3WU2E

Crystal structure analysis of photosystem ii complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
b'TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 20
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 3wu2E00
5H2FE 5TISE 3JCUE 4PJ0E 1W5CE 3A0BE 1S5LE 5KAIE 3A0HE 5B5EE 5E79E 3KZIE 5GTIE 4UB8E 5GTHE 2AXTE 4UB6E 5B66E 3WU2E 4IL6E 5KAFE
chains in the Genus database with same CATH superfamily
1JY3N 3CWBD 5L8RJ 4Y99C 2ZXEB 3PTZA 3OJAB 1L4AC 1KB9H 1T2KC 1AV1A 1EDIA 1QL2A 4GKGA 1PPJD 1YBKA 2GUSA 1GW3A 2E74D 3BCCG 2XNDH 3A2AA 2ZYDA 1QX8A 1BDDA 3I5CA 2ZYAA 3M9HA 1OXZA 3GF7A 1RH5B 1KYOD 1FC2C 1HF9A 2JKVA 2O1KA 3M0DC 4C7NB 3RGUA 1LWUC 1JY3P 1KILB 1EZVG 3CC7P 4KJMA 1EZVI 3A0HH 2GA1A 2L91A 3M06A 1PIXA 3KYQA 2JR8A 1KQSO 1S4XA 1MFTA 3H1JG 5KAFH 3L4FA 3HD7D 2PP6A 3L70G 1BCCE 5CCHD 3RL0B 3KXDA 3M91A 3WUTA 2WVRA 2K9YA 1L0LD 4CPGA 1FZBA 4U7JA 4PJ0E 1S5LH 2OTLP 3P32A 4WY4D 1M1JC 1HWTC 2ZT9B 5AW9B 3RK3C 2BCCG 4K35A 5GTIH 3H1IE 2FFDA 4QMAA 3M0AA 4UB8H 4EYYQ 3MTUE 3L36A 3AEFC 3TGUG 1A02J 2B89A 3HUSC 1OFCX 2OTKE 2QJKC 4JQ0D 2R5BA 1GL2D 1GK6A 4H44B 3B71A 3TNUB 3CLQA 1VQ7P 1K9MQ 1CW5A 2V4HA 5KKZC 3WU2E 5KLVJ 3PJSK 1YJ9P 1NU1K 3L73J 1PPJG 5E79H 4TT3H 1SFCC 1VQ6P 3CD6P 4XFJA 2IDBA 5APVA 2N1TB 1SVFA 4EDFA 3FWLA 3CCSP 1RF1C 4ZNCA 2BEQD 1KYOI 1URQC 2FKWB 2AEJA 3I56P 1PL5A 1VQKP 3V6IA 1P84E 1R8EA 4U3FJ 4A7PA 3T97A 3IN6A 1PP9D 1FJKA 1LTJA 4N78D 2OYHB 3MIWA 2WPRA 4I6MC 2Q1KA 3EQ2A 2WSCJ 5KLVK 3VP8A 3VMAA 3GMAA 3HE5B 3B5NA 3WUUA 4XA4A 1SQBJ 5KAIE 2KSEA 3GHGA 4RESB 3CXHH 1YYCA 2XZRA 1JY2N 5H2FH 2Q3EA 5APYA 1TU3F 3HE4B 3SSUA 2A45I 3G9RA 2Z4EA 1L4AD 1FZEA 2HG5D 2FY8A 1Q82Q 2KLUA 2J59M 5GTHE 4BXLA 2JEEA 2WTYA 3PP5A 3GG2A 2KS1B 3FXDA 3TYYA 1NGMB 5AW1B 1BCCG 1SQBK 3P7KA 3O6QB 5AVWB 3U1AA 3N4XA 4C7RA 4IFDK 1VF5D 1SQVJ 4D6TJ 5APXA 3PLNA 4PV1C 1KQFB 3CI9A 2C9NY 3FWNA 3RK3E 2V7QJ 3V4QA 4TLFA 4DCKA 2FFDC 1Q86Q 5KLVE 2I8DA 2M5AB 2YMKA 3L73E 1NU1D 1ZP0C 1NH4A 2N9BA 3AEBC 2R3SA 2Y9YA 3RL0D 4PD4E 1IK7A 1IFPA 1N7SB 2B88A 2LXBA 3O8ZA 1KFNA 1EQ7A 2K9JB 2Y0DA 1SQVK 3Q5RA 1UIXA 1SQXJ 4U3FE 2E75B 1PP9G 4JYBA 1M90Q 1JTHB 2ZAEB 5APQA 2ZT9D 1FDIA 4H0LB 3RK3D 2Q5UA 5CCGD 2Z5HA 4ZMDA 1NTMD 3CCJP 1JY3O 2E76C 3L73D 1N7LA 2P1JA 1SQBE 2XNXA 2NRGA 1RHZB 2W83C 3S4RA 4WVZA 4I7ZB 4GOEA 1HBWA 4H44D 3VMZA 1VL2A 5BU8B 1SQPJ 1LTJC 2OYIA 4U3FD 2FYZA 1J1EC 1AFOA 1M57D 1RQUA 3SFDC 2DW3A 3HD7B 1WT6A 4WB4A 1YQ4C 3B5NC 2CPBA 5BU5A 3LW5H 2HPCB 1VQOP 1KN7A 1T8ZA 2WT7B 2G8YA 2N1TD 2OTJP 3WMM0 2R3CA 3GHGC 4JBZA 1J1DC 1X22A 1SQBD 1YI2P 4IL6E 1BSHA 1SQVE 4D6TE 3C9IA 3RL0g 2H7HA 1SQPK 1PV3A 3CCRP 4ZKUA 1NU1G 2YXRB 2ZJSE 4NPEA 5AW4B 1KILA 2KXPB 1JNMA 1D7MA 2FXOA 1QGKB 2O3JA 3AE5C 1OZHA 5TJHA 1GL2B 2N9YB 3CX5D 1KYOH 1FZFA 1LTSC 