3WTUA

Crystal structure of the complex comprised of ets1 (v170a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
118
structure length
118
Chain Sequence
b'GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITADGPREPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
molecule tags Transcription/dna
source organism Mus musculus
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
total genus 18
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtuA00
1EAOA 4LOEA 4QO1B 3WTWA 3TS8A 4AGNA 3KMDA 4IBTA 2BIMA 3D08A 4IBZA 3IGKA 2P52A 4AGMA 2VUKA 3WTSA 2PCXA 3WTVA 4IBYA 2BIPA 1H9DA 1HU8A 3WTUA 2J6WA 4A63A 4AGLA 4L0YA 1HJBC 2ADYA 5KBDA 3D0AA 3Q06A 3WTYA 2BIOA 2BINA 1CMOA 5AB9A 5AOIA 5G4OA 2X0WA 4AGQA 4IBSA 5ECGA 2J1XA 2J1YA 3QYMA 3US0A 3ZMEA 5A7BA 4G83A 3WTTA 1GZHA 3D09A 4MZIA 5AOJA 3KZ8A 4IBUA 3D05A 1KZYA 4MZRA 1E50A 2RMNA 4XR8C 5G4MA 2IOOA 3Q05A 1TUPA 1T4WA 2J21A 2AHIA 3VD0A 2AC0A 4AGOA 3QYNA 5BUAA 5AOMA 4KVPA 4HJEA 4LO9A 4G82A 2MEJB 4IBWA 2BIQA 3EXJA 2FEJA 5ABAA 3US1A 2J1ZA 4AGPA 4LOFA 2OCJA 3D07A 1GZHC 2X0VA 1CO1A 1TSRA 3EXLA 5AOLA 4GUOA 2XWRA 3Q01A 3VD1A 2WGXA 2X0UA 3VD2A 2J1WA 4IJTA 2J20A 5AOKA 4GUQA 4L0ZA 4L18A 3IGLA 1HJCA 2IOIA 2XWCA 4IBQA 1UOLA 3D06A 1IO4C 4IBVA 2GEQA 2YBGA 5LAPA 1EAQA 3WTXA 1YCSA 2H1LM 2ATAA 3WU1A 5G4NA 1EANA 5LGYA 1LJMA 2IOMA
chains in the Genus database with same CATH superfamily
3G5XA 4JFEB 4WU5A 3GMOB 3C6LB 3HZYB 4M8VA 1IKFH 1RZJH 4Y9BA 1NCIA 5IHLB 1T1XB 1ESOA 2ZAIA 1F11B 2WYTA 4NGHH 3ZK0A 2FB4L 3O6FA 3P9LB 5GS1C 1MCBA 1CGSL 43CAB 3NN8A 5DYOB 2YD8A 1I3GH 1FSKC 2AQPA 2VH5L 2VR9A 5C0DA 3S4SG 3ZE0B 2V3EA 4FYRA 3EOAA 3C60C 4KKBC 3IXTA 3PY9A 4JO4L 3SCMA 5DJZA 5I1AA 2AQ3A 1DHKA 4Z7QF 2CUHA 3LH2H 5GGQL 3LKRA 3VA2C 3D87B 3IDIA 3KE0A 2QQNH 5DSCB 2GYSA 1WBYB 1E8ZA 2F58L 2WUBH 2R0ZL 1FL6A 2N01B 5GGTA 4GAJL 3O2VH 3PS6A 1KJMA 2W81C 3HI5H 4ODVL 1MIEH 1P7KA 3FOLB 1T21A 5C0NC 2N1KA 2HFGL 2ENJA 5AG8A 1OCWH 1HDMA 2VDML 2NXZD 3FPYA 4XP9L 3TYGH 4FXLA 3HC4H 1XF5A 4BSVA 1PS3A 5DR5L 3L5IA 2P5WE 4IOFC 4J12A 5CZXD 1YMMA 5D1QB 1TU2A 3I6SA 2D4DA 2CRYA 1KCSL 1U9KA 2MKLC 3N91A 1ZDSA 2AF2A 2PCPA 5IKCA 3K1KC 1PZ5B 1WC7B 3PNRB 3BJ91 1BV8A 5LQBL 1F4WH 4DPRA 2G5BA 4J8QA 2FT8A 12E8H 1QX1A 2GJ6A 3O41B 2DI8A 5D8JL 4BINA 1S7XA 4X7TB 1GZHC 5GS0C 2Z7YA 2IDCA 5D7LA 5EFIA 2EUWA 5I73B 3GSNA 5DFVC 5HDBB 4YHPA 4XE5B 5E2TH 3I2CH 1DBAL 1R3IL 2VN7A 4HUVB 2B2XL 3E3QC 2HH0H 3BH9B 3SKOB 4U1SB 5EMYA 5LBSH 2DQ6A 3IS1X 2WWKT 1RIUL 3MRIA 1BYPA 3B34A 3WDJA 3PCYA 1FFOB 3SE3C 1O5DT 2XZCH 3MROB 2JCCE 1DVFD 4CVZB 1I8KA 4HQQL 3R1GL 1V3KA 4DGUA 4OZFB 2W80C 3VM5A 2VDOH 4ZMXA 3NOIA 4N5UA 5C7XH 1FVCA 4ELKB 1HYSC 2IH9A 4F8QA 1J8RA 3GMLB 4FLSA 2DWDB 3QIWD 4DKDC 4F9LA 5IGXL 3QZOA 2HA1A 2MHAB 2W9EH 3Q3GB 2N56A 3EGXA 3L3DB 2L7JA 2VL4A 2DQEH 3QG7L 1KJ2A 2CO6A 5EF1A 4DEUA 2OMYA 2MQ0A 2Q5BA 4U1HA 5FA3B 5T1DH 4PRNA 4QY8A 2F18A 4PJ7A 1GOHA 4YBQC 5T1JA 1H3VA 1UZGA 3G6JF 1FZMB 3CVIL 1DP0A 4UTCA 3VG0L 1M7UA 4GUPB 3WLWD 3QEUB 3HZVB 3SPVA 2JCCF 3U83A 1FZMA 2ZAHA 3WSQH 3EBIA 4P5MB 5BRQA 1UCTA 3D9AL 3LNDA 4RAVB 4HLZG 3NEXA 4QRPE 5DURB 2ICWI 4X4XB 5T5FH 2ESVE 2VZTA 2WYIA 1XR9B 2UV3A 5DA4A 4QOKB 2DBJA 1KJ2B 2CO6B 2H8PA 3VI3B 1KBBA 3ATAA 3D2UD 5IFAH 5I1DA 2Y0SA 4IBSA 1AJ7H 1KJ3L 4D9LH 1WFUA 5FFOA 3NZHH 2R69A 1HE8A 3BMWA 4BZ1H 3OXRA 4PB9L 5JQHC 4B0MM 1F0LA 3S88H 3OLEA 2X05A 4Z76B 1BFVH 3NZSA 2NSXA 4QTIH 4R4FH 3TBWB 1Z3GL 3QEQD 2AJXL 4KPHH 5F6IC 3KYKH 2E7CA 2X6MA 1GCYA 2FIRT 3ML8A 4JY4A 3ZTJG 5C70A 1MSPA 4PVBA 3H3PH 4CC4C 3D0LB 1FG2B 1ZT1A 2LLGA 4HUVA 1E9PA 1MJUH 2NOYA 3BPLC 4H20L 4LPYA 3FB6A 4GRMA 1CGUA 3AWEA 4J5VA 1TLMA 1YEEL 2OMTB 1FG9C 4XXDB 3O8XB 3MRRA 3MXVL 2I60H 1AAJA 1OZTG 3FO0H 4WF7A 3CXHK 1BCIA 3BKML 5HGHA 1ES0B 3WOVA 1CFQA 2DQFB 5EZOH 1R3KA 2OYKA 35C8H 2MOVA 5F9OL 5IHUH 1SXBA 2GIXA 3HFMH 3US9A 3G9AB 1KDJA 3MAWA 2FHBA 5D7IF 4R90H 4HXAH 4NRZB 1FPTH 4WI6A 4XBPB 2WCSA 1JNLL 2NY5C 2YA0A 4YUEH 3W5NA 3FUIA 4HD5A 2WO3B 1YMMB 5D1QA 3HG1E 2VL5A 1R4XA 3P4OA 2HG0A 3H54A 4U3HA 2IMMA 1Q72L 4BZYA 1FNSH 4FI6A 4DN3L 4NO5B 3VXSB 2B15A 3ARED 1SDDA 3CIQA 4X6EB 5EF3A 1Q8MA 4AEHL 2VLME 3L3OA 2FBRA 3DURB 3GUTA 4JFOB 5GZNA 2D9QB 3GB7A 4J3SA 1KB5H 2ZYRA 3NFPA 4IRJA 4L8DA 4YHKH 1VB9A 5D1ZA 4PWEA 4L29B 5ERWB 3C6LD 1M7DB 5ADOL 2NQ3A 2GFBB 2A0LD 3O2DL 4NSKB 3T6QC 3CQFA 3FT4B 4HUMB 2Q2LA 1ERNA 3ROOA 3IXAA 3D18A 5IMOA 3BVNB 1IAKA 1NAMB 4Y2LA 3UBXB 1CLZH 2X2YA 4AM0B 5C71A 1WA2X 1A4CA 3NABH 3P73A 1DQJA 3SE8L 2P44B 3UBXI 3G7TA 4OGAC 4WTXA 3ILEA 4HWBH 3FRPB 4NI3A 4QJ3B 4QRRE 4E5XG 1BGXL 2WXOA 1V7MH 3V4LA 4WW2C 4K0OA 1B3IA 1NCDH 3KJ6L 1DBML 2X9YA 5EOQL 4OLVH 3B2MA 4CW1B 4ZMZA 1ETA1 1H8OA 4MS8D 2IH1B 2DTMH 3PP4H 3RDJA 4FADA 1RZGB 1TJIL 3VH8A 5HPOA 2AEQH 1IB5A 3TNMA 4Q4EA 3HMXA 3U4AA 5GZOD 5L8LB 4KZEH 2COVD 1WFNA 1YEKH 1HHGB 3AS3A 3F6IA 3L7FA 3CSGA 3Q7JA 2VRKA 1YG9A 3MJGX 4IBUA 4U2YA 1J11A 4HV8B 2VUYA 4L1HA 4BCZA 1HKLL 1FGVH 4HGWA 1I1YB 1A6TA 2ZCZA 3DUUA 5A2LH 4TQEH 2ADJB 3RWHA 2GTZA 1T7XA 2H9GA 1JGEB 3QHZH 3BQUA 1NINA 2WQVA 1IAOB 4AITA 1OP5K 1RFDH 4HGMA 3U46A 2YRLA 3IFOA 3ARFB 3TN0B 3M1BA 3VWKA 5I1GL 