3WU2E

Crystal structure analysis of photosystem ii complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 20
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 3wu2E00
5H2FE 5E79E 5B5EE 5GTIE 4UB6E 5TISE 5KAIE 3KZIE 5B66E 4PJ0E 2AXTE 3A0BE 3JCUE 3WU2E 3A0HE 1S5LE 4UB8E 5KAFE 5GTHE 1W5CE 4IL6E
chains in the Genus database with same CATH superfamily
3WU2H 1VQPP 1PP9E 2E75C 1JY3P 1XTCC 3H1HE 3SFEC 2PRRA 2FFDB 2JR8A 1IZNB 1NTME 4L73A 2YO3A 1OXZA 1SQXD 2YKQA 1DH3A 1N7SC 1G1IA 2XKMA 1RF1A 1FZGA 1JMBA 4BRYA 1OIPA 3CX5D 2W6JH 1SFCA 2C0WA 2QEXP 2R3CA 2FYUD 4PJ0H 3B8EB 5H2FE 1GW3A 2QG4A 1IK7A 2A45I 1DD3A 2R3SA 2O01N 1PPJE 1FU1A 3VMAA 2L91A 3F5HA 3O6QB 5EFWB 1AFOA 2SPZA 2O01H 1KYOD 5DJUB 5M1BA 1G2CB 5AVSB 1JTHB 4PD4I 5GTHE 5AVTB 2H89C 4I1LA 3QH9A 1RF0C 2XNDH 3R2PA 4D6TG 2IBZE 1LWUC 4N78E 2Z5IA 2CPBA 2N9BA 1EZVI 5KLVJ 1SQBJ 2O1JA 1H8AA 3L37A 3L70J 1JO5A 1PP9D 1QVFO 2WSCH 4EOTA 4XFJA 4OGQC 4Y99B 3H1LJ 3L71J 4RKUJ 1OMIA 1NTMD 3CXHI 3L36A 2ZJSE 3C9IA 1AA0A 3FGAD 2M8RA 1KTMA 2WQYC 1NTZG 3H1KJ 1LT9B 1GZLA 3L72D 1ZP0C 2YMYA 4HYTB 1K05A 1IK9A 2BCCG 2E74D 2XU6A 2WITA 1MZ9A 2WPRA 4H0LB 4NPDA 1GL2C 3VN0A 1DX7A 1SQPK 3H1JD 3A0HH 1LTBC 1MKMA 1JCCA 2A06E 1PPJD 1X0TA 3LW5H 4N3YB 1LP1B 2QIWA 3TNUA 3IN6A 3CCMP 1SQVG 1NAYA 1CZQA 1MFZA 2W27A 3CC2P 1Q7YQ 3H1IJ 1N73B 4H44B 5AVXB 2IBZD 2QVAA 4N78D 4H13D 1VF5C 1RF1C 2ZT9B 2Z5HA 1SS1A 3N4XA 1L0LJ 3I55P 1J1EC 5GTIE 1Q86Q 3CWBG 5AVVB 1NTKG 1SFCC 3RL0D 4LGDE 2WZ7A 5H2FH 1OVUA 3RK2D 3H32A 1K73Q 1GK6A 3M0DA 1EDJA 1AVOA 4GODA 4JBZA 1S1CX 4GDOA 5GTHH 1OX3A 1SQPE 3E1IA 3NXSA 4UB8E 2Y0CA 2KIKA 3D70A 2C9LY 2O3JA 3AE9C 1U7MA 1X22A 1VQLP 2WSFJ 1G1JA 1NO4A 1N2DC 1DD4A 3IAOA 5APYA 2A45G 3BCCG 4Y28J 2MJZA 2HODA 1EDIA 2BASA 3Q5RA 1ZN5A 2KLVA 2GA1A 2IPPA 4DZOA 2PAJA 2AXTE 5KLVK 2GUVA 2JJLA 5KLIB 2HYNA 2YNYA 3ABVC 3KYQA 1S3JA 1VQ5P 1CI6B 4YXWH 2QJYC 1SQBG 1EZVG 4L74A 3L70G 2K37A 4RESB 1BSHA 2GM4A 2KNCA 2Y0EA 3H1LG 3HE4A 2PFXA 1NGMB 1EC5A 1URQB 4HB1A 1BE3G 3E7KA 1SQPD 2Q3EA 3D6ZA 2Q1KA 1JMMA 1KB9D 1J1DC 1T8ZA 1L4AD 3TGUJ 4I7ZB 1S2EA 3H1KG 2K9YA 3FXEA 2HFED 3IR9A 2WWWA 3PH0A 3CC7P 2QJPB 1ZRTD 2KUBA 1P84D 1JM0A 1NU1G 1FZCB 4U3FJ 3MIWA 3G3ZA 3M06A 3MHVA 2E74C 3WUVA 3RGUA 4KHXA 4EDFA 5KLVE 3HD7B 1SQBE 1EZVE 2K9JB 3L70E 4A7PA 1L0NK 1S4XA 5APTA 2HG5D 1BGYD 3RBZA 1N7LA 1JNMA 2WT7A 3H1LE 3L71E 3I56P 4B86A 3M0DC 2FXOA 3V2QA 1L0LK 2W90A 2R5DA 3Q5PA 2R32A 2QE7H 3O6QA 3MGNA 1L4AA 4D6TJ 4UB8H 1SQXG 2W8ZA 3AEAC 1G2CA 4M3LA 1JTHA 3PHLA 1IJDB 3H1KE 2KI7B 2Q5UA 3VMXA 1PGOA 4OGQD 1LT1A 2E5TA 3U59A 3AE7C 1KFMA 4H13C 1QGKB 4OH8B 2N1TB 5KKZB 1JCDA 2G3AA 1BCCD 2JEEA 3RL0C 2QM7A 1FDIA 2OYHB 1IO4A 1R5LA 1NTZJ 1OW7A 3CCRP 3AEBC 1YJNP 2AXTH 4IL6X 3V2PA 2MKVA 1T2KC 1T3JA 2HPCA 