3A7OA 1SQVD 2FYNB 1BE3J 4YPCA 3L74J 2KNCA 2KZIA 4GT1A 1A02F 5KLVG 1DIPA 5CMZA 2YKPA 3L73G 4W80A 4GIFA 2R5DA 2KK7A 3TSIA 2W6BA 5B5EH 3V2RA 1NTKD 3GF3A 2HODB 2WSFH 3V2NA 2IZ0A 1RF0C 4U3FG 3USSA 1NTZJ 1ZR2A 1SQPE 1FZCB 2YIUB 3A0BE 2HFED 1NHLA 4YXDC 2OGUA 4H13B 1AVYA 1R5SA 1FAVA 3GW6A 1H0TB 1AQTA 3G71P 3AE4C 1H89A 1SQBG 4HKZH 2FXPA 1RE3A 1XTCC 1Y47A 3IR9A 1W5CE 1N7SD 2FXMA 1NVOA 4Y99B 3H6PA 1PZQA 5KJ7D 1ZMEC 1L4AB 2JO1A 3M9BA 2M0BA 2E75D 2OYIC 5AVQB 3MP7B 3II6A 4PJ0H 3L72E 1JB0J 4HH2A 4H0LD 4ASWA 2FYUJ 1JY2O 3G4SP 3L75E 1RY3A 3CX5I 1VF5B 1GW4A 2YO3A 3JCUH 2W6JH 1SQQJ 3HE5A 4YTPC 1KQLA 4KT0J 3BVHA 5C39A 4IOIH 1OW6A 2IBZE 5AVXB 1SQVG 2YXQB 1NAFA 5BVZA 1LNQA 3PH0A 1BE3E 3L74E 3TDKA 3HE4A 3RK2C 3L72D 1LT9C 5TISE 2FYUK 2JWAA 1PFIA 2R44A 3H25A 3L75D 1RQVA 2WWWA 5AVUB 1NTKG 3GLMA 3P8CE 3E7KA 4UB6H 4ZKPA 2G3AA 3I55P 2KS1A 1SQQK 3D6YA 3O6QA 1N86A 1M1JB 3RK3B 1NTZE 1NYHA 2C0XA 1BE3D 4JYCA 4N3YB 3L74D 2PFXA 1ZRTE 5AW7B 1LP1A 3HUSB 4HB1A 1BCCD 3Q5PA 3CCUP 5KAIH 2QJKB 1JEKA 1SP4A 2PGDA 1W2EA 2PAJA 3P8MC 3JC22 4L75A 1KZUB 2IYOA 2OARA 1L0NJ 4N6JA 2YMYA 2WSEJ 4RJTA 2QJPC 5KKZB 5CJ0A 2M3EA 5AVYB 1IFMA 1WRGA 4RKUJ 1J2JB 5AW5B 5APSA 1FDMA 2MJZA 1KC8Q 3H1ID 3H1LJ 2J5UA 4OWFA 3OA7A 1SS1A 2FYUE 1YTZT 3L71J 1ZRTD 3V4WA 1IO4A 2ZYGA 1JTHA 1RE3C 2IPPA 1NJIQ 1URQB 3BRVB 3SWYA 3BRTB 1AJYA 2I1KA 1SQQE 2IYPA 3B8EB 3V5BA 1L0NK 1IK9A 3VMYA 3IAOA 1LTIC 4DOJA 5AVVB 2NPSD 3L72G 3CC4P 3CCEP 3MD0A 1K73Q 2Q6QA 3Q1MA 2P7JA 4YXWH 2HYNA 1IFJA 1X9VA 3L75G 2QVAA 4H13D 1HH0A 1YJNP 2AXCA 4UB8E 2LKMA 1EC5A 1RE4A 3N7NA 3NMDA 3HD7A 2E43A 5CCHA 1P84D 1OIPA 4KHXA 1SQQD 1Q81Q 3M9QA 3KDPB 3CPWO 1T2KD 3G6EP 2Z5IA 1BE3G 1YHQP 2AXTE 3EFFK 3LIEA 3L74G 2LXCB 5AVSB 4BWNA 2D2CC 4WY4A 2WSCH 1M7LA 4IL6X 1QL1A 2XKMA 5E79E 2KOGA 3BCCJ 1T3JA 1JCCA 1NKZB 3FXEA 5AW8B 1N73A 1L0NE 1LGHB 1GL2A 2P67A 1G2CB 1HVVA 4IFFA 3F5HA 4OGQC 3H1HJ 4LLHA 5APWA 2E5TA 1USEA 3H1IG 2B87A 2H88C 3S1KA 3H1LE 1KORA 3L71E 1PGOA 3CX5H 1BGYJ 3R4YA 4IL6H 1E79H 2XV5A 3CXHE 1JO5A 1OWAA 2NZ2A 1VQMP 3CC2P 1L0ND 3H32B 2K37A 2Y0CA 1CI6A 2HODA 4WWIA 4BRYB 3WUVA 2BEZF 1JMMA 3JSVC 2V7QH 5KLVD 1T6AA 2E76B 2BCCJ 3SWKA 1AA0A 2PRRA 3FX0A 3L37A 2FYUG 1FZCA 2I1JA 1EDLA 1H88A 3LW5J 2E74C 4PD4D 1HJ0A 3K5BA 1P84I 1SQQG 1SQXK 3T97B 3CWBJ 1LTJB 1M56D 1MZ9A 1J1EB 3CL3D 1OW8A 1LTAC 2WMMA 3B5NB 3MZWB 1L4AA 1SFCD 2FBWC 2W6AA 3H1KJ 1RE4C 1J1DB 1ZW0A 1ZR4A 5B66E 3BCCE 1YIJP 1URQD 3E1RA 5CCHC 1LTBC 1BDCA 3HTKB 1NWQA 2A06E 1GZLA 1Z56A 4C7NA 1EZVE 5AVTB 3H1HE 3V2QA 2O01J 4OH8B 4WY4C 3SWFA 3MUDA 2Y9ZA 1MV8A 1JM0A 5APUA 1LT1A 2QM8A 1KMIZ 2KI7B 1BGYE 1HTLC 2QSIA 2IZ1A 1N73C 1SQXE 4D6TD 1WMKA 2H43A 1L0LJ 1OMIA 2L5GB 1X79B 1L0NG 2H8PD 4W7YA 2GM4A 2A06D 1U7MA 3Q3DA 3AE7C 1HGZA 4LGDE 3H1HD 1N2DC 