1EBAA 2UY6B 3CFBA 3LYRA 1KLFB 2WZAA 4Q6IB 2F6AA 4ZODA 3QJFB 5C0ND 3V9CA 4JLRA 4KROB 1CT8B 4XAKE 3TEWA 4MNQE 4UINH 3ROLA 2J72A 3FRPG 2J55A 3T2NL 3UTQB 5D93B 1X5FA 2KL6A 4GSDH 3K2IA 2BK8A 5D2NC 2PYEE 3S3BB 3TC9A 2YAEA 3ARZA 1XAUA 1L9PA 4JKMA 4JFED 3WIHL 1LEKB 5C07D 3ZZQA 1R3LA 4LCIH 2DWEB 4HP5A 1RFDL 1J5OH 1WFOA 1DVFB 2C9SA 1AY1H 1HHHB 1OAXH 3QQNA 1GTFA 1IT9H 3EFDH 1A65A 2D3JA 4I0KA 2ZAGA 2WTRA 5DRXA 1HWHB 4APXA 3P11L 3DECA 4DO6A 3V0VB 3OKEB 3INUH 2NY7L 1IEAA 1TQCB 2EICA 3S35X 1V54B 3V52H 2PP8A 3NIFB 3RBGA 5AUMB 3BPCB 4KITB 4CGTA 5I5MA 5DWUH 3SPJA 5LN8A 3HC0B 1G7QA 1PU0A 2HT3C 4AK1A 4QT5A 2NY2B 1R24B 5EBWB 2Q2EB 1MRCL 4X5WA 1KIRB 4JPVL 5F7UA 2DZEA 2BY1A 4NYLA 2JJSA 4W6XB 3QDGA 4JFVA 3IDNB 3ZDXB 3CH1B 1M6OA 4LHJB 3ARFC 3U46B 3U1SL 5JUEH 2NXZB 2XV6B 2ODIA 1X7SA 4MQSB 4LFHG 4HIXL 4OCYH 4CBZA 3QUZC 3K5RA 1JXFA 2DQDL 4G6JL 4GOSA 4UDTA 3P0YL 3BESR 1XH2A 1MFDL 4IU3B 4MB1A 3U9PL 2LR4A 4PRHD 1UASA 2A74C 2VZ3A 3HC3L 1OP9A 5CNHA 2G3XA 2ALWA 3EJCA 4MA7H 4MDJB 6PCYA 4B9IA 2MPVA 4G80A 5MHSE 1RMFL 1KTLB 1INQA 1LP9B 4G8GE 4LE8A 1ZT7B 2TAAA 3D9AH 1HIMH 4F7TB 2Q3XA 3I6LD 5SWQA 3QUYB 4M56A 4TS6A 3ARYA 2ORBH 4GP5B 4PJXB 1YPZA 2AJ3B 4WUKL 5E95B 1TQSA 3S34L 4OGZA 2DQHL 4IU2B 2JJSC 1JDAA 3SE9L 4C56D 3V2AR 4YAQB 1E0OB 2ZWSA 4YDLB 5I0ZA 2DQEL 3ECQA 4KXZI 1D5XB 2YD9A 5DLML 1BZDA 2AXFA 2ZWNA 4ZTPL 5JPMC 2YPVA 2WNWA 1FPTL 4MB3A 4LSPH 4QHMA 2UZXA 2CGZA 3FFCE 4OLZH 2ALAA 1E5BA 1T4KB 1VESA 4G5ZH 3UEQA 4HAGA 4JJ5A 4WUUD 4DERA 3ZKXC 5C7XL 2JJWA 4HQQH 1E2ZA 3G6JB 3BOVA 1EVUA 1MJ8L 4N2KA 2KPWA 5EA0L 5D2NE 4LL1A 4QCIA 3GHBH 3KLAA 4Y5YC 2H0EA 1RZKL 2PPDA 4FDWA 4XGZA 4B3EA 1O6TA 5FO8B 1M1SA 3DOSA 3EYFA 1AC6A 3QNXB 2X2JA 1QPPA 3HC0A 3T09A 3MOAL 4NJAL 5E8PB 3V4PA 2NX5A 3VQ2C 1X9LA 4PLOB 1OAZL 5MEOA 1KYDA 4JDZA 4QXVA 4H26B 4KUZL 4HMEA 3RY5A 1SNRA 4XN4A 1NOLA 3KYKL 4ODXB 1QUNB 3BN9C 3HE6A 4FRWA 5CJ5A 1U2CA 4Q6KA 1A6WH 1P84K 2WO2B 4B9KC 3LX9A 5FOJA 1NDMA 3MCYA 4MX7A 2Y7QB 2E7DA 1MI5D 1CTOA 3HR5B 4ZMTA 3BGAA 4N2LA 2VDMB 4Q2ZB 4Y8DC 5FUZH 1N6VA 4WKXA 2VO5A 3QDAA 5CZVH 4OF6A 4OJYA 2OR9H 3ELAT 2HJLB 1X5GA 3QEQB 1M53A 1A6VL 4BCYA 2PYFA 3KWWA 5IQ7L 5FIEA 2G3MA 4A6YH 3D4GA 3P0GB 4V1DB 3S37X 2C4FT 2PXYA 4XCNB 5JORB 3M86A 4LVHC 4Z18A 4RFNB 3MLSH 1HHIA 3AG4B 1AQDA 1CICD 2ZUUA 1DQDL 5CCGE 4HOZA 4TUKL 1B88A 2YOCA 3ZBMA 2N0KA 4F91B 3IDMB 1T6WA 5L8JB 3IFOB 3OGCA 5GGQH 4I1NB 3S3PA 1LMKA 4GAYB 3VNYA 4YWGL 1DCLA 2W07B 5T8IA 3NPSC 5F1KC 4EI5B 2VKWA 4X2UA 4K7PL 5I8OH 3IU3A 3CVHA 2Y4SA 4AIOA 4Z7WB 4DAGL 4FGMA 5HI4D 1E5UI 4QOKA 1RZIA 1DSFL 4HS8L 5IEKB 1RJLB 1NC4A 3HMXH 2QFRA 2VDQB 5F8RC 3VXNB 3KPNA 2VLRB 5LJYH 5FUCE 3GT6A 4O2FA 1NCWH 3SDAB 3TM6A 2L3BA 1R0AH 3GSNL 3O4LE 2YEZB 4JFFE 3I9PA 2B2XH 2JF1A 1U42A 5LB1A 3UYOD 3NFNA 5KANI 5I30L 3RGVB 1JZ7A 2XG5A 4P9HL 3GTNA 1FNFA 3QI9A 4YWGH 3P77A 3T0EE 2HKHH 5LN4A 2D2CC 2JNZA 4HEPA 1LK3L 2WQRA 5IEHB 4I0PA 4MAUH 3TJHC 1K6QH 1G7IB 5SWSB 12E8L 4ELMA 4ZZKA 2BY2A 3ARUA 2QQLL 4R3SB 1T03L 4IMLA 1U58B 1DQJB 3WFCH 4NXSA 1JXGA 3LZPA 4LP4A 1DDHB 1HL4A 5ICZA 1P9MA 1PPIA 5L7XH 3WE1A 4A6YL 1BZOA 2Q3AA 2FATH 4X50A 2IVFC 4DOHB 5ICXA 4WQOA 4CC0A 5CM1A 4APQB 1GOGA 5IB1A 3RIFK 2NY2C 4IDJH 2JSFA 1TMCB 5IBTH 2AJYL 2K4WA 4FQCH 4OVVA 2MOQA 1EHLH 5KSVB 1ORSB 4XBEL 5K93A 4X6DF 4P2QE 2WN2A 1A9VA 3GINA 4M7JL 4NQEE 2EEXA 2G9HB 4N2CA 2GTWA 1HTYA 1LP9A 2AXJA 3D6GA 1FQ9C 1G43A 5HGBB 1A6WL 5DQ9A 2DF3A 3H53A 4X8JB 3MUHL 4TSBL 1QI5A 2IBGA 4WJKB 1YMHA 2FO8A 3E0GA 1MFCL 4UT6A 5CD5C 3K71B 4CC4A 1H19A 1GJWA 1EJ8A 4UQ2A 3B43A 3U2IA 2J8OA 5A43C 5ENWB 3GMRA 4IRSA 4JO4H 3D39A 4KWUA 5CCKH 2UWEE 2HTLD 3OMAB 2HRPH 4HS3B 5DZJA 3KLHD 2X89A 4I3SH 3TBTB 4ZMWA 3ZIMA 1EZVX 5B8CB 4OQTH 3WNKA 3GMNA 4A63A 3LCYA 3WFDH 2LLNA 3W5MA 3IE4A 3JWOH 2BNQB 4MD5B 3DX7B 2Y22A 3K6SA 2G3NA 2R2EA 3GLZA 2AEIT 4P3DA 3DDFA 4P5SA 4D0CB 1FO0L 1MXGA 5BO1H 4B97A 5DC0A 4E9LA 2ZXBA 3KYMB 3ULSB 4C47A 1T20B 5KSUB 1NGQH 5FW7A 4WFED 2NSMA 4HJGA 1UM5H 5JTWA 2AV7B 4P2AA 3M17A 3Q6GH 2D31B 1XXFC 5LGHH 4B5EA 5I1AB 1NFDF 3TVMC 1AI1H 2YQGA 4C56B 3MLUH 4XP6L 3Q0HA 1XO8A 1OQXA 4M7KL 2VLLB 5HVHC 1AZNA 3TO4B 4FFYH 3LH8A 1S7VB 1GL4B 4ZFGH 1UJ3C 4TNFA 3RURA 1G87A 4N8VA 3MRNA 1JNJA 4OLUH 5F3HB 5EU4B 5MEPA 5HDQH 4JQIA 3U0WH 4N2MA 2XJLA 1CTNA 5HD8C 3ZE0E 3L3GA 3HZYA 5INCA 1JTTA 1KF9B 3M1OA 2JLPA 4Q58C 2MFNA 4JFXB 4N5EC 4NN7C 3MREA 1ZGLB 4J3OF 1N5AB 1S3KL 3SE3A 3GI9H 1E4KA 3U36B 4KFZC 5IREA 1IL1B 2EO9A 1MW2A 4DZBB 3UP1A 3IFLL 1CR9H 2NY2D 3FBQA 4Z7IA 4NHUB 5I6NA 1S46A 3VSUA 2KZKA 4PRNB 4QY8B 4XVJL 1LO3H 4U1HB 3TO4C 3U0PA 1E3FA 3AQDA 5EOCH 2F74B 1TZAA 5DJYA 4XZUB 3UTTB 4G42B 2ZKHL 5I2IA 4Q89A 2H9GB 4ZX3A 1S7SB 3VNZA 3RRQA 1GYWA 2P5WB 4A2HA 3CSTA 2IFFH 2XTJC 3VFNA 4W9FC 4HBQA 1IIKA 4DESA 4GJTB 1KGUA 3QS3A 2IAMD 1G7LA 1I8AA 3NPSB 3AT9A 3SQBA 4ZFOB 1EV2E 2CAKA 2XI9A 4FJYA 3VE0B 4FNPA 1KEML 2GK0A 3UPAA 3RZCB 3UOAB 3EJZD 1FLRL 1CG9B 4HKBA 4DVBB 5I8CB 3BAEH 4V1DD 5CP7A 3K80A 3QUYD 5T1MA 2CIKA 4I13B 1VENA 2AI0L 1GA2A 3CCHB 4M1GL 5EO0B 5AZEL 2Z65C 5B7EA 1L9QA 4Z0BL 2A6IA 4KJQD 4EIZC 3Q8BA 5KS9A 4AJ0A 1SVBA 1A9BB 3CZFB 3MYJA 2Y36L 1PG7L 2EQDA 3CSYA 1N6QH 