3WTUA

Crystal structure of the complex comprised of ets1 (v170a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITADGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 18
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtuA00
4QO1B 4KVPA 3Q05A 2H1LM 3WTVA 4AGLA 4G83A 1HJBC 3VD1A 3VD2A 4IBWA 4IBYA 2AC0A 4L0YA 5BUAA 2BIQA 3WU1A 2RMNA 1GZHA 5G4NA 5AOKA 2BIMA 2FEJA 3IGKA 2GEQA 5G4OA 3KZ8A 1E50A 4XR8C 3Q01A 2J20A 3D08A 1CMOA 2J1YA 2XWRA 2ATAA 5G4MA 4IBQA 3WTTA 2X0VA 5ECGA 2J1ZA 2IOMA 1H9DA 1UOLA 3D09A 3WTXA 3EXJA 4IBUA 3IGLA 2AHIA 3US1A 1EAQA 2X0UA 4A63A 2YBGA 4G82A 2MEJB 4HJEA 3D07A 1EANA 3KMDA 1GZHC 3WTYA 4L0ZA 5AOMA 2IOOA 2J21A 4MZIA 1YCSA 1EAOA 2P52A 3QYMA 2BIPA 2WGXA 3EXLA 4LOFA 4AGMA 2J6WA 4AGPA 2XWCA 3ZMEA 1KZYA 2X0WA 1HU8A 2BINA 5A7BA 3US0A 3WTWA 3WTUA 4GUOA 4IBZA 2VUKA 3D0AA 5ABAA 4LO9A 4L18A 4LOEA 5LAPA 1LJMA 2BIOA 3D05A 3QYNA 4IBVA 5AB9A 3TS8A 1TUPA 4IBTA 2IOIA 4GUQA 5AOJA 5LGYA 4AGQA 4IBSA 1TSRA 3WTSA 2ADYA 1IO4C 2J1WA 5AOIA 3D06A 2PCXA 4AGNA 2J1XA 5KBDA 2OCJA 3VD0A 3Q06A 5AOLA 4IJTA 1CO1A 4AGOA 1HJCA 4MZRA 1T4WA
chains in the Genus database with same CATH superfamily
2A9DA 4KJPD 5TDOA 2NNAB 2WP3O 2XXCB 4KJQC 3TOPA 5I1GH 4L4VA 3JT2A 4N0UE 5E1HB 4UYPA 3PWUB 5KVDL 4NO2B 1M71B 5FC9A 1KIUB 2LV4A 3TO4D 3A23A 3MRQA 4FTVD 3VQMA 3Q2NA 2H0JA 1GKEA 3CXDH 3QQ9D 5EPMB 1JZ4A 2C7FA 4NRZB 4ELME 1F4AA 3RZCA 3VGHA 4PP1C 5LDSA 4N6RA 3MCYA 1MFBL 4MHHI 1CIDA 1FL6B 3NK4A 1ZPUA 3E3QC 3NSDA 4LLUB 1TCRA 1UWYA 2OXGB 5G4MA 3WTTA 5IHLB 1U58A 3QG6B 1NGQH 5I8KH 2WSKA 5E9DB 2DQHL 4LNRB 1MHEB 2F53E 1AANA 2M1KA 4I5BA 4OCXL 1NUGA 4DQOH 2F19H 3G9AB 2GIMA 5DEGB 4AQOA 3S3BB 1GPOH 3ESVF 4HSAC 4KRPD 3C5ZD 4XOBA 2GSGB 3WNJA 1JK8B 2CNYA 1I1YB 5B8CA 4F7MB 4Q9BA 2BSDA 1DLFH 2XG5A 1MHPH 3T0WA 1G9MH 2OL3B 3IKCA 4F37F 3PJSB 2F5BL 4NZUH 3VFUB 1NIFA 2WXKA 4DO4A 5IFAH 4K73A 4DH2A 2AK4B 2CHWA 4PJ7B 4PH8A 3QIUB 4QCIA 5IWLC 1QZNA 3NCEB 4GXUN 1ETA1 4L9LC 1OAQH 2ZXEB 3QHFL 4XNAA 4AGPA 1XGPB 5FCUH 1MCLA 3FU5A 4QYOB 4UZSA 4F1SA 5GS2H 3MRMA 2BSTB 2P5EA 1TQCB 2H1PL 4OD2A 5KW9H 3Q9QA 3CQFA 5DD6A 3UJIL 3NA9L 2Y5TA 2Y6TE 2G3NA 1WCQA 3EO0A 1JOIA 1ZS2A 4GI6A 1J9TA 3VDAA 1XCTB 4DZBB 4R4ND 3U79A 1NC4D 4I3RH 3T04D 5A16B 5ABAA 5BXFB 3JZ7A 3UO1L 1RLBA 1NICA 4J8QA 5GZOD 1L9NA 1LO0H 3QUGA 3LHPH 4I13B 1U8HA 2UVEA 3MLZL 4I48A 4H8PA 4KHTH 3PWUA 1NLDL 5FO9A 1J7VR 4JREB 1KIUA 4F27A 4ZMOA 2WN2A 3K8LA 4UTAL 4MDJB 4UT6H 5BRZD 1BD2E 3QORA 4V1DE 2BIIA 2IBBA 4LCCA 4QXGL 3ZE1E 2VQ4A 5D96C 5CMAA 2P80A 3D39D 3REWB 2WQWA 5DZOA 5ICXB 1IBBA 1BD2B 4KI1A 2DM2A 1ZLUH 4GQZA 1T89A 3ESOA 1ZJBA 1KYFA 4PCYA 1OE2A 5EIVA 3GLAA 4N3TA 5EZIH 5AYQA 3I6GA 3FSWA 2PXYD 4S1RH 2JJVA 3X1EA 5BZDA 3A6BL 4E0RA 1UD2A 4JFTA 5KSAD 4P9HH 1HHIB 1IGYA 2AK4D 3L17A 3PIQA 4PTTB 3KPSD 3PS6A 1H9VA 5SX4H 3T77A 4C56A 5A2AA 1ASOA 2M26A 4ODVH 4FZEH 1HXYB 3QXTA 3PAYA 4XP4L 4B7LA 4YX2H 1Q9LB 3FOMB 3N40F 2FSDA 4QR7A 2MQGA 2VLLA 3SBWA 4MB4A 4YDLB 4G1MB 4HGWB 1R3HA 2ZE0A 4LKCA 4D7BA 1URIA 2NNXA 4XPTL 2QVIA 1D7FA 2DWDA 2AK4A 4PJ7A 1UENA 5D2NA 3NVQA 4ZUUB 1HYSD 3EDFA 1QSFE 3QZWA 1PKOA 4PJDA 3PNWB 1QVOB 2VLME 3LXCA 4H0LC 5GRUL 4BKTC 1N8OE 4QOKA 3U0PA 3BIAX 3ZTCC 2HKFL 3KPLB 2DV6A 5EOQL 2FO8A 4U1HA 4K7FB 5IV2A 5HDLA 4NZUL 5BVJA 2WQXA 3WNPA 4ZZKA 3TA3A 1PIGA 2ZCLL 3I9PA 2OMUA 4DEPB 2VQ1B 3QORD 3FRUB 1HIML 2X6BA 3N06B 4FTVB 3VXRA 1QSZA 5KVGL 5FM8A 4NN7B 4AMXA 4XCFH 3LRSA 4NO5B 1NOFA 4NM8H 5IBTH 1ZHLB 2A6IA 3TNNA 4B9FA 4Y2OB 3NCBB 1JVKA 3N2JA 1N6QH 2P44B 4H5SA 3RGVD 2X1PA 1F1DA 1FZJB 2JK5B 3QQDA 3QQ4B 1XD0A 2ZIDA 4LL4A 3FUDA 4Y9GA 2J3SA 2OSLA 3WLWC 1MUJB 2AEIT 3MODL 4OCSL 1B9KA 1XDTT 5H94B 3QT2A 3UAJC 3W2DL 3UP6A 1ZXKA 4N26A 1JFQL 4JFHE 5C0FB 3AT9A 2XX0A 3QRLA 1KLUB 3ZE2E 5HYIA 5I0XA 3F84A 4ZSOA 3TA3C 4QD2E 3PWLB 4Y4HC 3MKGA 3V4PA 5KANI 5CLWA 3E8UL 1U8QA 2IANB 2XG4A 1RZIB 3V52H 4TN9A 5F0PB 1USZA 2WBXA 5E8NB 4WO4B 4IMKC 4U1GC 3OKEB 3CTTA 1V05A 4GI9A 3RA7H 4RQQA 1HXYA 4HUWB 4M61B 4R97B 3UC0H 7CGTA 1EMTH 3TBWB 4B60A 1LO4L 5F1IA 3IJYB 3MBXH 1M1XB 2H1LM 4M3HA 5DD1H 3FUNA 2AXFB 4LSTH 5FUOL 5A2JH 2PWGA 3AY4A 1DSFL 2NXZD 2XXGA 5B4MD 3VSTA 4PJIE 5F70A 2WXFA 4QHLB 2ODHA 3FU6A 4QRRB 1OE1A 1YZZA 3MLXL 3P4OA 4NKOA 5E5MB 3W9EA 4Y1AE 2E7MA 3FFCB 3OD3A 4I18C 5EU5B 1R9FA 4DO5A 3K5RA 3P3SA 5TDOB 2YD5A 1FVCB 1IGTB 1MCCA 1T3FA 2FJFA 3BZDA 5JR1H 2FCBA 3H3KA 3VXNA 2JI2A 5KYNA 2JIXD 4P5KA 1AOHA 2FLRT 5IIEA 3BQVA 2Y2YA 1UATA 2XRAL 4Z7OF 4PJAA 1AZZC 4H13C 1C8QA 1A1NB 3QFJD 3RVTD 3PCYA 3FSZA 1D5ZA 2OJEA 2VW4A 2XA8L 3HBZA 4JM2F 4KWUA 4YUEL 5E6UB 5PCYA 4HYTB 4LL1A 1RZFH 3QORC 2WZ6A 2ENPA 1QBBA 3PF2A 4WNQB 4M5ZH 4DGVL 1DBJL 1MRDH 32C2A 3HPJA 4LK4A 4Q2ZA 2OKMA 4HDIB 2N3JA 1KTDA 3AG3B 4LOUC 1CCZA 4O2FB 4K5OA 3HZKB 1JGEB 5CCGE 2AQ2A 4X6CB 2Z91B 1I75A 3MACL 2UZPA 4P57A 1NCUA 1VFUA 3BCDA 2GY5A 1ORQB 3UYPB 2C9AA 4BQ8A 5C0JA 1E9PB 2BVEA 1SXBA 3OKLA 3B5HA 2VOTA 3AU0A 3MXVL 5D1XA 3S35L 1CDUA 1ZMYA 3LY6A 5B1JC 4W1TA 5D7KE 5HY9B 3UEQA 2J6WA 4CMMB 1HAWA 1LILA 1L9OA 2D03H 2FEEI 2HFEA 3FH7A 4MCYA 4EE2A 4QOKE 1IZKA 5I9QB 3GPSA 1O0VA 5A7BA 3L4ZA 4ZO8A 