3WTUA

Crystal structure of the complex comprised of ets1 (v170a), runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITADGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 18
structure length 118
sequence length 118
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3wtuA00
4AGPA 4LO9A 4MZRA 3TS8A 2ATAA 3Q06A 3ZMEA 4HJEA 4GUOA 1T4WA 2WGXA 3IGKA 3WTXA 3KMDA 2XWCA 1CMOA 2J6WA 1E50A 2J1XA 1H9DA 2AHIA 2MEJB 4L18A 3WTUA 3WU1A 3D0AA 5ABAA 3VD0A 2J21A 4AGLA 3D09A 5AOMA 5G4NA 1GZHC 3D06A 1GZHA 1LJMA 2BINA 5AOJA 2X0UA 5G4OA 4MZIA 3Q01A 4AGNA 1HJBC 4IBSA 4IBVA 1TUPA 4LOFA 2PCXA 5AOKA 4XR8C 2BIOA 2IOIA 2BIMA 3EXJA 3US1A 4KVPA 2J1WA 5AB9A 4G83A 1CO1A 2ADYA 4LOEA 4IBWA 5AOIA 2YBGA 2OCJA 3US0A 5A7BA 1KZYA 3VD2A 4A63A 2X0WA 5KBDA 1IO4C 5AOLA 2AC0A 4AGQA 2J20A 4GUQA 3QYMA 2H1LM 1EAQA 3IGLA 4IBZA 4AGMA 2FEJA 5LAPA 4L0YA 5ECGA 2RMNA 4IJTA 2BIPA 5BUAA 2VUKA 2XWRA 3EXLA 1UOLA 4IBTA 1HU8A 2BIQA 2GEQA 2J1ZA 4G82A 3D05A 2J1YA 1TSRA 4IBYA 4IBQA 1EANA 3WTYA 3WTSA 3WTWA 3KZ8A 3Q05A 4IBUA 5LGYA 1EAOA 3VD1A 5G4MA 3WTVA 2IOOA 3D08A 4QO1B 1YCSA 1HJCA 3QYNA 4L0ZA 2P52A 2X0VA 3D07A 2IOMA 3WTTA 4AGOA
chains in the Genus database with same CATH superfamily
2HG5A 4K23L 1FHGA 1ROWA 3CX2A 4JPVH 2C5DC 1NPJA 1HQRA 4ZK8A 4V1DB 4F3FA 3QC6X 3O41B 1N68A 3GJFB 4HPOL 4WU5A 1HE7A 3BLBA 1SXCA 5F7WC 1PG7X 2HWZL 4K9JA 2BERA 1CGXA 2HX8A 3MV9E 2H1XA 1FLRH 4XE5B 5H35B 1SY6L 1MELA 4WTXA 4HT1H 2ZX5A 1M1SA 2BSCA 1KXVC 3H6JA 1HH6A 4UBDD 1RJCA 4LLUB 2OYPA 2BRQA 3NABH 4ZAKD 2GB2A 3JWNG 5EPMA 2BCKA 3BOVA 3OR7B 1U0QA 4NO0D 1YEDA 3MLUL 3VE0B 1EWHA 1U8IB 1QNIA 1O6TA 3NG5A 1EO7A 1WZMA 2DEWX 4UNUA 4L9DA 5FYKD 4AEHH 1GZHC 1NPUA 1WVZA 4XMKL 1N6VA 2GTQA 1SEQH 3DNKA 2B7DT 1MFBL 2PYEE 2WJ5A 5EFIA 5I8OH 1AYRA 3L7EA 5GRUH 1MW1A 4PY7A 4WGWB 5CZXD 1BM3L 4TNWK 3FQNA 2VQUA 4OW6A 4UAHA 3P02A 4PWKA 1G9NC 2WCSA 3ZKQD 4L1TA 1QX1A 1KBWA 3L2MA 3UJIL 1XZWA 1MCHA 4YDLC 3VH8B 4F7KA 5IB2A 3REVA 1E5ZA 2DQDL 2YBRA 4PLJC 3DIVA 1OF2B 3ZKSD 4ZS7L 3KAAA 3QAQA 4JKLA 5HHOD 1XF5B 1OGAA 4YSSA 5IMOB 4PWJA 3ZDYF 3FCTB 4J1UA 3CHSA 2V7HA 2R1XB 5LNEA 2I9TA 4Z7WA 4A63A 3BQUC 1UJ3B 4IGBC 4RZKA 5E1AA 3FTSA 1F86A 3IWVA 2P8LA 4NQXB 1CGTA 1T7VA 4HUVB 1EHKB 1RIUH 3A24A 4YZWA 4N90E 5KVMC 2I60L 2W9EL 2OP4L 3CLFL 4HF5L 2PP9A 1MRFH 4NENB 3BN9C 4POUB 5DA4A 5GS0C 3KPLB 5I1JH 1QBML 3L48A 1JPFB 5I2IB 3AC0A 4WO4B 1GC1C 1JVOA 3AXLB 3TIEA 3LN5B 2ATKB 2VUKA 5E8DL 2UVEA 2J1ZA 3MV9B 5LAXB 2GEQA 4DGYH 4OIBA 5ID1A 2A1WH 4AQEA 3NJLA 1F42A 1QW8A 5CEYB 1W0WA 2GJ6E 3VUAA 4JHBA 2ORBH 5EIQA 3KM1A 3MFFA 4LLDA 1VAHA 1AHWC 4LVNB 4X9FA 3MLYL 4KZCA 4QO1B 1CFMA 3BISA 1U92B 2WIMA 3RWDA 3MZTA 3CHXA 4DAGH 3NJXA 4G71B 4AYDC 2L04A 3GIZL 4XC3L 1GZQA 5DHVB 3K6SA 3GJFH 3FPXA 3EYQD 2B3RA 5I1AB 3ORJA 7FABL 3U9PH 2GTZB 3FRUA 1OAUL 2XTJD 4JS7A 4A7UA 1IC5L 4MLSA 1QSED 2XZAL 2IXQB 2MPAL 5D5MA 2VQ1A 3FH7A 2X4UB 4RAVB 2X10A 1E8WA 3TYGL 4OM1L 5DC0A 3RB5A 1FYTE 1NC4A 3KBEA 4GP8B 1IU1A 3CVHA 3MJ7A 1DDHA 3Q8AA 4J3BA 4Q6IC 1AE6H 1VLXA 3HZYB 3CPUA 1VZHA 4KXBA 3QWOB 3C75A 3Q44A 1CFNB 4JDTH 3SOBH 2Y1ZA 4N22A 5K1VA 2XFGB 1DN0A 3ULUH 2QKIC 1JVLA 5DR5H 4OI8A 4JREC 3V8CA 3ZZSA 4J3OH 3QRFM 4P4KB 3QXDA 4N2OA 4PCYA 1U8QA 1TQUA 2H32A 4NC1E 5MEQB 5JHDE 3VXPB 2HT3D 1N7ML 5E8OA 3ULVD 4BZ2H 4IDJL 2D4DA 2J12B 4QRQB 3MX0B 1HHJA 2AQPA 2AVFA 4GRLC 4P9ML 4PW3A 2AABL 1R4XA 5E2WH 3ZHDA 5I0VA 4XB8A 5A2AA 4TTDC 4NS0A 4FMFA 1UUSA 2A9CA 4KRNA 4W81A 4DGWC 1KENL 4BFNA 1JNHB 1NCCL 2R39A 3T6VA 2X44D 1T7XA 4GXUN 3RAJL 4OQTL 3TBBA 1ES0B 2LU7A 1S7WB 2JQMA 4GAAA 4MMYB 3KGSA 3V4VB 4ZMVA 1E27A 4DUWA 3PABB 2BHFA 2GJ6B 2VXTH 1JWSB 3APFA 2C26A 1IKFL 5HYJE 3EH1A 4EI5C 3UIYA 2VJ8A 3OMIB 5ALCH 4UIKL 3BHBA 4XCYB 3UX9B 1J8RA 1QUNA 2OI9B 4FQCH 4BRVA 1PIGA 4OJCA 3N6YA 4RGMB 3G5VA 4OGXH 1S78C 5AWNH 1X5ZA 4B5EA 1S9XB 1EEYA 3X11A 1MQKH 1K8DA 4IBYA 3VXMB 2J1KA 4KQ4H 3WNLA 2HYMA 4M1GH 5HHNA 3IJSA 1YJDL 1MAMH 3IU3A 1EHAA 3CVBA 2RA1A 3VXUE 5EZLA 4YFLI 5ID0B 1B6UA 1CLYL 1T1YB 3WHE1 1ND0A 5DHVH 4U6TA 5FOJA 2MHAA 2LV4A 3FB7A 3GM0A 3QHTC 4ZSOA 3QEGH 5DJDA 2AJ3A 2LLNA 1XDTT 2YAHA 3JWOC 4K5LA 2PABA 5L2JA 4OV5B 1IAII 3VMPA 2XOTA 3GKWL 3K4AA 3IMWA 3P4NA 4M6NL 2X2JA 1T2QL 4IOIB 5TE6L 4JQXA 4Y5YB 3SO3C 3FS9A 2HKAA 5EEZA 3D69B 1DQVA 2BIIA 3K6NA 4OGQC 1DLHA 1NC2A 5GGRY 4CGUB 4DUVA 5E4EB 3ZX1A 1H3TA 1EDHA 1Q9OA 1TSHA 2YUXA 4JZOA 2XG4A 3S7GA 3GHBL 1D5RA 1A3LL 5G4NA 3OG4B 3ZZQA 4U1LB 3Q9QA 2WXRA 3VFTA 3LVEA 2EUWA 5AW9B 1KELL 2YPLA 5C0FB 3KG5A 4PJCF 1BD2B 4DTGL 4LSUH 5I24A 4LRIC 3F65A 4MA8L 1PYWA 3IF1A 3RNQA 4ZUTA 3UGEA 3V6ZB 1XR8B 4J27A 2FATL 1QTSA 2I07B 1EAPA 5HYJB 3QXUA 3VFNA 1KCSL 2A73B 2OXHA 1HCFX 3FH8A 4NZFA 1QR4A 3W81A 1TQVA 4CSZA 1F6FB 3IDIA 5I5RA 4QRUB 4A2LA 1NCAL 2AK4E 2NY5L 5C6TH 4TQHA 3PGDB 3VCLB 1IEAB 2R23A 3BMWA 4HEMA 3BGAA 1HXMA 5T3ZD 2BSED 4K3DH 2L7EA 4K7PH 2I85A 1IAOB 3U1SL 1BW8A 3CXHJ 4NQUA 4YHIB 1GGIH 4FQLH 4M8RA 5IW1A 4NC2B 4QOKB 2H2SC 1MLCA 4PM1A 3V4VH 3O8XD 4M93B 3IMUA 4Y2DC 3HNSH 1CXLA 1OIOA 4ODWA 5DZPA 3TCTA 3E8UL 5CKAA 4HS3B 4S1QH 1YC8A 2EINB 2WLYA 4N0YL 1ZVSB 3MLVH 2E74C 2H3XC 4KBPA 