3WU2O

Crystal structure analysis of photosystem ii complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
244
structure length
244
Chain Sequence
QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 52
structure length 244
sequence length 244
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3wu2O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3wu2O02
5H2FO 3WU2O 5E79O 5G38A 3JCUO 5KAIO 1S5LO 4UB6O 4PJ0O 5KAFO 4UB8O 5TISO 3KZIO 5GTHO 5B66O 2AXTO 3A0BO 3A0HO 5GTIO 5B5EO 4IL6O 5G3AA 5G39A
chains in the Genus database with same CATH superfamily
1E54A 3NSGA 5E79O 4K3BA 3AA1A 5G38A 1BXWA 4XNKA 5KAIO 4Z3TA 2M07A 3G7GA 1S5LO 1ZHTA 2IWVA 3LK3A 4RJXA 2YPVA 1T16A 4N74A 3SYBA 4PJ0O 2O4VA 3DWNA 2Y0HA 3LK2B 3PORA 4GCSA 5EE2A 2R4LA 5AFUK 5GTHO 1ZHZA 2JQYA 2XG6A 2M06A 2Y2XA 4O49A 3WI4A 4F4BA 1QJPA 3V8UA 1QJ8A 2WJRA 3LK42 5B66O 1T1LA 3K19A 4FSPA 3VY9X 8PRNA 2J1NA 4CTDA 5DL6A 2ERVA 5T5FA 2YNKA 3DWOX 3SZVA 3QRAA 3VZTX 1P4TA 2F1VA 4AYID 2PORA 1MPFA 4RLCA 4FQEA 3WI5A 3T24A 1HXXA 3FYXA 2FGRA 4U9CA 5ADXK 2LHFA 3HWBA 3AA0B 3VY8X 4E1SA 1GFNA 4GF4A 2K0LA 4G76A 4LSEA 5GV0A 5H2FO 3VE1A 1HXTA 1IZNA 4XNLA 3AA7B 3VZWX 2J4UP 4FZLA 2KDYA 2LFUA 3O0EA 3DA3A 6PRNA 1GFQA 4PR7A 2GE4A 3PGUA 3UAQA 4RJWA 1YS5A 2N2MA 5FVNA 4E1TA 2Y0KA 3AA1B 4FUVA 3VE2A 4AUIA 4LSIA 5DL7A 5IYUA 5PRNA 5ADXL 2KXPA 1ORMA 2XE5A 4FRTA 4FESA 2K4TA 3LK3B 2ZLDA 2AXTO 2X9KA 4BUMX 3SZDA 3BRZA 3A0BO 2MNHA 4C69X 5D5DA 5B5EO 3AA6A 4IL6O 2PRNA 4AYNA 4AFKA 3HOLA 2W81C 1OPFA 1ZHXA 2JMMA 4O3ZA 2R4PA 1HXUA 4AKMA 4D5UA 4O4UA 1G90A 3GP6A 2F1TA 3T0SA 4FRXA 2N2LA 4GCQA 3AAEA 3SYSA 2ODJA 2W80C 4O3WA 3UU2A 3WU2O 2R89A 3PRNA 4FOZA 1BT9A 3JCUO 1THQA 4JCHA 5DL8A 1GFMA 1MM4A 3PGSA 4RL9A 4FT6A 2R4OA 3SY7A 4FMSA 1IZNB 4AYDC 1ZHYA 2WJQA 4GCPA 4AYMC 2F1CX 5TISO 3KZIO 3HW9A 3KVDD 4FZMA 4KRAA 2IWWA 1MM5A 1BH3A 3AAAA 3POUA 4AKRA 3POQA 3PGRA 4O3XB 3HOEA 3A0HO 3LK41 5GTIO 2XE1A 2X27X 2XE3A 4QQ1A 2FGQX 3SY9A 3VZUX 2R88A 4B61A 5G3AA 1ZHWA 2KXPB 3EMNX 5G39A 4KR8A 4KR4A 4AYEC 2WVPA 2R8AA 4GHBA 1Q9GA 3POXA 4C4VA 3BRYA 4N58A 3AA6B 4FSOA 