3US0A 3U30B 3CH1B 2OJZL 3LN5B 5MENA 1SN5A 2UXGA 3OXSB 3BC9A 4P46A 4PBDA 2X1XR 3D0AA 1I82A 1VGKB 2DLFL 5J5EA 1NH6A 1AGFB 4L4TE 4XWOD 3WSQH 1I31A 4ZUTB 4CGUB 1KJMA 1JDCA 3WFBL 5ACLA 5LBSA 1JPEA 2VXVH 4KKAC 2BSED 4YQXL 2Y5TB 4M7JL 4MJ5A 3HC4H 3ILQD 3JWDH 3B5GA 1F6AB 1PLAA 4B5ZA 2Q3ZA 4X6CF 5I1AA 1JNLH 3FUMA 3WUZA 1T7YA 4UUJA 2DLEA 4J3WA 1M4KA 1UA6L 5C09B 1I3RB 2XZQH 1GC1C 3IN0A 3T0EE 1RUMH 1E9QA 2R2BB 5JW5B 4FMKA 2UZIL 4QKTA 4RMQA 1SJMA 5H2BB 2QTEA 1QSED 3NPSB 2GT9B 3UTPD 3RY6A 3RZCC 1FA4A 3IS0X 4F7TA 4NNPH 1WZAA 2F7QA 2YFOA 4L2LA 2BDNH 3NFSH 2NY5H 35C8H 4G9FA 1I7RB 2HLAA 3KCPA 4MMYB 4KQ4H 5T1DL 4PGEB 4OFYD 4XMZA 3LSOB 3P3YA 5I71C 1E90A 2CDEB 3RVXC 1AZCA 3D6GA 1A6PA 3QC5X 4HPOL 4P2AA 4YN3A 3GZQA 4H2CA 4FS0A 5KBLA 2NTFA 3B2MA 4KXAA 1KFAH 1J5DA 3KLSA 5D1XB 4PJ8C 4Q9RL 1HEHC 1ITBB 2WJ7A 3QEGL 1DUYA 2ZJSL 4HW6A 3PHQA 2F15A 2X09A 4MXVE 1QX1A 3A21A 3SN6N 2ZONA 1NFDF 2AQRA 5L2JB 1N19A 2DOCA 1T0MB 3VJ6A 2Y72A 4YAQB 5CHNB 3VFGH 4ZFZA 2MTAA 2CLZB 2H32B 4ZOBA 1RJLB 4MSWA 5EBMA 4NKDA 1HIMH 3G5ZA 3HG2A 5DK2A 5C0AA 1UB6B 43CAA 1NMAH 3BX7C 2I27N 2Z93B 4ANUA 4Y16B 3K2IA 4PD4J 3KPLA 2MHAB 1R0AH 2OMYA 2ADGA 2LE9A 4NP4L 1KXQA 3NCMA 3LRGA 4UNTA 4XMKH 4YSUA 1RL1A 3ASOB 5J6GB 3VXMB 1HU8A 4IRZH 4EI5B 4K07A 3FCBA 2C1PA 1TOXA 5KSUA 1C08A 1NCJA 1ZANL 4FFVC 1ZHLA 1DEEB 3GMOA 1BEYH 2F7IA 4UB0H 1SUHA 2AJXL 1ZLVK 4GG8B 5DZPA 3BYTA 3EOYG 1XSIA 4AL8C 1PEZA 3RIAF 2B1OA 4WF7A 5LAXA 4BEIA 2AV1B 3DMMC 3JWDC 1AVAA 4JK0D 1JPSL 3PXLA 4JFXB 1YMMA 5AOJA 4KXZI 3MV8E 1L7IH 4HETA 2J4WH 2QQKH 3FOLB 2AQ1A 2C4FU 1U8LA 2X7LB 3OR6B 4NZTL 3TYGH 1UYWH 2R9HC 4O51A 4AI7A 2GUOA 3SODB 1FL3A 5HVWA 3ULVL 3BEWA 3MRQB 1OKEA 3O0RH 5AZEL 2W88A 4MMXA 3GBNH 1FZKB 3RJDA 4HD5A 2IWGA 2OP4L 3VTMA 4WW2B 5DJCB 3FB7B 3FB5A 4OLUL 3OKEA 2H7WA 4R8WL 4A2GA 1DBJH 2H3KA 2J71A 2HKAA 4L3ED 4AYMC 2DEXX 2EO1A 3JTSB 4V11A 5I1CH 1S9XA 3PHQB 3VYNA 5LNDA 1RZ7H 1T4KB 2MJWA 4OM0H 2MCG1 4Y9FA 4P4KC 4PMEA 4P3WA 3BMWA 2XUWA 3NJJA 3E8UH 2BSEA 4JM2A 4JPKH 5DUJA 4BBWA 3AG1B 3EGXA 3OHXC 4W68A 1BECA 3ZR6A 4A66A 4AMKL 3TESA 4UIKL 1EHXA 1Y6NR 3EHBC 2NZ9C 3JT0A 5FGCE 1NCAL 4XXWC 4ODUA 1GS7A 1Z2KA 4NM4L 3VXME 4G6FD 5L8LB 1A3QA 1JWMA 2K9FB 4EJ1C 5T3XE 4NBYB 3KYOB 5E5UB 1RULH 1T21B 3PJSA 3HE6D 3D2UB 1GZPA 4KK6C 4OZHA 1FG9C 5F9JB 2PXYA 1JZEA 1IAIL 1XGUB 8FABA 3VXNB 3MC0A 2K4AA 1C16B 5I1KH 1FGNH 2Z6FA 4W6XB 5CGBA 4WI4A 3ZRSA 4YDJB 4ZX4A 3AACA 5DHVH 4HJ1A 1VADB 2VLJA 4IKLA 3LRHA 5BRZA 1J9CT 1MHCB 4FAAB 5GGRA 2QADB 4MZIA 2ZYIA 3JTBA 1SVCP 3EYOB 4J3SA 1HNYA 3WFDL 1QTSA 5I1IL 2X70A 4W4OA 2VZTA 2HRGA 4JY6B 5ANMB 4RGMC 4GO8A 5D7JD 4JFED 3FT2B 1QRND 4X6FA 4XNXL 1DE4A 3D0VB 2IV8A 5C0JB 3QJSB 3FO9B 4U6XA 1KCVH 4AZ8A 3FC8A 3OKLB 3K8MA 4MAYC 5F7EH 3BVXA 2VLKE 4M6MH 2W8CA 4W9IC 1D7CA 3SGDH 1WO2A 2WD0A 3VD4A 3P0VH 5DYOA 2FWOA 2IWKA 3C5ZA 2OZ4L 3KCWA 2HLEB 3LV3A 4FZEL 3FUJA 1UXWB 4XPGL 5IEHA 3BSZA 4WO4D 3NQKA 1JNJA 1SDYA 1J8HE 5CINL 4ANVA 2C5DC 1EMTL 2VZSA 5IB4B 4I1NB 3QEHA 3QG7L 3DMMB 4N28A 5KTEH 5T33L 1REIA 2OA9A 3HUJE 4OJAA 4YPGB 2GG1A 2BLFA 1MWOA 5I5JA 2YPVH 5C08B 3BZFA 3KJ4B 3QXAA 4JCLA 2EE0A 4QRPB 2DMGA 2V5SA 2C3HA 5CEXB 1KTLA 2OTPA 4HIIB 2WXPA 4LLQB 4L5FH 2A74C 1HE7A 2VLMD 4PRHE 4AQEA 3IMSA 5J1AB 2FEJA 5HJBA 2ZOLB 5T1DH 3KPNA 5TDPA 4PJDB 5D71H 1BQUA 3ECBA 1MI5B 2GJ6D 3DIVA 4XVTL 3SOTA 3QJFB 1YHPA 4BXSV 2YC1A 2WK2A 3OKMA 2DDQH 2FX7L 2NQDA 3LDBB 3FPXA 3ULUC 1Z3GH 1YPZB 2VNCA 1I7RA 3TH2T 3ULVF 3K46A 4W9DC 4IQHA 4WWNA 2X70B 3CFBB 4CSPA 4D9QD 3ARDA 3LKSB 5DA4A 3BD4A 5K9QI 3QCUL 4HIXH 4S1RL 3AITA 4K2UL 3U46B 1MXDA 5CEYB 4PLJD 5HDBE 4FYTA 1ROWA 1OL0A 4IHOA 4L5FL 3MXWL 1GGBH 1JZ6A 2DM4A 2EXYC 1GW0A 3WNLA 1CDIA 2J73A 5FKPB 2BWQA 1P5UA 4NC2B 1WFUA 1PBYA 3CFDA 3DX2A 2SEBB 2V8LA 3RX7A 4Y1AD 2CBPA 3SPCA 3F3HA 3WXWH 5F3BB 1K8IA 4WK2B 3IU4H 1U92B 4D0DA 1XF2A 4Y4HB 3SQRA 3Q6FA 5JMOC 1SHSA 3MRCA 5L7XH 2BMKB 1UYWL 4AL8H 4NJ9H 1BXXA 1AR1D 2VR9A 4PN6A 4PQXA 4M7KH 2JELH 3Q3GB 2BSBA 2HCZX 5CGYD 1A3ZA 2E27H 4A6YA 3ELQA 2X4TB 1BMWA 2EIMB 3FT3A 4IBZA 5F0LB 1JFHA 1TJGH 4JFEE 3U4EB 2D3LA 1CGXA 3SGKC 3RIKA 4ZI8A 2K3TA 4FEMA 2BIOA 5IB5B 4FN0A 1NC4A 2IF7A 2ZF8A 3FT4B 3GHEH 3NPZB 4KGLA 4HPYL 4PI0A 4JPSA 2OQJB 2W9DH 1EXGA 1EFXD 2V5MA 2H4EA 1R3JB 4NDMA 4P2QA 2CKNA 4BHUA 3SZKC 4ONOA 3W9EB 4N0CD 5DHXB 1G7MB 1UQSB 3B3IB 8PAZA 3FQ1A 4HX1A 2EE2A 1UB5A 2O61B 2Q1EA 3RY6C 2UWEA 3O2DH 3UZQA 1FVDB 4UDUA 5JNYB 1JK9B 4JY4A 3DRTA 4NO2A 2HPOA 5EF0A 4PV9B 2ED7A 1QFHA 1V27A 2MKLC 4TTDD 4WO0A 3UG3A 4TVPH 1F1AA 3WENA 2AQTA 1LEIB 1USQA 3FQ2A 4TM9A 1RUPL 4AV0A 4R6UA 1NPNA 5C07E 5DS8B 1QUPA 3BH8B 3EDKA 4MNGA 4GQPH 1P4LB 2FNBA 1L0PA 1JNHA 1HHGA 1BAWA 1O6SB 4RGNB 4XPBH 3UBXG 2VERA 3G5YB 5AVTB 3QO0B 2HH0H 4OLVL 5FKPA 5C07B 1GOGA 1TIUA 2WVVA 4HS6A 1G7IB 5E6IC 4JGUA 1K3ZA 1U58B 3QG6A 4FL4C 3EGSB 2RALA 2XETA 3ESPA 1OTSC 3H2WA 2O6EA 3FU7B 2EDWA 4PJCF 5IW1A 4TPRL 3IDMB 4N4YB 2FECL 4AYGA 3SYQA 4F2EA 5SWSA 4CVZB 1KLGB 5I5MA 2AJZA 1N5YH 1VF5C 1LEKA 5C8JB 1WTGT 3IDIA 4OLUH 4MZ3A 3H3PL 1T5XB 1YJDC 1MFUA 4A7TA 3STZA 4G8AC 1Q1JL 4WNJA 3EUUA 2RGSA 1A6UL 4UF7C 4B0MM 4UTAH 