3H1LG 2BCCE 1IFNA 1Q7YQ 1MUUA 1S9KE 2QJYB 3L71G 5CCGA 5M1BA 4PD4I 5KLIC 2RKLA 1Q2NA 2VRSA 1BGYD 3HUSA 1AQ5A 4WBAA 1GDTA 4PV1D 1VQLP 1SQXD 3CWBE 1L0LK 2NPSB 1NOHA 3UIAA 3MGNA 4AUWA 3ABVC 2IX7C 3NXSA 3TNUA 2KB7P 1QEXA 4GOFA 1NKNA 3TK1A 3ITKA 1OVRA 1FZCC 3H1KE 3ZDMA 1L2PA 3BATA 4LC1A 3AEGC 1EXIA 2N1TA 3AE2C 3KZIE 3U59A 1KYOE 1QVFO 2B9BA 3B4SA 4OVNF 1U7JA 4EOTA 2OYIB 3NTNA 1NTZK 2W8ZA 1SQPD 1PP9J 3D6ZA 1Q90D 1KQGB 2M8RA 2E76D 2OYHA 1MKMA 5CJ4A 3KQGA 1YTZI 3L35A 2E42A 2C0WA 3Q2YA 1E5WA 3H1KD 3VTPC 3S9OA 1FS0E 3U1CA 1LJ2A 2UWJE 2POHA 1LWUB 3AE8C 4D6TG 5KTBA 5B5EE 1S5LX 1VF5C 1QVGO 1L0LE 4AYCA 2ZXXA 3WU2H 3PHLA 2A06G 3IFMA 3RK2B 1YITP 1LT9B 1KILC 1U57A 3H1HG 4HYTB 3B5ND 1IZNB 3MUDC 2KYVA 1VQ9P 1DD3A 1Y9BA 4AQRD 2QRXA 2AEFA 1K8AQ 3VP9A 2QM7A 2IFMA 1FE6A 1BGYG 1P84H 3RL0C 1IJDB 5K5GB 1CZQA 1ZLLA 2IBZD 1SQXG 2KNCB 2QEXP 1VQ8P 1JCDA 1KB9E 1VQ5P 3OAKA 1PGJA 1JOCA 1ZOYC 4HJGH 2ZT9C 1NU1J 1G2CA 5CCGC 4DT0A 2GUVA 1T3UA 2M5AA 2RN0A 3P8CD 2KP8A 2Q3IA 4GODA 3TF5A 1HJBA 3EWKA 2WPSA 4DZOA 2QJPB 3JCUE 1LTGC 3CCVP 3VN0A 1N7SA 2P2UA 2Q7CA 3CWBG 1SQPG 4H44C 2HLOA 1EXJA 3A0HE 1NTZD 3A3YB 2K9JA 3AE6C 5KJ7A 5GTHH 1SFCB 2JWDA 2AXTH 1PP9E 4I2LC 1IC2A 1S2EA 4N78E 1S1CX 3AEEC 1KB9D 1VQ4P 2WQYC 3AEAC 1RF1B 5KAFE 3H32A 1FU1A 1NTMJ 3Q5SA 2YKQA 3H1KG 1DX7A 4BRYA 1H8AA 2RH0A 3CMEP 1AVOA 2WSSH 3AE1C 1GK4A 2N1TC 3RBXA 2QG4A 1FOSF 4UB6E 1R5LA 4RO0A 3SFEC 2WSEH 3RBZA 2QIWA 4IFMA 1N8RQ 3AECC 1S5LE 1GMJA 1NO4A 2R32A 5GTIE 2WZ7A 2OYHC 2FYUD 2LR2A 1OVUA 4EIJA 5EFWB 1NTMK 1ZV8A 4PD4H 3CCLP 1S72P 2HPCA 2WT7A 2HR3A 2IBZG 2YKOA 2IBZI 3CMAP 2MKVA 5CBNA 1L0LG 5DJTB 3VOPA 3BASA 1Y8AA 5APTA 1KILE 2A45G 2KUBA 2D2CB 5AW6B 4L76A 1K04A 4I1LA 2OQQA 2K3RA 3HTKA 2M3BA 1W2BO 3KHUA 1IFIA 1NU1E 1KV4A 3LIDA 1DD4A 2CK3H 3NFQA 4NPDA 4PV1B 2KZJA 4M3LA 3QWOC 3W68A 3CCQP 4EI2A 4JF7A 4OGQB 4W7ZA 2FFDB 2YO2A 1NTZG 1JY2P 3RK2D 1LP1B 1KB9I 1KILD 3H1JJ 4DJGA 1USDA 2K88A 3L70J 2JDIH 1NTME 2AEMA 5CHXA 5B66H 1FZGA 1X0TA 1G1JA 1NTKJ 3MHVA 5H2FE 1GD2E 3IF4A 1LTTC 1S3JA 1N7SC 2P58A 1M1KQ 2OYOA 3QH9A 1X8YA 2XU6A 3CCMP 5KJ7C 3OW2O 4R4MA 2E75C 2Y0EA 1OW7A 5AVZB 1K05A 1RF0A 1G1IA 5AW2B 1OVVA 2ZVOB 3H1LD 2NPSA 2JJLA 4K3AA 3TGUJ 3L71D 2ZVNB 4H0LC 2E74B 2QE7H 1EDKA 3HRNA 1QLED 4Y28J 1KD1Q 4XE5B 3FGAD 2E5YA 1H0TA 1NTKK 1ZN5A 3CXHD 3KPEA 2J58A 4I7ZC 3VMXA 1VDFA 3A5TA 2RMZA 1NAYA 2IFNA 1OX3A 1HUCA 1ZXGA 2QA4P 1JUNA 2W90A 4B86A 1IFDA 1MFZA 3GHGB 3HD7C 5AW0B 2K1AA 2WITA 3CX5E 3EFGA 2WPVB 5DJUB 2SPZA 1GU5A 4R4LA 3M0DA 1VQPP 3A0BH 1LWUA 5CBOA 2P10A 4WY4B 2O01N 4ASVA 5AW3B 3L72J 3V2PA 3PRJA 3H1JE 1JMBA 2KIKA 4MN4C 3L70E 1HGVA 1LT9A 2Q9IA 2YNYA 3L75J 3BCCD 3D71A 3AE3C 1UIIA 2O1JA 3D70A 3C1LA 1N73B 2WSFJ 3KZIH 3F89A 1NTKE 1GL2C 2H89C 3C8VA 3VYIA 1XTGB 1YQ3C 