 1OGAA 4J8RA 4AYGA 5L6YH 1FZKA 5C6WH 3QORC 5IROD 4KHXH 5EEUA 3CX5K 4IW4C 3LZFL 4IIZA 4GFXA 5J06A 1H3PL 1ETB1 4G6KH 2R29H 3P4MB 2XTLA 1RH8A 2X1WL 1MFDL 3D09A 4XRCB 1KTCA 3QEUA 3WXWL 3SYOA 5FA3B 4PPTA 4HBCH 1L6ZA 5BV7B 4OV5A 5FKPA 2DQIL 4XX1G 2BOBB 3QEQD 5JQHC 3QARA 2FIKA 2ZF8A 3K3QA 1J9RA 5EN3A 3MRBB 3R1GL 5IBTL 3VI4E 3ZSTA 3DV6A 3IU3A 1PBYA 3SKNA 5IVZA 4P2QD 3WBDA 3FU8A 2GFBB 3UZVB 3LPPA 2DM2A 4NQTA 1MLCA 5JZ7C 1OTTC 1K3ZA 1JZHA 3W56A 1NC4A 3ARDD 2XWDA 4OAWA 4XXDA 2BOCA 1I9JH 2BVQA 2IMMA 4BZ1L 3IRZA 2A74A 2GIYA 3ELAT 2V7HB 3TA3C 3L4VA 2SEBA 1KCVH 5E5UB 2XWCA 4Y5YA 1TITA 3IJYA 5FXCH 4LLDA 4L1LA 1JGEB 4GSDL 5DMGC 1HNGA 4XB7A 5HDRA 2LQRA 1Z3GH 3LV3A 2R23A 3SKUD 1LWJA 5I23A 3FFCA 4FNLL 4NO0A 4AG4H 4GFTB 4ZBJA 3ARFB 4PJCF 1UT1A 1I8KA 5KBLA 1DUYB 5HDBE 4FTVD 2F7RA 3LH2L 5HHOE 1EK3A 4AMWA 2YXMA 3MCKB 3C6LC 4JFED 2ZCHH 5I6OA 5E0FA 2BNRE 1PQZB 5TF1H 1S7XB 5B38G 1OZUA 4DP4X 4F8TA 1IAOB 2EH7H 3E80A 1VSCA 3SDDA 1QLEH 4E41A 2E9IA 3LDBB 5GZND 1T5XA 2FQDA 5C0BD 5B7MA 5TDOA 3ILQC 1NDGB 3FRPG 3GRWA 3D69B 3HJEA 1XGUB 4WEUD 1O7VA 4HPOH 3ZJAA 1UWFA 2OSLB 4YGVA 4PJ5D 1E4WH 1H15A 2W8CA 2W65B 2VUYA 2O5XH 5CMAB 3QO1B 4YAQA 1D5BA 3BT2L 3JWDH 4QXWA 3US9A 4M6NH 1G87A 1Y6KR 2UX7A 4LVNC 4UYQA 1OP3H 4BYHA 1S7QA 3W2DL 1CGTA 4M61A 3D18B 4OIBA 4XZUB 3WIHA 5ICYB 4QHLB 4KKCD 4TNEA 2VCOA 3N1FC 3VFGL 4FNRA 3PHOB 4JGNA 4UBDC 5AW7B 1FVDA 2H6PA 4RMRA 2RB8A 1T04B 2QKSA 4M6OL 3D30A 2ZYSA 4XBEL 5JXAL 2R1WA 4AT6A 1R75A 4X7SH 4S2SA 1JRHH 5TE6L 5F6IB 1NCAL 2J25A 4YSPA 3P9LA 2WXLA 3QJVB 1JZ3A 3Q2WA 1EWHA 3II1A 4HJ1A 3H9SB 2BWQA 3FUDA 5E6IC 2AQ1A 2EZ0C 4NBYB 1IFRA 2ZNWA 2EC8A 4NBZB 1T22A 4JFQA 3X12A 4YR6A 3ZTJG 4W68A 2IWEA 5GGTL 1IC1A 4HMEA 3FOMA 1KPUB 4L0PB 5HHPB 2P5EB 1I8LC 2BC4B 4X8XA 2Z8SA 3GKWL 4MBRA 1X4ZA 4KY1L 1KV7A 5G2NA 5IQOA 