1K9TA 1E67A 4PRPA 1CFSB 4XHQA 3BQUD 3FQWA 4OVUA 4EIBA 3QIUC 3KS0H 1C16A 1QHOA 3L7EB 4V1DB 1FH5L 3UBXI 5MENB 3Q2CA 2D4FA 2VXTH 3CHOA 1ZLWH 1KXTA 3TZVA 3LQAL 3GSOA 3L9EA 3GRWL 3O4OC 3ZJAA 1BJ1J 3ZKNC 1M9SA 2AJYL 4A7SA 2WSDA 5AFAA 3BISA 3T0XA 4PGBA 1B0IA 2I07A 3RWJB 3V5KB 4MA7L 3GI8H 3WIHL 1GC1H 3BKJH 4R5XA 1TR7A 2FGWH 2C9SA 3ARGA 2X12A 3FT2A 4N22A 4MJ6A 1F4YL 5KVFE 2NSMA 3GBDA 4NUGH 4S0HA 4X6FB 1UVQB 2HJFB 2R0KH 4N1CA 5I75C 5FW6A 1CN4A 4X7EC 2QKIB 5J4MA 1ZHNB 2I5YL 4PV9A 5KSBA 2BVQB 5EH1A 5AOIA 3VYPA 2HT4C 1IGIL 3TA3D 3GKWH 1F6LL 3OZ9H 3GGWB 3LV3B 5IQNA 2CUAA 3HCVB 3S8GB 2D0FA 1E7VA 4GG6B 1UASA 3NCYS 3P3UA 4QJ3B 1HNGA 3HAEB 4AKOA 4KH9A 3U9WA 1UXSB 3VQLA 1HDMB 2ZAGA 4JW3A 4P46D 5HDOA 3E38A 3QDJA 3VD1A 1UCBH 5TFSH 4NSKA 4GSDL 4YLBA 3KWWA 3OHXA 4Z3GA 4JZJB 4LSPH 4C83A 2NLJA 3NJFA 3X11A 1AYOA 5T1KB 1KV3A 4JANB 2GEQA 3LVTA 2VXUH 2EDQA 2C9QA 5AALA 2W81C 4ZSOE 1XR8B 4I0PB 4JFOA 4APQB 1J9RA 2IBZY 2ZOTA 2Y1AA 4IMKA 5AZUA 1U3ZA 4QHPA 4CNIB 3S96A 4WW1A 2V9TA 3ARQA 4LIQH 4LASH 1IM9A 1TTBA 1WGVA 3JWNH 3L95B 5EU7C 2GFBB 4JX0A 3RX8A 3B7YA 2WXGA 3KHQA 1G9EA 1WAPA 3CSGA 1VZIA 5IHBA 4YK4B 4BZ1H 3QDJD 5EO1B 1OM3L 5C0AB 1S3KH 1RZJC 2Z93A 1YJDH 1Q94A 1MHPL 4TSAL 1XMWA 3H54A 1P7HL 3EFFB 4M43L 2NY2D 3KLQA 5FB8A 1ADQA 2IMNA 4LE8A 1JWSA 4R0LA 1PJ9A 2CE6A 4WFFE 4ABUA 3KYKH 1GGTA 4WFFD 2V8MA 2C1PB 3LPOA 2G2PA 3LQZB 3POHA 4I8DA 3C2SA 1YUKB 5ABZA 5FGBC 2ZOKA 3V6OA 1LK3H 5E03A 5IOPB 4N5UA 3EXLA 4DP8X 3GJEB 1X9QA 4JFUA 4K71C 4ZMXA 5AB0A 5IHHA 4GG8A 3QQDB 3O3BB 2X53A 4G8FB 4JRLA 4OGQC 2GQHA 2BVQA 5JW3L 1QACA 2Q76A 2ODIA 4K9EH 2VLKA 2DKSA 4X9BA 4WI8A 4NUQA 5D1QA 2IAMB 4F1ZA 3WFBH 4QRQA 3WE1A 3PGDB 5I6MA 4RRPA 5GS0L 4FQXA 4F15C 1B4JL 5B1CA 5HSFA 4NHUA 3TEWA 5D96B 4G8GA 4QHMB 1NCWH 2XV6B 4OD1L 1UACL 5BOPA 1FNLA 1PKQA 2WNGA 1R5WB 4PW9A 3RPIB 1HESA 1IGJA 4JQVC 2X2YA 1ESOA 3WD5H 1VDGA 4JDZA 4OTXL 4DKFL 2CBTA 4U3SA 1TJIL 1Z0NA 3OZKA 1T03H 4KKBC 2OXHB 3LNFA 1V8HA 3GDBA 5JTWA 2FJHA 3TBWA 1OP3K 3VFSA 3NH7H 4WIQA 3NSCA 1ZT4B 3KJ4C 1TYEB 2DQMA 3WKML 5F7FA 2VDRL 3G5XB 2DWYA 1Z7JA 1NAML 2XZAL 3F85A 4YEFA 3FU0A 4Y8DC 4J3VA 4JG1H 3IJEB 4P9MH 5D2LF 3U1PA 1U8JA 1MCOH 1DZ0A 2NYYC 3AJ7A 2C4FT 3QA3B 5E5MA 2K45A 1PG7L 3EJSA 3QXDA 4FKHA 4OCYL 3O11B 3FFCA 4PJBB 3SHSA 4JFYA 5ICYB 1SBBA 3EYUH 1MIML 3S6CA 4PVLA 2YXWA 5F88A 4KTGA 2R4SL 2Y25A 4DGYL 3GWJA 1UB5B 4M7ZC 1A4JA 5T5FA 1KCSL 5GS1C 3BEVA 1Q4NX 4N2OA 1MCQA 2X9YA 2CHDA 2VXQL 1DJWA 3O2WL 2OYPA 4YNYB 4JN1L 3OAUL 3C60B 4FTVA 3ZGHA 2R8SL 1QEXA 3PQYE 1IBGL 1P53A 1U8IA 2ATPA 2J1ZA 2J2ZA 2QVTA 4OCXH 4UNVA 5K69A 5L2KA 4X0NA 4Q4EA 3F7QA 5DQ9B 4LVNB 4TSAH 2ADIA 4HUVA 1H15A 1AGCB 2AV7A 1WBXA 3KPMA 2YAMA 4Z0BL 4KTDL 4TL5A 5F6IB 4LDLB 3ARED 5E7BA 5I18L 3O3BA 4N0FA 1OQXA 1HH6B 1IQWH 4WDIB 5CJQL 1GGCL 1AIFA 1HOCA 4LSUH 1AXTL 3VD9A 4YDVB 2J55A 3KH4A 3MV8B 5DLLA 4UTBA 3UTZB 4MJIB 4O58H 4Z7QB 3I2CL 4NI6A 3SKNB 2OX5B 2QJDA 5D7KD 4NPYB 5HY9A 4G2AA 2Y4SA 4JRYE 3DJRA 3MOBH 5J3HD 4ONFH 2A2QT 2BVPB 2WKLA 4GXUM 5FUCC 2H3NA 1WC7B 4X5WB 3RNQA 3PLYA 1XH1A 3CSPA 3RY4A 4ANWA 4PY8I 4K5NA 2G9KA 2KZBA 3L7EA 4XBEL 2FB4L 5IEHB 3PQYA 3QIUA 4QCIB 4E42A 2IH8A 3QDGD 3OPUA 1ZT4A 1CG9B 3LX9A 2JNZA 1E4JA 4APQD 2VDQB 1I8IA 2PTTB 2Q7YA 4XH2B 3GK8H 4QRPE 1PF3A 3OAZH 4YPGA 5AAMA 3TO2B 3MREA 3QXDB 4HT1L 4DN3L 2XI9A 5CJXC 2WWNA 2AEQH 2OMZA 2CUMA 4Z6AT 1OAXH 2YA2A 3VG0L 4IGBC 3TT3L 5J6HA 3F2LA 1OAYH 4B53A 1JYXA 1YEKL 1MJ8H 2Z0BA 2HFTA 1SN2A 1FVCA 1MZYA 3MUY1 4TUUA 3V2AR 3VVVA 4DVBB 3A5VA 1JPFA 2XPGA 4N3UA 1FVEB 4P5KB 5DS1A 4OV5B 1P5VA 5FGRA 1GC1L 1CLYL 3O41A 1SJXA 4XVUC 4H8VA 4YNYA 4U1MA 4CMHC 4UBDC 5EU6E 2VDNB 1CFTA 2FBOJ 4YHPA 2OMVA 3P4NA 1EGJL 1QSEE 2CCWA 4G70B 4G7SB 4X80H 3WFEH 4WAFA 5JW4Q 2UZYB 4U3CA 3IMWA 4HWBL 5J9PB 3DXAA 5D4HA 3BI9X 1XH0A 1SXNA 1V3KA 4PGEA 1CFVL 4P2OA 1JN6B 5FYKU 2AMUA 2NUPB 4WDIA 1H3GA 4YDKL 3SO5A 1J5OH 3QDJB 2Z91A 4P57B 4U1IA 2XT1B 1C7TA 1SYSB 5HHOA 4K0OA 4F9LC 4LGSB 4PJEF 5T1KA 3K6DA 3HHSA 1TZHA 4M7LL 5SX5K 5L2KD 1A3LH 5E1QA 1MRDL 4PJ5D 5JW3H 4HJTA 1TYJA 2YAQA 1VEOA 4KJQD 1UWXK 3AXLA 5A3IC 5KJRL 4G72B 3OGOE 1Q1JH 1CD8A 5E7FA 3QWNA 1F4HA 1TZIA 2UUDH 4HIEA 4Z77B 3T2OA 2ZUTA 3ECVA 3VNYA 4G82A 3L95A 1KYDA 1WWWX 1F18A 3V6OE 4NKIL 3SGKA 4FULA 1TU2A 5LCVL 4OF6A 2EEFA 3QI9C 2WWKO 1JZ7A 5JZ7D 3QULB 4M8RA 2JCCE 1KPVA 2W9EH 1LMKA 2YUXA 4TNWK 3LZOA 3TONA 3MZTA 1SHXA 5BVJB 2DQTL 3ZDZE 4LSSL 3DGDA 1PX3A 4TULH 4EOWH 3LB6C 4K23L 5IB5A 2XKNB 4X83A 1FIGH 2F2HA 1J5IA 3J7HA 1NPUA 5ALCH 5A2LH 4EXPX 1L6XA 1DSYA 4YFEA 4LEEA 5LBVA 2OZ4H 1QFWM 4M56A 3KPSB 3GI9H 4C4KT 1RZGA 5FDYA 1E9QB 3CZGA 5DVMA 3BKML 4FQ2H 1LWRA 4G8GD 1CGTA 1DBAH 5IJCC 3WAJA 1SOSA 1XF4B 8CGTA 2R4SH 2XN9A 3TYFA 5EIIA 3LZNA 3RTLA 5GGSY 5T33H 3L3OB 2H1PH 2MTPA 1HI6A 3LS4H 4JE4B 5ISZB 2EIKB 1K6QL 3KLHC 2GUOB 4D9LL 4AY0A 4E36A 1L0QA 1IAIM 3MX0B 4OZGA 3F65A 3QWQB 4IOSD 2X4PA 4U1KB 4OF7A 5GS3A 5CEZD 3MV9A 1UKTA 3IVKB 4GBXD 5DSCB 5F7KC 1XZ0A 2XTJC 1AG0A 3GMNB 4G11A 2E27L 4TTGA 3TN0B 2YD1A 5BMFL 3M7OA 4R5VA 4KUCD 1HJBC 4JDZB 2EUXA 2B14A 3VVWA 2VDPH 2WVVB 4HS6B 1L4IA 2R56L 1OAKL 5I8OL 5J06A 