1OZHA 2JO1A 5CJ4A 5KJ7D 4EYYQ 1KQLA 2BCCJ 3H1IE 3OAKA 3TYYA 1A02F 3NTNA 3GHGA 3Q5SA 3EQ2A 1VQ8P 1LT9A 1K8AQ 5KLVD 4CPGA 4RJTA 1OFCX 1S9KE 1L0LE 2V7QJ 2IZ1A 1SQVJ 2JWDA 1YITP 3PLNA 1M1KQ 3EFFK 2RH0A 2PP6A 1PV3A 3L73G 3VP8A 2OYIB 1LTAC 1JB0J 1VF5D 5AW1B 1LP1A 1RY3A 4IL6E 3H6PA 5E79E 1KC8Q 4R4MA 1FOSE 1SFCD 1KFNA 2QJKB 1GTWA 3P8MC 2E76B 5KJ7A 1SQQG 2ZYAA 3CWBJ 1NTKJ 3AE1C 3Q1MA 2YIUC 1VQMP 3AE2C 3FWLA 4C7RA 2XZRA 2YKOA 1AQ5A 3VYIA 3V5BA 3U1CA 1JOCA 1NWQA 5TJHA 3RK3B 1WRGA 3L75G 2Y0DA 3BRTB 1VDFA 3TGUG 1UIXA 1GU5A 3WUUA 3H1ID 2I1JA 4JPZB 1XTGB 1L0ND 2KS1B 1L4AC 1ZR2A 2DW3A 2AEFA 1JUNA 4U3FG 3MP7B 3BCCJ 1L0LD 1M8OB 2M5AB 3OA7A 5APWA 2IFNA 1S5LX 3G9RA 1N7SB 3SFDC 3L35A 1KILE 1VQ6P 1GDTA 4IFFA 1U57A 3L74G 2R5BA 1VQOP 3LIEA 3N7NA 5CCHA 3GF7A 1VL2A 3HTKB 4XE5B 1NAFA 3GLMA 4WY4D 1FZFA 4PV1B 1N8RQ 3TGUE 5DJTB 1KV4A 1BDDA 1OVVA 3NMDA 3GHGC 3A2AA 4C7NB 1NTZK 4KJMA 1PL5A 3H1HD 3ITKA 3L4FA 3SSUA 1LT9C 4U3FE 4R4LA 1YTZI 3MUDA 1TU3F 2ZAEB 1BE3J 1LGHB 5APSA 2OQQA 1AJYA 3G4SP 4H0LC 1Y9BA 1CW5A 4IL6H 5E79H 1K9MQ 3B5ND 5AW7B 4AUWA 1QVGO 1AVYA 1NYHA 3O8ZA 1LTJB 1URQA 3L74E 2WPVB 1M56D 4WY4A 1SQVK 1IFIA 2ZFCA 1NU1J 3Q3DA 2J58A 4D6TE 2YKPA 1NOHA 1KN7A 2G8YA 5KJ7C 1E5WA 5BU8B 5L8RJ 2NPSD 2KZIA 2E42A 3CD6P 3Q2YA 2WSFH 4H44C 1PIXA 1KILD 1RHZB 1T6AA 3CMAP 1FZCA 3QWOC 5APXA 1K04A 4LLHA 2CPSA 2KLUA 3HE5B 1DEEG 3V2RA 2JWAA 4ASVA 2ITAA 1NTKK 3VMYA 2FYZA 1GL2B 3HD7A 2M0BA 1SQXJ 2KXPB 2D2CB 2K9JA 4WB4A 1NTZE 3B5NA 1FZEA 1DEBA 2AEJA 1ZW0A 3RK3E 3CX5I 1HVVA 5APUA 1YQ4C 3AEEC 2BCCE 5BVZA 3A0BE 4RO0A 1WMKA 3M9BA 2FYUJ 1HJBA 2NPSA 1T2KD 3G71P 2JKVA 5APVA 1KILA 1KYOI 4YTPC 1KZUB 1SQVE 1W2BO 2Q3IA 3LIDA 3MD0A 1YYCA 3CI9A 4K35A 2KYVA 2H43A 5K5GB 4BRYB 1BGYG 1J1EB 2FYNC 4JQ0D 1FBMA 4KT0J 2OYHA 3CCVP 5CCHC 2WSEJ 2A06D 3GF3A 3TK1A 3P8CE 4N6JA 4EI2A 4YXDC 5AW3B 3II6A 3CL3D 3AE8C 1H89A 3CWBE 4NPEA 1NTKE 1D7MA 3T97A 3KDPB 1R5SA 5KLIC 3BRVB 3L73J 4IOIH 5CJ0A 3GG2A 3MUDC 2NZ2A 1YHQP 1VQ7P 1BCCG 2WPQA 3D6YA 2M3BA 1SQBK 2LXBA 1W5CE 2B87B 2RKLA 4EIJA 1PGPA 1M1JA 4U7JA 1SQQJ 1FDOA 4GOEA 3L72J 2OYIA 1GW4A 1URQC 2FY8A 1ZLLA 4WY4C 1RE4A 2N9YB 3H1JJ 3JSVC 2B9BA 2FBWC 1HF9A 4W7YA 2CK3H 2P7JA 4I7ZC 4I6MC 1H0TA 1USEA 2WPSA 2OGUA 3CLQA 3BCCE 3PJSK 1SQVD 3CC4P 3ZDMA 4DOJA 2AXCA 3L75J 2QJPC 2P67A 1NU1K 2I8DA 1FZCC 1HGZA 4PD4E 2FFDA 1VPCA 3D71A 2ZXXA 5B5EE 1Q82Q 3HD7C 2IBZI 3S9OA 1N86A 3B5NC 2P10A 1EDKA 3V4QA 1OW8A 1Q2NA 4IFMA 2J5UA 2L5GB 1M90Q 1PFIA 1RE3A 3A0BH 3AE4C 3CWBD 3SWFA 1IFPA 1HTLC 3V6IA 2W83C 1Z56A 2RN0A 1YIJP 1IC2A 4UB6E 5C39A 1QX8A 1X8YA 1SQXK 1MFTA 2NPSC 3JCUE 3CPWO 3W67A 1FE6A 2V7QH 2XNXA 4GT1A 4YPCA 3L74J 2M5AA 1KILC 1ZXGA 1BE3E 1GMJA 5CBOA 3CXHE 3A3YB 2KZJA 1YJWP 3B4SA 1LTTC 1RQVA 5CHXA 2E74B 2LXCB 5CMZA 