1QSZA 1URZA 3KBPA 1JHTB 1NFDB 4FP8L 3H53A 3AADB 1NLDL 4UMGA 2WPGA 4PJ7F 2WWNA 3GIVB 3NFNA 4TLKA 2YIHA 4NUQA 4Z3IA 4N6QA 4JPWL 2NTSP 1LWHA 5FB8B 4O02L 3MBXH 3U82B 3UDWA 1X7QB 2AXJA 4OH2A 4X7TB 5ADPH 2BZCA 4FN0A 4PY7B 1U58A 4LK4A 3QC6X 3DPDA 4XMXA 1BA9A 1DLFH 3T3MB 1QPXA 4H8UA 3S0PA 1ICTA 1KJ2H 2YUVA 4P4KC 2BXYA 2OMYA 3OZ9L 4DETA 4KTDH 5IMKA 3QUZA 2X6MA 1SN0A 2R0ZH 1YY9D 3DSNA 4JO1L 3W11C 1OP9A 4A2HA 1JBJA 5DK0B 5D7KE 1PKQA 2ZP8A 2VQ1A 2EC9T 1GGUA 1U8JA 1A9EA 4NZ8A 1FL5A 5DJ2A 1EXUA 1RSFA 4OQTA 4JCMA 1F90L 2HTLD 5L7XH 3NIFE 4FG2A 1BXVA 4MA8H 2AK4D 4IKJA 3IJ8A 1OT2A 5E56A 5KYYA 4L0ZA 5E6IB 2ZWLT 3HG1B 4NENA 4ZAKC 2EIZB 1DL7H 3Q1SL 1CLYH 3WD5L 3BP7B 4JPSA 4L29B 8PAZA 3RTQC 4JO3L 2ZJSH 4KTEH 3VI3A 4Y8AA 1GC1L 3JWDC 3W37A 2FUQA 1AHKA 4TVPD 4MD0B 4NM4H 3UP6A 5T3XH 1UM5H 1LGVA 3JZ7A 4L0YA 3UBHA 3MOAL 4HDIA 5DQJB 3NZSA 5AVYB 3FSZA 1NJ9A 4QT5B 1KCSL 5TH2B 1NANH 4JFHD 1P5UC 3EFOB 4LLAA 4P07A 2IH8A 5F44A 1I4FA 4ZXBC 4Y9GA 5L2KB 1CFVH 5C0GB 3HNVH 1OWRM 5SWZB 1D2OA 4JRXE 3T5WA 3L95A 3EO9L 3FONB 2Q9OA 3O8XB 3NACH 3QQ3B 4FXGA 3EYQC 5D7IB 4DGIL 1KIPA 4Q9QL 1PG7X 1E5UI 3EDDA 4DGYH 1N6UA 2W59A 1CC3A 4OQ1A 4D9RE 2E6PA 4PIBA 4CMMA 1N8OE 3LS4L 4OLXL 4U7KA 1OARH 4L1DA 4X99B 3ZKQD 3HB3D 1CVRA 1CFBA 4D3CL 1JSYA 2WXGA 3PQYD 4PJ8D 3DYMA 3TBVB 4OLYH 4OT1L 4PGDB 2DJUA 1N5AA 3ZKMD 5ISZE 2OMTB 2R0LL 3D0LB 4Z3JA 2F53D 2Q0ZX 5JPNA 1I9RH 4KXBA 4HP5A 1YNKH 2APFA 2I25N 3GRBA 4H8HA 3RWDA 3K71B 3A6BL 4QHKJ 2GEEA 4HIQA 4U6HB 3TT3L 3FUFA 1UA3A 1NMBL 2G75A 5EO9A 1JF1A 2IGFL 4F8NA 5DRXB 1IEHA 2BCKB 1JYXA 3X13B 3QXAB 1A47A 2VM9A 4WHTA 1J18A 2X4UA 1KACB 3VMPA 3G5XA 4H7VA 1NH6A 4YDLC 2EH7L 1IVLA 2HYMA 1XIWD 3DIDA 2RCSH 4NS0A 5ERWA 1R5VA 2AAVA 2UWEA 3V0JA 2GAZA 3FCUB 5HDBB 1LEGA 4J6RH 4Y4KA 5JUEL 2C7FA 4OJFL 3PABA 1FLRL 1LP9A 2C7UA 