2O5ZH 1IJ9A 3O4LD 3QBTB 4N2NA 4N2GA 4PB0L 3WLWD 5INCB 3RL2A 2MCPH 4ZAKC 3MRCB 4LEEA 5IZ7A 4JFDE 4F8QA 1WA0X 3U4EA 4TSAH 1AH1A 2E5EA 3L7FA 1JZIA 1UA3A 5I15L 2AJSL 3KEHA 2XPZA 1EANA 4IBQA 2OS7A 3L9YA 4S1RL 1NGZB 3W11C 5IB3A 2DN7A 4JPKL 4HLJA 1X5IA 1PTZA 4FKEA 4PRBA 3LKNB 4UM8B 5IEHB 3ECQA 4XCFL 5ENWB 1ZTMA 3TBWA 4Z1PA 4HIHB 4JGMA 4L0ZA 3VTTA 3TWYA 3KH3A 4OZFA 1DQKA 5CD5D 3RNKA 2Z93B 3DGGB 1D7FA 4WY7H 1RCYA 3DROA 3RVTD 3S34H 3EOTH 1HHIA 3QRGH 4PD4J 4TM9A 2OMXA 4Z0BH 3RKDC 1QABA 1KDIA 2RIKA 2OMZB 4X5LA 3RWHB 4K8RC 1DVFD 2WXIA 5TQ0H 2AQRA 3MNMA 4KMTL 2PXYC 3EJPA 3BWAA 4J4PC 1RUMH 3NSCA 3ZHNA 1WD8A 4JANA 4JHAH 4FA8A 4AQAB 4FI7A 3MRHA 5CP7B 5DD5H 3GI8L 5I1GH 5KVFL 3BSZA 4GEIA 1XBRA 4TQPA 4D3CL 5IESL 3QJHA 2BK8A 3SCMC 2WM0A 3ARRA 1KTJA 5HVHB 1SLXA 3TL5A 3WY1A 4F2FA 2ALAA 2AJYL 1YPZB 2X0UA 4QHKJ 2NSMA 2YA2A 4KK6D 4PJGB 4B3VA 5ICZA 1G9MH 4IRZH 5I74B 4WV1B 1CE1L 2GTWA 2WQSA 3BUYB 3MBXL 4HS6A 4EVNB 1Z3GL 3CD4A 1XBDA 3QEHA 1FFOB 3HE6C 1MJJB 2JXMB 1A7OL 2F6AA 1FIGH 2F7PA 2V17H 3OHMB 4DZ8A 4YHKH 3N1QC 3II2A 4F2MA 3Q2LA 4XAWH 1GS8A 3VSTA 3I2CH 2OJZH 1EZLA 3TBYA 3VYNA 3BP4A 4JRXE 3M1BA 4OD1H 4D9RE 4PY8I 5HY9B 2KH2B 5D1QE 1D5IH 3MROB 2ADFH 3GPSA 4L1DA 3HI6H 5AW1B 5C0DB 1MSPA 2FBRA 4Y8AA 2EVGA 3NCYS 5CKGA 3B5GA 4DKEH 2J5WA 4UQ3B 4XNMA 1MDAA 3TV8A 3TCLB 4UOZA 2WXHA 2PCPB 3Q6GH 4WUUB 5FUOH 3CUPB 3K0WA 2VH5H 4H1LB 4PRNA 5KYXA 2CA3A 3RFZB 3T0DA 2Y1AA 2Z31D 2LFGA 1TVBA 2CIIA 2XTJC 3D85B 1PVHA 3QDHA 1GS7A 2I5YH 3ZTNH 2W94A 5KVEE 2DTML 4MJIB 5BQDA 1DJIA 2OMYB 4NKOB 3KW8A 5E0FA 1MZYA 1OAXL 4N2KA 5IWLC 2X09A 4KGLA 2Y6SD 3VWJD 5FGCB 4Y1SA 2Q3ZA 4U3SB 4P5KB 1U30A 5DT1H 4UTBA 1C5CH 4DP1X 1IZJA 2LAAA 2VLJE 5BW7C 1NCTA 3X12A 1JRHL 1UYWH 1YMHA 3I6GB 4I8DA 3MLSH 1JUFA 1OW0A 5E2VL 2X2UA 3IJ9A 4UQCA 4BQ9A 3P9LA 3PP3H 3C8DA 5EZJB 1EXUB 5C09D 2UZIL 5DJXA 1VIWA 3WUWG 2A4CA 4RQQA 2EVIA 3MRFA 2C8NA 1HI6A 2XWJB 5C7XH 1B4RA 2IVFC 1VCAA 4PJ8C 1B4JH 2O61B 3EYUL 2XWBA 3WN5B 5JOEA 4ZMXA 1OTTD 4R97C 1EBPA 3RRQA 2VERN 2O6FA 4WKXA 5IMLB 5I1DB 1GAFL 4LNVA 1JWUA 5A2JH 3POHA 2YD4A 1SZNA 1MFUA 3NMEA 4MNGB 2AI0H 1ZIAA 1A4BA 4JRXB 3T4AA 3W38A 2EDJA 1AANA 1RZKH 2JKRM 3FCSB 3QUMH 4Y5VA 1IX2A 1KACB 1MEXL 3FSWA 3AB0C 3NAAL 3WNNA 3LD8C 1CDHA 1ITBB 3BDXA 1Z9MA 4IBVA 3KYMB 2HPTA 1NICA 4BSWA 4PRIE 1M6UA 1OP9A 1U8MA 4FG6D 4RRPA 3P0YH 5GRJH 4UYQA 4HFUL 2WB7A 1BG9A 1XT5A 3LH9A 3SDAA 3QUYD 4LPXA 4LCWA 1GVIA 2X6CA 2XZCL 5AVZB 4J3TA 3FQTA 4M48H 3BJ91 4XP1H 1TKWB 5I1CL 2Y7QB 3LCYA 4OR1A 2WYZA 3JTTB 4NM8L 4J3VA 2AJVH 4M00A 3IVKA 4FQPA 4W9ZA 4IBWA 4JMNA 1DSWA 1JZGA 1SYVB 1PX3A 3HN5A 3MKGA 4PJXB 1GCYA 4S2SA 5FS5A 4LQ1A 3U83A 1SHMA 1OE1A 4YS4A 2QT6A 4H1LH 4KI5E 1R5IB 3EKCA 4Z7OE 2QZQA 1SYSA 3MLTB 4R90L 5EOCL 1SNRA 2YGPA 1GKEA 3VB8A 1KCBA 4I77L 1HYSD 1NBZA 2UX6A 4YHMH 5FKAB 5F6IB 3K2UL 2DLGA 1RZFL 1J5DA 4G42A 3PL6B 3TBCA 4PJEA 5I6XB 4HH9A 2QVTA 4F8NA 3TPUA 1A7BA 3M45A 1YNTB 3TZVB 4OZGE 1C7TA 2E7DA 4G8FB 2ZUQB 3FDWA 4MZ3A 4PV9A 3WNKA 3EXLA 1FF5A 3QNFA 4P5RA 2J1YA 5C08D 2CLVB 1JZJA 2EDEA 2Y36L 2FLRT 5EUOF 3GBEA 1FL5B 2N1KA 3RJQB 3US9A 1TQWA 3HBZA 2L8AA 4XCCL 1LD9A 1X9QA 1YEJH 4JR9H 5E6IB 2Z65C 3V0FA 4EKJA 4S10A 5I71C 1UTDA 1X3DA 1FH2A 1MIEH 4FN0A 4P2RE 4DP8X 3MRPB 3BPLB 5CHNA 4RNRB 2C9XA 1S5IL 1K6QH 2HTKC 1E9OB 2HWZH 5BS0B 3MRQA 4OAWA 4MNQD 1EV2E 1JN6A 1SJHA 5HDQH 2OQJA 3OJDA 5L2KA 1H3UA 2ITDA 3NRQA 1QRNB 4NRYA 4PWGA 4PJFB 4D9LL 4GKNA 4M02A 1E4XI 5D93C 3RWGB 4JFHD 3HRZC 1HEHC 1JYXA 4Y4KC 4QXWA 1UZ6F 4XHJD 4XN7A 3Q8EA 2BFGA 5CJXC 4JGJA 3S88L 4OB5H 4JVWA 5SWSD 2YAFA 2EABA 5DUPL 3RIKA 1QFWH 5IVXA 4LSVL 2ZG1A 4NQTA 3IB4A 2WUBH 2CDFB 2HLFC 4C56A 5IEKA 1K85A 2A9AA 3L4UA 3H42L 1A1NA 1P4BH 1WBZA 4FHBD 3CSFA 2FSEB 3ARFB 3L3HB 4A2DA 1BM3H 1NKRA 4FLHA 4QXVA 2N0MA 3T0EC 1FHNA 1KT2B 3IGAB 1KC5L 4JKWA 1CE6A 4NUGH 5ESVA 3MLZL 3UJIH 4PBWD 5KG9A 2BIOA 4PRHA 2X7LA 2DQDH 2HTLC 3CNKA 3I6SA 1XR9A 3BP6A 4M5TA 4PLKC 4YSPA 3N9GL 5KVEH 4U6YA 1PIFA 3I85A 1E3XA 5CU9A 5C07D 4KXDA 3EYOA 4P9HC 3D3VD 4ZS7H 3BUDA 2B2XH 1MW2A 3HS0C 3CFJA 3C5SA 2DY2A 1MIML 1FO0L 1OAQH 5D7EA 4F5CA 5DMJB 2E75C 4JBSA 1F1GA 3KPNA 3RURA 3M17B 1HZHH 1YUHA 1JV5B 3AY4C 4EUPA 5HHVH 4YGAB 4A68A 1WT5A 2DQFA 3EDFA 2CLRA 2Q76B 3V52H 2OAAA 3OXRA 2NTSP 3KL5A 3ABGA 3SDYL 2OP4H 4LKCA 1ZHLB 3VI4F 2DLFH 3BGMA 2B1HL 4JG1H 4O2CA 1EZSA 4WTQA 32C2A 4FL4C 5IQ9A 4U1JB 1NMBH 4NO3A 1QLRA 4ESKA 2CUMA 1R3LB 4AW7A 3AITA 3L4VA 3M8OL 3HLAB 4M5ZH 2YHGA 4L0YA 3G6JA 4MSWB 1E2VA 1RPUA 2NMSA 3CK0H 2XU9A 4LPVA 1CLZL 3TEXA 1Y6NR 1FFPB 1A6AA 4QAMB 4PJAE 3DLQR 2ESVB 2BSSB 2G2RA 1X7SA 4N0UA 1BFOA 4WFHE 1BMZA 5JPMC 3TEUA 3FSVA 5F3BA 1MUJB 1JE6A 1ED3B 1GGTA 1H15A 4Y19B 3RY6C 3ZN6A 2MNUA 4N2IA 4CVXB 3GIZH 1QLEL 2OBGA 2EDXA 4FQHA 4P2OD 2X88A 2HFFB 1RP9A 1U6AL 4RFNC 1GY1A 1L3WA 2EE9A 4EIBA 7FABH 1OAUH 5JOPE 2FHCA 5FO8B 2LW3A 5GQBA 4RVBA 2J6WA 2Q7YA 2XZAH 4OLVH 1IKNA 5JPNA 3FB5B 5GGTL 4JFEA 1S5HA 3RIFF 3UTZA 5I1IL 4MCNA 2GT9A 2XUWA 5IHBA 2A9ML 3WYRA 1DBML 1KTBA 2PWDA 4IOSD 2XXMB 4DCQB 4JFPB 4NKMA 1EA9C 3ZY7A 4UTAH 1MH5B 4BGDA 1HSBA 5F9OH 5ALBH 4DN3H 2QHRL 2EUVA 4J6RL 3LQAC 