3CVDA 4GKNB 4HG4J 4TTGA 1CDHA 4EI5D 4HIHA 2WBJA 5ES4B 3QFDA 3TOPA 1E3ZA 3N42F 5DXWA 1D5MB 2CJUL 5IBLC 2AGJH 4IRJB 3F6JA 1IM3D 5K9QI 5CILL 1XF5B 3TCXA 2PP9A 4D8OA 4Y16C 2UYLB 2P24B 5D2LB 1BOYA 4WZ9A 3NH7H 1VFAA 4H1LG 1XHHA 4JFDE 3RAJH 2V2WA 2IALA 1WT5C 5K9JL 3FO9B 4S1QL 2IXQB 2K6WA 3L1EA 4RFEB 4P5KA 2ZCHL 4QRAA 5FM4A 3GMNB 3VXRA 2RAMA 1GC1C 1ZTXL 2WSDA 3ARGC 4XWGL 2HUEA 3OKYA 5IBUG 5GRWA 5CEYB 1N5YL 3WUZA 3IRPX 3ZKMD 1GSKA 1KWKA 4OZIA 5GS2H 4NQSB 1XZWA 4MQ7A 4WY7L 5A2AA 5JYLA 4J1UB 4X5RA 2FO4B 2E7HA 2KS0A 4U0RC 2FSEB 3UTOA 1T80A 2WWNA 2ED9A 5CLYA 2H3NB 3DX4A 5IJDC 5IQ9A 2JB6B 4WW1A 1TZIA 4UF7C 4ONFL 2YQ2A 5KS9F 2DKUA 5HYSB 2OTUB 4FG6C 3KVDD 3LPPA 1L3NA 1BM7A 2DTSA 2XOTA 3MRRB 4RLDA 4A7GA 4JL2A 1E7VA 2XDHA 4KDWA 5JZ7D 3CNKA 4Z7VA 4GUOA 1QFUL 3WEMA 3GSOB 3RWGA 5I16A 4NX0A 4QO1A 4JANB 4K3EH 5E94B 2V7NA 4MJJA 1NCGA 1QRNA 3D85D 1DEEA 1ZCRA 1KCRL 1K72A 2YUXA 3LIZL 3OR6A 1EFXD 3QZNA 5AYUL 1JZEA 1P6WA 3AT0A 1JF1B 3E6HB 3VYNA 1JK9A 3PL6B 4Q0XH 1CK0H 3ZTEA 4BWUA 1QVOA 4LAQL 9PCYA 1IGJB 1SEBA 1VZHA 1CICB 2NQDA 5C0CB 1DVUA 3RNQB 4OZ4A 1YY9D 3GIVA 3FTSA 3D4ZA 1YEJH 3R0NA 2IG2H 1WBXA 3EGSA 3V6FA 3OZ9H 4FJ6A 4GMTH 4Y2DD 1AG0A 3OF6A 4JM0A 1OP3H 1RV6X 2AZUA 3C9NB 3TXAA 1OGSA 3CSBA 1MCLA 3B7YA 2X6CA 2VDPH 2ZD0A 3WENA 3QH3B 2EIMB 2F7QA 3OKDB 1QAWA 3PAUA 4I3GA 1N12A 3MV7A 3NACH 4G6KH 1LEGA 1FFPB 2V33A 4GW1B 2VDPB 3BGFC 2W8CA 4A7GF 3VXSE 3KXFD 3MPCA 1ZK5A 1P4BH 3DVNB 4YBHA 1NIAA 4ATWA 5ESQA 5I1LA 3BLPX 2NY4C 4HVBA 4I18C 1P5VA 5GHWH 1DVSA 5HHOD 5L2KA 4LVOC 3UC0L 4KQ3L 2ZKXA 1DANU 3BT2L 5FYJE 2BNRD 3WTTA 5INDA 2ADGB 2VYRE 1NEPA 4CUCA 4PRHB 1T22A 3VXPB 25C8L 3MJ9L 4N0UE 1EGJA 1QNZH 2GJPA 1MHPH 5ELIA 1NICA 1RSYA 3ET9F 5DEGA 3STLB 1JS4A 3ULUL 4N0FA 5CJXA 3M17B 3DX0A 2NTFB 3AITA 1IC5L 3FRUB 2CLVB 4V1DA 2NCMA 5T3XE 3UDWA 4R4FL 2JELL 4Y19E 1YEIH 2WB1A 1OM3H 5L6YL 3MN8A 4BH8A 3G6JE 5DD3L 5EU7E 3UERA 2A6KB 2X4NA 4FFZA 3L4TA 3N0PB 1GGIH 1XCTA 4L3EA 4Q7DA 5L2JB 2E59A 1NQBA 3CSPA 3VD4A 2HYMA 3QRGL 4OZGB 2DOCA 5IFAL 2ZOUA 5E2UL 5I6MA 4OB5L 3C5ZB 4JM4H 3RY4A 3WXVH 4F7PA 1CXLA 2XIDA 1ZGLP 5DHDA 4KVNL 4GINA 4Y2OB 3TPUA 3HE7B 3RVUD 1KPVA 3QXAA 1JN6A 4AIEA 3MODH 2YUWA 3FNKA 5TE6H 3ZO9A 2V9RA 3HB3D 4TOYL 2V8LA 4M3KB 3VSQA 1TFHA 4ENEC 1LMIA 4MXVF 4LFHD 4B7LA 3QUZD 4HBCH 1QBAA 1CGVA 1TVHB 3UTSD 3QDMB 4GIPD 1WA1X 3VU1A 1JI1A 1XF1A 5FWRA 5ADPL 2P7TB 3DJRA 4JN2A 5CSZA 1ZWIA 2X3BA 4JPWH 1MCFA 3BSZL 3TEXA 4EDWL 5KSAA 3T0EA 3BD5A 1KBKA 1O7SA 3DVIA 2VABB 1XWVA 1Z5LB 2DLGA 4JB9H 4QGTA 5ISZD 2R1YB 2WVVB 5J6GA 4QTFA 4YHIB 3MNZB 4PCSA 1D7DA 5EIIG 4BSJA 2G2PA 3BAXA 3NJMA 2V2TA 4X4ME 2PPFA 2PYEB 3D3VA 1KCRH 3IPBA 3LIZH 2FQEA 3LVTA 5AW7B 1GOFA 3ZDZE 1S9VB 2C34A 5D7KD 5DMIL 1Y6MR 3ARGB 2VXSH 3GRGA 3NIGE 4FNRA 1KELH 3WFZA 5GZNC 3L7EB 2O6PA 3DNKA 4D9RE 4PYGA 3KJ4C 3MBXH 4FFWD 1OWWA 4RETB 4LEXL 4KRLB 2L0DA 4GRLC 4F7MA 1WSST 5E6UB 5F0MB 4FFVC 1MCSA 5F89B 2CALA 1I8UA 3ULUE 3B9AA 3PDOA 1BF8A 1JCKA 1IM3B 3EGDB 5LQBH 2YGPA 3GSUA 1UEMA 1YRKA 4FFVD 1URZA 2Y25A 1ZPLA 4GFXA 3T77B 4CDHA 3TZVA 2W60B 1CDUA 2FX8L 2UXFA 1MJJA 4FHJA 2ZUTA 2V9QA 2VLRA 4XH2B 3VXNA 4PRIE 1VGKA 3SO3C 3JV0A 1USZA 4POYA 1CF8H 4LCUA 2XFGB 3NJJA 4ALAL 5EO9B 3EF4A 1U8NB 3TYGL 4N24A 2E86A 1FGNH 1ZVSA 4BFKA 5HHNA 3X13B 3FQWA 4EIBA 3HE7A 1C5CH 1BQ5A 2X70A 3PIQB 4GQPH 1KCVH 2XTSA 4ABWA 2VLRD 4J39A 1NGYA 3FO2A 3TT3H 3QIUA 4GAJH 4XN7A 1PZDA 1XB6A 2KLSA 2ZUVA 4ZSOE 1ICTA 3V0DA 3LXUX 2Y7OA 4KJPD 1R24A 1ZV9A 2IADB 5EBWA 5AB1A 1JK8B 3WXWH 1N6QL 2ZONA 3V4VA 1FZJB 3BH8B 4PRPA 5FPIA 1WZAA 2NUPB 3ARVA 4G7YH 5FAAA 3S2CA 3II3A 4J2XA 3CJJA 1A2YB 4NQEB 3AY4A 1MFEL 5AEAA 1HK6A 1E8WA 4YC2C 4N8UA 5E2WH 5AW0B 3QHFH 5JDSB 1A6PA 1EXGA 2IGTA 5AKTA 4L9DA 4OSUH 2HN7B 2E27L 4ADGA 3KG5A 5FV1L 2O5YH 4LB8A 5GXBB 1K6QL 5CSBA 5M95B 1A7OL 5CZRA 1A4JB 3ZZ1A 1LK3H 1M05B 2GJRA 2W65A 3B8YA 3QDGD 4NFBA 3PL6C 5DGRA 3BH8A 3AUWB 4ZPVB 3F7YB 4HF5H 2A0LC 3HHMA 4G6FB 4BWWA 3IKKA 4ZXBD 4YH6A 3RJQB 2O5NA 4ZS7L 3ZDYB 4IRJD 2IBZX 4BM7A 4D0DA 2AJSL 2Q1EA 4UIMB 4CA4A 1FAIL 1Z3RA 3IETB 1ILUA 5KZCD 4OM1H 1BPVA 3B8SA 3L3HB 3HMWL 2G4GA 3WJLC 15C8H 3BLKA 4JN1L 3O9WD 1PJ9A 5BOPA 4JBSA 4NNPL 5L9DH 4Y1AB 2WQUA 2BVTA 2R0LL 4GW4A 1T0MB 3FN0L 1HU8A 2DIEA 4KFMA 1VACA 2C9QA 3BP4A 5HYQB 4IHOA 1QSFA 1MG2C 4NZ8A 5D1QD 2BW5A 3WNIA 1JYXA 4HX1B 4BA8A 4TLKA 3ZJAA 1H3UA 1VA9A 4NUPA 4PBDA 4CSPA 1UH3A 2Z92B 3SDXB 5D5ME 1HCZA 1D9KC 1D6EA 4AKPA 8CGTA 1GZHA 4P5TC 4KH2A 4MMZA 4H5SB 3VO0A 3BSHA 2YRPA 2QL1A 2H6UA 4ODHH 2YD1A 4OD1H 3W39B 2JB5L 5H94A 1ZSHA 4AQ1A 3FAWA 4Y16B 4ZOBA 3QJZA 4WI2A 5IMLB 4PJEF 2VQ1A 4YIQA 3WUWB 5DRWA 2WLKA 4L0YA 3RHWK 4JPKL 2E47A 3P73B 1CTMA 2XZAL 2DQTH 4NHCL 5JIMA 1FVEB 1MAKA 2DLHA 3ETBF 4GRWF 4N2FA 5EO1B 3PL6D 4OCXH 4DVRH 2FTAA 3GSWA 1BX2A 3HBPA 4HWEL 4JY6A 3TYFA 2YD3A 2A9BA 4AH2A 4O5LH 3PABB 5C0CD 1F4YH 5LG6A 4IHBA 1T1YA 3H3KA 4OM1L 4ZK8A 2DJMA 2NX5D 4JY6B 4GW4B 4X6BA 3WO4C 2D7TL 5EIIA 1AC0A 3BSZA 3QQ4A 4K3GA 1OPGH 4FI7A 3BGMA 3L3KB 4LRNH 2IXQA 2ZCKH 4UT9L 4NQQA 3HA0A 3LKSA 4HIIB 5GSVA 5GS0D 4Y0GA 5CIPH 3U30C 2BSRB 3I02B 4DNLA 1A4KB 3BO8A 3FSOA 4F1SA 3EDFA 2CGYA 1WQVT 4P23A 