1PGPA 1GU4A 2B87B 1GTWA 1EZVD 1EDJA 2FYNC 2D2CD 2CPSA 1M1JA 2O01H 3AEDC 4L74A 1DEEG 4NPFX 2JP3A 3H1JD 3TGUE 2ITAA 1FDOA 5KLIB 1BCCJ 2KSJA 3G3ZA 1NTMG 3L70D 1BSNA 1PGQA 3AE9C 1FZAA 2W27A 2QJYC 3CXHI 1SLQA 1FJPA 1DEBA 1CI6B 1DH3A 2ZFCA 3R2PA 4OGQD 4L73A 2A45H 1FOSE 5TISH 2KLVA 1VPCA 2C9LY 5AVRB 1PPJE 2NPSC 3H1IJ 2YIUC 1KTMA 2BCCD 4JPZB 1S9KD 2BASA 2XDJA 4GDOA 3W67A 1FBMA 1YJWP 2WPQA 1SFCA 1VQNP 3TGUD 4C46A 1M8OB 4H13C 3E1IA 1KFMA 4Z1MH 1RF1A 1CSBA 4O9BA 1URQA
chains in the Genus database with same CATH topology
5H2FE 5TISE 3JCUE 4PJ0E 1W5CE 3A0BE 1S5LE 5KAIE 3A0HE 5B5EE 5E79E 3KZIE 5GTIE 4UB8E 5GTHE 2AXTE 4UB6E 5B66E 3WU2E 4IL6E 5KAFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2F E;  5TIS E;  3JCU E;  4PJ0 E;  1W5C E;  3A0B E;  1S5L E;  5KAI E;  3A0H E;  5B5E E;  5E79 E;  3KZI E;  5GTI E;  4UB8 E;  5GTH E;  2AXT E;  4UB6 E;  5B66 E;  3WU2 E;  4IL6 E;  5KAF E; 
#chains in the Genus database with same CATH topology
 1JY3 N;  3CWB D;  5L8R J;  4Y99 C;  2ZXE B;  3PTZ A;  3OJA B;  1L4A C;  1KB9 H;  1T2K C;  1AV1 A;  1EDI A;  1QL2 A;  4GKG A;  1PPJ D;  1YBK A;  2GUS A;  1GW3 A;  2E74 D;  3BCC G;  2XND H;  3A2A A;  2ZYD A;  1QX8 A;  1BDD A;  3I5C A;  2ZYA A;  3M9H A;  1OXZ A;  3GF7 A;  1RH5 B;  1KYO D;  1FC2 C;  1HF9 A;  2JKV A;  2O1K A;  3M0D C;  4C7N B;  3RGU A;  1LWU C;  1JY3 P;  1KIL B;  1EZV G;  3CC7 P;  4KJM A;  1EZV I;  3A0H H;  2GA1 A;  2L91 A;  3M06 A;  1PIX A;  3KYQ A;  2JR8 A;  1KQS O;  1S4X A;  1MFT A;  3H1J G;  5KAF H;  3L4F A;  3HD7 D;  2PP6 A;  3L70 G;  1BCC E;  5CCH D;  3RL0 B;  3KXD A;  3M91 A;  3WUT A;  2WVR A;  2K9Y A;  1L0L D;  4CPG A;  1FZB A;  4U7J A;  4PJ0 E;  1S5L H;  2OTL P;  3P32 A;  4WY4 D;  1M1J C;  1HWT C;  2ZT9 B;  5AW9 B;  3RK3 C;  2BCC G;  4K35 A;  5GTI H;  3H1I E;  2FFD A;  4QMA A;  3M0A A;  4UB8 H;  4EYY Q;  3MTU E;  3L36 A;  3AEF C;  3TGU G;  1A02 J;  2B89 A;  3HUS C;  1OFC X;  2OTK E;  2QJK C;  4JQ0 D;  2R5B A;  1GL2 D;  1GK6 A;  4H44 B;  3B71 A;  3TNU B;  3CLQ A;  1VQ7 P;  1K9M Q;  1CW5 A;  2V4H A;  5KKZ C;  3WU2 E;  5KLV J;  3PJS K;  1YJ9 P;  1NU1 K;  3L73 J;  1PPJ G;  5E79 H;  4TT3 H;  1SFC C;  1VQ6 P;  3CD6 P;  4XFJ A;  2IDB A;  5APV A;  2N1T B;  1SVF A;  4EDF A;  3FWL A;  3CCS P;  1RF1 C;  4ZNC A;  2BEQ D;  1KYO I;  1URQ C;  2FKW B;  2AEJ A;  3I56 P;  1PL5 A;  1VQK P;  3V6I A;  1P84 E;  1R8E A;  4U3F J;  4A7P A;  3T97 A;  3IN6 A;  1PP9 D;  1FJK A;  1LTJ A;  4N78 D;  2OYH B;  3MIW A;  2WPR A;  4I6M C;  2Q1K A;  3EQ2 A;  2WSC J;  5KLV K;  3VP8 A;  3VMA A;  3GMA A;  3HE5 B;  3B5N A;  3WUU A;  4XA4 A;  1SQB J;  5KAI E;  2KSE A;  3GHG A;  4RES B;  3CXH H;  1YYC A;  2XZR A;  1JY2 N;  5H2F H;  2Q3E A;  5APY A;  1TU3 F;  3HE4 B;  