3QO1B 4TRPL 3QQ4B 1S7RB 1QI4A 2H1PL 2IDSA 2PO6A 3CDZA 4PRPE 5IG7A 1N7MH 4JPIA 1L9SA 4CC0A 4NKDB 2WNKA 4IDJH 4LVHB 2FO4B 3ZT7A 3MO1A 4BSJA 4P9MH 3QUZB 3L2NA 5LGKA 3MRKB 1UB5B 4JM4H 4N2AA 3ZHLA 4NQEA 3G5YA 3SIKA 4Z76B 4KROC 1WZ1H 2C1OA 4NN6B 1DP0A 3RX7A 3D0VA 1LMIA 4M03A 3MMEB 4Z7VA 2WK2A 4NUJA 2XX1A 4WHTB 1DVQA 5HHME 1MHHB 2QVIA 4MD5B 5M94B 1LP9F 1NCCH 2VISA 4A7VA 2CBPA 3VFGL 1E7UA 5J12B 2GFBB 2IGFH 3KCWA 4QI3A 3RWEA 3T3ME 1E4WL 4F15C 2AQQA 3U2SA 2YFNA 3CH1B 1NLDH 3H2QA 2HH0H 3K3QA 6PAZA 3FFCA 1JPSH 1KTKE 2I9LB 3DRQA 3UTSA 1OTTC 4M7JH 3BEVB 2OMWB 4CSTA 3DUHA 4JFFA 2EDFA 4NKIL 4F7PA 5CGBA 1UA6H 2VLKA 1TTAA 1CGWA 2Q10A 4MMZB 2C4FU 2QADC 3LVTA 4XPGL 4R5XA 3GMNB 1YY8A 4D9QD 3WTYA 2ZOTA 4X5RA 2Y5TA 3VFOB 4IK7A 1BXXA 2Q2EB 5DI8A 3WAJA 4LLWA 3WEXB 2NLJA 3KR3L 4V11A 1CQKA 1QYGL 1X5MA 2AK1L 1CZ8L 1GYUA 4FADA 3W2DH 3SYAA 2CNYA 2BFVL 2I69A 3M7OA 4KKNA 3LIZH 4OUOA 2XYCA 4FG6C 4IIQC 2EUZA 1WFMA 4FFVD 1XGZA 3SD5A 3SSGA 2IDCA 4CVWA 2VRAA 3EDKA 3VXOB 5GGRB 1G7MB 1XIWB 1PZAA 2EC9T 2UY7A 3DVGB 5AL0A 2DIBA 3HCVB 2CM5A 4K3GA 5ERWB 4ZYKA 5J1AA 5LHDA 1CG9A 4ODUA 3GSXA 3AS3A 2X3AA 3PY9A 4LLYB 2O5XL 4N85A 1NCDL 2KLRA 2V5SA 3FTUA 1IT9H 3VRJB 3FMGH 3GHBH 2OCFD 3AWFA 1OP3H 1W72B 5CD3B 3WNOA 3BLPX 1HH9B 2JE8A 3QWRA 3DARA 1OAKL 3IN0A 4L8BA 2Q8AL 4DTGH 2NW3B 3QNXB 3QRLA 1HESA 3PQYE 4MA8H 5MP6L 2PPEA 4KQ0A 5DHYB 1Y1DA 5AVVB 1JNLL 1OQXA 4LLQA 5FFLA 1Y1UA 4PJHE 3L3IA 2W0PA 5CJ8A 3CC5B 4CKQA 2BIMA 5DFWH 3NFPA 5HDBF 3D4GA 3CFCL 4ODSH 3KGRA 1OOWA 2R9HD 4QCIA 4G83A 1OSEA 1XF2A 1UCTA 2VMEA 3OPZH 2HB0A 3G6AB 4LOEA 1E5CA 2ED8A 3QUXA 1DQML 3I50H 2IALA 2J6EA 4LGSB 1A25A 3TH2T 3U1SH 3CN4A 4U6XA 1NCBL 4UDTA 3DI2B 1KPVA 1BEYH 3ZMRA 1X44A 4G7VH 5C70A 1AQHA 4KJYB 3ZVVA 4DFIA 1JDAA 4GBXC 3JZYA 4TSCL 4I89A 4F8OA 2NXZD 1Z5YD 3JUYA 1KJ2L 1U8JA 5CFAA 4J39A 3FFOA 2OCCB 1A9BB 5AUMA 1ACCA 2AKRA 3TURA 2LQRA 1SBSL 1T0NA 4ZQTA 5CIPA 5CILH 2XWXA 4L4VE 3MA9L 2NOYA 2F8XC 1JPEA 3K2KA 1AZCA 2FGWH 3HTLX 3QDJE 4PB0H 3WS3B 5G5DB 3O3AB 2NY3B 1NFDA 1PD6A 1CF1A 1QFHA 1S46A 1ZA3B 3HG3A 4ZFZA 4KKPA 5LBSA 3S36L 1WWBX 4C58B 3UO8B 4X6DE 1YECH 4KZDH 2AJSH 35C8H 4D0DA 6CGTA 4RDBA 4Y2LA 3TLRA 3PXJA 1QZ1A 3DTXA 4AQ1A 1MCLA 2HMIC 2P8PB 5IROD 2LHAA 4NFDA 2HT2C 4J3OF 2IOOA 3IN2A 3MJ9H 2PR9A 4G80A 2X6UA 1UGNA 4AGOA 1OEZW 4WZ9A 4WF7A 5C0CD 3ABMB 4LSTL 4K3JL 4XVUC 1ASPA 5EU5B 4X4XB 1EJOH 1CFQA 3ETBJ 3W5NA 3WDIA 1RZGA 5CEZD 1DQLH 2OK0L 4NO0A 1OD9A 3ZR5A 5F0MB 2B77A 4OLYL 1N3NB 2JKNA 3DMMC 5EZOL 2D31A 1K3IA 5KVDE 3B5TA 4PREA 3UTOA 5D71H 2FT7A 5CINL 2CDEA 4BM7A 1KGCD 4EMZA 4CSPA 5KW9L 4O9HL 3TIDB 5HBBA 3KLAA 4GKZB 2EDNA 4D3CH 3MLXL 4TUOA 3SQBB 4PS3A 1W72H 2AEWA 1HKLL 2NTFA 25C8H 4LGRB 3EIFA 4AKQA 1I8LA 2A6JA 1MAKA 4GMTL 4JN2B 1SUJA 1LO2L 3BCFA 4AT6A 5EEXA 4FHJA 4JQIH 4BQ6A 1T7WA 4W9IC 4EDWH 2QPUA 2X53A 3DV6A 2R0LL 2XXGA 5JXAL 2KZKA 3AWEA 3CHQA 5LCVH 4GSUA 4TNFA 4Z78A 4P8QA 4Y4HD 4MLIA 1CTMA 4WFED 5AOKA 4Q0XH 3DPBA 4EIZC 2NY0B 1MXDA 2OX5A 3CX5K 2ZIDA 3NJFA 5E00A 4X8XA 3VG9B 5DZVA 4ZNCD 1X4XA 2J4WL 3VGHA 3QUKA 2N7SA 4F7TA 3DA0A 3V6OC 4X6EA 3MCLL 4ALAL 4FABL 4C4BA 2BSBA 1P4LB 5FOBB 2VO8A 1B0RA 4FYTA 4KHXH 4UT7L 3BD3A 4KKBC 3LRMA 3FOMB 1N4XH 1F1AA 4UM9D 4X6DB 4LMQE 1PZSA 1XZ0B 5IBLC 4NQDE 2OYLA 1RZ7L 4TVPL 3N43B 4X7SL 4R9HA 2VZUA 4CVUA 3HG2A 4DP4X 4NRZB 4F7EB 3FT4B 1E4JA 5IHZB 5DEFA 4YSRA 2DTMH 1ADQL 1JHLH 1U95B 2YARA 4JO1H 5T33L 4D7PA 1ERNA 3MUGA 2BHZA 3CFBA 5IVZB 4N24A 2VKXA 3QDAA 4XWOD 5TF1L 1BZ7A 1LL1A 3MACH 4MGXA 1OAXH 4NYLB 3ZL1A 3Q0HA 4Y1AE 2ZX8A 4DN4L 1M7DA 3F85A 4HJ0C 1OM3H 2DQGL 3SPVA 1KCKA 1JWMA 3MRDA 4KDTA 3MV8E 1QW9A 3W0WD 5IY5B 3GB7B 1CICB 1R3IL 2GQHA 3KDMA 1I8AA 1EFXD 1J8HE 1XTLA 5G55A 1N18A 1LGVA 4YIQA 4KITB 1VESA 4JNXA 1JMZA 4NQSA 4YSOA 4GO6B 4CNIB 1L5GA 5E70A 3IDXL 1A1MA 2VDLL 3F62A 3O2DL 4P23A 1UXMA 4MDJB 1RLBA 4OLZL 3GO1L 1CXIA 1M9WA 4Y2OB 4XMVA 5DUBA 5BMFL 5HJ3B 1ZCRA 3QPQD 1E28B 3F7RA 4ZOEA 1HHGA 2D7NA 5C0BA 1Y6KR 1OT4A 3MR9A 2F9BT 3P0GB 1INEL 4V1DD 2OR8A 1H9DA 3ATFA 1F4AA 2KT6A 2AEQL 3PCYA 1CJYA 2CNZA 2R83A 2XG5B 1FNSL 1R3JB 2EADA 1AGCB 3S8GB 2MFNA 3DO7B 1MFAL 2FH8A 5DQ9B 5EBWB 4N0CD 2CBTA 1YEIH 2Y7OA 1KOAA 1ZV5A 4I2XA 1UD4A 2L7UA 3EO0B 3TU6A 4QMEA 3VFUB 3KHQA 4U05A 5DTFA 3B1TA 4WI7A 4JJ5A 2FQFA 1J8KA 4PI0A 5AYQA 5AOZA 3ULUD 2CO2A 4P3DA 1M6OA 4ELKB 3BKCL 4G9DB 3RWCA 4HFUH 2BNQB 4J3OD 4RMRA 1PGRB 1N5YL 5BZWA 2OSWA 1NCNA 1FNGB 4EN3A 5IQNA 4HWEL 4NM8H 2BDNL 3MA7B 5DRZA 2ZWNA 3QCUL 3GRWH 2BNRB 4ZPTA 5F6HI 1R3HB 2E6QA 3I9PA 5I5IA 1IAIM 3QFJD 1FO0B 3UBXG 4BFBD 2WN2A 3AVEA 3HE7C 3RZCA 2J43A 4MAUL 4PJ5E 1A6TA 3JT2A 1M1XA 1UOWA 2ZUWA 2W0FA 3WUWA 1T21B 1AZNA 1RUQH 1W0VA 5EOCH 3TYFA 4K0OA 1SQMA 3AABA 4AXWA 4KGJA 4R3SA 3ZZ1A 2YAQA 1NCUA 3PHOB 5INDB 4JFZH 5D1XA 1X5LA 2V2TB 1RZFH 3ABLB 4XPAH 3KW7A 1MJ7H 4QT5B 3QNZB 4X6CB 4ZTOL 2UWEA 2QSCL 4TQIA 3L5XL 4PHZA 1RFDH 2MCG1 5BVPH 4OZIB 4YXLH 2QQLH 1S7XB 2WXMA 1IGMH 1J5OH 3B6SB 1INDH 4J12A 1QA9A 4FMVA 2DQIL 1UD6A 5A2LH 1KJVA 3ATAA 2COQA 1AXIB 5A6LA 2WLZA 4H2AA 1BVLA 4WO4D 1LEKB 2WQXA 3B9EA 2D7QA 3TF7C 1I1RA 5FYJL 1KTDB 1FN4A 3O45A 1DJGA 4I18A 