1NCHA 1EGJH 4ODWA 4HK3J 2B1HH 4N0YH 5DFTA 2EIZB 2P5WD 1KCUL 4NLAA 4X42A 3BVXA 2DY2A 5FC9A 2K7QA 4N0RA 3ARSA 5HPMB 1TENA 5EZJB 3ARGD 4Y4HB 3D52A 4OZGA 3NSYA 5CINL 1IFHL 2UXTA 2DWEA 4HEMA 3VFMB 1UH2A 4XXDA 2EJ1A 4F8NA 3B2UC 3LHPL 4GSUA 3HS8A 1E9QA 4B5ZA 1CG9A 1TJGH 5I19H 3VFSA 4BK4A 1W8OA 2FNWA 2X6AA 1HXYA 4WW2A 2D7PA 4KKLC 1SJHA 1RUMH 1P4IL 1O6SA 1T5WB 3BKJL 3D69B 2XT1B 4GBXC 1INEL 1TIUA 1BBDL 4GXVL 2ATKB 4X7SH 3OXRB 4BK8A 2AKRB 3KM1A 2E5EA 2EDQA 5JNYA 5I17A 1CXFA 3MX0A 3AB0C 3F7VA 5G55A 4LHUG 4I8DA 3VFTA 4NNPH 2F68X 3VXQA 1AHKA 2J3SA 2V5YA 4ZAKB 4PTTB 4DT2A 2D7OA 3K8LA 5EUKA 1BJ1H 3CAFA 4HV8A 1TZGL 1BBJB 2PR4H 1P1ZA 4ZMYA 1MJJB 3HG3A 4AMKL 3MKKA 2WNGA 4BQ9A 1WRFA 5HDWA 4ACTA 3L3OC 2ZX8A 4UOW1 1GYAA 4NAMA 3UTSB 1IL1A 3FOMA 2ZOKA 3OAWA 2IANE 1QRKA 3G6AB 4HSCX 3B9KD 3ZUCA 2FX7H 3HLAB 3AAZA 1JHTB 1G0DA 3MRBA 1SFDA 2IF7A 3NA9H 4BFNA 1SUHA 1F3JB 4PAZA 2WY3B 2VXSL 1QG3A 3QUKA 2ZUYA 3SYPA 3QISA 3RY6C 3T0VA 5T1LA 2A83B 4JCMA 3VGDA 5EU4A 5MEPB 3US1A 1OT1A 2YMXH 4JHAH 2HX8A 4YFLF 4CN4A 1ML0A 3QUXA 1SLWA 3V6OA 3QNFA 1J86A 3ARQA 3MSPA 4ISVB 4O9HL 1T1ZB 5D70L 5IIEA 3BVNA 4NUGH 5GGRB 2PW1A 2LV4A 3WLBA 4YL4A 1Y07A 5HHXH 5IFHL 4M7LT 4JPWL 5KYYB 1ED3B 2FUTA 3VD2A 2DM2A 5FLVA 5GGUB 3FTWA 4JVUA 1RPQA 2NNXA 2LVCA 2XRAL 5JMRA 3ZTDC 1JOIA 1Z7JA 4FL4C 4JANA 5IROA 3ZE1B 2F8OA 5IWLA 3BP6A 3T5WA 3TIEB 4AE0A 4BFFA 4EN3D 2XWJA 4FLHA 4JG0H 5GS2D 1WZ1H 1N4XL 1FV1B 4PY8J 5BPPA 3HRZC 5E8OB 2GQHA 4WUUB 1S7QB 3UAJA 5F88B 5KBLA 2P5EA 2XQBH 4KZDL 2Y06L 4LCWA 4XXCA 2XXCB 1XF2A 4GKZB 1XB8A 4Z95L 4ANUA 3A6CL 4R7VA 2NY0D 1HNGA 4UOW0 5AKRA 5F89A 1J0KA 3HI1B 3L9BA 2ZF8A 1KT2A 4DP8X 2DQGL 3OJDA 5AW8B 3E6FA 2N59A 4LIQH 1JRHI 3P3RA 3R0MA 5IVXA 5DVOA 4H0HB 4AYID 1Y6NR 3MRKB 1MKFA 4EDXA 1WG3A 3W2DH 4B9YA 5HGHB 3PGCA 3CHXA 3TWCH 3CHPA 2PYEA 5LKNA 4MHHG 2V2WB 2YRBA 2G60H 3CZSA 4K15A 1ETZA 4PGBA 2VW6A 1YUHB 4OLZL 4U6VH 2JMRA 1X5IA 1LYQA 1LD9B 2VLMD 4PJFF 5C0BE 1BVZA 2OCFD 4YDLC 4QJ4B 1O75A 2YRZA 2F15A 3QC6X 1MJ7L 1HH6B 5IMKA 4JPQA 4JMNA 5J0BA 3BHBB 1RK7A 4TPRL 2B3IA 3NABL 1ED3A 2W0FA 4XMVA 3GBNL 1JWSA 3Q8FA 5E6ZA 3X1GA 3G9VA 1PZ3A 2DQHH 1E6OL 3S34H 1TVHA 3KCWA 1XSKA 3R06A 3G5ZB 4IKNA 3V5DA 3V6OC 3VG9C 2EDEA 2GSGA 1IARB 2PO6C 1F90H 5D1XC 5TF1L 4MCYB 4Q6YA 3NSCA 4YDJB 4RZCA 5B7MA 1YY8A 4HLEA 2CIKB 5EULV 2E56A 4DGWC 1YUKB 3QJHB 4JO2L 4ZDHB 1BW8A 1IV8A 4ZFOL 1J0JA 2EABA 3DVNA 1FHNA 2OA9A 2W9DH 1AR1D 1L0YA 3FQ1A 3HW7A 3P77B 4D9RD 3IAGC 2B14A 3UIZA 4Y4HC 4E42A 4F2EA 3ISYA 1JUFA 3NCYP 4HPHA 4UNVA 1SBBA 1KC5H 2WLIB 4G6FD 2H1PH 3F01A 1U3YA 2DMBA 2X0VA 4OBSA 2Y5QA 3WNMA 4Z3GA 1I8LA 1P2CA 1GRWA 4RA0C 3WFBL 4CU8A 2R1WB 1ZLDA 3CLFL 3LQZB 4MMXB 3HE7D 5EUKB 4K3DH 4EMZA 4P59H 3SYOA 4GG6F 1Q0XH 4NQCB 3MDJA 1CL7L 4N0FB 2X4RB 1HESA 4N2AA 1WBXB 3GK8H 1TTAA 2P47B 1E4HA 3SZKC 2IOIA 3L3DA 3DK0A 3WS3B 3U30B 4U6HB 1YYMH 1AS7A 1F8TL 1NLBH 2R1XA 4DSYA 1BXXA 4K71C 4M62L 4N1CA 2WWMC 2YJLA 1TNNA 1EHKB 4LHUB 3MRMB 5A16B 1ITCA 2QHRL 2DN7A 3EH3B 2HX7A 3BSGA 5E6RB 4H20H 3M46A 4FXKB 2GJZB 1WS8A 5EPMA 1SLUA 3IGUA 4O51B 3W0WD 2KPNA 1MF2L 3OHMB 1U3HA 1TQBB 4GKSB 2RFXB 4N6QA 1DO5A 3IT8D 2OTUA 4TUJA 5C2BH 2PYED 3KGTA 3KL5A 3QJXA 4PGCB 4Y16D 1JGLH 2BRRH 3SKMB 5HYJD 2PXYC 3STBA 1SM3H 2F54A 4E9XA 2AVFA 3OGOE 3JTSB 3OMNB 4PRPD 4D7BA 3V4PL 2FO1A 5GQBA 2Y7QA 3LV3A 4YDMA 3D2TA 2IAAC 5I82A 4PRIB 2HKFH 3SGJC 4OLXL 3VWJA 4DKFL 2KBGA 5D4HA 2EDRA 2RCSL 3L4ZA 1IKNC 5K9JH 4DP9X 4LRIA 4ODWB 4WK4B 1X9RA 3N0AA 1JV5A 1AKPA 2HFEA 1CD8A 4JDTH 3FUJA 3GFUA 1G9EA 1IGJA 1BQKA 1BQLL 1AFVH 2NX5B 3IJEB 3VXRB 5E8PA 4FEMA 4K3DL 3RDTA 1E28A 2QZ5A 3CPUA 3FTZA 3I02A 4XC1H 3SO5A 4F5CA 3WMPA 3CLFH 4WFGE 1HT6A 1FFNB 5FYLL 4NN5B 3QK0A 1P5UB 3RUGE 5EEUA 4PPTA 2MMXA 3NCJL 3PWNA 5L4MA 2VMEA 3MLXL 4HH9A 4M93B 4UTAL 5MENA 3IMBA 2EDLA 4FKKA 4QIRA 4LMQE 4Q97A 2JIXA 3IAPA 5JR1L 1ZE3H 3QA3A 5CP3H 1LL1A 2VXTH 1KBVA 4I2XA 2ICES 3NJGA 2VITA 4LSTH 5D5MF 3MOBL 5HHXL 2DEWX 3D39B 3ILDA 4B9GA 5E9AA 1UG9A 2WVTA 5LNDA 4X8GA 5MERA 3PUUA 2UZXB 2O6EA 1D7BA 4Y89A 3GXIA 4M6NL 2R0KH 2MCPH 5D1QE 1I7ZA 1WBZB 1TEYA 3K6FA 1W6LA 3VRLE 5IW1B 3KJ6H 4LRIC 2J6EA 2HRLA 3FQNB 4HZLB 3ZL2A 1J1XH 5HGBA 4PRHE 3DHMA 3IDGB 2P3YA 3MUZ1 2YQ3A 3CU7A 4I2XB 4KK8D 2C1OA 4X80L 5J12C 3BZEB 3MBEB 3HEIB 4DWHA 4PV8B 4FA7B 4ZMNA 3FO1A 1BZ9A 5E5RB 2J1WA 4CU7A 2EYTA 4PJGE 1Z2KA 2EEDA 4N85A 1OGTA 4WV1C 5C08A 1E28B 4X6DA 1NCAL 3K81A 5DCCA 5AZ2H 2F7IA 2RQ8A 1NUDA 2GT9B 2O30A 4NFCA 2ZXCA 7PAZA 4FXGC 3QWQB 1A0QL 4H13C 4IRZH 4JG9A 3QFDB 4RRPM 2WBJB 1U4EA 2PPCA 3SOTA 1N5YH 1YDPA 1UOKA 3COOA 3WTWA 2IDTA 3K4ZA 4AYEC 1IBBA 4Y1AA 3FL7A 32C2A 5I0VA 4ZXBB 3K6DA 3BPLB 5LWYL 2MWCA 1CLYL 3BIKA 1CUOA 1YEFH 4UV7H 4KX8A 1L3WA 3GJFH 4FNLH 4HW6A 4N2BA 1JNLH 4DK3A 4E36A 4X5WB 4KZDH 4NO0A 1ADWA 3GNMH 1TJGL 5I19L 2Q76A 4FQPA 2K78A 5DZAA 4G2AA 3P4MA 1G1YA 3NSJA 5IEKA 1IC4H 1MFAH 3V6ZB 4JQIL 4UAHA 5E7BA 3NBNA 3OLIA 4MBRA 1PX4A 1F2XK 4HJIA 5A16A 1UADC 3BEWA 3OKNB 3LKNA 4U1NB 1KENL 2DQCH 2C5DC 1SMOA 2VLLA 3MGOA 4K7FA 3VGFA 1G7PA 1VHPA 1SXZA 5CP3A 2UXVA 5C0EB 4U6HA 2BHUA 5KVFE 3IDUA 1NWOA 1OE1A 1GPOH 1F00I 3H3PL 3ME0B 2CHDA 1IBZA 