1SQMA 1N8ZA 4S0TD 2NXYC 4WI5A 2D7TL 3D50A 5LNEA 4ZMAT 5IW1B 2I32A 3G04B 2IPKB 5I71B 1Z66A 5I1HL 3ULSA 4OR1A 4ES8A 2CO6B 5I73C 2NX5E 3BWUC 5FGBA 4Y19E 3KJ6L 3QZOA 1FZMA 4BFBD 1W2KT 1TJXA 2GBVA 2Y36L 2W0KA 3PWVA 4HLEA 1QEWA 1XL4A 3AGVA 4TUKL 4BA0A 3RGBA 2B5IB 3AQYA 2DQJL 1DQDL 1EXUA 1TJMA 4Y16A 4ZO6A 1E5YA 2DQDH 3VWKC 3QQ3B 3SE3A 1TTRA 4AG4H 4OV6F 1AQDB 3VXPB 3VGFA 2PCYA 1LDSA 2YSSB 5JW4M 1PG7H 4OCYH 1INQB 1FBIH 2HWZL 4YDJA 2YWYA 3QXUA 3VXOB 2GTQA 2EH8H 1MHHA 1UXMA 1TTAA 1D5BA 4I0PC 4B96A 4M6NH 5K9QG 4QF1A 3T3PF 2WBJD 5C3IA 4X9IA 2ADIB 5AW9B 4XZUA 3NIFB 3BPCA 2AV7B 4EZJA 3ULUD 4AIXA 2XXFA 2ZUVA 1YY9C 3BVUA 3W1ZA 4XPAL 5JHDE 2NY4B 3EG9B 5J12C 6CGTA 2ARJB 1HOCB 4RBPK 5KN5B 3LXAA 1E27A 4HIHA 4JO2H 3T3PE 3DVNA 1K72A 1HZLA 1LDPH 1CGYA 1K5WA 2YBRA 3CX5K 4FQ1L 4MQ7B 4MXWH 4P07A 4ADIA 4K3EH 2GSIA 5FO7B 2H32H 1TEGA 3PAVA 4QRTB 3THML 4G6JH 1E4WL 1G7LA 3UTOA 5JXEC 3GS7A 3HI1B 2APBA 2NQ3A 4PRIA 3NCYP 5FHBH 4BKLB 4LSPL 1LJMA 3B2UD 1SXZA 4K8RC 4JNXA 5HDBF 2NW3A 3BVWA 5MEPA 2O4EA 1HZHL 4OQTH 3PV6B 2X3AA 3DNKA 5BQ7A 1Z9OA 2ZOUA 4LRNL 5E9DA 3LEYL 5E23A 3KXFD 2PXYC 4XE0A 4AT6A 2VDRH 2I7SA 1U8OA 1O6TA 1QFPA 4BFOA 1UA6H 2VL4A 3R8BB 4ZTOH 1WFNA 5CKAA 5IREA 5D4IA 4YHIB 3DV4A 2GUYA 4K7PH 3U9PL 4EIZC 4FL4B 4NPJA 1K2DB 2FX8L 3R0NA 3OG6B 5LWYL 4UANA 2EINB 1ZRUA 2K8MA 1NCCH 3VFUA 2QADC 5I66A 5J7CC 1GZPB 1ZXQA 2D31A 4PHXA 2ZXGA 5I0YA 2V2TA 3EO1A 4KMTH 1BVZA 4DVBA 3P54A 1TTCA 4WGWB 4Y88A 1ZVHA 3T3MF 5EU4B 3ERXA 3H53A 4BZ2H 3KVQA 4WY7H 3IDGB 4PM1A 4XNQA 5TDNA 2D7OA 4WWKD 1DQDH 2QFRA 2GJ6E 3SZ6A 3VMNA 1FQ9C 5BS0D 2ZCHH 2C9XA 3TJHC 4X99A 5GRYA 5TJWK 1B88A 1D9KD 2CO7A 1C8PA 1CFQB 2F58L 3FQTA 1WFJA 3S3PA 2BWIA 4ZNCD 1OAUL 2DYSB 5JHAA 4CVXA 1AXTH 1H0DA 1LXMA 1BIIA 2Z65C 2EDKA 4D9QE 2NY5L 2X0UA 4R7VA 2BPBA 3I50H 3APMA 3MFFB 3HKFA 4NQEE 3D07A 3APDA 1VFAB 1GIGH 3P2BA 3PFQA 4E5XG 5B38A 5K1JA 3ZTNL 2F74B 3J07A 4AVHA 2YBRB 4MQ7A 3W0WD 3KYMA 2WO3B 3VXRD 1NEPA 1Q90A 2X10A 4B9ZA 3PL6B 4FQPA 1PZSA 4XO8A 5C08D 4HV8A 4HIEB 2YMXL 4Y4HD 3BP4A 5AW2B 2JTDA 4CKQA 4I3SL 4DGIL 1MVUA 4AQ1A 3OMNB 4HOMA 1HT6A 3ATFA 3OBAA 2FB4H 3GZKA 3S5YA 3P0YL 1T1YB 4KY2A 4F80A 1E4WH 4R26H 3RIFK 5DI8A 3NT0A 1KEMH 1B0GB 3GLEA 1X4YA 3N91A 4FDWA 4WUKH 2DQEH 1E30A 1SLWA 2QGDA 4XODA 1PW3A 4X8CA 5JUEL 4WI6A 1F11A 1IKOP 1DCLA 1VIWA 1X7QA 2YKLH 3G5XA 3QDHA 4OT1L 5IVXF 2G3XA 4J8RA 5I1HH 1TNMA 1AJ7H 4Y9CA 4HCGA 1EFXB 1HC1A 1CICD 1JNLL 1KTBA 4G6MH 4IBSA 1DFBL 1CFMA 1CGSH 3CCHB 2VDOB 5EV7A 2R0LL 3M8OH 5F6HJ 3PRZA 3PNWA 3VFTB 4P5MB 1G84A 2E8ZA 1GW6A 2NY1C 3M1OA 4AC4A 4PEEA 1FN4A 4D0BB 2NY1D 1LP9F 3BYYA 4NIKB 4PJ5E 3SDXA 2WWMC 3QJFA 1JPGB 3ARTA 1L9RA 1YEDB 5E95B 3V52L 5I17A 1KWKA 2XWXA 4BK5C 4LLMB 1G6RH 4ZTEA 5M94B 4O51B 4BK4A 2YZ1A 1SMOA 1FL3B 3WY1A 4DCQB 3FCSB 4M9PA 2V7HA 1QSFB 3MV9B 3IXTB 3WIFA 3MJ9H 1RIUL 2FX9L 2XVKA 3KZ8A 1QLRB 3EUDA 4GW5B 4M1DL 1U36A 2VZVA 1BMZA 1KTCA 4NQDD 1UJ3C 3O2VH 4Z7VF 5D7IB 3QHZL 1XH2A 2QLVB 5AAMC 3BDYL 5DMGD 3KYMB 1U8KB 1F58H 5H94A 2CJTA 1T22B 1DQIA 1FPTH 2XU9A 3DO3A 5DO8A 3S2CA 3ZYJA 4D2NA 1KTKE 3S3CB 3P3TA 2SODB 4LBAA 2HVJB 3INUH 1O5PA 3CHPA 5I1KL 4B9KC 1XR9B 2OX5A 3TNMB 1HL9A 4KRLB 3PWLA 5EA0L 3WO4C 1KB5H 2G60L 1MFBH 4YO0A 1MOEA 1B0WA 4XHJD 5JOPD 1DQQA 1FNFA 5DEFA 5AAPA 1RY7B 2B8OT 3U36A 1GH7A 1U4FA 1RH8A 2YRZA 4YZWA 3NACL 3TASA 3UDWC 2ICCA 2YEZB 4J5VA 4BRVA 5IWLA 1ZKAA 4KXBA 2B08A 4LDCA 4QXTB 1JGUL 2A83A 4HG4K 2D7QA 4U1NB 2NY2C 2EKSB 2KZWA 4XVSL 5I0VA 3RVXD 3ZT7A 1I3GH 1JXJA 1T83C 3TV8A 5I1GL 4NHCH 3U48A 1HWHB 2GJPA 1F56A 3QPKA 5AVRB 5L88H 1Q9KB 5EOTB 4DO6A 2LFEA 3CCHA 4UM9A 3BPCB 3EJQA 1TJGL 1IJNA 4N8VA 3THMH 4HJ0D 1F86A 2YQ2A 3VFTA 3SE4A 4TSBH 1OTTC 4ODVL 4AIOA 1SGKA 1LTXA 3R7QA 1QBMH 4HWUA 3QH3B 5CCJA 4KRMB 4PIBA 1INDH 4WFHD 3ZMNA 3UZQB 4JZNB 1JXGA 2BERA 1DJZA 4LGRB 4JFDD 5KVGE 2QKSA 4ZPVB 5C0CA 3MBED 2ZYSA 3GSVA 1RQ5A 4KAQH 5GRJL 2Y23A 4AGNA 4F3FB 1M56B 4P2RD 3UAAA 1WZMA 2W07A 3PWPD 4CGTA 3AREC 1BEYL 1O6SA 3T2NH 4GOSA 3N40P 4AH2B 32C2B 3U2SA 1PZUB 4H44C 5AZ2L 3MLVH 1K5NA 1RURL 1RUAL 1VENA 4AGLA 4PJBE 3V9FA 1DVZA 5E08L 3C5SA 4L3EB 2QVKA 1U8CB 2DEWX 1OM9A 4EVNB 1BF2A 1JNNH 4Z78B 4N25A 3QS3A 4HGKC 3IFPB 2WNWA 3VACA 1O9VA 5HJDA 1U8PB 4YBQD 4Y5YC 3EKCA 4JO8A 4HKZA 3IDIB 1XR8A 4I0PA 3LOWA 4HK3J 4R90L 4WZ9A 2WUBL 3CGTA 1OGAE 1DBMH 4PJBF 4ZOAA 4PJCA 2AEOA 3GRWH 1VLXA 3GHBL 3HN5A 3LD8B 1I8MA 2EILB 2EYRA 3W56A 4F20A 2UY7A 4O2CB 5A2FA 4EN3A 1D5MB 3ZZQA 3EAKA 5DHMC 2CKBB 2NCMA 3IJ8A 3X1GA 1LVEA 2ZUSA 5GS1B 1TU2B 1OSPL 1MH5A 5IR1B 2BRRH 3D09A 2MIZA 4Y1SA 1BYNA 1NCBH 2BCMA 1BM3L 1RZJL 3HUJB 4J1UA 3FAXA 4ORZC 2CCLA 3KPRD 4J6RH 1S6NA 5EBWA 3G6JA 2W60B 3LKNB 3PXHA 1EXHA 4LL9A 2ZKHL 1CXIA 1JG9A 1L7TL 2DL9A 2WV3A 4XX1G 4BGLA 1BF5A 2XNAA 4YFDB 5DR5L 2QSTA 3WO4B 1E28A 2AKRA 1XB6A 2AXHA 2EDYA 1F6AA 4PG2A 1THCA 3ARBA 2PR9A 3LRSB 4NYLB 3QCVL 1AHWB 4RH4A 5FYJL 3IPEA 4PG9B 5H4ZA 3VFMA 2ENSA 2MNWA 5SX4I 1BVNT 1BLNB 4OJFL 1FGNL 4LFHG 2XZCH 1RPUA 2Q76B 4MXWL 4YE0A 3MV9D 1MUJA 4R7XA 4N5EC 1FNGA 4PRAA 4WNSA 4UV7H 4LT7A 1XIWD 4XTRD 5HD8C 4F7KA 4EDXB 3JYCA 1AZNA 2XFGB 3HR6A 