4AENB 1HT6A 3H7BB 4F57L 3WGUB 1L4IA 3ALXA 5D70L 1ODUA 5KSBA 2V2WB 3FFCE 4PJXB 4KQ0A 3MRQA 3BMVA 2OX5A 2F58H 1MCKA 5C0RL 2WQRA 1BZ7B 3JQOB 5FYLD 3RUGB 1XR9B 1SM3H 3BC9A 4Z7IA 1WCBB 3U2JA 2XQBH 2XIBA 1ZHBA 2NW2B 4XBMA 3OKMB 3S8FB 2VC2L 3BSZL 3UJIH 3MRIB 4XMTA 1A9VA 1WZAA 4X9IA 3V5DA 1CMOA 4N2OA 3QCTL 3WS6C 1RZJH 2Y7QB 2H3NA 1LEKB 4RSVA 3ECQA 1QFUH 1EDYA 1T1XB 5AW8B 4WO4A 4M03A 4WRLA 5BZWB 4EMZA 3M1CA 2ZUVA 1BF8A 1FFOB 1E5BA 3KH3A 4LSPH 5LGKA 4IHOB 4CADB 5FGRA 1MNUH 3HW7A 1KJVA 3ZRFC 1NFIB 4BFOA 1E3XA 4JFEB 4PWJA 3C12A 3MRJA 5C2BH 1BQ5A 2ZSWB 5JOFB 4F8PA 4R2GB 5KS9E 2X4PB 4GKSA 1MH5B 2MKLC 2O5YH 3GMOA 2YBRB 1X5ZA 2P80A 5IMLB 1L0PA 1SVBA 2SODB 3V5KB 1IMHC 4MNQD 4AQAA 4NO0D 1BLNA 1LDPH 2KZWA 5GSRA 4B7LA 1KBGH 4HJ0C 2HG0A 3CH1B 1D5RA 4PUBH 4RFEB 3WUWB 5ID1A 4XPAL 5GISH 4U2YA 4W6XB 2CRZA 2PXYB 4Y89A 5AAMA 2JFCA 5JORB 3BVTA 3GSXB 3PUUA 2MOGA 3KBFA 1KG0B 2XQ0A 2J8OA 3MRGA 5I1IH 2F08A 4N0YL 5TPWL 3PCYA 1DEEB 3PPEA 5CXPA 4HUMB 4O02H 4R4NC 2Z31C 1YEEH 3IAPA 3QDGD 4NC2B 5EUOB 3X11B 2QKIA 1MHCA 4BA8A 1QQDA 2CLZA 5HBBA 3MRHA 4OI9A 1GAFH 4ZTOL 3SE8L 4WDIB 3P9MB 3MLUH 4Y88A 3SIKA 5DHEA 1UVQB 2PO6C 3ORJA 4FZEH 4XVJH 1ORSA 4QHUB 4NUPA 1TVBA 2QPDB 1YUHA 4L3CB 3RAJH 2BP8A 4XP6L 4BSVA 4R9HA 2YPKB 1UG9A 1E5AA 2DL9A 2W9DL 5I1HH 1U3HC 4JPIB 2XRAL 1MJJB 2NX5B 3QJFA 1MY5A 5H35B 5D2LA 2VB5A 3B43A 4BZ2L 4JKPH 2XJKA 4Y4HC 2R2EA 4ODVH 3STLB 3D25B 3NA4A 5AZUA 5IJVB 4ZMXA 3B56A 3EYUL 5FYLH 3ARQA 3F5WB 5G4MA 3MV8E 4PW9A 3FO0H 1NKRA 1X4XA 2XKUA 3QCVL 2XACC 3V6BR 4EQ3A 1WK0A 5BS0B 2DQGH 1LHZA 1GJIA 3QJUB 2Z93A 2XJLA 1YEKL 2EO1A 1FV1B 2BSDA 2NT0A 1CGXA 1KGIA 1T0PB 4AH2B 1JNJA 1RJCA 1TEYA 4QY8A 5IB3A 3UBXI 1FE8L 2K3TA 1BD2D 1KFAH 3PHQB 2X4SA 2Y7LA 4QRRE 3AXIA 4GQ9L 4L2YA 3U1SL 5I6LA 2CKNA 1A0QL 3ULUL 1H3WM 1JZ4A 2JTYA 2BNUA 