4XMTA 3IPFA 4I1RA 2PTUA 1DVXA 2E27L 3V0AC 4KDVA 3P0VH 3MSPA 4I0PB 3MV9D 4LPCA 4MJ5A 3L9BA 1XXDC 3TVMA 3BGFC 5KZCB 2FYYA 4UQDA 1QSFE 4XXDB 5CU5A 1ZLSL 1P5UB 2HKFL 1S5IH 4OBSA 5DD1H 3U25A 1D5XA 1NDMB 2HVJA 5B3JE 2BO0A 3CG8A 4HJSA 4H8PA 3OC8A 4OCMC 2Q3AA 1UM6H 4ONOA 3AU1B 3VD5A 1A7RL 1B0GB 1D7DA 1SXNA 1WWCA 2YPVH 1WITA 3ARQA 4D9LH 3KPOB 4UINH 3DVNB 3B2UD 4YDKH 3AAZA 3OX8A 3G9VA 4OY9A 2OXGB 2Q5BA 4F1ZA 3O6KL 3HG1B 4IU3B 1A3QA 3D09A 5DUPH 3AMKA 5FLVA 3A3YB 5E1HB 2OYMA 5DSCB 3OJ2C 3PP4L 4QRPE 3ARUA 1FLTX 3C2SA 4GXVL 4APXB 4DF9A 3H42H 4UT6A 2KQMA 4XBGB 4YHLH 5KYYA 4Y5XB 4AJVA 2ZCHL 3TV3H 4ORZC 5E7FA 5D7LB 2EZ0D 4N8VB 4FLSA 2AITA 1ZWIB 5K9OB 4XNAA 1RJZA 4Y88A 4Z9KB 2XWEA 3PAUA 4P4KD 4U1KB 4RRPM 5L7XL 1F58L 3CVCA 3OMZA 5K1JA 3N41B 1SXZA 3N9GH 4H8HA 4YK4C 2D2CC 4ABVA 2G5BB 2KBGA 3EOBB 1PSKL 3X14A 1HXYA 4GAGL 5DRXA 1LE9B 3QIUB 3FO1A 1QQDA 3O8XA 5ITBH 1WISA 3UP6A 1BF8A 2PR4H 1FO0H 4N90D 1U2HA 2YBGA 2WYIA 3AMLA 3H7BB 1MRCL 4Z3FA 1H5BA 3HBPA 2NY7L 2GUYA 2PYFA 2HJKA 1MCQA 3PWPB 4Q2ZA 3FQUB 3RVWD 5FO7B 3RE0A 3O4LA 3X1NA 4P05A 2R69A 4E9WA 4CU7A 2CKBL 4YGVA 3ARBB 2WLLB 5ICYB 3MTXA 2ZOLB 4GYBA 2FEEI 4E9SA 4RX4D 3M1CA 6FABH 2WYHA 2V9RA 3J2PA 2H41A 4BUGA 2GJ6D 4WWKA 1T20B 2JJSA 2X4OB 2VTFA 1KJMA 1RAMA 4GAFB 1ZA6B 1CDIA 1CLZH 2CHXA 4F7CA 1CI3M 2OSLB 3T8MA 2TAAA 1YPZF 3G04A 1DQDH 2KPWA 3NP4A 4MXQD 1LM8V 4PJGF 3NESA 3OJMB 3EH4B 4LGPB 4U1GC 5DA0B 5FCUL 3VXMD 1DVFA 3VWKA 1BP3B 3IWUA 3F7YB 1NL0L 2ZCKH 1U6AH 4U7MA 1M56B 4QRPB 1D7CA 1UQSB 1QPXA 5TPWH 1P84J 4HA1A 4M3KB 4ECNA 4DZBB 3HNTL 4X9HA 4B0MM 3KGUA 1OARL 1TJXA 4BH8B 5K39B 3BVVA 5FDWA 2Y3NA 3G08B 3D0AA 4FRWA 1IIKA 1KXTB 3DHUA 2VR6A 3C5XA 3HJEA 3KJ6H 4JMXA 4O00A 5JHDD 3B2MA 3KD4A 3OHXC 4OIAA 3PDOB 4B53A 3ROLB 1A7PL 4MKMA 1AO7E 2Y72A 5F1KC 5CS7A 4PJBA 5ITFB 3LMJL 3OL2A 1NIBA 4J6RH 1GYVA 4MD0A 1NBCA 1J9SA 4HIXH 4P59H 1X9RA 3OR6B 1IGTB 4NHUA 2IANE 5EOCJ 5JORA 2UZYB 2YD8A 1FFTB 4YPGA 2QGDA 5FLUA 1KGIA 4UZUA 2XIIA 4Q97A 4YBQC 4ZW8A 3ARTA 4HEME 1JHTA 1DQJB 2XV6B 5E9AA 5ETUB 2EH8L 4PRAB 3GSUA 3VQMA 2XVBA 5HYJD 5TDNA 4P07A 5F7EH 3PGCB 1YNLL 1KB5L 1OAZL 3FT1A 2V33A 3ROOA 4Q58C 2Z31A 2X6VA 3QNYA 1VFUA 3P77B 1I9RL 2UXFA 5D2NA 4CSSA 1K8IA 3WKYA 4JFUA 4XXWA 7PCYA 3U6RB 4XGZA 1IARB 4Z0XB 3WEMA 3GHEL 3LIUA 4M43L 3TBSB 3RX8A 4JE0A 5BQ7B 4QNPE 3EDEA 1G0DA 4J3OG 3TFKC 1J1PL 4PJCA 3DURB 3I75A 4QOKD 5GS0L 1NFKA 4JFOB 1FSKB 5E4IA 3VWJA 1PJWA 2OTPA 5DS2A 1M71A 3EFFA 3U0PB 3IGUA 1Y18B 4G9FE 3WHXA 4LF3B 1FRGL 3VH8G 4EJ1C 3J07A 3ZHKA 1JK8B 1JI1A 3Q9PA 3WXVL 2A74A 2QQKL 1TOXA 4KOCA 2YAMA 3H56A 4X4YB 1T0PB 3AGVA 1BM7A 4G1MB 1ZT4A 3BIAX 3GMMA 2WUCH 1XGYL 3PREA 4CBZA 2Z1KA 5JW4M 4ZOAA 1TEYA 5JHMA 1XF4A 1CZ8H 1HEZB 3O3EA 4ZFOB 2X0VA 3ULSA 4DFHA 2IF7A 5JXED 3M1OA 2IBGA 4OIFA 4XH2B 3TNNA 3Q5OA 4J3OC 2WBWB 1X6LA 5F97E 2QSTA 4X6BB 4ZFQA 3RUGA 3UZVB 1BPLB 1JPGA 1T5XA 4F8TA 5LXGH 3MRJA 4HUUB 5DS8A 5I8KH 1J5IA 3U0TB 1P1ZB 5E8PA 1IL1B 1QO3A 5E6RB 5EU6E 3DXAA 4TUKL 1I7ZB 4GNKB 3X3FL 3QEQA 2OMTA 1QOKA 1TYRA 5FA3B 1S9WA 1RKRA 1CN4A 3ESUF 4PJXF 5MERB 2IAMB 4XPBL 5A2CA 5I1KL 1NCDH 2DEXX 3B83A 5L9DL 2YA0A 3CFMA 2VAAB 2CUHA 3L2LA 1ZGLB 1G7PB 2WWMD 4FI8A 5D70L 3S2CA 4AX3A 5D6DC 3LHPL 4GKSB 1XSKA 3MRMB 3AT8A 3QUYA 1GIGH 4HMDA 4U0RC 5MP6H 1JNLH 3UJJL 3HHSA 1OTUD 2CXGA 1FORH 3JZ7A 5BV7L 1JK9A 4KVCL 1LK2A 2E4TA 5IMKA 4PG9B 4HC1L 3EYVA 1GGYA 3CFCH 4A6YL 2XSKA 4KHTH 3D87B 4HAKA 3TO2B 15C8H 5I18L 1ROCA 4QUOA 4BUHA 1QSVA 3PE9A 1DEEB 3KS0J 3FONA 3U46B 4EO5A 3UPRB 3RWFB 4GW1A 3A6BH 5MHSD 1AIFB 3VNYA 1B88A 3FUDA 4GS7B 3SBWC 1S2EA 3L08A 4UQ9A 4R7XA 3P69A 4TSCH 1OSYA 2OTUA 3DX3A 4PGEB 4R4ND 5F9WC 4LVNC 2H8PB 5T1JA 1QHOA 3GMPB 1TZOA 2JQAA 2X4SB 4M62H 4JY5L 4G6KH 4HJGB 5HHPB 4XBPB 1R33A 1Y07A 5I6LA 4TULL 1ZDQA 1ESOA 5C08A 4BCZA 2EXWD 4PJFF 1J18A 4TV3A 2HFTA 4Z3TA 3B3IB 4IJTA 3MV11 1X5FA 2XZQL 3HZ3A 4IHOA 5BPPA 3D85D 4L9LA 2FEDC 4NWUL 1D5ZB 1IGYA 4MJID 1SN5A 4MCZB 4TYUA 4Q4IA 5EU6B 3SKMB 3WXWL 3OB0K 3HPJB 2NNRA 1A0QL 4NEHB 1JFQL 2FJFB 3HMWH 1JCVA 1Q9KB 3FPYA 3PAZA 3Q5YA 3U30C 2HFEA 4MNQA 1S6NA 1BQRA 2ADJB 2VCOA 2FGZA 1GSKA 4KI5F 4LSTH 5LN4A 2R29A 1KIRB 1V3JA 4P4KC 4ZOCA 1OL0A 2C7UA 4NFBA 1PZ3A 2GSGB 4QY8A 2CHNA 3FL7A 4AEIL 5IB5A 2HPOA 1UXWA 3NIDE 4LLAA 2XICA 3MNZA 2EDRA 2CHZA 1CL7H 2SODB 1IIIA 2UXTA 1NBQA 5KW9H 4LSQH 1O7DC 3U0WH 2VUYA 4HIQA 3RVWC 1FZMB 4FZ8H 4OFPA 1VDGA 5C0ND 5EBMA 4BCXA 2WBXA 4GH7B 4GIOA 4DETA 3HPLB 3CZEA 3S9DB 1FBIL 3IMSA 3D39A 3ESPA 3RX9A 3FKUS 2CJ3A 5JXAH 2AQTA 4UT9L 4XMUA 2F61A 1ZPUA 3WS6A 4JRXD 3QW9A 5FKPB 3SPHA 4D9RD 3CFEB 5D1QD 3NZ8A 4QHUA 5C0GB 1KN4L 3GS0A 4L3EE 3LKRA 4FXKA 2XY2A 5E8EA 2TRYA 1OALA 2OI9C 4U1NB 2DQCH 1U58B 2FO1A 4OVUA 5E5MA 4ALAH 3SBQA 4P48A 1IGJB 4RGMC 2GBUA 4ZXBA 3DWTA 3P4OB 3IXTA 3IPEA 1KN2L 3PRZA 5IHLB 4BKLB 4HKJA 4BDVB 3C2AH 2WZAA 3WFBH 5F1IA 5ACZA 3VGAB 3GFUA 1EEZA 2R59A 1VFBB 2DMCA 2FZ3A 2MNWA 4Z7UE 3UFIA 5AAMC 3SJVB 3F7KA 3SDCB 2F1AA 2VZ3A 3N85L 5F3HA 4P46B 5HYQB 5EF0A 4PGBA 1GL4B 5HI4C 3UBXI 1BEXA 1IEBA 3KEDA 1URIA 1KMGA 2GK0A 2V7NA 4WI2A 3WL9A 2VLJD 1ZGLP 1BVOA 2WAHA 1CYWA 3GKZA 3HI1B 