2D2CC 1OW0A 4MJHA 5GGSB 4LO9A 2ROYA 4U1LA 1NCDL 5E9NA 4LU5H 4MS8C 3WHXA 4M00A 2HRHA 5TE7L 1HDMA 5M7QA 1IZJA 4ZDHB 3NFNA 2BVOA 3STBA 5JHLH 3OKOA 1A1OB 1ZPLA 2MQ3A 4O4YL 1VHPA 2B7DT 1G7PA 1JZFA 2EDHA 3E6FB 5CKGA 1ND0B 1YAZA 3VFSB 3AAZA 5DHYA 1UTDA 3BFOA 4KZEL 4H0GA 1B4RA 1F11B 1X7QB 4XX5A 2N1KA 2VLLB 4LSUL 1EGJA 1HH9A 5L4JA 4APXA 4GINA 4HKJA 2VN5A 3ML9A 3DETC 5I82A 3MGTB 4S1QH 4PG2C 2DWDB 3TIDA 3SDCD 1J11A 4PJBA 4W6WB 1FYTE 2BFVL 1IBHA 2W5PA 1EWHA 4GAJL 1ECYA 3UP1A 2GKIA 2A6JB 3VQ1C 3BSZH 3NQIA 1G7MA 3CC1A 2FH8A 4GKNB 4UILL 4LAQL 3NIGF 4ZMQA 4NZJA 2UXVA 1RCYA 4GEJA 3VWJD 3TTSA 4PVMA 3EFFA 4LCWA 2NX5B 2F19L 2YUWA 3L3KB 4G8EA 1ET7A 3B1UA 4U7SA 1E5BA 5CZKA 4PGCB 2XNAB 3SDXE 2CM6A 4EI5A 3GSXB 2AKRB 2XWRA 3LPFA 4MD0B 5JYLA 2XPZA 1MAKA 1RHHB 4LPCA 3QFJB 1RU9L 1KPUB 5A6MA 4OM0L 3GIZH 3BLBA 5FW7A 5F97E 1WS7A 1IU1A 5HHOD 3GJEA 4Q6IC 3QZMA 3VU2A 1H6UA 3EW3B 4N0FB 3B56A 4MNQB 1UH4A 3CG8A 3K6SB 1EJ6A 3ZU8A 4HMCA 3EYQD 1XGZA 5J56B 3WTYA 3FMGH 5I76B 2JLLA 1OAYL 4ACTA 3TEUA 2R39A 3DGGA 4Q9QH 2CDFB 3PGDA 1W6LA 1KLGA 4EXKA 2F8XC 1G6RA 3FH5A 3CLEH 4MQXC 3GXDA 5JIKA 3T5WA 4DEUA 1WITA 2DQGL 1MQKL 3ZX1A 1WC7A 3QIWC 1BYPA 1U8QB 2IANA 1JGIA 3SDDD 2X0WA 3ILPA 3Q8CA 4XNUH 3SQBA 3O6LH 5CM1A 2FT6A 2YAPA 3AW5A 2QKIC 2NNRA 3D51A 5I6LA 3UTSD 4I9WE 1IQDA 3CPLB 1A02N 4G59C 1QAWA 4ZMZA 1KJMB 1RIVL 2D4DA 4NENA 1G9NL 3HKZA 4XN4A 5C0BD 5GGRY 3RFZC 1BQRA 2Z4TA 5LAPA 5KJ7E 3P9MB 3MRMB 2ITFA 3HVDA 1WF5A 4YHIA 1S5HA 1D7DA 3NIDB 2EVGA 2BNRE 1SXAA 4AEFA 2ZG1A 1Q0YH 3P73A 1AFVH 3HFFA 2ETWA 3KYOA 2DM7A 4OGAC 4QUOA 5AWNL 3VXQA 4ERSL 1Z0MA 3KW8A 4X5RA 2ALAA 5JIQA 1CO1A 3QDGA 2FK9A 4OUUB 3TIEA 3H9SA 2WXHA 3KW7A 4YMPA 4U1MB 4JFPB 1EBPA 2FO4B 4QJ4B 3IDGA 5CGYC 4ETYA 5HYSB 5KSBB 3LEVH 4Y0GA 2ZG2A 1BZEA 3RPBA 1X5YA 1G0DA 3WEOA 1P9MC 1PJWA 4LCCB 3L1FA 2IPUK 2HLFD 1HS6A 3CDGA 1NUNB 3MLRL 3K5SA 4ABVA 3DRQB 2DLTA 1AGCA 4MMYA 1K8DB 2WBKA 4RX4A 4JY6A 4WCYL 5ANMA 2VKWA 4TOYL 4FXKB 1QNIA 3HN3A 1GRWA 4NCDA 4X9GA 1UXSA 3EOTH 1BJ8A 3V4VL 3WUWG 1F97A 1G5GA 4YXLH 4DGIH 4ZZFA 5I6NA 2XWBB 2MQCA 2A6DB 4HIQA 2RR3A 3PIQB 2BSCA 4XN7A 1IMHC 2EXYD 2LAAA 5DC2A 3T77B 3B7SA 3OR7B 2FGZA 2APVA 4NQDB 2F7OA 4ZO7A 4Z0BH 5F6HI 2WLLA 1HVXA 1RZJH 4K94H 5TFSL 2H45A 3AWFA 4IK7A 1C1EL 1KOAA 5EUOE 4JKNA 2IDTA 2X4QB 4JEGB 5IQMA 3N9GL 5ITBL 3ENEA 3H3BC 1WPCA 2CPCA 4LKCB 4MKTA 3QXVA 1URLA 1S5IL 1TQWA 4PWFA 5F9WB 3MBWB 3GXUB 1CFVH 1JHLH 2FECI 3CH1A 4PJ9D 4QRUA 3W0WB 4YBLB 4KX7A 3OXSA 2Z34A 1X6NA 1PD0A 3OAYH 2EABA 2DYPA 4XBPB 4LHUA 2IAMC 3G6JB 4DKTA 3ARFD 3SB3A 2OMNA 4K7FA 3FT0A 1JTOA 4XMLH 3FFCD 4HXAL 5F96L 1V7NH 4M6ML 2IDFA 1BM3H 4Y4FD 1GCYA 2PW2B 3RNKB 2RACA 3GQFA 3UAJD 1MCKA 4NKQB 1RZ7L 1WAAE 4PW4A 2FVNA 3ISYA 3CDZB 4P2QE 1YY9D 2BNQE 4HWEH 1N5AB 4WWKB 5KUMA 3SE6A 3GMPB 1WWBX 3WGVB 2QR0A 1FAIH 1HHKA 1Y0LA 1XF4A 2WWMD 4ILDA 3K1DA 1UD4A 5GZOC 5D9SA 4RMTA 1GTFA 5E4EC 1OT1A 4HLZH 5CD3A 2QPSA 4G9FD 3AU1B 4UMGA 1KTRL 4UCFA 3OC5A 1K8DA 3HNSL 3IXAA 2GAZA 5ADPH 3SJVA 3CHXA 1IT9H 2LLLA 4L8SA 1HL8A 5ALCL 3SQOH 3IVKA 2BP3A 2Q6WB 4HPHA 3M88A 2GTZA 2EEAA 1HSBA 3I6KA 4ZDHA 5EDSA 2BY3A 3UPRA 2Q2EB 3O4LA 3PL6D 2X89A 3OKOB 4M62L 3BVDB 4M02A 1JERA 2VLRE 2ZXBA 2EC9T 5HDQH 2XLLA 3QZWG 5JHBA 5E6RB 4PLJC 4ZXBB 2Q7NA 2NY7H 3RGVB 2XA8H 3E3QE 1KC5H 3H9SE 4YHOL 5F1IB 2XIIA 1H3TA 3AVEA 4YL9A 1NM4A 4Y4FC 5HYQA 3KGUA 2N59A 4AE1A 4Q89A 4QHLA 3DJSA 4QRRA 2CMRH 3OF6A 2YN3A 7PAZA 1OD7A 1QFWH 2W0FB 2X0VA 5BS0B 4F7CB 1KUMA 4OZHB 43CAB 2OAAA 1IILE 2FEDC 1A8JH 1J0IA 3DX7B 3L13A 4R2GC 1FZOB 3B3BA 2NX5A 3QEQB 3L3KA 2ZWNA 2A83B 3BEVB 3A4FA 2GEEA 2HFGH 4L37B 2LQRA 1N6QL 4L9LB 1EJFA 1MHHB 4A63A 4X5XA 5BUGA 3VTTA 5KSAC 4W9CC 1TKWB 2MSPA 2OCFD 1L7IL 3DUUB 4JM4H 1AS6A 4YBHA 3PFUA 4UQAA 1T80A 2A9AA 2EICA 4HU8A 3EYOA 2CGRL 2IANE 4JHWL 3U0TA 4P8QA 5JHDD 2NT1A 2OSYA 3DUSA 3GJFH 2JKNA 3EG9A 4QRSB 2P5WB 1KJ3L 2LTQC 3MJ8B 3F6IA 1XCQA 4X4ZA 4P48A 2Z8VC 2HXAA 3DTDA 4HCRL 4J4PA 3CQQA 1FIEA 2R2EB 3HC3L 3MRDA 5IMOA 3GUTB 4TRPH 4JPVL 3D0VA 1O9ZA 3O4OB 3SDYH 1PY0A 1E9PA 5B7FA 4GRLC 3X13A 3ZDXF 3KPPB 1A7PH 5B3NA 2VN4A 3IFOB 1I1AD 4YX2L 4BA8A 4UT6L 3RKDC 1P4UA 2WVTA 1J5HA 3HAEH 4HKXA 5IB2A 3T0BA 3CVHH 3ZHLA 5GRZA 3C5ZB 4H26A 1LK3L 3SQBB 1RZPA 2PYED 2JJUA 2YRLA 3HVNA 3RVVD 1DQJB 1F4XH 1M6OA 1UOWA 1ZSHA 3EFOB 4PUBL 4AL8L 4N0YH 3D34A 4UIMB 2ZXCA 1CZ8H 4MX7B 3CZFB 3H1ZA 1KJVA 4JJ5B 5DQDL 5LDUA 2WLMA 2EVHA 4QT5B 1H3VA 25C8L 5DZ9A 1IM3A 3FTZA 3FF7A 3H4HA 1TNNA 2CCVA 3MLUL 4ODXB 4JHVA 1QO3A 1JZDC 4X7SL 4DQAA 5HVHB 1JWMB 1OAQL 3QHFH 2OMZB 3BKCL 4AYEC 4FNTA 3QJOA 1D6EA 4IBYA 4EQ2A 3UBGA 3V0IA 1KPRB 5EUKB 1RUQH 3LZRA 3BP6A 2FNWA 3BPNC 4OF0A 1OY3B 1MCWM 3O41B 5E99L 5FYLE 2EAEA 3D9AL 4K23H 4JO4L 4XR8C 3DBSA 5E1GA 3Q48A 2Y36H 3K6SA 1LNUB 4XMTA 1LQBC 4E9YA 4KROD 1J8RA 3B34A 4KY1H 5IJVB 1IBGH 2Q2LA 3B9KC 3KL3A 3P4NB 2NY3B 1UCBL 2VWEE 1MJ7H 3UDWA 2G3MA 2NY6C 3CDGB 5FX3A 2Z92B 3S34H 4TKWA 1NDGA 3JBG7 1WBZB 3MRIA 3QRGH 3IFLH 4IOFC 2YAEA 3TBVA 2BHYA 3Q2LA 2HKHH 3OAYK 4J3OD 3IF1B 4KRPB 5TH2B 4PLNC 1NWPA 4HQQH 2CDEA 2WWOA 3IFNL 4K8RL 3PABA 3EF4A 3NGBC 1FFPB 3JWOC 