3SSU A;  2A45 I;  3G9R A;  2Z4E A;  1L4A D;  1FZE A;  2HG5 D;  2FY8 A;  1Q82 Q;  2KLU A;  2J59 M;  5GTH E;  4BXL A;  2JEE A;  2WTY A;  3PP5 A;  3GG2 A;  2KS1 B;  3FXD A;  3TYY A;  1NGM B;  5AW1 B;  1BCC G;  1SQB K;  3P7K A;  3O6Q B;  5AVW B;  3U1A A;  3N4X A;  4C7R A;  4IFD K;  1VF5 D;  1SQV J;  4D6T J;  5APX A;  3PLN A;  4PV1 C;  1KQF B;  3CI9 A;  2C9N Y;  3FWN A;  3RK3 E;  2V7Q J;  3V4Q A;  4TLF A;  4DCK A;  2FFD C;  1Q86 Q;  5KLV E;  2I8D A;  2M5A B;  2YMK A;  3L73 E;  1NU1 D;  1ZP0 C;  1NH4 A;  2N9B A;  3AEB C;  2R3S A;  2Y9Y A;  3RL0 D;  4PD4 E;  1IK7 A;  1IFP A;  1N7S B;  2B88 A;  2LXB A;  3O8Z A;  1KFN A;  1EQ7 A;  2K9J B;  2Y0D A;  1SQV K;  3Q5R A;  1UIX A;  1SQX J;  4U3F E;  2E75 B;  1PP9 G;  4JYB A;  1M90 Q;  1JTH B;  2ZAE B;  5APQ A;  2ZT9 D;  1FDI A;  4H0L B;  3RK3 D;  2Q5U A;  5CCG D;  2Z5H A;  4ZMD A;  1NTM D;  3CCJ P;  1JY3 O;  2E76 C;  3L73 D;  1N7L A;  2P1J A;  1SQB E;  2XNX A;  2NRG A;  1RHZ B;  2W83 C;  3S4R A;  4WVZ A;  4I7Z B;  4GOE A;  1HBW A;  4H44 D;  3VMZ A;  1VL2 A;  5BU8 B;  1SQP J;  1LTJ C;  2OYI A;  4U3F D;  2FYZ A;  1J1E C;  1AFO A;  1M57 D;  1RQU A;  3SFD C;  2DW3 A;  3HD7 B;  1WT6 A;  4WB4 A;  1YQ4 C;  3B5N C;  2CPB A;  5BU5 A;  3LW5 H;  2HPC B;  1VQO P;  1KN7 A;  1T8Z A;  2WT7 B;  2G8Y A;  2N1T D;  2OTJ P;  3WMM 0;  2R3C A;  3GHG C;  4JBZ A;  1J1D C;  1X22 A;  1SQB D;  1YI2 P;  4IL6 E;  1BSH A;  1SQV E;  4D6T E;  3C9I A;  3RL0 g;  2H7H A;  1SQP K;  1PV3 A;  3CCR P;  4ZKU A;  1NU1 G;  2YXR B;  2ZJS E;  4NPE A;  5AW4 B;  1KIL A;  2KXP B;  1JNM A;  1D7M A;  2FXO A;  1QGK B;  2O3J A;  3AE5 C;  1OZH A;  5TJH A;  1GL2 B;  2N9Y B;  3CX5 D;  1KYO H;  1FZF A;  1LTS C;  3A7O A;  1SQV D;  2FYN B;  1BE3 J;  4YPC A;  3L74 J;  2KNC A;  2KZI A;  4GT1 A;  1A02 F;  5KLV G;  1DIP A;  5CMZ A;  2YKP A;  3L73 G;  4W80 A;  4GIF A;  2R5D A;  2KK7 A;  3TSI A;  2W6B A;  5B5E H;  3V2R A;  1NTK D;  3GF3 A;  2HOD B;  2WSF H;  3V2N A;  2IZ0 A;  1RF0 C;  4U3F G;  3USS A;  1NTZ J;  1ZR2 A;  1SQP E;  1FZC B;  2YIU B;  3A0B E;  2HFE D;  1NHL A;  4YXD C;  2OGU A;  4H13 B;  1AVY A;  1R5S A;  1FAV A;  3GW6 A;  1H0T B;  1AQT A;  3G71 P;  3AE4 C;  1H89 A;  1SQB G;  4HKZ H;  2FXP A;  1RE3 A;  1XTC C;  1Y47 A;  3IR9 A;  1W5C E;  1N7S D;  2FXM A;  1NVO A;  4Y99 B;  3H6P A;  1PZQ A;  5KJ7 D;  1ZME C;  1L4A B;  2JO1 A;  3M9B A;  2M0B A;  2E75 D;  2OYI C;  5AVQ B;  3MP7 B;  3II6 A;  4PJ0 H;  3L72 E;  1JB0 J;  4HH2 A;  4H0L D;  4ASW A;  2FYU J;  1JY2 O;  3G4S P;  3L75 E;  1RY3 A;  3CX5 I;  1VF5 B;  1GW4 A;  2YO3 A;  3JCU H;  2W6J H;  1SQQ J;  3HE5 A;  4YTP C;  1KQL A;  4KT0 J;  3BVH A;  5C39 A;  4IOI H;  1OW6 A;  2IBZ E;  5AVX B;  1SQV G;  2YXQ B;  1NAF A;  5BVZ A;  1LNQ A;  