4K3EH 4P2RD 1QZNA 2ZAGA 2AJVL 3KPOA 2XN9B 5C0JB 2NY4C 1VA9A 4PV8A 4V1DA 1EVTC 4L05A 4TQEH 4Y9CA 4QXTA 5LNGA 1INQA 3WSQL 5JXEA 1A6WH 3Q6FA 3ZE0B 3W0WB 5DD6A 3WEAA 4YHNB 2E27L 1ZXQA 3THML 4ZZKA 2VLKE 2VZ3A 1ZPLA 1QMUA 1VGEH 4Y16B 4PWKA 3B8YA 5DJDB 5IJBC 3TF4A 5CGYC 1AXTL 4HKBB 1Z3GL 2D7NA 4L48A 4OKVB 4R7XA 3EHBD 3QQ9D 4JZOA 1BQRA 5F7WC 5DTFB 3BQUB 3N41B 1C08B 3TBYA 2XWTA 3AQZA 3F7PC 3O6KH 4WFGE 4KQ4H 2VSCA 1FSKC 3LRKA 1LNUA 2ZNXA 4PJAB 3VGAB 4FQLL 3HVNA 4NWTL 4K0OA 3QWQB 1LM8V 1WP6A 2YXFA 4L3EA 4GAJH 5K59F 3CN0A 4RMUA 3UPAA 3DTXA 1EMTL 1D9KC 1JHKH 4F27A 3HUJA 4DZ8B 4F1ZA 5A40E 3DX9A 1H3PH 2WB7A 9PCYA 1PZSA 3O3DA 3CDZA 3SGEI 4JFXA 5GS0H 2A83B 4NN5C 4FFVC 5DQ9B 3BKCL 2MCG1 1HJCA 4OW6A 3RZCC 1UXWA 2CALA 3FU3A 1MIML 4GLRH 5JO5A 4NQDA 3VNZA 3RAJL 4QKTA 5KSVB 1FCCA 3LB6D 3RZCB 2DLIA 1DSYA 3CPUA 4OF7A 4F8LA 2YARA 4AQ1B 3J7HA 2EDLA 1KN2L 1FN4A 2EDYA 4EKXA 2IAMB 5I24A 4O00A 4HH9A 4F15B 2WWOA 4ZUVA 3WEMA 2QSQA 3ZO0A 3LPWA 2HT3D 2WBJA 4F33A 2DTSA 1QLFA 4CGUB 3HS8A 1E4HA 3CC5B 4XNMA 5DUML 5HHOD 4A38A 4EVNA 4HUVB 4ODUB 4UTCA 5EN2B 3RUGF 2J44A 3K6IA 2AXHA 1D5IL 2DH2A 2DEYX 2UVFA 4B41A 2VDKB 1TEGA 2ICWB 3HB3C 4Z7QB 4JRYB 3DURA 5JA9A 3LKRA 2PETA 4JL2A 3F62A 4HBCL 4HCFA 4LOUD 4Y8DC 4Q97A 2WNGA 3HC2A 2F9BT 2IADB 4XX1E 3QUZD 3F2LA 4C8XA 4IBUA 3I6LD 4RGMC 3DKHA 1AE6L 1L9TA 4XAKD 3T3PB 2W38A 1O0VA 4PGEA 1DVFD 2EXYD 4FQQA 4RZKA 4X8CA 2WLHA 3C08L 5D5MF 2AK1L 1KJ2B 4PRAA 1WA0X 4AJWA 1U91B 1E3FA 1S46A 3MR9A 4DEPC 3BPOC 1ZANL 1GS7A 4NPKA 3QEHA 3ARGA 2WP3O 5DA4A 1V7NL 4PRPE 5JDJA 1QAWA 1R5IB 2OBGA 3LKPA 1FI8C 4N5EC 4XOEA 4D8PA 3FUJA 3CSFA 1EH9A 1IE4A 4ABQA 5JPNC 3MNWB 3NCYS 4RWYL 3Q9PA 3HG1E 4WWKA 1AGBB 4HU8A 2A73A 1IC5H 3CLFL 4LSVL 3EYSL 4ODBD 1I8MB 3GLDA 3AM8C 4OKDA 5DRWA 3SDXF 3I50L 5KUMA 3I02B 1A1OB 2WLKA 2YAFA 