1KYUA 3EJTA 3BUIA 2K0RA 3FOLB 3IBEA 5HJBA 3UDWC 1TQCC 3OJVC 4DN4H 2BIQA 2P5WE 1MCOH 4JCLA 4F2EA 2A2QT 4U1HA 3PL6D 1S9VA 2ZXBA 3RU8L 4X80H 3WLBA 4JL2A 2D0FA 2WOBA 2AXHA 3EJCA 3T8VA 1R3IH 1L7IH 2OZ4H 3T71A 4P2OA 3IJYA 1ZXKA 2EQDA 3TZVD 4Q9RL 1ORSA 2HRPL 2UY6B 3FTGA 4GG6B 2MCMA 3PAYA 1S7SB 4XPFH 1RUPL 1UM5H 3IDXH 5B22A 4M1DL 3FFDA 3O2DH 2DB8A 4LK4A 5DDHB 3FXIC 2A9DA 2JJVA 1NFIA 3W37A 1HCZA 1N5AA 5E6ID 5F7NC 2DJMA 3L3JB 5K9JL 5FM8A 3GO1H 4RAUB 4XTRD 5LGHL 2FQGA 2NY2B 3C6SA 3L1OL 2Q1EA 4OFYD 4BFIA 5IQ7L 5L2KE 1G9MC 4QGYA 4JFXB 1AGDB 4LOVA 3WIFB 3NZHH 3EUDA 4KDTC 2BZDA 2AQ2A 3E6FA 4ELME 4E36A 4NAMA 3WCYA 4K71B 3FF7A 1KNOB 1CT8A 4L3EB 1HIML 2F2HA 4E42B 3I02B 5BS0D 5E6UB 2JCCB 4XZ4A 5E08L 1MFAH 1KIQA 1QRND 2Z9TA 4P23C 4O2EA 4NZJA 5E2TH 3IDMB 1OSZB 4R2GC 1BA9A 5SV4A 5KSAC 4PBVC 4PGCA 3AM8C 4LIQE 1I7RA 3DBXA 4GAJL 4KTGA 3TBTA 2J71A 1EH9A 2VN6A 3CMGA 4MJ6B 5C0RH 4JO2H 3ZKXC 4RMQA 2EDTA 4XXCA 3GSWA 2EC8A 2D2OA 2VQTA 4WEEA 1XGQA 3EHBB 1MFEL 1JZ4A 1SDDB 3RIAF 3L3OC 1DBKL 3FQXB 5JW3L 2WXNA 1O7VA 4X4MA 3ARFD 3NJGA 1RIVL 2WP3O 3Q7JA 4HAFA 3MUUA 1O5DT 4JFQB 2AERT 2BDNH 3OKKA 1LO5B 3QCUH 4KI5D 1QTPA 2Z7ZA 3IU4H 5C0AA 3ZKNC 1UD8A 3WKPA 3CU7A 1A3RH 1BVNT 2JVUA 3F12B 5DJ0B 5AYTA 4HP5A 3UZEC 4X4ZA 1EQWA 3RB7A 3SYQA 1KPUA 3EUUA 5GZND 3A47A 4QHMB 1BQ5A 3BDYL 4FHKA 4HK3N 1H3XA 2CKBB 5ICXA 3TASA 2VZVA 3FN0L 1WH0A 4LKXB 3TEZA 1NDTA 2NX5A 2QVKA 4EN3C 2Z92A 2AJZB 2QZ5A 3U36B 1MW3A 2K6WA 3ET9F 1S4IA 1CD1B 4C8XA 1JOIA 4JDZA 5C7ZA 4OLXL 1TEGA 1L0XA 2XA3A 1GGCL 3JWNE 3GLZA 4H7VA 3BWSA 3ECBB 3ZRCC 3LNEA 3O0RH 3RZCC 2DQIH 5I19L 5T1LB 1TSRA 2EO1A 4MA1B 4OSUH 3HVNA 4F33B 5EC1B 2CIKA 2C9SA 5DVOA 5DXWA 4IBUA 4AK2A 5CWSA 1I8IA 2WWMC 5TGBA 1A6ZA 3WKQA 1P6AB 4FTDA 3WIHL 4LCCB 4OLWL 2APXA 3LZPA 1UT2A 1K4DA 1F4YL 2AZUA 1AQMA 5HVHC 1D5MA 2ESVD 1JYWA 2HKFH 3FU7A 3VXQB 4H1LG 4LT7A 3BPNC 2WWNA 3GSVA 2ATAA 1DZ0A 3CZNA 3PXHA 1IQWL 1U3HB 3B8YA 4WV1C 1MCIA 4Y19D 3VI4A 5AYUL 3IKCA 1XFPA 3VD9A 1KBGL 3TOPA 5LDUA 1NMAL 3HZKA 1KG0A 3LKSA 4PS4H 1QNZL 2GVYA 5EC2B 4KXCA 1SLVA 3ILPA 2ITCA 3LH2H 1SHXA 3UBXA 3W3BA 3O6KH 3H85A 3EF7A 5B1BB 3TVMC 3ZSSA 5H4YA 3EGDB 3I6LD 4DP0X 2ENYA 4Q56A 3PV6A 2F19H 3LZOA 4TSBH 4DUXA 2FX7H 2WSKA 3VFPA 5A3IC 1AXSA 4FLQA 5FCSH 4AQ8C 2CLZA 2O6PA 2QDWA 1R47A 4IEFA 4AGNA 4ETQA 2ZCHH 4UQBA 43CAB 4K55A 2VXUL 3VMNA 4LOFA 1VKXB 2OL3L 2W88A 3L3KB 4OLUL 5DRNA 4EZMA 2ZXDA 3BUQA 4MNHB 4NQEE 4PR5A 4LU5H 2BOCB 2UZXA 4QXGL 5L7XH 1CBJA 2ZSVA 4Z7VE 4ADIA 1CFSB 1KPRA 2P5EB 2AXWA 3AQXA 5JHLL 4PCSA 4XNZC 1PSKH 5DFTA 1HL5A 4GAGH 1HDMA 2ZKYA 4HHAA 2WXKA 1E67A 5JDSB 4O58L 1OGTB 1BIIB 2G60H 2DL2A 4QR7A 4B3EA 3KH4A 1DN2A 1MRCH 1Q9WB 4XO5A 5I1HL 1QLFB 2HJLA 1NAMA 5M95B 3BQUB 4IGBB 3ATBA 5TDPA 1M7IA 3QGVA 1A9EA 5ESAB 1MWOA 3BSHA 3RVXC 5B8CA 3D0LB 4G8IB 1YVLA 4MDRA 4YSQA 3UTSE 1AG6A 3FQYA 3DC0A 4G5ZL 5IFAL 4BUQA 5CGYC 4F58H 1FNEA 3N1MC 4TPRL 3WD5H 1NGQL 1O0VA 1KXQA 4RBPK 2C9UA 3VFVA 2Z0UA 4MX7A 4HBCH 4XAKE 3VX0A 2RMNA 4XVTL 1KBPA 4GI6A 1A6PA 5IROA 4G1EA 1RK7A 2ZUUA 1J9TA 2CGYA 3KPRB 2F8IA 5DCCA 2V2WB 3JVGA 3P54A 3V5KB 4DGIH 1RHHA 1KCWA 3AJ7A 3L3GA 4KK9D 4P5TA 3H55A 4XMPL 5F9DC 1RJLB 1EEUA 5C0CA 1DVUA 1LP9A 4Z3EA 1JXGA 3A0OA 3CZFA 5D7SL 4ORGB 4OCSH 5FCUH 3PNRB 4X5PA 4F7MB 1P7HL 2DDQL 5CUSL 4LOUC 3S97C 4PD4K 3JV4B 5IHHA 4XCNB 4LIQH 3EO1B 4XCEA 2BRRH 4YDIL 2YRLA 4APQC 1NCWL 5DD3L 5JLZA 5A1AA 1D9KC 3FB8B 4MBOA 5GRZA 4AYMC 3X3GL 1EO8H 1G94A 3SKJH 4HKBB 5EO9A 2VLLA 1JF5A 1PLCA 2FD6H 5ICUA 1HHHA 3TGXA 1ECYA 2VN5A 1FL3B 2YSSB 3IDNA 4N1HB 4I1PA 4LCIL 4KTEH 3ZE2E 5CO1A 4X6DF 2ZXCA 5GHWH 1XIWD 1R34A 4Q6IB 1UACL 1C1EH 1WFTA 4OGAD 2VLME 1A7PH 4Y4HA 4EQ2A 1I85A 4RMWA 3N43F 4DO4A 2M83A 4XMWA 1MJUL 2X4QB 5IV2B 4JREB 1A6WL 1U8CB 1P5VB 2P44B 4PP2B 3P4MB 3ARXA 3ILQC 4NNXA 1ZLUK 5BJTB 1BYNA 5J3HD 1MZZA 4ZFGH 5T8IA 1G9NH 1R1CA 3K8KA 4GB9A 5F8QC 2VXVH 4M7KH 1B4LA 2V5MA 3QIWB 4AYEC 4AE1A 4GRLB 4LHUA 4JB9H 4OBRA 3RZWA 3AREC 2ZNWA 1BCIA 5I1EH 2D0GA 4UM9A 2FE0A 5GGQH 5CBAB 3MRIB 5LBVA 2H47C 4ICWA 3QEUB 1E3FA 4HFWB 5IBUB 5IUSA 2GW5A 5FW6A 2ROYA 1CDBA 3GSOB 5FUZH 4L2LA 4PJ6A 5F3FA 2OCJA 3BZDA 4DVRH 3CN3A 1FAIH 1T5KA 1OCOB 3SE6A 5MEOB 5CLWA 2MQCA 2X9ZA 3OQRA 3B9KC 2OKMA 1I9RH 3P3SA 5CEXB 3B9DA 2C1PA 5C0JA 2WWKT 2APVA 4FNUA 2PTVA 3VXRE 2E3VA 1LK3L 3PFUA 1GYCA 2J3SA 2H9GB 3KVPA 4QYAA 4EI5B 1HS6A 1HN1A 4PP1C 4UIMA 2JLPA 1EAQA 2YEZA 5GS0H 3JV0A 4U31A 1YC7A 5CSZB 1MI5E 4M61A 2DTSA 1NFDE 3BYTA 1GC1H 3W0WA 5PAZA 4QPEA 3T0BA 5KSBB 1EFXA 3SY0A 3KM2A 4RGNC 3I3DA 4W4OA 2KDGA 3ZQ9A 3CFKA 4R8WL 1CTNA 3WXVH 1I7UB 1T66D 4AENA 4MVBD 5EO1B 1O9VA 1SF3A 3N50A 5TFSH 4NUQA 4XVJL 1UM4L 3LS4H 3A22A 1H6TA 2NY3D 3UEQA 1S7QB 2GCYA 5J57B 3EBAA 1VHPA 1FH5L 3WI9A 1XGYH 1PDKA 4RZCA 1ZK5A 5EORL 1FZJA 1OV8A 4ZFFB 3WTTA 2CSPA 4V1DA 4NGHL 5I0DA 3GMOB 2IQ9L 3O41A 3GMRB 3GJFA 1RVFH 1YN7B 4O4YL 2JB5L 3MZGB 3VI3A 5H37A 2VE6B 3O2WH 1QEWB 1A14L 1P6WA 4TUUA 5FYKE 1H3PL 3SGKA 3S36X 2BMKB 3CVIH 3SO3B 3X3FH 1TT6A 3UC2A 1DO6A 4LLUA 1FNAA 1KEMH 3B34A 1S9YA 3PFQA 2VDPH 3PWLB 3LRSB 4UOQA 2J8UA 4KKCC 1NSNL 3AADB 4OH2A 5I1KH 1I75A 5IJDC 