5AW4B 4WBAA 3AE5C 2OYHC 3OW2O 3HRNA 3CCJP 1NU1E 1KMIZ 2FYUG 3HTKA 4H0LD 3H32B 1MUUA 2JDIH 1GK4A 3CCEP 3BCCD 1W2EA 3AE3C 5KAFE 3JC22 1YI2P 1JY2P 4PD4D 1FZAA 3VOPA 3RBXA 4AQRD 2WSSH 1KORA 2KOGA 1VQNP 4OVNF 4H13B 3IFMA 4ZNCA 1SQXE 1M1JC 1M7LA 4H44D 2ZVOB 3M0AA 2KB7P 3RL0B 2OYIC 3TSIA 4K3AA 1OW6A 5AW6B 1SQBD 1EZVD 3L70D 3MZWB 2ZT9D 3RK2B 1PP9G 1LTJA 1RE4C 3CX5E 1ZR4A 2QSIA 3USSA 4Z1MH 1JY2O 2FYUE 2A45H 3H1LD 3L71D 1HWTC 1NTMG 1SQQK 1BE3D 1EXJA 3CXHD 3HUSB 5AVRB 2IZ0A 1JY2N 4BXLA 1KB9I 4PD4H 3S4RA 1KYOE 1USDA 3B71A 1KQSO 3H1KD 1LNQA 3AE6C 5B5EH 1SP4A 3SWYA 4ZKUA 2KSEA 1YQ3C 2FFDC 3L72G 3V2NA 1KQFB 3C1LA 4DCKA 2Q6QA 1JEKA 1N73A 1NU1D 1P84I 3RK3C 1E79H 1RH5B 4W80A 5KAIE 2BEZF 3H1JG 2WMMA 2YXRB 4MN4C 3OJAB 1RE3C 1U7JA 4UB6H 1PPJG 1NHLA 1L2PA 1HGVA 1J2JB 1R8EA 3JCUH 5AW5B 5CCHD 1BGYJ 1T3UA 3L73E 1Q81Q 4QMAA 3CXHH 2YIUB 5APQA 2YXQB 2E75B 1GU4A 4JF7A 3FX0A 2IBZG 2IX7C 2E43A 2K3RA 3KPEA 1IFJA 1S9KD 3PRJA 3CMEP 1SQQE 2XDJA 3L72E 1CSBA 4ZKPA 1Y47A 3I5CA 2Y9ZA 3UIAA 5KTBA 5AW2B 3H1JE 1IFNA 4PV1C 2WT7B 3KHUA 1JY3O 1A02J 4I2LC 3GMAA 1BCCJ 5AW0B 5KAFH 3BVHA 3AECC 1L4AB 2VRSA 2HLOA 1JY3N 1URQD 3L75E 1HBWA 3H25A 4Y99C 4WVZA 3S1KA 4GKGA 3M9HA 1FZBA 5AW9B 2B87A 3A7OA 1FOSF 4GOFA 2A06G 2K1AA 1S5LE 1KQGB 3CX5H 1CI6A 3EWKA 3VMZA 2UWJE 3BATA 1LTJC 3EFGA 2H8PD 3E1RA 1LWUB 3HD7D 3L73D 2HPCB 5AW8B 1BDCA 1HJ0A 2FXPA 1ZMEC 1KYOH 3GHGB 2J59M 3WUTA 2ZYGA 1YBKA 4OGQB 1FJKA 1PZQA 1SQQD 3V4WA 3CCUP 2V4HA 3A5TA 2YO2A 5KAIH 1N73C 2WSEH 2XV5A 1Y8AA 2D2CC 2O01J 1LJ2A 3P7KA 2N1TD 1HUCA 2ZT9C 1NH4A 1YJ9P 3U1AA 1SQPG 3L75D 1VQ4P 4NPFX 3TGUD 2OTKE 1VQ9P 3CCSP 1LTIC 2OTJP 1L0NJ 3BASA 3NFQA 1SVFA 4U3FD 2WSCJ 1OVRA 1H88A 2Y9YA 4TLFA 5CCGD 4HJGH 2H88C 5B66E 1VF5B 2JP3A 2HR3A 2N1TA 3WMM0 1RF1B 5AVZB 2B89A 3AEGC 3L74D 1SFCB 3G6EP 4XA4A 4D6TD 1KB9E 3PTZA 4O9BA 2OARA 3CCLP 5AVYB 1NJIQ 1EXIA 2E76D 3LW5J 1PP9J 1S5LH 4LC1A 2WTYA 2Q7CA 3H1HJ 1AQTA 1ZRTE 1P84E 5CCGA 2KSJA 4AYCA 1NTMJ 2FYNB 3FWNA 2IFMA 1EQ7A 3FXDA 4ZMDA 2AEMA 3AEDC 3AEFC 1NTZD 4L75A 4BWNA 2P58A 3RK3D 4ASWA 2IDBA 4OWFA 1BGYE 2BCCD 5AVQB 3HUSA 2BEQD 1X9VA 1PGQA 4TT3H 1IFMA 1QEXA 1LTSC 3C8VA 2E75D 2O1KA 2KK7A 3CCQP 2K88A 2IYPA 2B88A 5KLVG 2OYOA 3SWKA 1FS0E 2E5YA 2OTLP 3VP9A 5CBNA 2ZYDA 1BSNA 1N7SD 4C46A 3L71G 1NKZB 2C0XA 2QJYB 1BCCE 2LR2A 2ZXEB 4HKZH 1UIIA 2QRXA 3KZIE 1EDLA 4WY4B 1ZV8A 2P2UA 3P8CD 1YTZT 1AV1A 3TNUB 3KQGA 1FDMA 4PV1D 1NTKD 2W6AA 2FXMA 2KS1A 5TISE 1S72P 2R44A 4JYBA 1J1DB 1Q90D 2QM8A 5GTIH 3WU2E 5B66H 5BU5A 2Q9IA 3MTUE 3VTPC 1QLED 2ZVNB 3M9QA 3B5NB 2Z4EA 2N1TC 5KKZC 1N7SA 1PGJA 2FYUK 1FJPA 1MV8A 3R4YA 3H1IG 4JYCA 3GW6A 1KB9H 1L0NG 3KXDA 1NVOA 2POHA 2NPSB 1FAVA 2P1JA 4PJ0E 1VQKP 1KILB 1L0LG 2LKMA 1SLQA 1HH0A 1GD2E 3RL0g 1P84H 2I1KA 1WT6A 