2YMXL 4XCNA 4C59B 4DGYH 5B4MC 3NIGB 1VKXB 4C4KO 4IEFB 1QO3A 3SOBH 4NM4H 3WHE1 3UDWC 3V0WH 4NM8H 2PO6B 4F8PA 1XB3A 2YAPA 1IQDB 4XODA 3B2VH 3GS0A 3VRIB 3F00A 3ZDXF 2FX7L 1AJ7L 1KJ3H 2C7UB 2H41A 1VADB 4D9LL 3O9WA 3RWFB 5KVEL 1IGIL 1HILA 3J7HA 4PI2A 1HVXA 2D3NA 1PX3A 3JVGA 1J9TA 4O5LL 3ARDB 3VXME 1HINL 1MCJA 1S7TA 2YPVH 4Y8AA 4ZUVA 2Y06H 3OSKA 5LBVA 2QJDA 3QPQD 3KPPA 4M4PA 3RTQA 2XWRA 3HAEG 1TITA 2IDQA 1EX0A 4XI5C 4P8QA 4M6MH 4QRRA 1OAUL 5IF0A 4Q9RH 3V5HB 3FH7A 4KTGA 3ESPA 1GS6X 1LDPL 1TCMA 1XGRA 3CLEL 4JZOB 4DUWA 3JVFC 3FT2B 5D7JA 3BQUC 1G5AA 3ZZSA 3D06A 1IO4C 1L0QA 3TZVB 2HLFD 4WNSA 4HPOL 2D31A 4I0CC 1R6VA 1RUML 1SFHA 4GAFB 4LARH 1MNUL 1ETB1 3CSFA 4ZSOB 2ITCB 5GISL 2D9CA 3AADB 3QCTL 4L1SA 4OUUB 2X2IA 4RX4D 1TQTA 4AK2A 1ADQH 4KXZH 1PY4A 3BKYL 5EU3B 3CLWA 1U8MB 3F05A 1WUNT 3LIUA 4APQA 2E3VA 4M7KH 1BVKB 1GZPA 1UXSA 4X5XB 5B39A 3WTVA 4M1DH 1IFHH 4HALA 3QBTB 5FEBA 4QHUB 1M6UA 3WE6B 1L4IA 3D18B 8PAZA 1OGPA 1EFXB 1BAFH 4X4YA 1TKWB 1KB5B 1A8JH 3RWEB 3SBRA 2ZYHA 4NBXB 2OMXB 1Z9PA 5D7HA 4OUUA 2VUOA 3DXAB 3EJPA 1VFBB 4KOCA 3HMWH 4CSTA 4XNUH 3QUYA 5F97E 1NGZA 3BWSA 4LCCB 3F04A 4N8VG 3HJEA 1IAIM 1W6WA 3NFNB 3O3UN 5FM5M 1JNNL 4P2QD 5I1CL 3WFDL 5IFJB 3FUEA 4MZ3A 4PJCE 2H0FA 2OM5A 3P30L 4OQTL 5H4ZA 3LZRA 1KCSH 2QV4A 1Z0NA 5E6IB 2ITEA 4JR9L 1XZ0B 1DVZA 2XA8H 3PWPA 3VQ1C 5K1JA 4IU3A 3PUCA 2OKMA 1M57B 2CQVA 4GRLA 3MUUA 5PCYA 5GGUA 2WVUA 2FWUA 3MZTA 1RH8A 4K55A 4N4YB 2VDRH 5ICXB 5DURD 4UQ9A 1WAPA 3IVKB 2PABA 3MRQA 1YEGL 4PG2C 3L1GA 4PJBE 5ICZB 1GYVA 5HI5C 4IKLA 5HYSG 1N8OE 3EO9L 4OTXH 1R5VA 2VDRB 2ZG1A 2BVQB 2F8VA 1F41A 3QDJB 4H8WC 2RR3A 1T89C 2EDXA 1WITA 1W72A 3B9KB 4ZRGA 5D7JC 4YEEA 1JPFA 3FB6B 3CZEA 4DGVL 5J1TC 4BSWA 1KYOK 1XH1A 1HQ4A 4K23H 3STZA 2AXHA 3VW3L 4P2RB 3F6LA 4XPGH 3ZE1E 4QHNA 4Q52A 4KDTC 2XN2A 4LPTA 4MA1B 1RK1A 3MV8A 4PUBH 3MHZA 5A7EA 1BMGA 4JY5H 5DRXB 4APXB 2WGXA 3U4KA 1KCBA 3TBWA 1CI3M 3B4NA 2GIMA 4HULB 2EC8A 1XVSA 5CR8A 3WDIA 4MAUL 3DTUB 4U0QB 3F7RA 4Z7WA 2VDNL 4MA1C 1X7QB 4PJHF 3NSDA 2B0SH 3FHQA 3SJVA 3PXHA 2ATKA 1H6FA 3Q2NA 2EINB 2XTLA 3P4MB 1ECZA 1Q9OB 3CZGA 2ZUWA 1W0WB 1GMEA 2PWEA 5D55A 3RU8H 1TYEB 4IIZA 3NSFA 4A38A 3SPVB 4BK5C 4MYPA 3LAFA 2O5XH 2HLFC 4XC3L 4MXWL 2VUKA 1OP5H 1X3DA 4HS8H 3AACA 3FCGA 2WXKA 4TUOA 1I3UA 1NLDH 3K2MC 4Z7NF 1NGWB 5JQIB 3MV9A 1WEJL 3DX6B 3PRZA 4QI3A 5CD3B 4I7ZC 4FULA 3V4UL 1RLWA 2XN9A 2NR6A 2N4IA 3BDYL 4ZG1A 4DK5A 3UYRL 2F2HA 3VFMA 4Z3EA 5I1HH 5I1IL 3Q3GA 4N2OA 1LWJA 5DD0L 2EXYC 2WNXA 1DQDH 4G1MA 3VSVA 1AZUA 4YDKL 5I5IA 2ADFL 4K3JH 3FCTA 5TFSL 3KYAA 4L5FH 4QPEA 4CMHC 3U0TA 3BLBA 1QRNE 3DRTA 2OLDA 1ACYL 5JPNC 5GS0L 1SOXA 2DWSA 5DS1A 5GRZA 1R5WB 3MO1A 3KZ8A 3MRCA 1NL0H 4GMSH 4EI6A 1IJNA 4N2HA 1NZRA 3HZKB 1AQHA 1KG0B 3MNWA 3WKPA 1DJHA 3NESA 3W0WE 4TUUA 1M2VB 2UUDH 5FM8A 1OHZA 4QRSA 5AW4B 4MD4B 2EILB 4LAJH 1EJOL 1ET8A 1JZ5A 5I1JH 4KO7A 2YN3A 1I1AC 5AVWB 3ARDD 5SX5K 4HJ0D 4XNXH 2ROXA 3GXFA 4FNTA 4G7SB 3ZW3A 3WJMB 1BOGA 4N90E 3QA3B 1A3LL 4QXWA 1D9KA 5F1IB 1AR1B 4AW4A 3C08H 3IYLW 4EBQL 4OKDA 3TN0C 3FFDB 5SWZE 4R7XA 2UWEB 3J2PA 1RZKH 2DLIA 2PCYA 3BZDA 3FTVA 4H88H 5EB9A 3L3OB 3T6VA 1J10A 5DD3H 4AQ8C 4KTEH 4Z7UA 2HT2D 1H8LA 4JM2F 2IQAB 3DOIA 4X6EA 2J88H 4IJTA 4NERA 3GDCA 1NDGA 1P7KB 4XX5A 4TSAH 1UWEL 5C9JA 4NT6B 4AEIL 2BNQE 4AQ1B 4ZW3A 4DGYL 5IP4A 2J5WA 3JTTB 5H37G 1LNUB 3T6XA 4IOSD 1IC0A 2E27H 2XV3A 3UTSE 1NFDA 4LBAA 2WD0A 4RGOL 1MI5B 3BN3B 1RXLA 3E2HC 3D0VB 3EHBB 5HVGB 4LSPL 4LLVB 4Z7NE 2JQMA 4Y5VB 4O2CA 2HUHA 3S96B 2D03H 4JHBA 5HHOB 1JE6A 3EOAB 4BKLB 1KGCE 2IGLA 4Q9BA 4NQDB 4QXGH 5LGYA 2QEJA 1TOXA 1W91A 4MJIE 4QMEA 3D48R 1VPOH 4KK5C 4QR7A 5C07B 4GNKB 4PGCA 3REVA 2AEWA 3JV4A 4P3CH 2LOEA 4WNQB 1HHKB 1IQWH 2XNAA 4Y4KB 1O9VA 5HHVL 3MNDA 5KVFH 1ZHKA 3G5VB 5I1GH 5LVEA 2MCG1 4HUUB 2VAAA 1TEFA 1FG2A 1DFXA 1I85C 3OKMB 4UYQA 3RLSA 2FT7A 5KBMA 4G3YH 2EZ0C 4YDNA 3QDGB 4NC1E 4R2GB 1CU4L 1T89A 2JKXA 1SXAA 3QJVB 5F7EL 3VWJC 3MFGB 1PCSA 3HE6D 4M5ZH 3AY2A 1OTTC 5GJSL 3ZRFC 4R26L 2LTQB 3TURA 3SYAA 2UX6A 2A9NL 3OZ9L 5GGSY 1DUZA 3X17A 1D5IH 1F4XH 1K4DB 4ODTH 1IGML 1JGEA 2FVNA 3ZYIA 5CR1A 1GS7A 1TZOA 3NIDB 3OJ2C 3QORA 2X89D 2W65B 1SY6H 4YDVA 4JE0A 4PW9A 3V4VL 1AFVL 1BQLH 4LAQH 4OH2A 4YLQT 2RMNA 2R69H 5HP5A 2ERJC 3QXVA 4MMXA 4K5LA 1VSCA 4OIIH 5H35A 2VMFA 5FECB 2VRAA 5E1AA 5CSGA 1U8CB 3GM0A 3PJLA 1CJYA 2J21A 4NBYB 1A2YA 2HKFL 4NQEA 5T3XL 4OLWH 3A67L 4C8XA 5C3IA 5C8JA 3MBXL 1MHCB 4FABH 3MV11 3NCEB 1T6BX 5MEQB 3X14A 4KUCD 1INDL 3BIBX 5ETUB 3E7JA 3PWLB 1NTDA 4OD2A 2HFTA 2MQGA 2A99A 1WPCA 4KAQH 4BUHA 1BA9A 3TLRA 2MCPL 3BFWA 5DD1L 1GZQA 2DWDA 5C0JB 4JRFA 5D1ZC 5IQNA 3S7GA 1N64L 3TN0A 3VWKB 3L9EA 3O6FD 3HCVA 4Q8BA 4BWTA 3EXLA 2X70B 3PIQA 4AYMC 5FYJL 4XVSH 3OG4B 3B1TA 1DE4A 2Q6WB 4E41A 2NNRA 4HJ1A 4YHZH 5J1SC 2Q8AL 3TVMA 2EVJA 1NFAA 5JW4R 4R4BB 3ERXA 2BVPA 2GITB 1F6AB 2JTDA 3B3IA 3QR0A 3CXFA 4GSDL 5ADPH 1I1AA 2FX9L 2R0WL 3K4AA 3Q2WA 4GRLB 4E41B 5IMKB 1I1YA 1U3JA 4KJWD 3MRJA 1T3FA 4NIKB 2GJ6E 4JGNA 4IBVA 1FNSL 4UQBA 1IC4L 1MFAL 2QDWA 3KD4A 4LQFH 3ZE1F 2XUWA 1GS8A 2OW6A 1EO8H 5LUMA 5T3XD 3FU3A 1L7TH 4NKMA 1Q0XL 3H9SB 5FO9B 4OZHE 2AGJL 