1P7QB 4AKOA 1OKEA 5GZNC 3IJHB 3ECWA 3ZE0E 5LDSA 3O3BA 2Z6FA 1NH6A 1OE2A 4JKPH 5E4AA 3O11A 3VXSE 3WGVB 1F3DH 5EA0L 1COBA 1J1OH 3LHPH 2EUXA 1IJNA 2PPAA 3O9WD 2ICEA 4X6CF 2D7TH 4WI4A 2IFFL 5GS3A 1GTNA 2ZQKA 1T2XA 3TPKA 5HHOE 5DRWA 3EFDH 4MMXB 1DVSA 5DJ2B 4OZIF 4KVCH 1BFVH 5F1SA 4BV1A 4BZ2A 4HXBH 1DQQB 3CVHL 3WEOA 3QFJA 1PG7L 4WI6A 3UAJD 3TA3C 3RVVD 1FG2B 1OF2A 2P45B 4DP5X 4OFDA 2NY0D 1VGKB 1BDYA 3FUNA 2CO7B 3O3DB 5DWUL 5IMOA 4JY4A 1MWAB 3FCTA 4PJIA 3ZKMD 4F37K 5E2UL 1J11A 3U4BL 4LAJH 5E1IA 4G7YL 5FF6B 5D7JC 3NCFB 3ZT6A 2PW1B 1WIOA 1UJ3A 3K1KC 1YJDC 2YD9A 3KPMB 3EG9B 3P73B 4Y2DB 3V55A 3CSGA 1CLOH 5D6CB 2EEBA 3MRNA 2X40A 1FA4A 2VDNB 2W9DL 1Y6MR 2RCSL 4WW2F 4LRNL 2CUAA 4ODVL 1AYOA 4ZMOA 2YPKB 1XF1A 2DWEB 3KPLA 3W82A 4GQQA 1JPFA 2QTEA 3F7VB 3LB6D 4WO4A 1ZANL 4DKFL 2QPFA 2LR4A 4M7LH 5FM5M 3LN5A 1GGUA 2CR6A 1MCBA 4G6ML 4L05A 1S7TA 3MV9A 1JXDA 4KZ0A 3AG4B 4KPHH 2DPKA 2ARJB 1GCFA 5CEYA 1KGYE 3LEXA 4PGDB 3GQFA 5DJAA 4U6VL 2HX9A 4RWHA 4QO1A 2XTJE 2JSFA 2RFXB 3OAWA 3HC0B 5D72H 3KBPA 1QSEE 5IFHL 1BJ1H 2EH7L 1CICD 4JO3H 5DHVA 3VXSB 4BXSV 3RP1A 3JWOH 4I3SH 3IFNL 1MFCL 1YEHL 2EYSB 5E99H 5I1AA 3DV4B 2GIYA 4PTTA 3N41F 1A7QL 4HOMA 1OHQA 4I3RL 1UA7A 3EOAA 4QHLB 3I84A 3TT1H 2PXYB 2NQ3A 3QUZC 3VGBA 2IXQA 3GGWB 3PXLA 2VRKA 3WTUA 3D4CA 5ISZB 2B08A 2ZF8A 5DD6B 4QRFA 2H3NA 3HZYA 4TVUA 5IHUH 2NY5C 2A6KB 3TO4D 1Y0LB 1CFNA 2AV1B 4H44C 3SCMB 2B3IA 2DAVA 4I2XE 3L1EA 3QWNA 1SGKA 3QI9C 5HI3C 3ILEA 1FBIH 1MXGA 4MBRA 4YOKA 4LSDA 1N8ZB 1KCLA 4N6RB 4V2BA 2JJUA 4OIIH 5MEQA 1ONQB 1BQUA 3VXPA 3TA4D 4OTXL 4RSYA 3T0WA 2EDMA 3OAUL 4CW1A 4JQVA 5D7IB 4XWGL 4TXVB 2E7HA 1XMEB 1N0XL 4Y4FC 3U1QA 4YHPB 5F88A 3WFHB 2BC4B 5D1ZB 3X17A 3OKEA 2VDRL 4LDCA 3B2DC 5ANHA 2F54B 4MWFB 1MWAH 3PNWA 3APDA 3QG7H 2BNQD 1I3VA 1MOEA 2NUTB 5GS1B 1IBGH 4A39A 3B9AA 3V4LA 1YQVH 4AYID 4RX4A 4LBEA 4MMYA 4S0SD 4XN5A 2BNRD 4KY1H 3V4VA 3PABA 2GJ6A 3S3CB 1JWSA 1FL6B 2VDKB 5JW4N 4G8EA 2VDNH 1UD2A 2AEPH 2G75A 2VZOA 4FXKC 4Y1AD 3N85H 3GXTA 3BXNB 3OV6A 5L4MA 2I7OA 4QRTB 4NKQB 1ZLWK 3KVQA 4YR6A 2E86A 3MV8D 2F53B 2F7QA 3L8QA 4QDGA 4N26A 1CTOA 2X1XR 4ANVA 1VFMA 4X8GA 3TBVB 2FWUA 1J8HD 3O6FB 4D7BA 1Z9OA 2V8MA 1YMMB 4PRDB 2CGZA 3RU8H 2CBQA 2ZOWA 1GS6X 4K94L 3H0TB 3VXMA 3WTWA 1G4MA 3ZDYE 5C9KA 3UAAA 3UTQB 1OE3A 4FQIL 4HHWA 4ELDA 5HD8D 1V55B 2QBWA 1FYTA 3KCPA 4X8CA 4YDVA 3V7MA 2FL5B 4M1DH 5ID0A 1TQTA 1T1YA 4HWBH 3HEIB 3GSQB 4TNWF 4WEBL 5K9JH 3BKJL 3EDJA 1L9PA 1TZ8A 3NGBB 4PSPA 1F3DJ 2CO6B 3R1GL 4YJZL 4PJ8B 2CM6A 2DI9A 4I0PD 5IQ7H 3GI9H 3R19A 4K8RH 5KZCD 2XY1A 5I6OA 5JHDA 4ONFH 4IOIA 4NAJA 3S4SG 4ZDHB 4JE4B 4FYSA 4Y5YA 5IK3B 4RIRA 2MOVA 2CGRH 1WHPA 1NPNA 2F58H 3D69A 4I3GA 5AVTB 1HIMH 4G6JH 3KLQA 4NDMB 1CIUA 5LUMA 3LPWA 3PWVA 3LXBA 4ANWA 4KXZH 4EF3A 4N8CL 3EGXA 2DIEA 5K33A 1I8KA 1NEUA 2NY4C 1FGNL 5JHAA 4GAJH 4ZUWB 3IJEB 1UZ8B 3LRLA 5C0FA 1KEGH 1EDYA 3EW3B 2Y22A 4AEFA 3AB0B 4L1LA 4DERA 2CK0H 3EJYC 1BJMA 4PWIA 5T3ZE 4Z8FL 5DC9B 3N04A 2MKWA 5DJ6B 1JGDB 1C8PA 1W9XA 1FYHB 4PBDA 3SYCA 2I07A 5HYJA 3MGAA 3B43A 4HQQL 3WELA 3F5WB 4ZW5A 3AW5A 1N26A 1JGVL 1RIVH 1A4KA 1RUAH 4JHWL 5D7LD 4HS8L 1NGPH 2OJEB 3NUKA 1V3LA 1FAKT 4L5FE 2IWKA 3MCKB 4FFYH 3EYFB 3RFRA 3PGDA 1G6VK 3VCLA 4DKTA 5L0QB 2JWYA 1CK0L 4PSRA 5BVJB 1IAOA 4IMKA 2JTYA 4HIPA 2E9IA 4M5YH 2XNAB 1SM3L 4CDGC 2BVTA 3O4LE 4GSRA 4M4PA 4NO2B 4WHCA 3QIUD 5E56A 1XH1A 2CKNA 3QDGB 1L3NA 1QFPA 2F8OA 1IC7H 3T0EE 1VCBC 1RPKA 2VDKH 2X2YA 4KK8D 4NZRL 1FZOA 4AH2B 5D4JA 1U8PB 3ERXA 4HMCA 1MVUB 3VXUA 5HYEA 3ARGC 4NZDA 4IM8A 3G5ZB 3V5DA 2QGEA 1T03L 1QWHA 5KBKA 2HXAA 3PWPD 3B2VH 1IAIL 2J2ZB 1I82A 1BJ1J 3DK0A 3QDME 4AC4A 5C0IA 3S0PA 1ZDSA 2G2NA 3ARBD 3MRCA 1KFAL 3KXFB 3BUBA 2ZYHA 5AZEH 4X98A 4N2BA 1CDJA 4B97A 1L9RA 2C9RA 1QFWI 3QH3A 4LASL 1DE4B 1OPGL 1QSFD 3FN3A 2FBJL 5JXEA 5J7CC 2QV2A 3PHQA 4OZHE 1IM9B 3BH4A 3WIHH 5IJKA 5IEHA 5ENWA 1I1AA 4HIHA 3T0XA 4GAYB 4B9JA 1KYOK 4LLVB 1ICTA 4CILA 3DGGA 4PUBH 3GC3A 1NZRA 4HETA 4AQOA 2O5YL 3EJSA 3QUHA 3MJ8B 4LVEA 3C6LA 3UAJC 4JFYB 3RVVC 4OFIA 2PCFB 2OMZA 4UTBL 4URKA 2J44A 2JI1A 4A1RA 3CFDB 1J0JA 4JAMB 5DMIL 2R0ZH 2DQTH 3VG9C 2DS4A 3HRZB 4QRPD 3BKYL 1AIZA 1XD1A 4LDEB 1NA8A 2ZOOA 4Y4KB 3V2AR 4AQAA 3MUZ1 5L4FA 4UQIM 5EF1A 3WMPA 4Q52A 2VR4A 4JRFA 2VB5A 2HG5B 4Z7IA 2AK4A 4OJYA 3RPBA 2GPZA 5H94A 4LCYB 4F3FB 4YHNB 1YPZA 2XQBH 5G4OA 4WU5B 2XIBA 3SZ6A 3GPEA 5KBNC 3QUMA 1QBBA 4CMMA 2A6DA 2YK1H 4PU2A 5ILTL 3RY4A 5E24E 3LRHA 3QQXA 5FA4A 5F9JA 4NBYB 4EVNA 4WW1A 1WP6A 1HH6B 1PCXA 4EI6B 1MJJA 4QXGH 5CZVL 3NA4A 1TEFA 5JDJA 1YEDB 1QWUA 3T2QA 5JHLH 3GT6A 2CO4A 2EO7A 4O5LL 1IE4A 4DHLA 4HJIA 1CF8H 5EOQH 4MJ2A 4KQ3L 3F7PC 1AXTH 4QTHB 2BVQB 3HS0B 3MROA 3GNMH 5DK0A 5C0DA 3LXUX 5EFIB 5GGVL 5AVXB 3L7EB 3SQOL 3QQDB 2ZKWA 1YEKL 3H3PL 1YLBB 3TCLA 1MFDL 1A1OA 3CUPA 4XMLL 4H1LA 2DQJL 4FQXC 4PJCE 4OZHB 5IB2B 5IFAH 2NR6D 3UBGA 3RFZA 3N55A 3SPIA 6PCYA 2YBRB 4TN9A 1LO4L 3IS1X 5J9PB 3T2NH 3D85A 4TLSA 3V9CA 3V6BR 2R2HA 4FL4B 4AYGA 4NIYE 5SX5K 1OGAB 2B4CL 2JKIS 3ESOA 1CXHA 2OMYA 2ZYIA 3G5WA 3OPUA 4JG9A 3NYKA 4OM0L 4M1CC 4XVTH 3L4ZA 4WSJA 4LZKA 3VSQA 2V7HB 4WSGA 1BQLL 