4GUQA 2IQ9L 3WMQA 1R17A 4WK2B 4NNXB 3CDGB 3P73A 2W95A 4W9LC 5D7LD 3OAYH 4U3XA 3D39B 2X0VA 1KGYE 2ENJA 4RGND 5T3ZD 2IH9A 1WFMA 4PYGA 5AD0B 3X1NA 3BH4A 2AVFA 3O41A 4UTBA 3MKKA 3FTVA 1IQDB 1SY6A 2AXGB 2HTLC 1KGCE 2KI6A 3C08H 2ZAHA 4LOUC 1T7YA 4FA8A 1KJMA 2IOMA 3OZKA 4ELKB 4HJGA 4LAQL 3KNBA 4UQ3A 3RX5A 3ISYA 3O3BB 1JGVL 2NY1B 4I2XB 1E5CA 4P46B 3DHUA 1ZHNA 4NYLA 2PABA 2RFXB 3QEGL 4JFZH 4LDOB 5FA4B 1G6VK 4WJ5B 2JKXA 1DJSA 3E1ZA 4J12A 3QZMA 3LX9A 4DOHB 1I1FB 1B4LA 2FZ3B 4FEIA 1TZOA 4J3OC 4MS6A 1HHGB 4XC3L 2JLLA 3A67L 5AVXB 4XP1H 5GGRA 3U1SH 1FJ1B 4AGOA 5I19L 5I1DB 3ULUH 1EUTA 2CIIA 3JUZA 3KBEA 4TTDC 2R2HA 3P77A 3TV8A 2J2ZB 1S7SA 1U3JA 4NAMA 5LG1A 2EE6A 2WK2A 3FB5A 5D4IA 2CNZA 3R4RA 4F5CE 4KK6D 5BRZD 4HKJB 5DT1L 3QHFL 3TBWB 2K4WA 3SCMA 4A37A 3BKJL 1X9RA 4TM9A 4NSKB 4MDJA 3GPEA 4ZFOL 5E4OA 5EU5B 1TVHA 1O5DT 5DD3L 3RWHB 4FFZA 1P4IH 1X5LA 4Y9FA 2JJSA 4FI6A 1YLBB 3GSWB 5JYLA 1OL0A 3ILPA 3L48A 3SPGA 4F2MB 2PR4L 1WFNA 4IRZL 4JUTA 2NY6B 3P2TA 4ZO9A 4GRWE 5JLZB 1DBJL 2VKWA 3GMLB 4HIEB 1QFWL 2BLFA 3FO0L 3QCVH 4DJMA 4MCMA 5I5IA 2J6EL 4HUXA 4JHAL 2ICEA 2JJTC 4HWNA 4N0YH 2GY5A 3W9EB 3EFDL 1XGTA 3PWPD 4LKXA 4NZRH 5GSVB 1KB9K 4JM4H 3K2UL 5B3JF 3ME0A 3QC5X 2WBJC 3OKDB 4EF3A 4NRXB 4P46C 1HQRB 1NGQL 3BCFA 3T3ME 2ZUYA 4BWTA 3TF7C 3UFIA 4FQHA 4GAYB 1Z5LA 4F3FB 3D52A 1NC4D 5FYJU 3NCJL 1DSFL 1MZYA 4QHNA 4NUJA 1V8HA 4XXCA 3RLSA 4GKOA 2XICA 1MQKL 5T1MB 3SDAD 3WNJA 2CUMA 5AW1B 1ZKAA 3MV9A 1S9YA 4Y19D 5ANMB 5GGTA 1LEIB 1E3ZA 1F4AA 5KAQG 3GHEH 4HS8H 3KLAB 4TQ8A 2DQHL 5HGGS 5C2BL 1E4JA 5I6XC 5DYOB 2YOAA 2IDSA 4UU9B 1CFNB 4FX5A 4PMFA 4IBZA 3VFUA 4R5VA 5MHSD 3U6XA 4UQ2B 1IT9L 1UKTA 4WSGA 3WFHB 3HI5L 4PWFA 2VH5L 4OU3A 3EOTH 2OMUA 4MB5A 2VLJE 2KMWA 1A7PL 5DJZA 4KZEH 4MZ2A 2YPLA 5KBNC 1QW8A 4HIIA 1KBGL 1OHZA 3K0YA 3QDMB 2ARWA