3WU2O

Crystal structure analysis of photosystem ii complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
244
structure length
244
Chain Sequence
QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 52
structure length 244
sequence length 244
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3wu2O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3wu2O02
4IL6O 5E79O 5TISO 5B5EO 5G38A 1S5LO 5KAIO 5GTIO 2AXTO 5G3AA 3A0BO 5B66O 4PJ0O 4UB6O 5H2FO 3JCUO 5KAFO 3WU2O 3KZIO 5GTHO 5G39A 3A0HO 4UB8O
chains in the Genus database with same CATH superfamily
4IL6O 2LFUA 3SZDA 4AYID 2KXPB 4RLBA 5TISO 4LSFA 3T24A 4GCPA 5B5EO 3AA0B 2JMMA 2JQYA 2Y7SA 4FZMA 2ERVA 3SY7A 1OPFA 4K3CA 3A0BO 1IZNB 3AA7B 2R4LA 2LHFA 1Q9FA 2QTKA 4D65A 4PJ0O 4QQ1A 2O4VA 3UPGA 3HWBA 4O3YA 5G26A 1ZHYA 3JTYA 3PF1A 4GF4A 2R4OA 3NJTA 5G38A 4RJWA 2J1NA 1Q9GA 4FESA 5DL8A 1MPFA 5KAFO 4FSPA 4C69X 2PRNA 3KZIO 4C4VA 1G90A 2WJRA 5DL7A 3WI4A 2XE1A 4FOZA 3WI5A 4G75A 3HOLA 3POUA 1GFPA 4JCHA 4PR7A 5DL6A 3VE1A 4AKRA 3A0HO 3NSGA 3BRYA 2KZ7A 1HXXA 2KXPA 1QJPA 3BRZA 3PGRA 5E79O 3C5OA 4E1SA 2N2MA 2Y0LA 4N75A 3PGUA 4KRAA 2WVPA 3PORA 5D5DA 2J4UP 2XTQA 4LSIA 2KDYA 4U9CA 5GTIO 3V8UA 3EMNX 1BH3A 1GFQA 3SZVA 2XE3A 4AFKA 3LK42 3RBHA 4D64A 8PRNA 4Z3TA 1ZHTA 5ADXK 5B66O 2MHLA 2KC0A 4GCSA 2Y2XA 2WJQA 3PQSA 2N2LA 3DZMA 3VZTX 3PGSA 5T5FA 2M06A 4AKMA 5H2FO 2M07A 2R4PA 3FYXA 3K19A 4D5UA 3LK3B 3WU2O 2YPVA 1GFOA 2PORA 3SYBA 4C00A 1P4TA 1ZHXA 1E54A 2IWVA 2MNHA 4FQEA 4XNLA 4AYDC 1IZNA 1QJ9A 2GE4A 4E1TA 2XTRA 2X27X 3DWOX 5G39A 4LSHA 4C4VB 4FRTA 3AAAA 1PHOA 2IWWA 3VZUX 3QRCA 4AKRB 2F1CX 2FGQX 3AA0A 3DA4A 1QJ8A 4G76A 4LSEA 5FVNA 5PRNA 3POQA 1GFMA 3SY9A 2XE5A 3VY8X 1BXWA 1S5LO 4FUVA 4K3BA 3BS0A 4O4XA 3VZWX 5GV0A 3G7GA 4N59A 5ADXL 4CTDA 2Y0KA 3GP6A 4AYMC 3AA1A 4O3WA 2YNKA 5JDPA 5DL5A 3HW9A 3AA7A 1ORMA 1T16A 3DWNA 4XNKA 4UB6O 3KVDD 3T0SA 2ODJA 5IYUA 2F1TA 2K0LA 2R4NA 4RJXA 4N58A 4RLCA 2W81C 4GCQA 3JCUO 1MM5A 2K4TA 3QRAA 3LK2A 1ZHWA 3O0EA 4PUXA 2Y0HA 3AAAB 4FZNA 6PRNA 3A2SX 2ZLDA 4RL9A 1HXTA 3PQUA 2W80C 5AFUL 3VE2A 7PRNA 3LK3A 