4IRSC 2I9TB 3DECA 4Z7WB 2D7OA 3FHEA 5C09E 5E1AB 1MLBA 3VM5A 1E2ZA 1SQ2N 4P5KA 2XJKA 4YHOH 1UUNA 4Z23A 4DPBX 3D51A 1GXEA 2ZG3A 3PJNA 4HUNB 4L3AA 3KPSE 1LNUA 4IKNA 4R7DA 1UKQA 1EXUA 5EZJA 2XV3A 1SHSA 3MHZA 3UCRA 4FTVE 4PJDE 5B1JA 3TIEB 2D03L 2FECI 2J7LA 5GJTL 1U2YA 2YXMA 2O61A 1QR1B 3WN5A 1MCEA 1SUHA 1IVLA 1HZKA 4AL8L 3QS2A 5LQBL 4AQEB 1O6SB 5MI0C 1WZAA 3C6EA 2BOBA 3MFFB 2X4NB 1IQDA 2Y3AA 3POCA 1O5PA 2KLTA 3V4PB 1GYWA 4Y9EA 5IMLA 5D7KE 4I9WE 1YUKB 3GXMA 3LKOA 3RWDB 2JELL 4MNGA 1DBAL 4JFWA 2H7WA 1TTBA 1ACYH 1GZQB 4OF3A 1F3JA 4JRXA 3BC9A 2DBLL 1D5BB 5KSUA 3DX8A 1FE8L 1UWGL 5C2UB 1DEDA 5D1QA 4EXPX 2FX8H 2IAMD 1AD9A 1FUNA 2VGLM 4UV7L 2WIIB 3AG1B 2G9KA 3FRUB 5HDOA 3RTLA 2Y5EA 5IUCA 4DW2L 5KN5B 1HWWA 5D5MB 3KYMA 2VQ1B 3UBFA 1F8TL 3V0JA 1WWWX 1DDHB 2D7MA 1ZSDB 4TKWA 5I6MA 2ZPKL 1DL7H 3GJEB 4KROB 2P9RA 1TKWA 2Y7QA 2FTAA 3CFNA 3CZGA 4ZTPL 3H2PA 1DN0B 2EDKA 2M8XA 2NDFA 5AZ2L 4NNYA 3RLSA 1DFBL 1D6VH 3GYRA 5L88L 3WKML 5F70A 3QXDB 1VSCA 1MF2L 1W8EA 3LRKA 3KLLA 4P5MB 4PJXA 1G1YA 2H32B 1LQBC 1JYVA 3GSNB 2DLHA 5ADOH 5E8OB 5EU4B 4U49A 3KPQB 3N40P 3I9GL 1NINA 3UJTL 1OZTG 2MSPA 2VLJA 3MLTA 3QYMA 4AUJA 4PVMA 1PW3A 2VT0A 3DTDA 2IWGA 4HKZB 4L8DA 1BBDL 3KPSB 3BPOC 3OKNA 5D4HA 4LL1A 3PL6A 1J87A 2Y24A 2FDBP 1Z7JA 4FTVB 3QHZL 1U9KA 4PJDB 2D7PA 1WZLA 4HCIA 3EH3B 3TZVA 3LTVA 2ROXA 4FD0A 5FAAA 4G8FA 3SE4A 4JFVA 2JCCF 3BAEL 4R8WH 3LSOA 2X3BA 2O6EA 3DO4A 3ME0A 4EOWL 4F20A 2CLVA 4ZUSB 3U7WL 1UM4H 2CRIA 1FL5A 1E27B 1RIHL 2DMBA 3FUJA 3K6IA 3O4OC 4E9QA 4OT1H 1WUNT 3BHBB 1ZLEA 2WP3T 5EU6D 4IMLA 2WO3B 3MRPA 5SX4H 4JFHE 2YGOA 3CVDA 3GXUB 4IIQB 2NDGA 1LYQA 1BZ8A 2UZPA 5KJRL 5JUEL 3LN4B 2J88H 2Q7NA 4S1DC 3ZMEA 5SWSE 2G4GA 1E9OA 3SEPA 4YUEH 3ZZLA 2W9LA 5BS0A 3DDGA 4E2OA 3A5VA 3QJVB 4MYPA 1F6AB 1P9MC 4XVOA 1QRNA 4GSQA 3IJSB 1L7TH 3OLEA 3IU3B 2EYRA 3V4PH 3RWGA 5HPMB 1JYNA 2H2PD 2YJLA 2Z34A 4R6UA 3CX5J 1NSNH 1FPTL 2ADGA 5D4IA 4YXKL 3BAXA 3VW3L 3S35X 1ND0B 2WVVB 3D7PA 4PCKA 2MHAB 1U3NA 4ZSOB 3INUH 5DJDB 2BX5A 3H9ZA 1ZJAA 4WSKA 3VFRA 1F3RB 3IRPX 2G3ZA 2JLLA 3BZ4A 4I85A 4MQSB 4PTUB 4UTAA 3LQAH 4ONGH 3R8BB 2V5TA 2DICA 3F6JA 4W9EC 2FSEA 5C07E 2DV6A 3ARFA 3D3VE 2AEIT 2FX9H 2YMXL 3AS1A 4MCYA 3SGKC 4H25B 3ARBC 1YQ2A 3FU6A 1KT2A 1UEMA 3IGAA 4PS7A 3WJJA 4B5ZA 2LVCA 2AZAA 1TTCA 2K78A 3FU8A 4TNVF 1RY7B 3J8F7 1G1KA 3WE6B 4ZMTA 3ESVF 3D2TA 1Q9OB 3EADA 3EH2A 3X13A 1UJTA 2WZ0A 4ZMAT 3OXSB 1Y7VA 5ADPH 5IIEB 5MEPB 1ZXQA 12E8L 4FJZA 5DWUH 3VFTB 1YEGH 4GPVA 3TTYA 3WEBA 4G7SB 1DANT 2YPLB 4OZGA 3U4BH 2H32H 4G7YH 3GSNH 1HILB 3M17A 5KBDA 2PF6A 2V3DA 1JV5A 1OZUA 2N4IA 3IF1B 4JZJA 4GBXB 3B7TA 1AC6A 3RGHA 1H3VA 1EAPB 1OOAA 2OXHB 2W9DH 5H2BB 1TJMA 2RCSH 1ZHLA 4LRNH 4TNGA 4ODVH 3V6OE 4QJ4B 3VXTB 2XV0A 2VSCA 5JOFA 2R23B 5LAPA 5DLMH 1HXMB 1R3LA 4FNLH 2O5NA 3SJVD 5CCKH 2RHEA 1E4XL 3SDCD 4MSWA 4QHNB 4P46D 4AVHA 4H4NA 5IB1B 1E9QB 1BGXL 2YWZA 4UQEA 5I76B 4LARL 1FFPA 4KAQL 1WFOA 1XMWA 1R24A 5FR3A 4ODWB 1J9CT 2BSSA 5EBGA 3T2OA 1MCPL 1FFRA 2BVUA 1R3KB 3BQVA 3MRBB 2W65B 3B7SA 1S7UA 4HWZB 4N2EA 5EV7A 1VFOA 1WA1X 4QRRE 5DHEA 1ED3A 3LNGA 3UG5A 4PW4A 3AU0A 4YQXH 5ACMA 3VD7A 2CU9A 3K2MC 5E9DB 3RL2B 1F6LL 5A7EA 2HFFA 1WHOA 3LIZA 5I0XA 4IHBA 3U4EB 1RZQA 3DUUA 1JL8A 3L7FB 2IFGA 2Q2LA 2XQ0A 4X7FC 4XNXL 4XN8A 4YHZH 3VG0L 4KO6A 1PLGL 3VGGA 1KGXA 5FO8A 2KC0A 5FGBC 4UMGA 2A3TA 4ZODA 3DMMB 4RGOL 5IB3B 3LKQA 3ZQXA 1G6RB 4PRBB 3RQ3A 4HVBA 1YEEL 3TBWB 1QSZA 2FB4L 3BPCB 5EUOE 5J06A 5IF0A 5E5RB 4JM2C 1R0AL 1TR7A 4UWQB 4DCQA 2OMBA 1U8OB 3DROB 3SN6N 1FGVH 4ANXA 2OMVB 1SPDA 1SN0A 1HHIB 1J1XL 1MH5A 4L3ED 2XVLA 4ZG1A 4PVNA 2OMXB 4IQHA 1G1CA 5DJCA 2PKDA 3QO1A 1S7RA 2E0PA 3K6DA 3M46A 5CN3A 2BHYA 4NKDA 2YOAA 4KK5D 3DUSA 2FO4A 4XWGH 3MRHB 1CLVA 4CVZB 4KTDL 4FNSA 1FSKC 2ZWZA 1P4IH 5AVUB 1PQZA 3MGOA 1KJ3L 1R17A 4U4IA 3STLA 4DSYA 3QJHB 5EWIL 1WZKA 5AW3B 4JRYB 1A64A 1R46A 1S7VB 1X5YA 1WAAE 5FWQA 1UZ6E 1G5GA 5FYLH 1OK0A 3HVDA 4BZ1A 5B1AB 3D25A 2EEDA 1A3ZA 3HOGA 5ICZB 1I1FB 2ZCLL 2AQ3A 4U7SA 1AGEA 3D2UD 2Z35B 3JXAA 2NW2A 4QXUL 4TQEL 3IYLW 2GTWB 1EDQA 1XCQA 3OSVA 3SKOB 2Y4SA 2CHDA 3O2VL 3WFCH 5HXMA 1CFVL 4PJAA 3BZEA 4JQVC 1KYFA 3QEHB 2OW6A 2OJ1A 3NSJA 2GI7A 3TC9A 1FC1A 1RLWA 4OGYL 2OZNA 4F2MB 3ASWA 4LAQH 2OMWA 4QRRB 2L7JA 3TBYB 2J6EL 3QPXL 3WO4C 1PAZA 1OP4A 5JIPA 3RDTC 1EGJA 1PPIA 4MMZA 2YKLL 1AZZC 2XX0A 2BWDA 1RL1A 2EDBA 1IV8A 3UO1H 2GIXA 1A8ZA 3UPCA 2WINB 9CGTA 4JL1A 4M5SA 2ED9A 1NOAA 3VFOA 5KYXB 3VAEA 3L6FA 2P7TA 3GTTA 3RGVA 4OD3L 1G4RA 2AJXH 3HHMA 3WEXA 1TVBB 2CIIB 5T1LD 3QORC 3MJ9A 4BA8A 5I8CB 4RFOH 5BUGA 2E7LC 4LO9A 4OCRH 4EN2A 5LBSL 3DHMA 2PTTB 1CU4L 1P84K 3R1GH 3MBEC 2ZTBA 3VI4E 4E68A 3E1ZA 5I0ZA 5LLIC 1DCLA 2XWTA 3VXOA 1TJHL 3DYOA 4QAWA 3VB9A 4L8SC 5L6YL 3QR2A 1IFHL 3WMQA 1XIWA 1OP5H 3ZIYA 5KAQF 1IRAY 4OF5A 1CMOA 4PRPA 1WBXA 2FQEA 4WK4B 2JKTM 4P3CL 1G6RH 5ERWA 5BZXA 4WI8A 3X12B 3MV7E 3IE4A 3KYNB 1U3HD 4OCWH 3MYZA 3L4CA 5JIHA 2XVGA 4LLYA 4HEPA 1KTLA 3ZQWA 4HJJH 5IP4A 4ALAC 1R5VB 2W5PA 4N8CH 3Q1SH 2IPUK 1W72A 3MRFB 1HI6B 2ENPA 2BINA 2BP5M 5EEUA 1QVOA 1T0OA 1CD9B 2XN9E 4Y2NA 1Z3RA 4GS7C 4FE9A 5T3XL 2APTA 4JQIA 3FQ2A 