1RZGA 3JUYA 4HT1H 4P2QB 4PP1D 4YR6B 5I76B 4QHLA 4EUPB 4UV7L 5F9OH 4EVNA 4JEGB 5IHBA 1E40A 3GGWB 3D08A 3KPQA 4LHQB 4OJCA 4XAWL 1BG9A 4HS3A 1EK3A 5BZDA 1U8QB 4X9IA 3QJQB 1UCBL 9CGTA 1MY5A 4OIBA 4D3CH 4KKZA 1KGJA 2WXGA 3L7EA 2F1AA 3I85A 5IK3B 3K71A 3UADA 3F12B 4PVNA 2E7MA 2BRRL 3MGTB 4M48L 1UHVA 1TVBA 5F9DC 1JPTL 1UB6A 2Y1YA 3MGAA 3T3PF 1LQSR 4N8CH 4M8UA 3SYQA 4M7LH 2J5LC 5E8DH 4CAGA 4WO4D 4PMFA 2AK4A 3IXAB 3W3BA 5E0FA 3ARPA 5F70A 5ID0A 5HGGS 3N41B 2H32B 4RMVA 2WZPA 5J6GB 2DYPA 3CZLA 1M7DA 2NY3B 4PS7A 2AJXH 4KPHL 3GD1C 1N0XH 3CDCA 1TTBA 4QTIL 4Y4HD 1C08A 3JYCA 4JDEA 5E8EA 3DUHA 2IH3A 3ALPA 4WWID 4X80H 5IJBC 4JFOA 3V8CA 4PB9H 2ZNXA 3PAZA 4PR5A 4UM8A 1LO2L 4A2GA 3LH9A 4FABL 5CEZD 4G8GD 2EACA 4ERSL 4B53A 4BFEA 5CZKA 1TYRA 1UGKA 3BW9B 3OX8B 4U6VL 5I6XB 1NCCL 3K3QA 1A14H 4R3SA 2WSPA 4FEIA 3SSGA 4N26A 2MH4A 1MFBL 4H4NA 1AXIB 3LN5B 2MCMA 3K6IA 4PSPA 3TWCL 4FQQA 1DBJL 2APSA 3WFHA 4BIKA 1QBMH 1YNTF 3LIZA 2ZX9A 3LDBC 5E08H 3ABKB 1CYWA 1F3JA 2XQ0A 4AG4H 1DVFC 1F4XL 1MPAL 1B0RA 4PV9B 3VDBA 5CLZA 3RPIB 2N7BA 3MQIA 3QZWA 5DJ8B 1QBLH 1UCBH 3MLXH 4Z7OF 3ULUD 4OV5B 3RI5K 3UTZB 4EOWL 4YSAA 4JO2H 4OFPA 3OG6B 3RAJL 4CDGC 4JDVA 3REWA 2AXGA 3KLDA 2FYYB 4HXAL 3BZ5A 3DO7B 1UT2A 2XQBL 4LESA 3VXQB 4MB4A 3R1GH 8FABA 3NEOA 3ME0A 3VTMA 5I17B 3WMSA 5I8KH 2G5UA 4NENA 4NZUH 1WAAA 5BVJA 2F08A 1SY6A 3ILPA 1KIPB 5DJCA 1U33A 5CCJA 1FIGH 1KLUB 2IWKA 5FYKD 3UZQB 2CDEB 1RD6A 2YQBA 4K94L 3B9VA 4TM9A 4LLWB 1R75A 2FQFA 1GC1H 2NTSP 5I6OA 1I53A 1JGUL 3F65A 2H6OA 1JDDA 3MLRL 1DQQA 5EEXA 4ZAKC 2WYZA 1COBA 4GS7C 3FC8A 3X1BA 3SE4C 4J23A 1KIUB 3QZBA 2XYCA 2XKNA 3QNYA 3DGDA 4G1EB 3MFFB 3HZVA 1Z66A 3CD4A 3QIBA 1ZHBB 2EKSB 1ZHNB 3KPSD 5C07A 4Y4KC 4MSWB 1DVXA 3S8FB 3AFLA 4NKQB 2KQNA 3K6NA 3QR1A 2FZ3A 1DBBL 3LXCA 4H8PA 2H3KA 3MA9H 3BWAA 4MDIB 1R34A 3UBFA 2NW3A 5DJ0A 5KVDL 2V3FA 3O3AB 5CJQL 4P4KB 3RWDB 4WSKA 2WXPA 4OIIL 2MHAA 4OCSH 4H26A 3RGVC 4Z7VF 2ATPB 4H25B 4KXAA 3BAJA 4NT6A 2CCLA 3FAXA 3FT1A 1XSIA 3Q5YA 4MLIA 3T65B 4XCCL 3B6SB 3EH1A 1NKOA 3MRHA 5DLLA 4NRXB 1UVQA 3TU6A 5CAYB 3FQYA 1NMBH 2ZYSA 4W6YB 2BOBA 3L3KA 1DEEB 3OR6B 5T3ZH 3C60A 5E6ID 1KJMB 2AQ1A 4WEBL 2AVGA 4F8TA 3QDME 3N42B 2XX1A 4PJAA 5JHDA 4X6BB 3ECWA 4DO5A 3LZOA 4P0DA 2HG5B 4UT6H 4GKLA 1MW1A 1Z9NA 1UUNA 2IPTL 1H0DA 1UURA 1YEDB 2X87A 1LO4L 1T5XA 5EUOF 4HZLA 3TYFB 2LABA 3OBAA 3GSWB 4KRPD 3BMVA 5C0DB 3GJFA 4N86A 3O6MH 3O6FB 3P9LA 4TTDC 5FDWA 2FO4A 4NOFA 4QRSB 4KHXH 1OTTD 1QD0A 3HE6C 4DPAX 3ZDZB 4QXTA 4WEMB 3IF1B 2RIKA 2JI1A 1D7CA 2ZCLH 4PJ8C 1MI5A 2BZCA 3TO4D 4BRVA 4NKIL 5J8OA 1KN4L 4LCYB 1A5FH 4Y4KD 1A7NH 3FONA 1WWBX 4P2QA 5I76A 1OAKL 4HK3N 4RFEA 2VM3A 1W15A 1PZAA 1NLDL 3MZGB 5DZPA 1FRGL 1OGAE 1CURA 4G8IA 3QIWB 5DJXB 4M5TA 3B6SA 4AEIH 1KYOJ 3D12B 3C8DA 4XHQA 1NPNA 2CIIA 4UQDA 3RU8L 2CBQA 4H25A 2OL3L 5JXAH 3W2DL 5AAWC 3RWDA 1BOGB 4TQHA 4NC2B 1D2OA 4A7SA 5F7YC 2HMIC 3OHXB 3LKOB 1KYUA 3FB8A 5DR5H 1HAWA 2VZUA 1HS6A 4GW5A 3C08L 4LPUA 1PAMA 4N9GA 2Z31C 1QWUA 2G4EA 3UTTD 4WI9A 1PKQB 2AQSA 2PETA 2UZIL 2V7HA 4S1SH 4S2SB 1X5LA 5FLUA 1SOKA 3ZX1A 3WY4A 1BMZA 3KXFB 4H7VA 4QKTA 4QGYA 4M5YH 4ZMQA 3MUGA 5E1HB 1TFPA 3WTUA 3U0WL 3GSRB 4AM0Q 2R0ZH 5HGDA 3PWLA 2OZ4L 3O2WL 4U7SA 1FA4A 1A6VH 5E5MB 2NY3D 4HKBB 1NJ9B 3DSFL 1QLRA 4MQXD 4WKZB 2BINA 1N4XH 2BNRB 2IAMB 2PTTA 2Z35B 1QWHA 3BP7B 4ZFZB 4O02B 1ND0B 1P4UA 4FXTA 4NOBA 5EIQA 4YEFA 1R5WA 3MO1B 2Q0ZX 1N0LA 2EH8L 1X7QA 3CK0L 3D5OF 3OAUL 4JGMA 1N18A 2P8LB 3QB7C 3BRDA 5C0RH 3RZCD 4KHTH 4HXBL 1KFAH 4M93C 4S0SD 3ATBA 3GXUB 4L8SB 3MJ8A 3GXPA 4MMYA 1YSOA 1G7HA 4F1ZA 5AB0A 5BO1L 2X4SB 4IKJA 3WNOA 4F7EB 1AXTH 2AJVL 3HZ3A 4LPXA 4MFHA 3NSXA 3O8XD 2P5EE 1T4WA 4PRPB 5D4IA 1T04A 3HNTH 3DBSA 3LOWA 4ES8A 5LDSA 3MV9B 1JPSH 3V4VB 4X4KA 3TJPA 5ACZB 1EMTL 1MREL 4PLJD 3TFKC 2BWIA 3Q05A 1MOEA 1XMWA 1VRSA 1CN4A 1UKTA 2AV1B 2ARJB 1QA9A 2XA8L 3L4CA 4GRWE 4S10A 4DZBA 1FC1A 3BVUA 2D8KA 1FNHA 2DKMA 5IB2A 4M8QB 3S35L 5I1CH 5I8EA 4PV9A 2WQAA 4PJEE 3IVKA 1D9KD 4ONGH 4K3HA 3B2PA 5EEYA 2FIKA 4WWKB 5EORH 4XC3H 1LXMA 1UM4L 4K8RL 1CE6B 3P69A 3K8KA 1BD2A 3QUZB 4TVSa 1P1VA 2VN4A 3SKUD 2F1BA 4R5XA 3RWHB 3ZN6A 4YDJA 3DETC 3A24A 3L4VA 4MCYA 4PVLA 2R2BB 2XZAH 2BIHA 1SLVA 5CMAA 3IJYA 1NFIA 4X7SL 1OANA 3KBEA 3UL4A 4B50A 1UTDA 1ZA6B 2EUXA 4I48B 4LZKA 3D39D 4OT1L 4U6XA 2A1WL 5D71H 3EOTL 3WN6A 1WA0X 3ULVH 3GSUB 1CIUA 3O6ML 5DUMH 4OZHF 3L95A 2VXQA 1XGYL 1QWNA 1LNUA 3PQYD 5D96C 4P4RA 3U82B 1CFSA 2BSCA 2C9UA 3MJ7B 3PGFL 3F7QA 4WDIB 4ZXBC 4NQXA 4JFFA 3RE0A 4D0CA 1GJUA 3LRHA 3GRBA 4MGXA 3P4NB 5HHPA 3KLSA 2XY1A 5JW4N 5FHBH 1TKWA 3KMDA 4LARL 3C5SA 4QHUA 1E6JH 3MRDB 2QADC 3BUYB 4QRTB 5CZVL 4KNQA 4TLUA 3L3IB 2P48B 5KYNA 1NAMA 4PREB 5FUZL 3D3VB 3I3DA 4GQ9L 4W1TA 2CNZA 3ROOB 4W9EC 3M45A 1A7RL 3D30A 2Y7LA 3CPLA 2DH2A 5EU3A 1PIFA 5LLIC 1CDYA 1XIWA 5BZDB 1U8HA 4YPJA 3C2SA 4RMTA 3VYPA 5IESL 3DSNA 3KPTA 3HPJA 1CICC 5DHVB 1ZWIB 2WAHA 4KKRA 4CVWA 3MV7E 4LOUD 3WELA 3W11D 4P5TB 4FA8A 1BP3B 4CILA 5IM7A 3HRZA 2WLHA 1ZJBA 2IQ9H 2GTWB 4DPCX 1CFBA 2YWZA 4JREB 3ESVF 1OPGL 3O11A 1U8LB 2F61A 2I24N 3B3IB 4XWOD 5AL0A 1KGYE 2VDOB 5DQDL 4ZTOL 4X7CC 2QKIC 2NQCA 2OMVB 