4UB8O 3UU2A 3AA6B 4BUMX 1MM4A 3SYSA 4B61A 1T1LA 2OMFA 2R89A 2ZFGA 4FMSA 3POXA 4O4UA 1YS5A 2XG6A 4N74A 3AA6A 4GHBA 1OSMA 2R88A 4KR4A 4FRXA 4FZLA 5EE2A 2XE2A 5KAIO 4O3ZA 2AXTO 5G3AA 4O3XB 4KR8A 2XMXA 4O49A 3TZGA 4AUIA 2FGRA 1GFNA 4FSOA 4AYNA 3T20A 3LK2B 3VY9X 2R8AA 3AAEB 1H6S1 3AAEA 3PRNA 3DA3A 1PRNA 3UAQA 4F4BA 1THQA 4FT6A 1ZHZA 2KZ7B 3HOEA 2F1VA 3AA1B 2X9KA 4AYEC 5GTHO 4JFBA 5AFUK 4AZLA 1HXUA 1BT9A 3LK41
chains in the Genus database with same CATH topology
4IL6O 5E79O 5TISO 5B5EO 5G38A 1S5LO 5KAIO 5GTIO 2AXTO 5G3AA 3A0BO 5B66O 4PJ0O 4UB6O 5H2FO 3JCUO 5KAFO 3WU2O 3KZIO 5GTHO 5G39A 3A0HO 4UB8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL6 O;  5E79 O;  5TIS O;  5B5E O;  5G38 A;  1S5L O;  5KAI O;  5GTI O;  2AXT O;  5G3A A;  3A0B O;  5B66 O;  4PJ0 O;  4UB6 O;  5H2F O;  3JCU O;  5KAF O;  3WU2 O;  3KZI O;  5GTH O;  5G39 A;  3A0H O;  4UB8 O; 
#chains in the Genus database with same CATH topology
 4IL6 O;  2LFU A;  3SZD A;  4AYI D;  2KXP B;  4RLB A;  5TIS O;  4LSF A;  3T24 A;  4GCP A;  5B5E O;  3AA0 B;  2JMM A;  2JQY A;  2Y7S A;  4FZM A;  2ERV A;  3SY7 A;  1OPF A;  4K3C A;  3A0B O;  1IZN B;  3AA7 B;  2R4L A;  2LHF A;  1Q9F A;  2QTK A;  4D65 A;  4PJ0 O;  4QQ1 A;  2O4V A;  3UPG A;  3HWB A;  4O3Y A;  5G26 A;  1ZHY A;  3JTY A;  3PF1 A;  4GF4 A;  2R4O A;  3NJT A;  5G38 A;  4RJW A;  2J1N A;  1Q9G A;  4FES A;  5DL8 A;  1MPF A;  5KAF O;  4FSP A;  4C69 X;  2PRN A;  3KZI O;  4C4V A;  1G90 A;  2WJR A;  5DL7 A;  3WI4 A;  2XE1 A;  4FOZ A;  3WI5 A;  4G75 A;  3HOL A;  3POU A;  1GFP A;  4JCH A;  4PR7 A;  5DL6 A;  3VE1 A;  4AKR A;  3A0H O;  3NSG A;  3BRY A;  2KZ7 A;  1HXX A;  2KXP A;  1QJP A;  3BRZ A;  3PGR A;  5E79 O;  3C5O A;  4E1S A;  2N2M A;  2Y0L A;  4N75 A;  3PGU A;  4KRA A;  2WVP A;  3POR A;  5D5D A;  2J4U P;  2XTQ A;  4LSI A;  2KDY A;  4U9C A;  5GTI O;  3V8U A;  3EMN X;  1BH3 A;  1GFQ A;  3SZV A;  2XE3 A;  4AFK A;  3LK4 2;  3RBH A;  4D64 A;  8PRN A;  4Z3T A;  1ZHT A;  5ADX K;  5B66 O;  2MHL A;  2KC0 A;  4GCS A;  2Y2X A;  2WJQ A;  3PQS A;  2N2L A;  3DZM A;  3VZT