1KLGA 2YR3A 4NC1C 3ZBMA 1NAKL 2BVPA 3I9IA 5DO8A 5FYKL 5LCVA 4KMLB 5KSBF 2XYBA 2BZ7A 4P4RB 3NP3A 1JWUB 3BSZH 1DO5A 4XX1E 2Y69B 1F4HA 2ZXQA 4JG0H 1MHEB 3LZLA 2D3NA 4B27A 5KTEH 3T4AB 3QJQB 2GK2A 2ENQA 2GBVA 4UMSA 5C6WH 1CK0H 3L4WA 3K2IA 4GG8B 4YXHL 4GSXA 1CYXA 3QWQB 1NCGA 2VITB 1AC0A 2ZXGA 4LP5A 1SM3H 1CDUA 2P5ED 3QIBA 4PLJD 1N19A 5F0JB 5T1MA 3N44B 3S37H 4X7TB 2VMDA 3LHAA 3DX0A 1U8MB 5T1DH 4KRPC 4MTMA 3RTQC 1KXQE 4LCWB 1M05B 1FV1B 1T03H 1TYEB 3BQUD 4IGBD 1IFGA 2RACA 3WS3A 3S4SA 3O3AA 2WQRA 1DJXA 1SEBA 1SVCP 1RPQA 4S2SB 4N5ED 4PJ9A 4LASH 3S98A 5GS0D 2R4SH 3BN9D 1OCRB 3UACA 4NXSA 2P24A 5C0CE 3WV0A 4XNUL 4AJ0A 4HK3J 1SYSB 1MG3C 3MV7B 1FFNB 3OB0H 4LMQI 2P8PA 2WXOA 1RURH 5FO2A 4DK5A 3FUEA 1JHKH 2CCVA 3MXWL 3KPRD 1UCBL 4G42B 3FT9A 2CJUL 1EHNA 3LV3A 4PJEB 2VN4A 3LZNA 3BD4A 4HH9B 1LHZA 3MKKA 4JZNB 3TPUB 2NY6C 2DIJA 2O5YH 4JCMA 2F68X 1KGCE 4OV6F 3M07A 5CBEA 1EO5A 2XN9B 2GITA 3HS8A 4PV9B 4GQ9L 4WI0A 5DFVC 5JIMA 4B7LA 4AMKH 2EXTA 1XF3A 4WWNA 3PQYA 1WBYB 1Z9NA 1DJZA 2CMRL 1PLAA 3PIQA 4PBXA 1ZTXE 1N3NA 5F7YC 3UGUA 1LD9B 3MRLB 3OBAA 2X42A 3BKYH 4XN9A 4HLZH 4X42A 1U33A 3TJPA 1VB9A 2FT6A 2ZAIA 2CPCA 3ARVA 3B3BA 1SJEB 3QJXA 2FWLB 2ZP0T 4GKZA 3ZE1B 3O9WA 2ICWI 4WAFA 1KCRL 4JN2A 1M2OA 2VDOL 3C6LC 1OT2A 5TJWK 1JN6B 1SJHB 3VGAC 1BG1A 2ITDB 2MOGA 2YAPA 4NRYB 3TESA 1BQKA 1NGXA 4Q9QL 3FW6A 4KO5A 3ZMNA 4B7IA 3FAXA 4P46C 5EEVA 4A7SA 5AAWA 4H0IA 4G8GB 1N0LA 5EIVA 3FQRB 4O5LH 4YK4B 3UAEA 4X7EC 1J05B 4GI9A 5IVXB 3ETSA 4UILH 3ULVL 1S3KH 3AQDA 4KQ3H 1H3GA 3ARDC 5JW5A 5FOBA 2WCGA 4CRPA 5B1CA 3EYSL 4GRLD 3SDDC 3GRWA 3OMNB 5GSVA 3C5ZC 3US0A 4K15A 5GGVH 3VD2A 1A1NB 2XC8A 4TLKA 1WBZB 3GTVA 4U4BA 1KDJA 3BVWA 4TTDD 4X6DA 4HK0B 3H3PH 4FKHA 3AZUA 4XMLH 5ESVB 5KG9B 1CE6B 4XAKD 4NWTL 1TDQA 4KV5E 4PRHB 2X7LB 4BSVA 2WXPA 4HUMB 5CJQL 1LO4H 1XR9B 4RH4A 4F7EA 2K6ZA 4U6YB 3W0WE 1X5AA 5IHZA 3RWJA 5IM7B 1U95A 4YSTA 2PNDA 3ENEA 3C5SB 5IVZA 2NY2C 5HDBE 4NYLA 4EI5D 3Q6FA 4R7NA 3TT3L 4LB8A 5IBTL 4FX5A 1E4KC 3T77B 4J2XA 3THML 1YUHB 4G2AA 4G82A 4BE5A 1B2WL 3NZUA 4EUPB 1OSPL 2BJML 2DQFB 4K71C 3ZYJA 2B16A 2CLRB 4GJTB 4S1SL 4OJEH 2WKOF 3OXRB 1CICA 3H4FA 5A2BA 3NSFA 3LX9A 3UH8A 3BW9B 4MASA 3R4RA 4WTZG 4LKCB 2V8LA 3QVAA 1UD3A 4U1GB 3TWCH 4O2CB 4AVIA 4CNIA 3H53A 32C2B 5IQ9B 4O2FB 1OGSA 4MDJA 1RJYA 4OFKA 3FTZA 5CFHA 1ODUA 2YWYA 1FC2D 2GY7B 5D7IF 4KKAC 3E3QC 5DGQA 5ANMB 5GJTH 2LOEA 2MTPA 5GXBB 3CCHB 3Q06A 4YDZA 3T04D 4ANKA 4BFEA 4Y2OA 5LQBH 5GJSL 3KMDA 4YDNA 2VMFA 2R27A 1J88A 2GSIB 1A6AB 3EHBC 2NT1A 3TO4A 3LN9A 4X5WA 1T1ZA 1OAYL 2W92A 1BYPA 5D2LE 2YPVA 1NGYB 1BZQK 4N0UB 1BFOB 3CAFA 4PN6A 3BP5A 5AVYB 1E30A 3T08A 5F3BB 1H15B 2ZF9A 4AKPA 2H26B 2M2DA 1DBAH 1R3JA 1AGCA 4BQCA 3DO7A 2Y23A 5EBWA 3AS2A 4FQHB 5DQ9A 1QI3A 1IAMA 3OKMB 2XZZA 4F57L 3NIGB 3FNKA 1XWVA 3V4UL 3IAPA 4GW4A 4ZZFA 3D4YA 1ANUA 4ZMWA 3VFUA 4KI1A 1ZAGA 2B1AH 4IRJC 1INQB 3B7YA 4JFEB 3H3BC 1F8TH 2Q6WA 3Q8BA 4ELKA 4HISA 2BNQA 2GI0A 1MCNA 2ZPKH 2P1YA 5AL8A 1ZPLA 4XP6L 1RMFL 4A7GA 3MA7A 3NCJH 1MPAL 4R26H 4W9GC 3FT2B 1DFBH 4HBQA 3HMXH 4QTIH 1HSBB 5HGBB 4AV4A 5JNYB 5L88H 2ED7A 4UT6L 1PKOA 5F96H 3WKMH 3JWDL 4Y1AA 1MF2H 4P2QE 4MA1C 1FVEA 2X0WA 3H9SB 3CDZB 4J5VA 1CFBA 2PO6B 5IG7B 3UYOD 1TQBC 3C8KB 3MV8A 2O1AA 1K2DB 3UJTH 1EVUA 1CS6A 3GZQA 2ICWA 5IJCC 1NIAA 3K7UA 2SEBA 1J8HA 3G5YB 4FC3E 5INDA 4NHCL 2V2TA 4IK6A 2H2SD 2OW7A 1Q72H 2A83B 3QCTH 4QT5A 3D0VB 3FO0H 4X6CA 4IS6A 4TS6A 1KWKA 4Y2DD 1F2XK 2EYTB 4L5FL 2B20A 2DKMA 2KZ1B 4QXTA 3Q2WA 1U3HC 2P80D 1S7XA 4QHPA 2VISB 3B6SA 4KJQC 1V7NL 1IM3B 5E6ZA 4EUPH 1JPTH 4FG4A 5GZOC 4EOWH 3RWEB 1ZTXH 2GKIA 2R69L 5DURB 2V6HA 2KZBA 3U2SB 5D2LB 4ZMPA 1KTDA 1XXFC 1BIHA 2L0DA 2WB1A 3VX1A 2ENSA 4AMWA 5F7AA 1I8MA 2YAEA 4ODHH 4I0PA 5JR1L 4FQJL 4P04A 2R7EB 3UYRH 4C83A 1IB5A 5J13C 2BCMA 4CBPA 1HINL 1ZMYA 2DRUA 2XWZA 3W11D 1P5UA 1CB4A 3WFDL 5KJRH 1NDMA 2VLKB 1N6QL 1OB1B 4RWYL 4BE6A 2R56L 3NRFA 3NSYA 1J86A 4N9GA 4HV8A 1AR1C 1XGTA 1N10A 4WW2A 3L16A 1A6VH 4WDIB 1OLLA 4KY2A 4C4KO 1B0GA 3VXSD 5AB2A 4LEXH 2PUQT 3KPOA 4PMEA 3RKDD 2NLJB 2FJHA 2I26N 2Z4QA 4K8RD 2H6PA 2F7OA 3QQ9C 4DEWA 2PXYD 4N1EA 1JVKA 3N1PC 3A4EA 4J4PD 3LKPA 4WEUD 1QFWM 2G9HB 1L6PA 5ISZD 1PZDA 4LSSL 4XBGA 5DU7A 4P2QB 2ZG2A 4U0RB 4Y5XA 4PJ5A 5DC4B 4BK8A 3SCMD 1A7NH 4HZAA 1D7BA 4IW4C 3ULAB 4ZYKB 1ZWIA 1I3GH 1F18A 1CG9B 3FC8A 4ODUB 3GSXB 5TK4A 1U93A 4N5EC 4ONHA 3L95B 2NNFA 3IJ7A 2ZP9A 1P7BA 4Y1TA 1O7DE 1B0WA 2AAAA 1M3JA 3IK2A 4NJAL 2WJ7A 3P2TA 4XNYL 3WIIL 1LE9A 3QIUA 5B3SB 1W6LA 3HE6D 2N7BA 2WLIA 1NIDA 4CAGA 1E3ZA 4H8QA 1NBVL 4L8BB 2AXFB 1DSYA 3H7BA 3FBKA 2VXQA 1WFUA 5C8JB 2IBBA 5D1ZD 1Z5HA 3MODL 3VFMA 1Q1JH 3GD1C 3PWPA 3MBWB 4LLQB 5FUCC 3GWJA 2F54D 5F9WB 1GJUA 5FO7A 5IT2L 3WE1A 3K72A 1Q0YH 2F1BA 2VC2B 3FQWA 2VDQL 2IGTA 3NFPB 4CUCA 4L3CA 1NGWA 1YDPA 3RA7H 1P69B 3C60C 2DJUA 4QCIB 2BVYA 5FV2A 1TCRB 3QUXB 3N42B 4RBPH 1QSFA 3N40F 3DGCR 2IALB 4MQXC 1OT1A 3GSRB 1SVBA 3L4YA 2V37A 4U6XB 3NDZE 4CDHA 1KPVB 1M7UA 4NT6B 1VGEH 1ZA6A 3VXME 5KAQG 3DVIA 2F53D 1JNJA 5IBUG 2Z91A 1RZJL 3CZUB 3T2PA 1MCPH 2QQNH 3O6FD 2AKRB 1T0NB 2WBJA 3AUWB 2YO3A 4PY8J 2Y7MA