3H9HA 1OIOA 1L9TA 2JVUA 2ZQKA 1MFEH 1YLBB 3AUVA 5KYWB 4LO9A 2NXYC 2DDQL 3PDDA 5I1EH 4MNQD 4WCYH 1A1NB 1XF4A 3F5WA 4G71B 5CO1A 3TA3B 4UOZA 2XQYG 1DN2A 3BDXA 3C2AH 3X14B 4DN4L 4OFQA 3FMGL 2M8XA 2WWOA 2WM0A 4FHBD 4FMVA 3DUSB 3UEZA 1I8MB 2E7LA 3RP1A 4XNMA 3HJ0A 3N40P 4RX4A 1A6UH 3O2WH 3Q01A 4JY4B 3RIAF 1MH5A 3U7WH 1WTLA 3DPBA 4OV6F 2A5UA 2WXNA 4GT7A 3RGHA 5GZND 4UM9A 1XGRB 1O9ZA 3U48A 5HYJB 1DEDA 2BJMH 1NCJA 1OAZH 1MY7A 2B77A 2DLTA 4OZHB 4PHXA 4RFOH 2UVFA 4F2ME 1VCBC 2EE0A 2MQ3A 3TV3H 3IU3B 4JM2D 3BRFA 5BW7A 5C09A 2X6UA 1UZ8A 4HJUA 4XRCA 5E4OA 5EU5B 3C5ZD 1JHKL 2FIKB 4WWKA 1I31A 1HL8A 3GHBL 4UU9B 1I7UA 1A0QH 3IGFA 1V05A 1N2RA 3N5AA 1OARL 2CBOA 4JHUA 2FH8A 3X1FA 1J18A 2AEQL 3O9WB 5EC2A 5FW8A 2B3RA 3RWFA 1H6UA 3QPKA 1IRAY 4GUPA 4XPTH 3H9SD 1YEHH 2GHWB 4QF1B 1DBMH 1NC2D 1W72H 2VE6B 3A47A 3K74B 32C2B 5E2UH 5D93C 4ZTPH 4H2CA 3OKOA 4I4WA 1NOFA 3P9MB 3S48A 1UYWH 4GQQA 3WIIH 4HMDA 4ZUTA 3TCTA 3RG1C 1KPUB 3ARBC 3GPSA 3REVB 3D0AA 2DW5A 1FNEA 1R5VB 3SE9H 2JJTC 5F0LB 2UY7B 3FTGB 2LGNA 3MA7B 2J8HA 3SOBL 4XXWC 1E4XH 1V7NH 4HAKA 3GS4A 1MLCA 2GB2A 1J88A 3E6HA 1RURL 4P06A 2BWDA 3C8HA 2FSDA 3KR3L 2DIBA 4LLVA 1F02I 4PRAA 4W9ZA 1AQKL 5FGBC 1KXQE 3C09C 3M7FB 4AXWB 1J05A 3W81A 5MEOB 4XR8C 4YHPB 1BLNB 5K1NA 1P53A 5B3JF 4Z7VB 1A4KA 3BO8B 2BNUA 5JR1H 1VF5C 3QUMB 1MCRA 5C0IB 3ABGA 5IOPA 3UC2A 1EO7A 1PIGA 1CC3A 5EBLA 1JERA 4O02H 1KZQA 3O41A 1Q72H 5IQMA 1M9WA 1MCDA 1MEXH 3DXAD 3D4YA 2NMSA 2NSQA 4HIJA 3BPOC 4A68A 4OCYL 1JRHH 1UEYA 3T4AB 3KNBB 4R84A 1I4FA 1D9KB 4TOYH 4EZJA 5FGRA 1NAMH 1IBDA 1C5CL 3L81A 3BVVA 2CDGA 2CLRA 1JFHA 4FTVD 5DEZA 3WEAA 2V3DA 5E9DA 2WBJD 1T7VA 2VSKB 1WV7T 2XZZA 1M3JA 1N19A 1GAFL 3MLTB 5MENB 4LL4A 1JSYA 4KGLA 1HKLH 4U1GC 3FQUB 4U49A 4ES9A 5CHNB 2SODB 4X7EC 4RIRA 1JGLL 1G1OA 4Y9GA 4JHZA 4DKAA 2QGEA 4LCVA 2PMZA 4U33A 5ABDE 3M8OH 1AS6A 2V37A 1AY1L 1JV5B 1CVSC 5IT2L 3IDIB 1S8DA 2ED7A 2APFA 4P46B 1QEWA 4P9ML 4AZUA 4Z8FL 4G8GA 3KWUA 1KNOA 2BMKA 4H0IA 1NEZA 3U0TB 3EIFA 4LP8A 3LV3B 3MYJB 1D6EB 2I9LB 3B3BA 3RUGF 4OFKA 2ATAA 3U4BH 4C58B 4HFWB 3VFOB 3SPIA 1OL0A 4XMWA 3UJTH 3SE8H 3UC0H 3V5HA 4QHPA 4QRRB 4XMKL 2W91A 3V95A 3VB9A 1BQHG 3SKNA 4HX1A 1N67A 5T3XH 5JHMA 3HS0B 2I69A 3RTLA 4JRXA 4NUJA 4UT9A 2Y2YA 3BQVA 3I9GH 1CE6A 4W9KC 4HLJA 3WEXA 2VIRA 5ESVA 4PG9A 1RULH 1X5YA 3VA6A 4C4BA 5I8CA 2BCKA 2YAHA 4BKSC 1Z9SA 2OR7A 4FG0A 1DVQA 1AIFB 2Y2TA 3NACL 3UJJH 2YMTA 4GEIA 4AGLA 1TETH 2VDLL 3T71A 2GW5A 1PBYA 1IGMH 4FQIH 5DRNA 5H8DA 4D0DB 3FT3B 1NWPA 1R19A 4BDVA 2AW2A 4IBLT 3FCBA 3T65A 1E7UA 3KH4A 5TE4L 5D2NA 2DJUA 4UTAH 5AUMA 3PF2A 4ZNEE 1THCA 2XPGB 3C75A 3ZMEA 3T0DA 1Q9KA 3KYNB 3ZL4L 2YGVA 4Z5RA 1UA7A 1ZXQA 2B08A 4G3YL 4WWKD 2N7AA 2YFNA 5C0EA 1RZPA 1UWFA 2OXHA 2QR0A 1C5DB 4M02A 4XMPH 4XVUD 2F19H 1HHHA 1A64A 4AKQA 3NTCH 1XQ4A 2CUIA 1NCDL 1TJXA 1MRFL 2VJXA 4MA8H 5KOMC 2EKSA 1RK1B 3QIBB 2YJQA 2WLIA 2VM4A 3TZVC 3ZHNA 5GGTL 1JFQH 3RFZA 2R59A 2B9AA 3MXVH 4ZW8A 5D7IE 2DS4A 4Z77A 2X1PA 1YEIL 1OM3L 3UPRA 1WICA 4RSYA 1OD7A 4R97C 4TNWF 4ZPTB 3SE6A 3QCVL 2W94A 4LOUC 1HC1A 4KRPB 2WXFA 2CLZA 5FYJU 5IMMA 2EECA 3WN5B 5EZIH 5GS1B 2G75B 2O1AA 4L3AA 4S2SA 2E7LC 1S7VA 1RHHB 2APVA 4GSXA 3TO4A 5ISZA 4N8CL 3PWVA 1RUKL 1KB5L 2CCWA 4M61B 4YHOH 1ASOA 4DUVA 4H88L 4JPIB 3ATEA 2ZUSA 4BZ1L 3ZSTA 2GBVA 3EADA 4JFTA 1PDKA 3AJ7A 1T0NB 2VLKE 5E7FA 5GSRB 4HG4K 1X5ZA 4Q56A 1LEIB 4XNYH 3BUTA 1NLBL 3QUYC 43C9A 3CFDA 4J8RA 3W57A 1YUHA 4LDLB 4MRCA 1H3WM 1CYXA 4ZQKB 2BW4A 3FT0A 3QARA 2NY0B 3APDA 5JW3H 1FHGA 5IR1B 5F9WC 1YA5A 5DJAA 4M1CC 3CV5A 3DX7A 1AOZA 3WU1A 2DQIL 4XVJH 2ZG3A 4IS6A 5B3SB 4AQ1C 2QSCH 4Y5XB 4JFWA 2OX5A 4AENA 3K1DA 3O3EB 4AEFA 4JKNA 4ANWA 3QXDA 4P2YA 3X1EA 4U1KA 2RJMA 3AREA 4WWNA 2VOTA 4DETA 1U92A 2R8SL 3IJ9A 4Z0BH 5L4FA 3L4XA 3KEDA 5IJVA 4UIKH 3MRGB 3O6KL 3OXSA 4GO9A 2BVEA 2BHYA 3L5WB 1WDAA 2WXJA 3EHBD 5IHZB 3H42L 1NEZB 4PRDA 5K39A 1SF3A 4A7UA 1KEGL 1KCLA 1S5IL 4MJ6A 1G9HA 2HJFA 5ECGA 2J2ZA 3T3MF 1Z5LA 2J1XA 2VABA 3QDJD 4PY7A 4NQDD 3DPDA 2KYIA 4G9FE 1K8IB 2YLHA 4PJAB 2DBLH 1CZ8L 3GB7B 5E2VH 1G7JA 4JRXE 1KJVB 1M71A 4I2XE 1JYWA 3AG2B 1QFUH 3V4UH 1ZMYA 2E9IA 1AKJD 4P99A 5E24E 4YBQD 3VXSA 3UACA 1NMCB 2E4TA 5F1OB 5HJ3B 2CBTA 3BAWA 4HJTA 2FE0A 2NYYD 4Z7QB 3SGEH 3SBPA 1E3XA 5M7QA 1XR8A 5GRJH 3CX5J 1YJDC 4CBPA 3O0RH 4X8CA 4G82A 2IH8A 1U93B 1NGXB 1FL3A 3CVIH 4IBWA 4ZTOH 3QULB 2HRPL 3EFOB 5DT1L 3OV6A 5DMGC 1XEUA 3FOMB 3V0EA 1PD0A 2ZCHH 2XWXA 3C6SB 3SDDA 5E00B 1IZKA 3EG9B 1BJ8A 5A1AA 2I07B 4HJJH 3K72A 5K5YA 5C6PB 4FMFA 4J3OC 3TPKA 5KVDE 1SJXA 4XCEA 1FH5H 3A4EA 3CWGA 3LQAC 3TFBA 5HYEA 3VFPA 1AGCA 3ULVF 1X6NA 2JI2A 2YFOA 5GSRA 5JA8B 2JKJA 2VLJA 4RAUB 2V5TA 5TD4A 4TTDD 4LLWA 4J27A 3U2SA 1UWYA 2CGRH 2ROYA 5IIEB 2FL5A 1E4JA 4G8FB 1JF5A 4DCQA 2XWEA 2Y07H 4Z5RB 1LE5B 4FQCL 4QLRA 2Y9RT 3QEQE 5EEVA 2CLZB 2XVKA 5IMMB 1KCKA 1HZHH 3SDYL 1KPUA 5IVXF 1LJMA 3HAEA 1EUUA 4WJ5B 5D70H 3PQYB 1YEGH 3F7LA 2UWEF 5CF3A 3UROR 1L0PA 2J8UE 3H9YA 2FWLB 2F5BL 3FSWA 5MEQA 2VR3A 4F9PC 3WTSA 4O58H 5I66B 1FC2D 1NSNH 2ZPKH 2K4AA 3AS0A 3OKDA 5HXMA 3SY0A 5CCHE 1U30A 2CPCA 3QCUL 3PYCA 2FCBA 4PGZA 5J3HC 4KK8C 5H35B 2QVIA 4UT9H 