3PH0 A;  1BE3 E;  3L74 E;  3TDK A;  3HE4 A;  3RK2 C;  3L72 D;  1LT9 C;  5TIS E;  2FYU K;  2JWA A;  1PFI A;  2R44 A;  3H25 A;  3L75 D;  1RQV A;  2WWW A;  5AVU B;  1NTK G;  3GLM A;  3P8C E;  3E7K A;  4UB6 H;  4ZKP A;  2G3A A;  3I55 P;  2KS1 A;  1SQQ K;  3D6Y A;  3O6Q A;  1N86 A;  1M1J B;  3RK3 B;  1NTZ E;  1NYH A;  2C0X A;  1BE3 D;  4JYC A;  4N3Y B;  3L74 D;  2PFX A;  1ZRT E;  5AW7 B;  1LP1 A;  3HUS B;  4HB1 A;  1BCC D;  3Q5P A;  3CCU P;  5KAI H;  2QJK B;  1JEK A;  1SP4 A;  2PGD A;  1W2E A;  2PAJ A;  3P8M C;  3JC2 2;  4L75 A;  1KZU B;  2IYO A;  2OAR A;  1L0N J;  4N6J A;  2YMY A;  2WSE J;  4RJT A;  2QJP C;  5KKZ B;  5CJ0 A;  2M3E A;  5AVY B;  1IFM A;  1WRG A;  4RKU J;  1J2J B;  5AW5 B;  5APS A;  1FDM A;  2MJZ A;  1KC8 Q;  3H1I D;  3H1L J;  2J5U A;  4OWF A;  3OA7 A;  1SS1 A;  2FYU E;  1YTZ T;  3L71 J;  1ZRT D;  3V4W A;  1IO4 A;  2ZYG A;  1JTH A;  1RE3 C;  2IPP A;  1NJI Q;  1URQ B;  3BRV B;  3SWY A;  3BRT B;  1AJY A;  2I1K A;  1SQQ E;  2IYP A;  3B8E B;  3V5B A;  1L0N K;  1IK9 A;  3VMY A;  3IAO A;  1LTI C;  4DOJ A;  5AVV B;  2NPS D;  3L72 G;  3CC4 P;  3CCE P;  3MD0 A;  1K73 Q;  2Q6Q A;  3Q1M A;  2P7J A;  4YXW H;  2HYN A;  1IFJ A;  1X9V A;  3L75 G;  2QVA A;  4H13 D;  1HH0 A;  1YJN P;  2AXC A;  4UB8 E;  2LKM A;  1EC5 A;  1RE4 A;  3N7N A;  3NMD A;  3HD7 A;  2E43 A;  5CCH A;  1P84 D;  1OIP A;  4KHX A;  1SQQ D;  1Q81 Q;  3M9Q A;  3KDP B;  3CPW O;  1T2K D;  3G6E P;  2Z5I A;  1BE3 G;  1YHQ P;  2AXT E;  3EFF K;  3LIE A;  3L74 G;  2LXC B;  5AVS B;  4BWN A;  2D2C C;  4WY4 A;  2WSC H;  1M7L A;  4IL6 X;  1QL1 A;  2XKM A;  5E79 E;  2KOG A;  3BCC J;  1T3J A;  1JCC A;  1NKZ B;  3FXE A;  5AW8 B;  1N73 A;  1L0N E;  1LGH B;  1GL2 A;  2P67 A;  1G2C B;  1HVV A;  4IFF A;  3F5H A;  4OGQ C;  3H1H J;  4LLH A;  5APW A;  2E5T A;  1USE A;  3H1I G;  2B87 A;  2H88 C;  3S1K A;  3H1L E;  1KOR A;  3L71 E;  1PGO A;  3CX5 H;  1BGY J;  3R4Y A;  4IL6 H;  1E79 H;  2XV5 A;  3CXH E;  1JO5 A;  1OWA A;  2NZ2 A;  1VQM P;  3CC2 P;  1L0N D;  3H32 B;  2K37 A;  2Y0C A;  1CI6 A;  2HOD A;  4WWI A;  4BRY B;  3WUV A;  2BEZ F;  1JMM A;  3JSV C;  2V7Q H;  5KLV D;  1T6A A;  2E76 B;  2BCC J;  3SWK A;  1AA0 A;  2PRR A;  3FX0 A;  3L37 A;  2FYU G;  1FZC A;  2I1J A;  1EDL A;  1H88 A;  3LW5 J;  2E74 C;  4PD4 D;  1HJ0 A;  3K5B A;  1P84 I;  1SQQ G;  1SQX K;  3T97 B;  3CWB J;  1LTJ B;  1M56 D;  1MZ9 A;  1J1E B;  3CL3 D;  1OW8 A;  1LTA C;  2WMM A;  3B5N B;  3MZW B;  1L4A A;  1SFC D;  2FBW C;  2W6A A;  3H1K J;  1RE4 C;  1J1D B;  1ZW0 A;  1ZR4 A;  5B66 E;  3BCC E;  1YIJ P;  1URQ D;  3E1R A;  5CCH C;  1LTB C;  1BDC A;  3HTK B;  1NWQ A;  2A06 E;  1GZL A;  1Z56 A;  4C7N A;  1EZV E;  5AVT B;  3H1H E;  3V2Q A;  2O01 J;  4OH8 B;  4WY4 C;  