X;  3PGS A;  5T5F A;  2M06 A;  4AKM A;  5H2F O;  2M07 A;  2R4P A;  3FYX A;  3K19 A;  4D5U A;  3LK3 B;  3WU2 O;  2YPV A;  1GFO A;  2POR A;  3SYB A;  4C00 A;  1P4T A;  1ZHX A;  1E54 A;  2IWV A;  2MNH A;  4FQE A;  4XNL A;  4AYD C;  1IZN A;  1QJ9 A;  2GE4 A;  4E1T A;  2XTR A;  2X27 X;  3DWO X;  5G39 A;  4LSH A;  4C4V B;  4FRT A;  3AAA A;  1PHO A;  2IWW A;  3VZU X;  3QRC A;  4AKR B;  2F1C X;  2FGQ X;  3AA0 A;  3DA4 A;  1QJ8 A;  4G76 A;  4LSE A;  5FVN A;  5PRN A;  3POQ A;  1GFM A;  3SY9 A;  2XE5 A;  3VY8 X;  1BXW A;  1S5L O;  4FUV A;  4K3B A;  3BS0 A;  4O4X A;  3VZW X;  5GV0 A;  3G7G A;  4N59 A;  5ADX L;  4CTD A;  2Y0K A;  3GP6 A;  4AYM C;  3AA1 A;  4O3W A;  2YNK A;  5JDP A;  5DL5 A;  3HW9 A;  3AA7 A;  1ORM A;  1T16 A;  3DWN A;  4XNK A;  4UB6 O;  3KVD D;  3T0S A;  2ODJ A;  5IYU A;  2F1T A;  2K0L A;  2R4N A;  4RJX A;  4N58 A;  4RLC A;  2W81 C;  4GCQ A;  3JCU O;  1MM5 A;  2K4T A;  3QRA A;  3LK2 A;  1ZHW A;  3O0E A;  4PUX A;  2Y0H A;  3AAA B;  4FZN A;  6PRN A;  3A2S X;  2ZLD A;  4RL9 A;  1HXT A;  3PQU A;  2W80 C;  5AFU L;  3VE2 A;  7PRN A;  3LK3 A;  4UB8 O;  3UU2 A;  3AA6 B;  4BUM X;  1MM4 A;  3SYS A;  4B61 A;  1T1L A;  2OMF A;  2R89 A;  2ZFG A;  4FMS A;  3POX A;  4O4U A;  1YS5 A;  2XG6 A;  4N74 A;  3AA6 A;  4GHB A;  1OSM A;  2R88 A;  4KR4 A;  4FRX A;  4FZL A;  5EE2 A;  2XE2 A;  5KAI O;  4O3Z A;  2AXT O;  5G3A A;  4O3X B;  4KR8 A;  2XMX A;  4O49 A;  3TZG A;  4AUI A;  2FGR A;  1GFN A;  4FSO A;  4AYN A;  3T20 A;  3LK2 B;  3VY9 X;  2R8A A;  3AAE B;  1H6S 1;  3AAE A;  3PRN A;  3DA3 A;  1PRN A;  3UAQ A;  4F4B A;  1THQ A;  4FT6 A;  1ZHZ A;  2KZ7 B;  3HOE A;  2F1V A;  3AA1 B;  2X9K A;  4AYE C;  5GTH O;  4JFB A;  5AFU K;  4AZL A;  1HXU A;  1BT9 A;  3LK4 1; 
#chains in the Genus database with same CATH homology
 4IL6 O;  5E79 O;  5TIS O;  5B5E O;  5G38 A;  1S5L O;  5KAI O;  5GTI O;  2AXT O;  5G3A A;  3A0B O;  5B66 O;  4PJ0 O;  4UB6 O;  5H2F O;  3JCU O;  5KAF O;  3WU2 O;  3KZI O;  5GTH O;  5G39 A;  3A0H O;  4UB8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...