4L76A 4C7NA 5CCGC 5AVWB 2H7HA 4HH2A 1RQUA 2YMKA 3PP5A 4W7ZA 1NKNA 1RF0A 3K5BA 2KP8A 4DT0A 3RK2C 1OWAA 2QA4P 4DJGA 2WVRA 3F89A 1LWUA 1GL2D 2D2CD 3TDKA 2HODB 5AVUB 1NTMK 3T97B 2FKWB 1M57D 3M91A 3HUSC 1L0NE 2NRGA 2IYOA 1ZOYC 2C9NY 2QJKC 1FC2C 3H1HG 2W6BA 2E76C 1X79B 1DIPA 1SQPJ 3W68A 4GIFA 1M1JB 4IFDK 1IFDA 3IF4A 3TF5A 1KD1Q 3KZIH 2RMZA 2PGDA 1QL1A 3HE5A 1GL2A 4WWIA 2KNCB 1LTGC 3HE4B 1H0TB 2GUSA 3A0HE 5TISH 3P32A 1QL2A 2M3EA
chains in the Genus database with same CATH topology
5H2FE 5E79E 5B5EE 5GTIE 4UB6E 5TISE 5KAIE 3KZIE 5B66E 4PJ0E 2AXTE 3A0BE 3JCUE 3WU2E 3A0HE 1S5LE 4UB8E 5KAFE 5GTHE 1W5CE 4IL6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2F E;  5E79 E;  5B5E E;  5GTI E;  4UB6 E;  5TIS E;  5KAI E;  3KZI E;  5B66 E;  4PJ0 E;  2AXT E;  3A0B E;  3JCU E;  3WU2 E;  3A0H E;  1S5L E;  4UB8 E;  5KAF E;  5GTH E;  1W5C E;  4IL6 E; 
#chains in the Genus database with same CATH topology
 3WU2 H;  1VQP P;  1PP9 E;  2E75 C;  1JY3 P;  1XTC C;  3H1H E;  3SFE C;  2PRR A;  2FFD B;  2JR8 A;  1IZN B;  1NTM E;  4L73 A;  2YO3 A;  1OXZ A;  1SQX D;  2YKQ A;  1DH3 A;  1N7S C;  1G1I A;  2XKM A;  1RF1 A;  1FZG A;  1JMB A;  4BRY A;  1OIP A;  3CX5 D;  2W6J H;  1SFC A;  2C0W A;  2QEX P;  2R3C A;  2FYU D;  4PJ0 H;  3B8E B;  5H2F E;  1GW3 A;  2QG4 A;  1IK7 A;  2A45 I;  1DD3 A;  2R3S A;  2O01 N;  1PPJ E;  1FU1 A;  3VMA A;  2L91 A;  3F5H A;  3O6Q B;  5EFW B;  1AFO A;  2SPZ A;  2O01 H;  1KYO D;  5DJU B;  5M1B A;  1G2C B;  5AVS B;  1JTH B;  4PD4 I;  5GTH E;  5AVT B;  2H89 C;  4I1L A;  3QH9 A;  1RF0 C;  2XND H;  3R2P A;  4D6T G;  2IBZ E;  1LWU C;  4N78 E;  2Z5I A;  2CPB A;  2N9B A;  1EZV I;  5KLV J;  1SQB J;  2O1J A;  1H8A A;  3L37 A;  3L70 J;  1JO5 A;  1PP9 D;  1QVF O;  2WSC H;  4EOT A;  4XFJ A;  4OGQ C;  4Y99 B;  3H1L J;  3L71 J;  4RKU J;  1OMI A;  1NTM D;  3CXH I;  3L36 A;  2ZJS E;  3C9I A;  1AA0 A;  3FGA D;  2M8R A;  1KTM A;  2WQY C;  1NTZ G;  3H1K J;  1LT9 B;  1GZL A;  3L72 D;  1ZP0 C;  2YMY A;  4HYT B;  1K05 A;  1IK9 A;  2BCC G;  2E74 D;  2XU6 A;  2WIT A;  1MZ9 A;  2WPR A;  4H0L B;  4NPD A;  1GL2 C;  3VN0 A;  1DX7 A;  1SQP K;  3H1J D;  3A0H H;  1LTB C;  1MKM A;  1JCC A;  2A06 E;  1PPJ D;  1X0T A;  3LW5 H;  4N3Y B;  1LP1 B;  2QIW A;  3TNU A;  3IN6 A;  3CCM P;  1SQV G;  1NAY A;  1CZQ A;  1MFZ A;  2W27 A;  3CC2 P;  1Q7Y Q;  3H1I J;  1N73 B;  4H44 B;  5AVX B;  2IBZ D;  2QVA A;  4N78 D;  4H13 D;  1VF5 C;  1RF1 C;  2ZT9 B;  2Z5H A;  1SS1 A;  3N4X A;  1L0L J;  3I55 P;  1J1E C;  5GTI E;  1Q86 Q;  3CWB G;  5AVV B;  1NTK G;  1SFC C;  3RL0 D;  4LGD E;  2WZ7 A;  5H2F H;  1OVU A;  3RK2 D;  3H32 A;  1K73 Q;  1GK6 A;  3M0D A;  1EDJ A;  1AVO A;  4GOD A;  4JBZ A;  1S1C X;  4GDO A;  5GTH H;  