1GFOA 4K3CA 3LK2A 2Y0LA 1GFPA 2XTRA 1QJ9A 4RLBA 2QTKA 2OMFA 4C4VB 3DA4A 4JFBA 4UB6O 5JDPA 3T20A 3QRCA 3AAEB 4LSHA 2Y7SA 2ZFGA 4O3YA 3PQUA 5DL5A 3UPGA 5KAFO 3C5OA 4UB8O 1PHOA 3DZMA 2KZ7A 4N59A 3BS0A 4PUXA 3NJTA 4FZNA 1Q9FA 3RBHA 4G75A 2R4NA 4C00A 4AZLA 1H6S1 3AA0A 4O4XA 4D64A 3TZGA 2KZ7B 2XE2A 3JTYA 2XTQA 1OSMA 3AA7A 2MHLA 2XMXA 2KC0A 3AAAB 4N75A 7PRNA 1PRNA 4AKRB 5AFUL 5G26A 4D65A 3PF1A 4LSFA 3A2SX 3PQSA
chains in the Genus database with same CATH topology
5H2FO 3WU2O 5E79O 5G38A 3JCUO 5KAIO 1S5LO 4UB6O 4PJ0O 5KAFO 4UB8O 5TISO 3KZIO 5GTHO 5B66O 2AXTO 3A0BO 3A0HO 5GTIO 5B5EO 4IL6O 5G3AA 5G39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2F O;  3WU2 O;  5E79 O;  5G38 A;  3JCU O;  5KAI O;  1S5L O;  4UB6 O;  4PJ0 O;  5KAF O;  4UB8 O;  5TIS O;  3KZI O;  5GTH O;  5B66 O;  2AXT O;  3A0B O;  3A0H O;  5GTI O;  5B5E O;  4IL6 O;  5G3A A;  5G39 A; 
#chains in the Genus database with same CATH topology
 1E54 A;  3NSG A;  5E79 O;  4K3B A;  3AA1 A;  5G38 A;  1BXW A;  4XNK A;  5KAI O;  4Z3T A;  2M07 A;  3G7G A;  1S5L O;  1ZHT A;  2IWV A;  3LK3 A;  4RJX A;  2YPV A;  1T16 A;  4N74 A;  3SYB A;  4PJ0 O;  2O4V A;  3DWN A;  2Y0H A;  3LK2 B;  3POR A;  4GCS A;  5EE2 A;  2R4L A;  5AFU K;  5GTH O;  1ZHZ A;  2JQY A;  2XG6 A;  2M06 A;  2Y2X A;  4O49 A;  3WI4 A;  4F4B A;  1QJP A;  3V8U A;  1QJ8 A;  2WJR A;  3LK4 2;  5B66 O;  1T1L A;  3K19 A;  4FSP A;  3VY9 X;  8PRN A;  2J1N A;  4CTD A;  5DL6 A;  2ERV A;  5T5F A;  2YNK A;  3DWO X;  3SZV A;  3QRA A;  3VZT X;  1P4T A;  2F1V A;  4AYI D;  2POR A;  1MPF A;  4RLC A;  4FQE A;  3WI5 A;  3T24 A;  1HXX A;  3FYX A;  2FGR A;  4U9C A;  5ADX K;  2LHF A;  3HWB A;  3AA0 B;  3VY8 X;  4E1S A;  1GFN A;  4GF4 A;  2K0L A;  4G76 A;  4LSE A;  5GV0 A;  5H2F O;  3VE1 A;  1HXT A;  1IZN A;  4XNL A;  3AA7 B;  3VZW X;  2J4U P;  4FZL A;  2KDY A;  2LFU A;  3O0E A;  3DA3 A;  6PRN A;  1GFQ A;  4PR7 A;  2GE4 A;  3PGU A;  3UAQ A;  4RJW A;  1YS5 A;  2N2M A;  5FVN A;  4E1T A;  2Y0K A;  3AA1 B;  4FUV A;  3VE2 A;  4AUI A;  4LSI A;  5DL7 A;  5IYU A;  5PRN A;  5ADX