4NC0B 2OMYB 3QJHA 4ONOA 3GTVA 3WFHB 2DQJH 5C09B 3LN5A 5I1KL 3EGSB 3V6FB 1CLOL 1KV3A 3IS0X 3UCRA 1KMGA 4MZIA 5SX4I 2ZKHH 3CXDH 4W9LC 2R29H 1XBDA 4PGDA 4NQUA 2E9WA 3TTSA 1DSYA 1IJ9A 4K7PH 5I8OL 5HYIA 4QYOB 3IFLH 1RQ5A 2EYTB 2GG1A 4H1LB 2YAQA 5F7HA 4GP4B 1JXKA 2VNCA 1S7UA 1KDIA 3FJTA 3HOGA 3NQKA 5DTFA 5C6TH 3RL2A 1JYVA 2XFXA 2MJWA 4L1BA 3GSOA 4GG6E 4KVPA 2HJFB 4NUMA 4LU5H 1F18A 5J6HB 3HS0A 2X40A 1T1WA 3N1GC 3DC0A 1A66A 4BZ2H 2ZJSH 1HX0A 2QSQA 4CJ1A 5IV2A 3BGFB 5DZ9A 3PGCB 1YN7B 4XB8A 2OTWB 4AYDC 1PNDA 4HHWA 4UZSA 5EHFA 4MASA 4MMXC 3GM8A 1PZ5A 4BKLA 2IGFH 3POHA 4N2DA 4NRYB 3WUWA 4YFDB 3KPRA 4DZ8A 3AM8C 4G8GB 4M43L 2O5ZL 3BJLA 4UOQA 4G5AA 5TE7H 3PJSB 4GI9A 4NO3B 4GKOA 1NPJA 1TU2B 4Y4FA 3RDTC 5I30H 3O11B 2XN1A 1OAUH 4GH7B 1S78D 3N1PC 2GK2A 4PJXE 5H94B 3PWNB 1NDGB 1G94A 1OLZA 3CBRA 4JG5A 4U1GB 3GO1H 3FO9A 3VGHA 1AHWB 1NCWL 2VWEE 3LY6A 2P5EB 5KBKA 3AZUA 1S7QA 3KJ4B 4K8RH 1T21B 3QEHB 2ENYA 2FBJL 3FOLA 4R2GD 1D2PA 2A2QT 2WLLB 4S1DC 4GBXB 3HPJB 5CBAB 4AL8L 4G43B 5GGSB 1F56A 1LEIA 5AKSA 5DQJA 5ANMB 2BFVL 3RTQD 1HCYA 4JM2B 1PY0A 2QQKL 5F72S 1RUAL 1J5CA 4MLSA 3FCSA 3GI8H 1MWOA 2WLZA 5DZVA 3Q13A 5EA0H 4Y88A 2YEQA 5GGVL 3VXTA 4UB0L 4XP4L 4S11A 2BVOA 1KXVA 3SDCB 2J7LA 5A2JH 1KTDB 3JWDC 3BAKA 1T83A 5GRVL 4QRPD 5HHPB 3TJEH 1EDHA 3QIBD 3WD5H 5I6PA 1VFMA 1KFAL 1YAZA 5KG9A 4WIQA 2Z0BA 4FF9A 1FZKB 3OPZH 1ODAA 4A37A 3TBYA 2CJTA 1UXLA 2BS8A 3ZTNH 1XCQB 4NP9A 3LRLA 4Z7VE 1AKJB 1E9OB 1ORQB 2QFPA 3D09A 4TL5A 1H5BB 4Y9EA 1XTMA 3DSFH 1AR1C 4PJAF 1IC7L 2VDLB 1OAYH 2YD7A 1BDYA 2HN7A 2NNCA 2OZ4H 5F21B 2CPUA 5JIQA 1R33A 3AVEA 1PL3A 1Q0YL 2QELA 5E70A 4FLQA 4ZAKA 5HHQA 3OTTA 4AQAB 4AT6B 1AHWC 3LD8B 5EZIL 3QXWA 3CU1A 1LEKA 4S1SL 2WQSA 1ZLWH 3VQMA 1HSAB 1ZV2A 2BSED 5K9KB 3V0FA 5EBGA 3HRPA 3KCPB 5DI8B 1J5HA 1AIZA 1TYJA 3NRPA 4ZO8A 1L6PA 3RHWF 4NJ9L 3L3HA 5MENE 5GGTH 1CD1A 3CHRA 5AW1B 4PQXA 5LO7A 4AZ8B 3OAYK 4ZOEA 3LDBB 3OPUA 3PAVA 1S5HA 5JUEL 3U1SH 1VGEL 1HXYB 1KEGH 1ACCA 1CQYA 3VYOA 4XXWA 1UACH 1I7TB 4QAMB 5EN2B 1HEHC 2LHAA 3UTPE 1CXEA 1S78C 4BELD 3AWGA 1MXDA 3PHQA 2NDGA 1G6VK 5AYQA 3VI4F 5EOTB 3EUDA 4Z7WE 4ABVA 3MLVL 5TPWH 4OGYL 3B83A 5C0AB 3MJ8B 2AMUA 4NQDA 4HCRL 1E8XA 5F3BA 1M4KA 5CFHA 1NC2A 3O9WC 3QZWG 4QJ5B 2JKRM 1KNOB 2BMKB 2DIAA 4WLCA 4OCRL 4N6RB 2BRQA 3MNVA 3IM1A 5J1AA 1BQSA 4ZFZA 1FZJA 2Z35A 5G5DA 4CSSA 3AQZA 3ZPDA 3C12A 4PV1C 4GSRA 1EANA 3PWPE 4G7YL 3WUWG 1XMEB 2N3JA 4A6YA 1WT5A 5GSVB 4FKEA 4BK5A 3AB0B 3K6SB 4B60A 2GI0A 2BVOB 1UZ6F 3B9EA 5G5DB 5EUOB 4KJWC 1NGYB 3FO2B 4QRRD 3LB6D 3IN0A 5T3ZL 3VXOB 1PG7X 3NCXA 2CRZA 2V2TB 3AMKA 2BSDA 1WF5A 2Y6SC 3WHXA 1T1YB 4N25A 3Q43A 5FO7B 1GW6A 3EJQA 4JFSA 4EPSA 2ODHA 1Q9LA 3SGEI 2IEPA 5TE6L 1OK0A 1RZ7L 4LCUB 1I4FB 3KNBA 1CQKA 2JKWA 4WI5A 4LT7A 5KVDH 1WJ3A 3K46A 4BRJA 1XBRA 4EN3A 1BM3L 5DHMC 2PNDA 5E8NA 4PD4J 4XCFL 5BZXA 4NO5A 1JHLL 3KDMA 4FQLL 4A7QA 1DJIA 4AYBA 4K5OA 4X5QA 5F1SA 2WJ7A 4MA8L 3CN0A 5TGBB 3DLQR 3ETTA 3TT1L 3KYOB 2YLKA 4WFGD 2EDBA 1M9SA 3IF1A 4XMPL 4QXTB 2EO1A 5DZLA 3DRTB 4E2OA 1AO7B 1AZCA 1F45A 4G5ZL 4NRYA 5GGRA 1MLCB 4XNQB 4PG2A 5FM5O 1DZ0A 1WIOA 1FO0A 1NBYB 3ORJA 1U58A 3NCCB 1BQRA 3WY1A 3NCYS 2A83A 4LKCA 4R7LA 1G7IA 1T1WB 5SWSA 2XZQL 4EI0A 1KELL 4AQEB 5C86A 2OAAA 1WD9A 5C07E 4WDIA 3OLDA 1A8ZA 1XGTB 1Q94A 4L9LC 4M29A 3U6RB 2HWZL 4FP8L 1N7ML 3B5HA 4N1EA 5KBPA 1JF6A 2CM5A 4DFIA 4TN9A 5AOLA 1RP8A 2ZOKB 4J3OD 4JQXC 2EZ0D 1X5AA 4UIMA 3W9EB 4FFWC 2EIEA 3L3JB 4PJGA 3EJYD 2X4QA 2EYSA 5JO5B 5AVVB 2X10A 4LVNB 2AAVA 3QRFM 4PB0L 2VDPL 3QDGE 2EADA 3DV4A 4H1LH 5KS9E 1EZLA 1J9CT 1UZ8B 3MX0B 3VFTB 3KPPB 3RTQB 5L2KB 5ICUA 5BRZA 2VXUH 3E80A 3W9DA 1KTKE 2FUQA 1EAQA 2Z0UA 1TPXC 3NCBB 4ATTA 1UJTA 2DQDH 2UZYB 4DP0X 1I7TA 1T2QL 2NCEA 3UJIH 2IG2L 4HD9A 1CE1H 2A6DB 4WI8A 3MLVH 1FSKB 4P5MA 1PSKH 3W9EA 4APQC 2DMKA 4JFDA 1TTFA 3VX0A 3SBWC 2A38A 2XKNB 3LRGA 3CVHH 2ARJQ 5FA3A 3A6OA 3VFSB 4HCFA 1V7ML 3MACH 3C9NA 4M6OH 3KWWB 3V79C 1AG6A 3EKCA 4ODSH 1W9XA 1KJ2L 1S9XA 2IADA 4F7EA 5L6YH 1CLZL 3HB3C 3VRJB 4ZD3L 1AE6L 3TV3L 4TNGA 5KUMA 2AQTA 2EXYD 3MGOB 1KLUA 5HPMA 5MHSD 1QVOB 3OWEA 3Q6FA 4U1NA 4FQ1H 3MRIB 3NFSL 1ZKAA 4IOIA 3EDJA 4J4PA 3MJ9H 5GRUL 3SKOA 4URKA 4XCEB 3DV4B 3KS0J 2FAUA 4P23B 4BFGA 1U91B 1B4TA 1G6RH 5E5MA 4PJIE 1UD5A 4J28A 4X6CB 4CNIA 3ZE2E 1BHGA 1ZTXH 3IDYC 3L3JA 4PCYA 1IM9D 3L9YA 4EIGB 2BOCA 4XGZB 1KBPA 3IAQA 3VXUA 1KTDA 2GJ6B 1AQKH 4XPFH 1WFIA 3FTXA 4YDZA 4RVBA 1WAEA 2H5UA 3C5ZC 2Q7YA 5G2NA 2W9LA 3UMTA 4GW5B 4R90L 5FF6B 4HCRA 1NGPH 4RH4A 4P5TD 1L9RA 4HC1L 5HTSA 2BH0A 4RISL 2ZSVB 4FS0A 4XP4H 4UQCA 2P1YA 3FZUC 2BO0A 3VXOA 4KKNA 2NW2B 3TT1H 4KRMB 2J4WH 4LLQB 5C0FB 3GI8L 3QEHA 1RIHL 4LSVH 5AG9A 2QQKH 3DX9A 5FKPA 2Z1PA 3A6BL 1KIQA 3K2KA 3T2LA 2NPLX 4HZAA 4FMKA 1HNFA 2V17L 4PTUB 5DHVH 5I71C 5C0BB 3G5WA 4YHNB 4WFHD 1SYSB 4QRPB 3P0VL 2C9XA 1JV2B 2XZCL 4NNXB 4KV5F 3EO0B 4WFEE 1ECYA 1HCVA 3MV8E 1ASPA 5GGVY 4DEPB 2YA2A 4MJ6B 3RX9A 5D7IB 5DHYA 4A2FA 3RGBA 5IW1A 4R7DB 1OXYA 4JKPH 1SJMA 2K6ZA 2AEPH 4JG1H 3MGTA 2FSEA 1T5KA 1F11A 4PB0H 4ZYKA 1DJZA 1VJSA 3DX8B 1O5PA 3EJUA 4KI1A 2FH6A 4B9CA 5JHLA 1GY2A 4OF3A 1Q0YH 4Z0XA 4IKKA 3NRFA 1KOAA