1OX3 A;  1SQP E;  3E1I A;  3NXS A;  4UB8 E;  2Y0C A;  2KIK A;  3D70 A;  2C9L Y;  2O3J A;  3AE9 C;  1U7M A;  1X22 A;  1VQL P;  2WSF J;  1G1J A;  1NO4 A;  1N2D C;  1DD4 A;  3IAO A;  5APY A;  2A45 G;  3BCC G;  4Y28 J;  2MJZ A;  2HOD A;  1EDI A;  2BAS A;  3Q5R A;  1ZN5 A;  2KLV A;  2GA1 A;  2IPP A;  4DZO A;  2PAJ A;  2AXT E;  5KLV K;  2GUV A;  2JJL A;  5KLI B;  2HYN A;  2YNY A;  3ABV C;  3KYQ A;  1S3J A;  1VQ5 P;  1CI6 B;  4YXW H;  2QJY C;  1SQB G;  1EZV G;  4L74 A;  3L70 G;  2K37 A;  4RES B;  1BSH A;  2GM4 A;  2KNC A;  2Y0E A;  3H1L G;  3HE4 A;  2PFX A;  1NGM B;  1EC5 A;  1URQ B;  4HB1 A;  1BE3 G;  3E7K A;  1SQP D;  2Q3E A;  3D6Z A;  2Q1K A;  1JMM A;  1KB9 D;  1J1D C;  1T8Z A;  1L4A D;  3TGU J;  4I7Z B;  1S2E A;  3H1K G;  2K9Y A;  3FXE A;  2HFE D;  3IR9 A;  2WWW A;  3PH0 A;  3CC7 P;  2QJP B;  1ZRT D;  2KUB A;  1P84 D;  1JM0 A;  1NU1 G;  1FZC B;  4U3F J;  3MIW A;  3G3Z A;  3M06 A;  3MHV A;  2E74 C;  3WUV A;  3RGU A;  4KHX A;  4EDF A;  5KLV E;  3HD7 B;  1SQB E;  1EZV E;  2K9J B;  3L70 E;  4A7P A;  1L0N K;  1S4X A;  5APT A;  2HG5 D;  1BGY D;  3RBZ A;  1N7L A;  1JNM A;  2WT7 A;  3H1L E;  3L71 E;  3I56 P;  4B86 A;  3M0D C;  2FXO A;  3V2Q A;  1L0L K;  2W90 A;  2R5D A;  3Q5P A;  2R32 A;  2QE7 H;  3O6Q A;  3MGN A;  1L4A A;  4D6T J;  4UB8 H;  1SQX G;  2W8Z A;  3AEA C;  1G2C A;  4M3L A;  1JTH A;  3PHL A;  1IJD B;  3H1K E;  2KI7 B;  2Q5U A;  3VMX A;  1PGO A;  4OGQ D;  1LT1 A;  2E5T A;  3U59 A;  3AE7 C;  1KFM A;  4H13 C;  1QGK B;  4OH8 B;  2N1T B;  5KKZ B;  1JCD A;  2G3A A;  1BCC D;  2JEE A;  3RL0 C;  2QM7 A;  1FDI A;  2OYH B;  1IO4 A;  1R5L A;  1NTZ J;  1OW7 A;  3CCR P;  3AEB C;  1YJN P;  2AXT H;  4IL6 X;  3V2P A;  2MKV A;  1T2K C;  1T3J A;  2HPC A;  1OZH A;  2JO1 A;  5CJ4 A;  5KJ7 D;  4EYY Q;  1KQL A;  2BCC J;  3H1I E;  3OAK A;  3TYY A;  1A02 F;  3NTN A;  3GHG A;  3Q5S A;  3EQ2 A;  1VQ8 P;  1LT9 A;  1K8A Q;  5KLV D;  4CPG A;  4RJT A;  1OFC X;  1S9K E;  1L0L E;  2V7Q J;  2IZ1 A;  1SQV J;  2JWD A;  1YIT P;  3PLN A;  1M1K Q;  3EFF K;  2RH0 A;  2PP6 A;  1PV3 A;  3L73 G;  3VP8 A;  2OYI B;  1LTA C;  1JB0 J;  1VF5 D;  5AW1 B;  1LP1 A;  1RY3 A;  4IL6 E;  3H6P A;  5E79 E;  1KC8 Q;  4R4M A;  1FOS E;  1SFC D;  1KFN A;  2QJK B;  1GTW A;  3P8M C;  2E76 B;  5KJ7 A;  1SQQ G;  2ZYA A;  3CWB J;  1NTK J;  3AE1 C;  3Q1M A;  2YIU C;  1VQM P;  3AE2 C;  3FWL A;  4C7R A;  2XZR A;  2YKO A;  1AQ5 A;  3VYI A;  3V5B A;  3U1C A;  1JOC A;  1NWQ A;  5TJH A;  3RK3 B;  1WRG A;  3L75 G;  2Y0D A;  3BRT B;  1VDF A;  3TGU G;  1UIX A;  1GU5 A;  3WUU A;  3H1I D;  2I1J A;  4JPZ B;  1XTG B;  1L0N D;  2KS1 B;  1L4A C;  1ZR2 A;  2DW3 A;  2AEF A;  1JUN A;  4U3F G;  3MP7 B;  3BCC J;  1L0L D;  1M8O B;  2M5A B;  