3EGDB 3PPEA 3FO9A 5D5MF 2HT3C 3WNOA 4F2ME 1N68A 4O9HH 5I19H 5K1VA 4JRWA 1WWCA 2FTAA 5AOMA 4ZFOB 1CVSC 2ENYA 1UJ3A 3GIVB 4OLZL 4YGAB 3GBNL 3RVTC 2DQIH 1Q9OA 3T1WA 3MRCB 2AZUA 2LR4A 3GTVA 3Q1EA 3QGVA 3HNSH 4ZYKA 4LF3A 1N59A 2YPKA 2J6EH 1K4DB 4MFHA 3HAEA 1FYTA 1OAKH 3WHXB 3WAKA 2FHFA 3VX0A 1NGPL 2D7TH 4HS8L 3LS5L 2RQ8A 4F58L 4OGYH 4KO5A 4N9GA 2DMHA 2ADGB 2XWEA 2B1HH 4HEPG 4KKCD 3L9BA 5DJDB 3QNYA 3FSAA 1XGRA 5E6SB 1IRAY 4ADGA 2EVJA 5BPPA 4JUTA 4AK1A 3OVUB 1KBWA 4X4YB 2XKNA 5F71A 4Z76A 2IDCA 2R1XA 1NFAA 3GXNA 1ZCRA 3SD2A 1YEKH 3APFA 2VDKL 5FM5O 3TT1L 3N5AA 4NN5C 4CBZA 4D9LH 2BFGA 2ICWJ 2HP4A 5LBSH 1XGYH 3HIZA 5BRQA 2ESVA 4OCRL 1LQSR 1MJJB 4H25B 2V9UA 3HMXL 4IHBA 1TVBA 2IPTH 4YVNA 5AUMA 1FNSH 1U8MA 1KGUA 4PJXF 3SDXB 5HHQB 5IM7A 2VT0A 2CR6A 2UWEB 5D2LE 1CJYA 5T1MB 4I85A 1PFOA 3WUWA 4F58H 5JNYA 5CD3B 2BOCA 1FRGH 2UZXA 4QRFA 5C0RH 2OMUB 2XQBL 3DX1A 3O3DA 2V9QA 4NXKA 4OFPA 4DGUA 3EBIA 3EADA 5E2VH 4LNVA 3KBEA 4NX0A 2DF3A 1RULL 2V37A 4LB8A 5F7AA 2WCSA 5F1NA 4AQ1C 1C12B 4Q4IA 3I6KB 1YNTB 2FIRT 1X5LA 4JB9H 1A7QH 1LE5A 1R3KA 3U1SL 5C2BH 1SEQL 2QSCH 1E9OB 4KXCA 5LCVA 1QRNE 3A47A 4NOFA 2OM5A 2XVGA 3T0AA 5C6TL 3AZUA 2F54E 3E9TA 4NQQA 2E7CA 2A9CA 4MASA 5C3TA 2R1YA 4G7YH 5DXWA 2OL3L 2CUIA 5LN4A 3LKQA 4OIAA 1PG7X 5C0FA 4BFIA 4BFRA 4AQ8C 1JRHL 3TA4D 3EGXB 3WLBB 4FA8A 3QIBA 1MN4A 1CE6B 1F90L 1UT1A 1FZMB 4XMKL 1QEWB 4NS0A 1YN6B 2C9VA 3ALPA 4WUUB 4YHMH 3V5HB 2YAHA 3IAGC 2A38A 2WIIA 1H8SA 1U95A 1IGJB 4BM7A 3HRPA 3HLAA 5F9JA 1ADQL 2BS71 4WVRA 1IJ9A 2XBZA 1AG6A 3LVEA 2Z31A 1S3KL 2I85A 4GRMB 3VXOA 1EO8H 5D1XC 1BA9A 4AW7A 1XGPA 4KK5D 4LQFH 2OR7A 3QNXA 3L08A 1M1XA 4XWOC 5ITFA 1MREH 4X80L 3WFEL 1NJ9A 1IE5A 2IGTA 4PBXA 3BOVA 5I75B 5GGRB 2R4RH 1PKQE 1AZRA 4KKAD 3GSWA 5TGBA 3CZEA 3NFPA 1FFRA 3HZVB 3KDMB 5CF3A 1RXLA 3D1MC 1WIOA 1CVRA 1RIUH 2FX9H 3T0ED 3NJMA 4JO5A 4B9IA 3UTTB 1IEAA 1SJHB 2W0LA 3QG7H 5BO1L 3W57A 3LNEA 4YWGH 1WD8A 1RZQA 1DANU 3TIEB 2CQVA 4BZ2A 4TOYH 3SPJA 5DD0L 1CZ8L 3IPBA 2F0CA 2RCSH 2WJ5A 4FGMA 4PJHF 5LGYA 2C3VB 4DFHA 3DKHA 3QZLA 3BKJL 4AVJA 2R15A 1B0RB 2GVYA 2IFFL 4ELKB 1A9BB 1DJHA 3IXTA 3WIFB 1KXVC 4OLXL 4H26B 5AAWC 1FC2D 4GRWH 3TBYB 5HGAA 1DHKA 1Z32X 3K71B 1W16A 3EFOA 1NLBL 4GFTB 4BRJA 1T7VA 3LNGA 3IDJB 4GH7B 4O02L 1KJ2B 3OB8A 4HH9B 3ZT5A 3SY0A 2AEPH 4M7ZB 1WWAX 4XP9H 2YGOA 3S36L 3OHXB 3ZDWA 1MHEA 4UT9A 3ZOAA 3LS4L 5HI3C 2P9RA 2DQTH 4P2OC 1VFBB 3AUWB 1LEKB 5C8JA 4P2OD 2OCCB 2WIMA 1F8TL 1MWAA 3HI5H 5D8JH 1BPLB 3WDJA 3VDBA 3G6AB 1TZ8A 1NA8A 1T5XA 3D3VA 2EYRB 2Y3AA 1CXHA 3WSQL 3IK2A 5CCHE 2EYSA 2O72A 3AMKA 5EOCJ 1BZ7A 1F00I 1M05A 5FA4B 2E0PA 4LLQA 2I24N 4GT7A 2L8AA 3QZWB 3SDCC 5IMKB 4FFYL 3A4EA 1NZRA 4OD3H 5GRVL 5ID1B 4J1UB 4ZUTA 2HN7B 1MI5A 4OQ1A 5AB2A 1IAOB 2WZAA 4JO3H 3F6JA 1HCFX 3NZ8B 1XAKA 4AITA 1QLFB 1QPKA 2E8YA 1EHLH 5IY5B 1J48A 4J23A 3TA3B 2OTUA 4HXBL 1CGSL 1JRHI 2LU7A 4HZLA 4Z7WF 1N67A 2XZQL 3EOBB 5C86A 1QOKA 5H37A 4BZ1L 1HAUA 4NLAA 2LTQB 1WA1X 4Y1AA 3UCRA 5HBBA 1A6ZB 5IMMB 3RU8L 1OAZH 4CN4A 4QY8A 1GZQA 2E56A 5DVKA 4KKNA 5C09A 1I3RA 1IKNC 3TH3T 4UTBL 2Z7WA 4Q0XL 2F58H 1XTMA 1T04A 2VXVL 3H55A 3QBTB 4P49A 4WTWA 1TVDA 3FUFA 1MNUH 4X6BA 2OSLB 4TLKA 2C3VA 1AXSB 1MJUL 4KK6D 1A8ZA 4AQAA 4JQVA 3EYUL 3PL6A 3ARDC 4ISVA 5ALBL 2TRYA 4FHKA 1MCIA 3CU1A 5CMAB 3REWA 4M48L 4P2CG 2DTMH 2YEVB 4FF9A 4OSUL 4KX8A 1I9IL 3VWKB 4AQ8A 3OKDA 4ENED 1JN6A 5KYYA 2GK2A 1ZAGA 4UI2A 5I1IH 2L3BA 5CUSH 3VAEA 1T66D 3VFRB 2OW6A 3CMGA 1RP9A 5EO0A 1XIWC 4XTRC 5HD8D 3U2JA 3NFNB 1ZEAH 3I6GB 1PCXA 3QEQD 3FFDB 4B0MB 4E68A 5GXBB 5IHUH 1P84K 5DQJA 4NN5B 2NTFB 4U6HA 5KYUB 2ADYA 3IFPA 4ZUVB 5HHNB 4C83B 5EWIL 1DDTA 3V5DA 5EIQA 3SKOA 4EDWL 4Z7WB 4DP2X 3VH8G 3NDYE 3AXLB 1S7TA 1NGPH 2RTTA 3R4DA 5JIMA 4LMQI 1P7QD 3R7RA 2DKUA 4G43B 2XFXA 1T0MA 4O2CA 2TAAA 3K81A 4P3DA 1KBGH 4MAYD 1V7MH 5JPNC 1X5FA 3A4AA 3T1FA 5K59E 1AKPA 2K4WA 5J13B 3DIFA 2J72A 3VXRE 3PV7A 4YHML 4RFEB 5EO1A 1EZSA 4PJAF 1NDMA 3EOTL 4EUPB 1TVBB 3G5VB 5AUMB 4Y19B 4J3XA 1OCWH 1S7UB 3SCMD 2A6KA 4AM0A 2W0PA 2KQNA 4ETQB 3O9WC 2E6JA 1JWSB 2IALA 3NOIA 2ZAIA 5GQBA 2KLTA 3MRGA 4PJDE 3GSQB 5KJRH 4DCQA 3PE9A 3GBML 1MFCH 2OV0A 1R5IA 5BNXD 3ZN6A 3FU3A 1DSWA 2VH5H 4D3CH 1LE5B 3IU4L 4WKZB 1WAAA 2J88L 5TPWH 4KVCH 5K9JH 4GAFB 4A7GF 4H5SB 2IQAA 2P5WA 4X6BB 4MNHA 3U82B 4YDMA 1B6UA 4PB0H 3V4UH 4V1DD 4OFYA 1PY9A 1ZVNA 1U8KA 3W3BA 3L81A 2ORBH 4YHOH 3VXUD 1PZ5A 1U8LB 3GKWL 3JVGA 1TTFA 4U6VH 3V0WH 3CXHK 1XHHA 4ELMF 5I1JH 2LLNA 4DNLA 2WXLA 4Y7MA 4Q74A 4GP8B 4YO0B 4W9GC 2P5WE 3GZPA 3QO1A 3V4PH 1XQ4A 2YZ8A 2B77A 5GGTL 1MXGA 3STZB 1BX2B 3PL6C 3VI3E 2QBWA 1KCBA 1KXVA 3FO2A 4KJPC 2AK4E 4HWEL 4PJ7E 4YJZL 1WZ1L 1M42A 3I3BA 2MWCA 4XPGH 5HHNA 3LN5A 3AROA 4QNPE 5B8CC 4MX7A 5D71L 1S7TB 3NZSA 2R1WB 1LLAA 2PUQT 4JVWA 4HUKB 1BEXA 1L5GA 5KVEE 3F7YB 4Y7OC 1IGIH 3U0WL 2X4NA 4LVHB 3F7RA 3F05A 3OGCA 4LARL 4NQCD 1DJGA 4OKDA 2OI9C 2VUYA 4PCTA 1IGMH 1JHKH 5E9DE 3TIDB 1GGUA 4MB3A 4WI2A 1YN7A 3DIFB 3MZGB 2O6PA 2AQNA 3DX3A 3NUKA 4RFEA 1N2RA 1XF1A 4GKNA 4AJWA 2YARA 5B3JF 5INDB 1QTYT 1N3NB 4RWHA 1A3RH 3F5WA 4MNGE 4PLKC 4IJTA 3SGEI 1HYSC 1IFGA 