3SWF A;  3MUD A;  2Y9Z A;  1MV8 A;  1JM0 A;  5APU A;  1LT1 A;  2QM8 A;  1KMI Z;  2KI7 B;  1BGY E;  1HTL C;  2QSI A;  2IZ1 A;  1N73 C;  1SQX E;  4D6T D;  1WMK A;  2H43 A;  1L0L J;  1OMI A;  2L5G B;  1X79 B;  1L0N G;  2H8P D;  4W7Y A;  2GM4 A;  2A06 D;  1U7M A;  3Q3D A;  3AE7 C;  1HGZ A;  4LGD E;  3H1H D;  1N2D C;  3H1L G;  2BCC E;  1IFN A;  1Q7Y Q;  1MUU A;  1S9K E;  2QJY B;  3L71 G;  5CCG A;  5M1B A;  4PD4 I;  5KLI C;  2RKL A;  1Q2N A;  2VRS A;  1BGY D;  3HUS A;  1AQ5 A;  4WBA A;  1GDT A;  4PV1 D;  1VQL P;  1SQX D;  3CWB E;  1L0L K;  2NPS B;  1NOH A;  3UIA A;  3MGN A;  4AUW A;  3ABV C;  2IX7 C;  3NXS A;  3TNU A;  2KB7 P;  1QEX A;  4GOF A;  1NKN A;  3TK1 A;  3ITK A;  1OVR A;  1FZC C;  3H1K E;  3ZDM A;  1L2P A;  3BAT A;  4LC1 A;  3AEG C;  1EXI A;  2N1T A;  3AE2 C;  3KZI E;  3U59 A;  1KYO E;  1QVF O;  2B9B A;  3B4S A;  4OVN F;  1U7J A;  4EOT A;  2OYI B;  3NTN A;  1NTZ K;  2W8Z A;  1SQP D;  1PP9 J;  3D6Z A;  1Q90 D;  1KQG B;  2M8R A;  2E76 D;  2OYH A;  1MKM A;  5CJ4 A;  3KQG A;  1YTZ I;  3L35 A;  2E42 A;  2C0W A;  3Q2Y A;  1E5W A;  3H1K D;  3VTP C;  3S9O A;  1FS0 E;  3U1C A;  1LJ2 A;  2UWJ E;  2POH A;  1LWU B;  3AE8 C;  4D6T G;  5KTB A;  5B5E E;  1S5L X;  1VF5 C;  1QVG O;  1L0L E;  4AYC A;  2ZXX A;  3WU2 H;  3PHL A;  2A06 G;  3IFM A;  3RK2 B;  1YIT P;  1LT9 B;  1KIL C;  1U57 A;  3H1H G;  4HYT B;  3B5N D;  1IZN B;  3MUD C;  2KYV A;  1VQ9 P;  1DD3 A;  1Y9B A;  4AQR D;  2QRX A;  2AEF A;  1K8A Q;  3VP9 A;  2QM7 A;  2IFM A;  1FE6 A;  1BGY G;  1P84 H;  3RL0 C;  1IJD B;  5K5G B;  1CZQ A;  1ZLL A;  2IBZ D;  1SQX G;  2KNC B;  2QEX P;  1VQ8 P;  1JCD A;  1KB9 E;  1VQ5 P;  3OAK A;  1PGJ A;  1JOC A;  1ZOY C;  4HJG H;  2ZT9 C;  1NU1 J;  1G2C A;  5CCG C;  4DT0 A;  2GUV A;  1T3U A;  2M5A A;  2RN0 A;  3P8C D;  2KP8 A;  2Q3I A;  4GOD A;  3TF5 A;  1HJB A;  3EWK A;  2WPS A;  4DZO A;  2QJP B;  3JCU E;  1LTG C;  3CCV P;  3VN0 A;  1N7S A;  2P2U A;  2Q7C A;  3CWB G;  1SQP G;  4H44 C;  2HLO A;  1EXJ A;  3A0H E;  1NTZ D;  3A3Y B;  2K9J A;  3AE6 C;  5KJ7 A;  5GTH H;  1SFC B;  2JWD A;  2AXT H;  1PP9 E;  4I2L C;  1IC2 A;  1S2E A;  4N78 E;  1S1C X;  3AEE C;  1KB9 D;  1VQ4 P;  2WQY C;  3AEA C;  1RF1 B;  5KAF E;  3H32 A;  1FU1 A;  1NTM J;  3Q5S A;  2YKQ A;  3H1K G;  1DX7 A;  4BRY A;  1H8A A;  2RH0 A;  3CME P;  1AVO A;  2WSS H;  3AE1 C;  1GK4 A;  2N1T C;  3RBX A;  2QG4 A;  1FOS F;  4UB6 E;  1R5L A;  4RO0 A;  3SFE C;  2WSE H;  3RBZ A;  2QIW A;  4IFM A;  1N8R Q;  3AEC C;  1S5L E;  1GMJ A;  1NO4 A;  2R32 A;  5GTI E;  2WZ7 A;  2OYH C;  2FYU D;  2LR2 A;  1OVU A;  4EIJ A;  5EFW B;  1NTM K;  1ZV8 A;  4PD4 H;  3CCL P;  1S72 P;  2HPC A;  2WT7 A;  2HR3 A;  2IBZ G;  2YKO A;  2IBZ I;  3CMA P;  2MKV A;  5CBN A;  