3OA7 A;  5APW A;  2IFN A;  1S5L X;  3G9R A;  1N7S B;  3SFD C;  3L35 A;  1KIL E;  1VQ6 P;  1GDT A;  4IFF A;  1U57 A;  3L74 G;  2R5B A;  1VQO P;  3LIE A;  3N7N A;  5CCH A;  3GF7 A;  1VL2 A;  3HTK B;  4XE5 B;  1NAF A;  3GLM A;  4WY4 D;  1FZF A;  4PV1 B;  1N8R Q;  3TGU E;  5DJT B;  1KV4 A;  1BDD A;  1OVV A;  3NMD A;  3GHG C;  3A2A A;  4C7N B;  1NTZ K;  4KJM A;  1PL5 A;  3H1H D;  3ITK A;  3L4F A;  3SSU A;  1LT9 C;  4U3F E;  4R4L A;  1YTZ I;  3MUD A;  1TU3 F;  2ZAE B;  1BE3 J;  1LGH B;  5APS A;  2OQQ A;  1AJY A;  3G4S P;  4H0L C;  1Y9B A;  1CW5 A;  4IL6 H;  5E79 H;  1K9M Q;  3B5N D;  5AW7 B;  4AUW A;  1QVG O;  1AVY A;  1NYH A;  3O8Z A;  1LTJ B;  1URQ A;  3L74 E;  2WPV B;  1M56 D;  4WY4 A;  1SQV K;  1IFI A;  2ZFC A;  1NU1 J;  3Q3D A;  2J58 A;  4D6T E;  2YKP A;  1NOH A;  1KN7 A;  2G8Y A;  5KJ7 C;  1E5W A;  5BU8 B;  5L8R J;  2NPS D;  2KZI A;  2E42 A;  3CD6 P;  3Q2Y A;  2WSF H;  4H44 C;  1PIX A;  1KIL D;  1RHZ B;  1T6A A;  3CMA P;  1FZC A;  3QWO C;  5APX A;  1K04 A;  4LLH A;  2CPS A;  2KLU A;  3HE5 B;  1DEE G;  3V2R A;  2JWA A;  4ASV A;  2ITA A;  1NTK K;  3VMY A;  2FYZ A;  1GL2 B;  3HD7 A;  2M0B A;  1SQX J;  2KXP B;  2D2C B;  2K9J A;  4WB4 A;  1NTZ E;  3B5N A;  1FZE A;  1DEB A;  2AEJ A;  1ZW0 A;  3RK3 E;  3CX5 I;  1HVV A;  5APU A;  1YQ4 C;  3AEE C;  2BCC E;  5BVZ A;  3A0B E;  4RO0 A;  1WMK A;  3M9B A;  2FYU J;  1HJB A;  2NPS A;  1T2K D;  3G71 P;  2JKV A;  5APV A;  1KIL A;  1KYO I;  4YTP C;  1KZU B;  1SQV E;  1W2B O;  2Q3I A;  3LID A;  3MD0 A;  1YYC A;  3CI9 A;  4K35 A;  2KYV A;  2H43 A;  5K5G B;  4BRY B;  1BGY G;  1J1E B;  2FYN C;  4JQ0 D;  1FBM A;  4KT0 J;  2OYH A;  3CCV P;  5CCH C;  2WSE J;  2A06 D;  3GF3 A;  3TK1 A;  3P8C E;  4N6J A;  4EI2 A;  4YXD C;  5AW3 B;  3II6 A;  3CL3 D;  3AE8 C;  1H89 A;  3CWB E;  4NPE A;  1NTK E;  1D7M A;  3T97 A;  3KDP B;  1R5S A;  5KLI C;  3BRV B;  3L73 J;  4IOI H;  5CJ0 A;  3GG2 A;  3MUD C;  2NZ2 A;  1YHQ P;  1VQ7 P;  1BCC G;  2WPQ A;  3D6Y A;  2M3B A;  1SQB K;  2LXB A;  1W5C E;  2B87 B;  2RKL A;  4EIJ A;  1PGP A;  1M1J A;  4U7J A;  1SQQ J;  1FDO A;  4GOE A;  3L72 J;  2OYI A;  1GW4 A;  1URQ C;  2FY8 A;  1ZLL A;  4WY4 C;  1RE4 A;  2N9Y B;  3H1J J;  3JSV C;  2B9B A;  2FBW C;  1HF9 A;  4W7Y A;  2CK3 H;  2P7J A;  4I7Z C;  4I6M C;  1H0T A;  1USE A;  2WPS A;  2OGU A;  3CLQ A;  3BCC E;  3PJS K;  1SQV D;  3CC4 P;  3ZDM A;  4DOJ A;  2AXC A;  3L75 J;  2QJP C;  2P67 A;  1NU1 K;  2I8D A;  1FZC C;  1HGZ A;  4PD4 E;  2FFD A;  1VPC A;  3D71 A;  2ZXX A;  5B5E E;  1Q82 Q;  3HD7 C;  2IBZ I;  3S9O A;  1N86 A;  3B5N C;  2P10 A;  1EDK A;  3V4Q A;  1OW8 A;  1Q2N A;  4IFM A;  2J5U A;  2L5G B;  1M90 Q;  1PFI A;  1RE3 A;  3A0B H;  3AE4 C;  3CWB D;  3SWF A;  1IFP