L;  2KXP A;  1ORM A;  2XE5 A;  4FRT A;  4FES A;  2K4T A;  3LK3 B;  2ZLD A;  2AXT O;  2X9K A;  4BUM X;  3SZD A;  3BRZ A;  3A0B O;  2MNH A;  4C69 X;  5D5D A;  5B5E O;  3AA6 A;  4IL6 O;  2PRN A;  4AYN A;  4AFK A;  3HOL A;  2W81 C;  1OPF A;  1ZHX A;  2JMM A;  4O3Z A;  2R4P A;  1HXU A;  4AKM A;  4D5U A;  4O4U A;  1G90 A;  3GP6 A;  2F1T A;  3T0S A;  4FRX A;  2N2L A;  4GCQ A;  3AAE A;  3SYS A;  2ODJ A;  2W80 C;  4O3W A;  3UU2 A;  3WU2 O;  2R89 A;  3PRN A;  4FOZ A;  1BT9 A;  3JCU O;  1THQ A;  4JCH A;  5DL8 A;  1GFM A;  1MM4 A;  3PGS A;  4RL9 A;  4FT6 A;  2R4O A;  3SY7 A;  4FMS A;  1IZN B;  4AYD C;  1ZHY A;  2WJQ A;  4GCP A;  4AYM C;  2F1C X;  5TIS O;  3KZI O;  3HW9 A;  3KVD D;  4FZM A;  4KRA A;  2IWW A;  1MM5 A;  1BH3 A;  3AAA A;  3POU A;  4AKR A;  3POQ A;  3PGR A;  4O3X B;  3HOE A;  3A0H O;  3LK4 1;  5GTI O;  2XE1 A;  2X27 X;  2XE3 A;  4QQ1 A;  2FGQ X;  3SY9 A;  3VZU X;  2R88 A;  4B61 A;  5G3A A;  1ZHW A;  2KXP B;  3EMN X;  5G39 A;  4KR8 A;  4KR4 A;  4AYE C;  2WVP A;  2R8A A;  4GHB A;  1Q9G A;  3POX A;  4C4V A;  3BRY A;  4N58 A;  3AA6 B;  4FSO A;  1GFO A;  4K3C A;  3LK2 A;  2Y0L A;  1GFP A;  2XTR A;  1QJ9 A;  4RLB A;  2QTK A;  2OMF A;  4C4V B;  3DA4 A;  4JFB A;  4UB6 O;  5JDP A;  3T20 A;  3QRC A;  3AAE B;  4LSH A;  2Y7S A;  2ZFG A;  4O3Y A;  3PQU A;  5DL5 A;  3UPG A;  5KAF O;  3C5O A;  4UB8 O;  1PHO A;  3DZM A;  2KZ7 A;  4N59 A;  3BS0 A;  4PUX A;  3NJT A;  4FZN A;  1Q9F A;  3RBH A;  4G75 A;  2R4N A;  4C00 A;  4AZL A;  1H6S 1;  3AA0 A;  4O4X A;  4D64 A;  3TZG A;  2KZ7 B;  2XE2 A;  3JTY A;  2XTQ A;  1OSM A;  3AA7 A;  2MHL A;  2XMX A;  2KC0 A;  3AAA B;  4N75 A;  7PRN A;  1PRN A;  4AKR B;  5AFU L;  5G26 A;  4D65 A;  3PF1 A;  4LSF A;  3A2S X;  3PQS A; 
#chains in the Genus database with same CATH homology
 5H2F O;  3WU2 O;  5E79 O;  5G38 A;  3JCU O;  5KAI O;  1S5L O;  4UB6 O;  4PJ0 O;  5KAF O;  4UB8 O;  5TIS O;  3KZI O;  5GTH O;  5B66 O;  2AXT O;  3A0B O;  3A0H O;  5GTI O;  5B5E O;  4IL6 O;  5G3A A;  5G39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...