1L0L G;  5DJT B;  3VOP A;  3BAS A;  1Y8A A;  5APT A;  1KIL E;  2A45 G;  2KUB A;  2D2C B;  5AW6 B;  4L76 A;  1K04 A;  4I1L A;  2OQQ A;  2K3R A;  3HTK A;  2M3B A;  1W2B O;  3KHU A;  1IFI A;  1NU1 E;  1KV4 A;  3LID A;  1DD4 A;  2CK3 H;  3NFQ A;  4NPD A;  4PV1 B;  2KZJ A;  4M3L A;  3QWO C;  3W68 A;  3CCQ P;  4EI2 A;  4JF7 A;  4OGQ B;  4W7Z A;  2FFD B;  2YO2 A;  1NTZ G;  1JY2 P;  3RK2 D;  1LP1 B;  1KB9 I;  1KIL D;  3H1J J;  4DJG A;  1USD A;  2K88 A;  3L70 J;  2JDI H;  1NTM E;  2AEM A;  5CHX A;  5B66 H;  1FZG A;  1X0T A;  1G1J A;  1NTK J;  3MHV A;  5H2F E;  1GD2 E;  3IF4 A;  1LTT C;  1S3J A;  1N7S C;  2P58 A;  1M1K Q;  2OYO A;  3QH9 A;  1X8Y A;  2XU6 A;  3CCM P;  5KJ7 C;  3OW2 O;  4R4M A;  2E75 C;  2Y0E A;  1OW7 A;  5AVZ B;  1K05 A;  1RF0 A;  1G1I A;  5AW2 B;  1OVV A;  2ZVO B;  3H1L D;  2NPS A;  2JJL A;  4K3A A;  3TGU J;  3L71 D;  2ZVN B;  4H0L C;  2E74 B;  2QE7 H;  1EDK A;  3HRN A;  1QLE D;  4Y28 J;  1KD1 Q;  4XE5 B;  3FGA D;  2E5Y A;  1H0T A;  1NTK K;  1ZN5 A;  3CXH D;  3KPE A;  2J58 A;  4I7Z C;  3VMX A;  1VDF A;  3A5T A;  2RMZ A;  1NAY A;  2IFN A;  1OX3 A;  1HUC A;  1ZXG A;  2QA4 P;  1JUN A;  2W90 A;  4B86 A;  1IFD A;  1MFZ A;  3GHG B;  3HD7 C;  5AW0 B;  2K1A A;  2WIT A;  3CX5 E;  3EFG A;  2WPV B;  5DJU B;  2SPZ A;  1GU5 A;  4R4L A;  3M0D A;  1VQP P;  3A0B H;  1LWU A;  5CBO A;  2P10 A;  4WY4 B;  2O01 N;  4ASV A;  5AW3 B;  3L72 J;  3V2P A;  3PRJ A;  3H1J E;  1JMB A;  2KIK A;  4MN4 C;  3L70 E;  1HGV A;  1LT9 A;  2Q9I A;  2YNY A;  3L75 J;  3BCC D;  3D71 A;  3AE3 C;  1UII A;  2O1J A;  3D70 A;  3C1L A;  1N73 B;  2WSF J;  3KZI H;  3F89 A;  1NTK E;  1GL2 C;  2H89 C;  3C8V A;  3VYI A;  1XTG B;  1YQ3 C;  1PGP A;  1GU4 A;  2B87 B;  1GTW A;  1EZV D;  1EDJ A;  2FYN C;  2D2C D;  2CPS A;  1M1J A;  2O01 H;  3AED C;  4L74 A;  1DEE G;  4NPF X;  2JP3 A;  3H1J D;  3TGU E;  2ITA A;  1FDO A;  5KLI B;  1BCC J;  2KSJ A;  3G3Z A;  1NTM G;  3L70 D;  1BSN A;  1PGQ A;  3AE9 C;  1FZA A;  2W27 A;  2QJY C;  3CXH I;  1SLQ A;  1FJP A;  1DEB A;  1CI6 B;  1DH3 A;  2ZFC A;  3R2P A;  4OGQ D;  4L73 A;  2A45 H;  1FOS E;  5TIS H;  2KLV A;  1VPC A;  2C9L Y;  5AVR B;  1PPJ E;  2NPS C;  3H1I J;  2YIU C;  1KTM A;  2BCC D;  4JPZ B;  1S9K D;  2BAS A;  2XDJ A;  4GDO A;  3W67 A;  1FBM A;  1YJW P;  2WPQ A;  1SFC A;  1VQN P;  3TGU D;  4C46 A;  1M8O B;  4H13 C;  3E1I A;  1KFM A;  4Z1M H;  1RF1 A;  1CSB A;  4O9B A;  1URQ A; 
#chains in the Genus database with same CATH homology
 5H2F E;  5TIS E;  3JCU E;  4PJ0 E;  1W5C E;  3A0B E;  1S5L E;  5KAI E;  3A0H E;  5B5E E;  5E79 E;  3KZI E;  5GTI E;  4UB8 E;  5GTH E;  2AXT E;  4UB6 E;  5B66 E;  3WU2 E;  4IL6 E;  5KAF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...