4YHZL 2P5EE 1QSVA 3C5ZC 3MLVL 5DR5H 2ZSVA 1L9PA 2DWXA 3HZYB 2D8KA 3AWGA 4PU2A 4PJFA 3VG9C 2VLRB 3EJPA 3L3GA 4MDIB 1N10A 1VADA 4C56E 2P47B 2FD6L 4E41D 1NFDA 4ZUWA 4LARH 4HUXA 3I2CH 2LU5A 3BN3B 2GJJA 1JV2B 2WTRB 4DN4H 2HLAB 3MNMA 4CW1B 1NAKH 3WELA 3R1GL 4PWJA 5F1SA 2ILLA 2VAAA 2ARJA 3MUHL 5I6PA 2ENQA 1KB5B 5J11C 2CLVB 3UZVB 1KGYE 1XMEB 4XC3L 1FPTL 2Q86B 4AV4A 4ZS6D 1SYSA 5HHOB 1L9SA 1A6UH 4AZ8B 1AHKA 3WN5B 2VDPL 3CZSA 3CZNA 4JZJA 2ZUQC 2CDFA 1LE9A 4LRIC 1ECZA 1EV2E 1MFMA 2GSIB 2YUVA 5FO7A 3C8HA 2VDLB 3HE7D 3QO1B 3QPQC 1MJUH 3ARSA 2FLBT 3ILEA 4FE9A 3ZKXC 4BQ6A 3TEZA 5FA3B 5F7NC 1MFEH 2KHAA 4LPTA 4JFWA 4MCYB 4P5TD 4FFZL 3MBXL 43C9B 2Z8RA 2V3DA 2XVBA 1IVTA 2XBTA 3RVVC 3QWOA 4JVPA 1G7QA 3QIWB 5GGVL 4FJZA 1DQVA 2YPVL 5IB4A 1FL5B 1U8OB 5GPRA 6PAZA 2P52A 3HUJA 2WLZA 1JXDA 1J1OH 3MR9B 3U7WH 5IBUG 2YQ3A 4X7TB 2MKWA 4LCUA 5HHMB 5JDSB 2IBZX 4GXVH 3RAJH 2EIBA 3L3IB 4OM1L 5E6ID 4RDBA 2EO7A 2FSEB 4NFBA 4C8XA 3C8KB 4X4YA 4Z76B 2DS4A 1IC4H 5FECB 1IFRA 1OSEA 4EKJA 3ZE2F 2Z8WC 2ADJA 1T6BX 1GJIA 3TCTA 1CK0H 4NGHH 2X3CA 4OGZA 4A6YL 3BVNA 1OLZA 4PJ8A 2Z31C 3PYCA 1B2YA 1QBLL 2VLJE 2BSRA 4P0DA 2H2PC 5EC1B 4NAMA 5IVZB 1T5WB 2YHGA 3P69A 2FJGA 1GYUA 5HGDA 3BUTA 3A6OA 2YC1B 3P0YH 5EN3A 3GPEA 4Q8BA 5HHOE 1NBYB 3UAJA 2WTRA 4OZHE 2GAZB 3B8SA 4HXAH 5F96H 4P06A 4UWQB 3DV6B 1U2YA 2GTZB 3L1OH 4JKMA 4PGJA 2CLVA 1DVQA 2VM3A 3ZUCA 3P02A 3UPRB 4Z7OE 1NMCB 3KLDA 3IETB 5CEZE 4C4UA 5DQJB 5GS2D 4J3BA 2LHAA 1JPTL 3QJXA 2CAKA 4ZUVA 2F74A 2IAAC 5KBPA 4G6AC 3EDEA 2BS9A 3C9NB 3HHSB 3K4AA 4KKQA 4M5YH 1OOAA 4NJ9L 1S7WB 3FN0H 3PP3K 3OLGA 2PPAA 3GHBH 2P3YA 3ULSB 4C4KO 4JM2B 3T6WA 1TZAA 5FA3A 4G43A 1CWVA 1PYWA 4LOUD 4YC2B 2WINB 3HC3H 2I7OA 2X6MA 1PLGL 1KN4L 1P69B 1UFUA 4LSSH 1NBVL 3DK2A 4WTZA 1KWGA 2W65B 2O30A 4I0KA 3H4FA 4K5MA 4OUOA 5FV1L 4Y4KC 3DOHA 4F7CA 2OMXA 1T1YA 1RZ8B 2Z1KA 5GHWL 4K3EL 5E08H 3OJVC 1L9MA 3DIDA 4MA3A 1QFUH 1QBAA 3FN3A 4IDJH 5EORH 3AXHA 2I60L 3SPGA 3OMAB 3ULUH 4Y5VC 1OLLA 4CU8A 4OFIA 3PGCB 4PREB 3D18A 4X9FA 5I1EL 1QP1A 1F13A 5FWQA 1EPFA 3LQAH 3MJ6A 2JXMA 3HG1D 1EFXA 1ZLUK 5CSZA 1KPUA 1P7KA 1NDTA 3BXNA 3S8FB 1ACXA 1X7TA 4NDMB 5B1JA 25C8H 3I84A 4LDEB 4LSRL 3RJOA 4ZW8A 4B9GA 3AABA 1EA9C 2YPVA 3LEVL 3ALWA 3DXAE 3MRDB 4TVPL 3GUTA 5JOFB 1IGCH 1HN1A 1TQCC 3UX9B 2J8UE 2NDFA 1XSOA 3ZUNC 3QUHA 3HMWH 3KPPA 2DJSA 3ELAT 2DQEL 1KBVA 3IFOA 3VCLA 4HKXB 4RGOH 2V7HB 2MPAL 2BZ7A 3VD5A 4ZQTA 3VXMD 4H20H 2PO6A 2QQNL 2X88A 3FO2B 1OE3A 2H3NB 5FYJH 3WBDA 4RLDA 5CZXD 4YZFF 3VI4B 1YNKH 5IG7B 1U30A 5LGHH 5FXCH 2OTWA 5F3HB 2Y1YA 2JSFA 5DGRA 2WMPB 3C9NA 3ULAB 1KJ3H 3RUGA 4DKDC 2HG0A 5BVPL 3WIHH 3OKKB 1IGCL 4TSCH 2H1XA 3QAQA 1C5CH 1OGAD 2AF2A 3Q2VA 4CVZA 4DT2A 3KH3A 3EBHA 4JZJC 4XVUD 2Q7YB 5TE6H 4YSQA 4W4OC 4GQ9H 4CC0A 1QO3B 1MWAB 3H8NA 1BQLH 2D7PA 2XG5B 2HZHA 3PWVB 3TTYA 3G6AA 1E6JL 1QYGL 2OMXB 1GCFA 3AG4B 5E9AA 1RZ8A 4GW1A 3B9KA 4JFSA 1OGAB 3STLB 4PVBA 2D9CA 4KI5E 2YEZA 2KPWA 3SYPA 1RD6A 1W0YT 5EC2B 1GVIA 2AC0A 1OEZW 1A22B 2AITA 4DK6A 4ZNEE 3REVB 4OUUA 3LRKA 3TZVD 4Q14A 4U1NA 3L9YA 4JRYD 5IJKC 4JFPA 3RGHA 3EH3B 2XKUA 1UGKA 3CXHJ 1D6VL 2FHCA 3F01A 1VB9A 2NSQA 4WHCA 2VUOA 3HS8A 4GFXA 4UTBH 5B39A 5DK0B 1LYQA 4XC1L 4YGVB 2PWHA 3VQ2C 2WXMA 1G6RL 3U7AA 3CHSA 3DHUA 5FF6B 4FQ1H 4KTYA 4JO1L 1AQHA 2IOMA 3OMIB 4DZBA 1R34A 4EUPG 3EH1A 2VXTL 1EEUA 4XNYL 5K93A 4JFDB 5IHZB 3KPRB 5IMOB 3R18A 3UBXA 3L4TA 1R24A 1P5UB 1UM6L 3QARA 1KIQA 4OCMC 3CFDB 1TG8A 1UURA 5E2TL 1LHZA 1UJ3B 3GIVA 4NQDA 1U91B 1ZWIA 2EIJB 1K3IA 3EYFB 5F9OL 1T2JA 1EAOA 4MMZB 3TL5A 3OAZK 1A6VH 2CO2A 3BP4B 2P49B 2FWOB 1NC2D 1A7NL 4MS8D 5ADOH 1U2HA 5FIEA 2V3EA 2JIXB 5MEPB 2EE9A 2AAVA 1BBDH 2IMMA 1RK1A 3MGAA 1NCGA 3EO9L 2UYLA 4S10A 3WTWA 1EAPB 4PS7A 5D7LA 5EU6D 1IM3B 3RA7L 1XO8A 3X3GL 1XWVA 3L3IA 1IC1A 4BZ2L 3JVFC 3D48R 3P2TA 3WDHA 4KKCC 3JWOL 2L7UA 4PJGB 1FO0H 1NAMH 2XZAH 1BG1A 3CFCH 2EE6A 3KAAA 4JL2A 5ADOL 1X5GA 3O6LL 3MUZ1 3U2IA 3KPSA 1CE1H 5CGTA 1FFNB 4LMQE 1YEWA 4FA6A 5C70A 2JKLA 1TQBC 5TE6L 1B2WH 1OSZB 2PYEE 3B3IA 3NJGA 3VRIA 4PJHB 1W8NA 3KVPA 1KB5L 2G60H 2Y7QB 1U8MB 3QR1A 4HZAA 5IM7B 1NMCC 5HHQA 1CT8B 5GGUB 3W0WE 2ZF9A 2XC8A 1T2QH 3ZL1A 5E8OB 4P5TB 1PZDA 2ATKA 3I50L 4JPWL 2NW2B 1NBYA 3EBGA 4JVUA 2BY1A 3DRTB 4K5LA 4W93A 3OLDA 5I30H 3OF6D 5MEOA 3IXAB 1JGUH 3SJVB 4N90D 3VXRB 5IJDC 4JM2C 2K9UA 3ZTEA 3F04A 3SIKA 5DC0A 3IGAB 4ODSL 1L3NA 4U2YA 2N0MA 2XA3A 2D3VA 4DGVH 4JDTL 4HP5A 3W2DH 5ECJE 3U4BH 1UWXH 1YMHA 4IOIB 3WOVA 4AYFA 2F1AA 1KCRL 4Y2NA 2IQAB 3LQAC 2R4RL 2FATL 2UUDK 4JUSA 2XY1A 2XACC 1S78C 3AT0A 3VDCA 1U91A 3ARDD 1IUZA 4FLOA 3ZDZB 5F3BA 4N0UB 3MTXA 2DQHH 1PAZA 4NZDA 1CDJA 2XICA 1Q9OB 3BH9B 3QUML 5IBTL 1HHJB 4BXVA 2WINA 4L1LA 5B21A 2ZUUA 4EBQL 1EK3A 1QA9B 2P5ED 4ZPTA 4RWYH 5ILTH 3O2VL 1DL7H 4IS6B 4X42A 5IFHL 4Q9RH 1RK1B 5ERWB 4PJGE 4P2RB 4Z3TA 4O9HL 5K9OB 4Q58C 2KC0A 5BS0A 4DKEH 5HHMD 3NIFE 3KMDA 2VRQA 1SDDB 4G6ML 4A6YB 4FG2A 3FT1A 3D4CA 1F42A 2CGRH 4Z7UB 3GIZL 1CLOL 2ADFH 1XGQA 1KFGA 3AXIA 2JKSA 4HUWA 2VDNH 3FQXA 1HINL 3QNXB 3QQ9C 4X5XB 1F4WL 4PJGA 1QFUL 4UDTB 5SWZE 1A4KB 1SYVB 2OMTB 1WTLA 3IJEA 1BV8A 4CU7A 