A;  1HTL C;  3V6I A;  2W83 C;  1Z56 A;  2RN0 A;  1YIJ P;  1IC2 A;  4UB6 E;  5C39 A;  1QX8 A;  1X8Y A;  1SQX K;  1MFT A;  2NPS C;  3JCU E;  3CPW O;  3W67 A;  1FE6 A;  2V7Q H;  2XNX A;  4GT1 A;  4YPC A;  3L74 J;  2M5A A;  1KIL C;  1ZXG A;  1BE3 E;  1GMJ A;  5CBO A;  3CXH E;  3A3Y B;  2KZJ A;  1YJW P;  3B4S A;  1LTT C;  1RQV A;  5CHX A;  2E74 B;  2LXC B;  5CMZ A;  5AW4 B;  4WBA A;  3AE5 C;  2OYH C;  3OW2 O;  3HRN A;  3CCJ P;  1NU1 E;  1KMI Z;  2FYU G;  3HTK A;  4H0L D;  3H32 B;  1MUU A;  2JDI H;  1GK4 A;  3CCE P;  3BCC D;  1W2E A;  3AE3 C;  5KAF E;  3JC2 2;  1YI2 P;  1JY2 P;  4PD4 D;  1FZA A;  3VOP A;  3RBX A;  4AQR D;  2WSS H;  1KOR A;  2KOG A;  1VQN P;  4OVN F;  4H13 B;  3IFM A;  4ZNC A;  1SQX E;  1M1J C;  1M7L A;  4H44 D;  2ZVO B;  3M0A A;  2KB7 P;  3RL0 B;  2OYI C;  3TSI A;  4K3A A;  1OW6 A;  5AW6 B;  1SQB D;  1EZV D;  3L70 D;  3MZW B;  2ZT9 D;  3RK2 B;  1PP9 G;  1LTJ A;  1RE4 C;  3CX5 E;  1ZR4 A;  2QSI A;  3USS A;  4Z1M H;  1JY2 O;  2FYU E;  2A45 H;  3H1L D;  3L71 D;  1HWT C;  1NTM G;  1SQQ K;  1BE3 D;  1EXJ A;  3CXH D;  3HUS B;  5AVR B;  2IZ0 A;  1JY2 N;  4BXL A;  1KB9 I;  4PD4 H;  3S4R A;  1KYO E;  1USD A;  3B71 A;  1KQS O;  3H1K D;  1LNQ A;  3AE6 C;  5B5E H;  1SP4 A;  3SWY A;  4ZKU A;  2KSE A;  1YQ3 C;  2FFD C;  3L72 G;  3V2N A;  1KQF B;  3C1L A;  4DCK A;  2Q6Q A;  1JEK A;  1N73 A;  1NU1 D;  1P84 I;  3RK3 C;  1E79 H;  1RH5 B;  4W80 A;  5KAI E;  2BEZ F;  3H1J G;  2WMM A;  2YXR B;  4MN4 C;  3OJA B;  1RE3 C;  1U7J A;  4UB6 H;  1PPJ G;  1NHL A;  1L2P A;  1HGV A;  1J2J B;  1R8E A;  3JCU H;  5AW5 B;  5CCH D;  1BGY J;  1T3U A;  3L73 E;  1Q81 Q;  4QMA A;  3CXH H;  2YIU B;  5APQ A;  2YXQ B;  2E75 B;  1GU4 A;  4JF7 A;  3FX0 A;  2IBZ G;  2IX7 C;  2E43 A;  2K3R A;  3KPE A;  1IFJ A;  1S9K D;  3PRJ A;  3CME P;  1SQQ E;  2XDJ A;  3L72 E;  1CSB A;  4ZKP A;  1Y47 A;  3I5C A;  2Y9Z A;  3UIA A;  5KTB A;  5AW2 B;  3H1J E;  1IFN A;  4PV1 C;  2WT7 B;  3KHU A;  1JY3 O;  1A02 J;  4I2L C;  3GMA A;  1BCC J;  5AW0 B;  5KAF H;  3BVH A;  3AEC C;  1L4A B;  2VRS A;  2HLO A;  1JY3 N;  1URQ D;  3L75 E;  1HBW A;  3H25 A;  4Y99 C;  4WVZ A;  3S1K A;  4GKG A;  3M9H A;  1FZB A;  5AW9 B;  2B87 A;  3A7O A;  1FOS F;  4GOF A;  2A06 G;  2K1A A;  1S5L E;  1KQG B;  3CX5 H;  1CI6 A;  3EWK A;  3VMZ A;  2UWJ E;  3BAT A;  1LTJ C;  3EFG A;  2H8P D;  3E1R A;  1LWU B;  3HD7 D;  3L73 D;  2HPC B;  5AW8 B;  1BDC A;  1HJ0 A;  2FXP A;  1ZME C;  1KYO H;  3GHG B;  2J59 M;  3WUT A;  2ZYG A;  1YBK A;  4OGQ B;  1FJK A;  1PZQ A;  1SQQ D;  3V4W A;  3CCU P;  2V4H A;  3A5T A;  2YO2 A;  5KAI H;  1N73 C;  2WSE H;  2XV5 A;  1Y8A A;  2D2C C;  2O01 J;  1LJ2 A;  3P7K A;  2N1T D;  1HUC A;  2ZT9 C;  1NH4 A;  1YJ9 P;  3U1A A;  1SQP G;  3L75 D;  1VQ4 P;  4NPF X;  3TGU D;  2OTK E;  1VQ9 P;  3CCS P;  1LTI C;  2OTJ P;  1L0N J;  3BAS A;  3NFQ A;  1SVF A;  4U3F D;  2WSC J;  1OVR A;  1H88 A;  2Y9Y A;  4TLF A;  5CCG D;  4HJG H;  2H88 C;  5B66 E;  1VF5 B;  2JP3 A;  2HR3 A;  2N1T A;  3WMM 0;  1RF1 B;  5AVZ B;  2B89 A;  3AEG C;  3L74 D;  1SFC B;  3G6E P;  4XA4 A;  4D6T D;  1KB9 E;  3PTZ A;  4O9B A;  2OAR A;  3CCL P;  5AVY B;  1NJI Q;  1EXI A;  2E76 D;  3LW5 J;  1PP9 J;  1S5L H;  4LC1 A;  2WTY A;  2Q7C A;  3H1H J;  1AQT A;  1ZRT E;  1P84 E;  5CCG A;  2KSJ A;  4AYC A;  1NTM J;  2FYN B;  3FWN A;  2IFM A;  1EQ7 A;  3FXD A;  4ZMD A;  2AEM A;  3AED C;  3AEF C;  1NTZ D;  4L75 A;  4BWN A;  2P58 A;  3RK3 D;  4ASW A;  2IDB A;  4OWF A;  1BGY E;  2BCC D;  5AVQ B;  3HUS A;  2BEQ D;  1X9V A;  1PGQ A;  4TT3 H;  1IFM A;  1QEX A;  1LTS C;  3C8V A;  2E75 D;  2O1K A;  2KK7 A;  3CCQ P;  2K88 A;  2IYP A;  2B88 A;  5KLV G;  2OYO A;  3SWK A;  1FS0 E;  2E5Y A;  2OTL P;  3VP9 A;  5CBN A;  2ZYD A;  1BSN A;  1N7S D;  4C46 A;  3L71 G;  1NKZ B;  2C0X A;  2QJY B;  1BCC E;  2LR2 A;  2ZXE B;  4HKZ H;  1UII A;  2QRX A;  3KZI E;  1EDL A;  4WY4 B;  1ZV8 A;  2P2U A;  3P8C D;  1YTZ T;  1AV1 A;  3TNU B;  3KQG A;  1FDM A;  4PV1 D;  1NTK D;  2W6A A;  2FXM A;  2KS1 A;  5TIS E;  1S72 P;  2R44 A;  4JYB A;  1J1D B;  1Q90 D;  2QM8 A;  5GTI H;  3WU2 E;  5B66 H;  5BU5 A;  2Q9I A;  3MTU E;  3VTP C;  1QLE D;  2ZVN B;  3M9Q A;  3B5N B;  2Z4E A;  2N1T C;  5KKZ C;  1N7S A;  1PGJ A;  2FYU K;  1FJP A;  1MV8 A;  3R4Y A;  3H1I G;  4JYC A;  3GW6 A;  1KB9 H;  1L0N G;  3KXD A;  1NVO A;  2POH A;  2NPS B;  1FAV A;  2P1J A;  4PJ0 E;  1VQK P;  1KIL B;  1L0L G;  2LKM A;  1SLQ A;  1HH0 A;  1GD2 E;  3RL0 g;  1P84 H;  2I1K A;  1WT6 A;  4L76 A;  4C7N A;  5CCG C;  5AVW B;  2H7H A;  4HH2 A;  1RQU A;  2YMK A;  3PP5 A;  4W7Z A;  1NKN A;  1RF0 A;  3K5B A;  2KP8 A;  4DT0 A;  3RK2 C;  1OWA A;  2QA4 P;  4DJG A;  2WVR A;  3F89 A;  1LWU A;  1GL2 D;  2D2C D;  3TDK A;  2HOD B;  5AVU B;  1NTM K;  3T97 B;  2FKW B;  1M57 D;  3M91 A;  3HUS C;  1L0N E;  2NRG A;  2IYO A;  1ZOY C;  2C9N Y;  2QJK C;  1FC2 C;  3H1H G;  2W6B A;  2E76 C;  1X79 B;  1DIP A;  1SQP J;  3W68 A;  4GIF A;  1M1J B;  4IFD K;  1IFD A;  3IF4 A;  3TF5 A;  1KD1 Q;  3KZI H;  2RMZ A;  2PGD A;  1QL1 A;  3HE5 A;  1GL2 A;  4WWI A;  2KNC B;  1LTG C;  3HE4 B;  1H0T B;  2GUS A;  3A0H E;  5TIS H;  3P32 A;  1QL2 A;  2M3E A; 
#chains in the Genus database with same CATH homology
 5H2F E;  5E79 E;  5B5E E;  5GTI E;  4UB6 E;  5TIS E;  5KAI E;  3KZI E;  5B66 E;  4PJ0 E;  2AXT E;  3A0B E;  3JCU E;  3WU2 E;  3A0H E;  1S5L E;  4UB8 E;  5KAF E;  5GTH E;  1W5C E;  4IL6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...