1QSFD 5AW3B 3EO9H 3QDJE 2BP8B 2V9RA 2H47C 4WHTA 1HL4A 1FGVL 3QJRB 4JQIH 5ABDE 1GAFL 3SD5A 4PJHA 4JO4H 3ARGB 4JN1H 1GSKA 3B6SB 1FHGA 2F7RA 3VFVB 3C6SA 1T0OA 3CFCL 2WBWB 3DVNB 5FYJD 2MPVA 3DURA 3TEXA 3CVCA 2YJLA 3CU7A 5BS0E 2OPCA 4A67A 2VLRA 3U1QA 2OJEB 1D5ZB 1XGYL 3QORB 4TSBL 2VR8A 4ELKA 1GJUA 4QWWC 1QSFA 3HMXH 4DKEL 3DBXB 4BKLA 2GC4C 2FBJH 3IU3B 4CW1A 1M6OB 1P4BH 4WTZG 1QASA 3NCWA 1HCYA 3NG5A 2VR5A 3KLAA 1KTDB 5JXAL 1G4RA 3F6LA 2XQYA 5HHVH 4HVBA 1IE4A 4U1JA 1B3JA 2EJ1A 1BZDA 3KYNA 5DHEA 1O7DE 1F4XL 1OALA 3IDMA 4PRBB 3VYOA 1UUSA 1S78D 3BHBB 4WW2F 5IFJB 2BIQA 5GJTL 4XMLL 2RMNA 1OCOB 4X7DC 3U1SH 4ZPTB 5C2BL 1JHKL 3CDYA 1UWEL 4K55A 5IGXL 4GIOA 5BZXA 1GY1A 2XZCL 2Y7MA 2BVPA 2A9NL 1MFAL 2R69L 4PB9L 3RL2A 5KS9E 2J1YA 5JR1L 2D31B 2O26U 2CKBA 4Y19D 4XCFL 4HKBB 4HOWA 5F7HA 3MRJA 5D7LE 1M7UA 3ABKB 4N8CL 1O7DC 4P5RA 5AAWA 4DUXA 4J3OH 2NT0A 1E5AA 3UJJL 2VXSL 3OLEA 3FQXB 4PP1D 2AK1L 2YFNA 1ZT7B 4B41A 4PW3A 3EXJA 4AE0A 4DGYH 3NZ8A 3WXWL 3ZHDA 2FQGA 3E1F1 1HKLH 1BLIA 4KGJA 4XB8A 1M7XA 1MVYA 3IYLW 1A47A 2DB8A 3D8MA 3Q5TA 1KYOJ 4QRRD 1ETB1 5CN1A 3ARGC 2Y2TA 3ZL4H 3AY4C 2NY4C 5J12B 2JQMA 1CYGA 4G6KH 1NMBL 3IF1A 2AABH 4UQCA 1H6EA 2A6IB 3RB5A 3BRGC 4PRIE 5FHBL 4XO5A 1UZ8A 2HJFA 1UVQA 2F08A 3BAYA 3RU8H 1FFPA 3DURB 3NCXA 2QKIA 3BZEA 5I8OH 2BHZA 1MY7A 5IVZA 4KNTA 4RAVA 3VRLE 1ZD6A 3VWKD 4JFZH 4HS8H 3T2PA 4H8WH 4JY5L 1QUNA 4MXQD 4M6OL 4F7TB 3P4MB 1A6AA 4H40A 1A9BA 5DC9B 4E9XA 4BH7B 1W72H 4MWFA 1ZTXH 1GA2A 2IJ0C 3Q6GL 4U1LB 3GMQB 3RX5A 4WI7A 1W8EA 5EUOB 3PP4H 4FXKA 4LSTL 5FUOH 1KZQA 1T1ZB 4I3RL 4P2YA 4G8GB 4CC4A 5J57B 2PPFA 5AWNH 1MCBA 1D5IH 4YIQB 4XNDA 4U0RC 4U1JB 3HE7B 2G2NA 3BDXA 5E8NA 4IU2A 3EHBB 5E0FA 2NYZA 4KMQA 5E4EB 1NKGA 4U2ZA 4U3SB 4I7ZC 4JQIA 1BBDL 1GSMA 2QSQA 3S4SG 5H4YA 2A77H 4NEHB 5IVNA 2WLLB 2FJHB 4AJYV 1S7WA 1QFOA 1AQKL 2J8HA 3ROOA 3TVMD 2NXYB 3KXFE 4ZJ9A 4O02H 2XFXB 2R1XB 4KTEL 4XX1E 1KB9K 4APXB 1JTPA 2LU4A 5D70L 1L7TH 2GJZB 2ZICA 2RAMA 4WW1B 4TNEA 4I9WD 4UQEA 2DWEB 1YSOA 4FMFA 3ATDA 3A67H 3VU1A 3MV9E 4ELMA 4IBWA 1TJIH 3GTTA 3MQIA 3TPUB 4TULL 4EOWL 4A37A 1OGTA 4PLKD 4H25A 4MCNA 5A2BA 1KPVB 1YEJL 2BRQA 2K70A 4NAQA 4MA3B 2EKJA 4F8TA 1ACYH 5FYKD 3SDYL 4UT7L 4JS7A 1S7QB 4YSCA 2NW2A 3N50A 1UUNA 3OJ2C 1G0YR 4R0LB 1S9YB 5KS9B 4JO1H 1WAAF 5HYFA 4V33A 2JXMB 3B2PA 5D2NC 2R56H 3BKCH 4WWKC 2DQ6A 5HGHB 2VO8A 1QLEH 4X6DE 1R0AL 3ARWA 3W81A 1X5XA 4FHJA 1JAEA 2COQA 3LNHA 4KO6A 4XN1A 3WEBA 4HISA 4KK8D 3KJ6H 4RZCA 1JS4A 1Y1DA 4IEFA 4BWUA 4RAVB 2RHEA 4JHAL 1JGEA 4YDVA 2H6PA 4AQAB 3QJTB 1NL0L 1PTZA 1G4MA 2Q7AA 3EJUA 3P40A 4Z7QE 2IWFA 1JJUA 2PTUA 2Q9OA 3SKNA 5H37G 1HHJA 4L29B 4A7GA 5JHLA 1EFQA 4PS8A 1QA9A 1HILB 1RFDL 4Y4KA 2NY6D 4L8SB 4DK3A 3FRPA 3BKMH 4ICXA 4MBOA 2B3RA 1P1VA 1BX2A 4P5TC 2QMJA 5K9OA 2OBGA 2G4GA 2WIIB 1KLFA 5I15H 3G7TA 2H8PA 1INDL 2MCPH 3ILQC 5C0GA 5IUSA 4N2LA 1XGQB 3NIDF 3FTXA 4TF4A 3PQYB 3GM0A 5I24A 1S9XB 2DTML 1Z5HA 3FTGB 2R1WA 4GT0A 4UTCA 1UD5A 2NUTB 3ROOB 4E9TA 4J6IA 4KJWD 2E7DA 3NJHA 5BO1H 4QGTA 1SYVA 4KJWC 1KYAA 4Z95H 3UYRL 3TO2A 1TQUA 3TT1H 4HC1A 1U8JB 3QA3A 4QO1A 4ACPA 1F4WH 1LMIA 4OLYH 4XVJH 1Q1PA 2V7NB 5FUZH 3QQNA 1G9MC 2A6JA 5CO1A 2VDNL 4A2MA 3K6NA 5I1AB 4WSGA 5IFAL 3C6SB 3D87B 5E70A 4DUVA 2EXTA 4N2KA 5K39A 3FFOA 3H9SB 2WLHA 2A5UA 1YYML 3GSNH 2WP3T 3APNA 5CBAA 4L9LA 3C5JA 3MJ7A 4XCNB 2IALB 3VG9B 2Y06H 3SOBH 1NCNA 3ROLA 4AMWA 1R5VA 1T0PB 3GSXA 3UC0L 4DIXA 1Q72L 3PP3H 3IDYB 5J1SC 5EEXA 3ZYZA 1J1XH 4U3HA 3BAWA 4FLHA 4A2HA 1KBKA 1T1XA 1R5IB 1BBJB 3QK0A 4HK0B 3KNBB 4HWNA 2EUWA 4Q9QL 2VDKH 3ULUF 4CU6A 1CB4A 2KDYA 3A0OA 3L5XH 4M9OA 4HC1H 3QDMB 4GP5B 4B50A 2HTLC 2YPLD 4TLTA 4Y2DB 4HJJH 4I77L 5TQ0H 4I2XB 4CILA 3Q0HA 1V7NL 1PCSA 3BUYB 2BCKA 4BQ9A 2A6DA 3H9HA 1YEHH 3JV0A 1CURA 3T0EB 3B9AA 4LLAA 3O6KL 4L8CB 1LE9B 1YMME 3VXSD 2Z35B 3DPBA 4X4XB 4F8PA 2VDMB 3AREA 1WGOA 2DIEA 5GSVB 1DL7L 2DLGA 3TF7C 4KUZH 4JFZL 1MZZA 2Y7LA 3NH7L 2AEWA 4F5CE 3T4AA 1F3JA 2MRYA 1KIRB 5FYJE 3S36X 5I9QC 1TTUA 4URKA 2JIXA 3PUUA 3A6CL 4PJ5B 1WIUA 1MJ7L 5J0BA 1DBKL 1M7DA 3FTGA 1BZQK 5BZWA 3LN4B 4OI8A 2NY0D 3O8XC 1R47A 4PFEA 5DDHA 1NPJA 3QUYA 1I8AA 3QEHB 4QRAA 4MAUL 1W0VA 3ARRA 2R2CA 4KDTA 4RGMB 4UM8A 3Q8AA 3MJWA 5EBWB 4JJHA 5EMYA 4G8IA 3L5WA 4KUCF 3SJVD 1BGXL 2Y5QA 3EOBA 1YEIL 3BZFB 3QXAB 5JUEH 2VDLH 3P73B 4N2EA 1P1ZB 4MA8L 4CC1A 3WL9A 4NWUH 2CJ3A 3QJHA 3TM6A 3ATAA 2VXSH 1N2RB 1CR9L 3EYSL 1TZGL 4NWTL 1OPOA 2VE6B 4LVOB 2V2TB 3C75A 1DEEA 5AW6B 3GMPA 1CFBA 1TETL 3QUXD 4WCYH 1E2VA 1T04B 3AS3A 3CC5B 4DWHA 2FYYB 2Z31D 5HYJD 4GI8A 3ROLB 3ECBB 4J3TA 1R5VB 5LWYH 2E7LC 4WW2C 3ZQWA 5HYSA 4EI5C 5IJVA 1BMGA 4MAUH 5HYJE 4WLCA 4YHPB 4H1LG 5I26A 4NO3B 5F8QC 3ULUE 1NFDB 2E3VA 1S3RA 2YLKA 4MWFB 4JN2A 5AKTA 2VR7A 2QVFB 5KG9B 4YFLI 5D1QC 1EBAA 3L3OC 3UBHA 4E5XB 5IKCA 3FQTB 3OPZL 2JJTA 2PCXA 5HGGS 3CFBA 3MO1A 5KVEH 1UEYA 4Z7NE 5TH2A 3IE9A 3EJYC 1I1FB 2BCKB 3HE7A 3MFFA 4M1CC 1COBA 2A0LC 1VFAA 4KU1A 5B38B 4RDQF 1BFTA 3WYRA 3OR7A 4Z7NF 1SDAB 1I9RH 2BSSB 1M9WA 3ML8A 1I3GL 1ZLSL 3IT8D 1K8IB 1KYUA 1PYWB 4ZMYA 2NY3D 4XP1H 2Q10A 1JFQH 1MF2L 2EIEA 2YPLA 4AQ1B 5CEZH