3WU2O

Crystal structure analysis of photosystem ii complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
244
structure length
244
Chain Sequence
b'QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 52
structure length 244
sequence length 244
chains with identical sequence o
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3wu2O01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3wu2O02
3WU2O 5E79O 3A0HO 5H2FO 5GTHO 3JCUO 5B66O 5GTIO 3KZIO 4UB6O 4IL6O 5G38A 5B5EO 1S5LO 5G3AA 2AXTO 4UB8O 4PJ0O 5G39A 5KAIO 5KAFO 3A0BO 5TISO
chains in the Genus database with same CATH superfamily
3DA3A 5E79O 4LSEA 4AUIA 2GE4A 3PORA 2XTRA 4FQEA 3AAEB 3POXA 5B66O 5DL6A 4K3CA 2PORA 2XE3A 1MM4A 2ZLDA 3POQA 4O49A 4AYEC 2Y0LA 3DA4A 3KVDD 4FT6A 4FSOA 4XNLA 5G38A 4Z3TA 3LK42 1E54A 1ZHTA 4O3ZA 2OMFA 4QQ1A 4RLBA 5AFUL 2W80C 3LK3A 1MPFA 4FSPA 4FUVA 4O3YA 5D5DA 5T5FA 4RJWA 3BRYA 3SZVA 2FGQX 3AA0B 3A2SX 1OPFA 3NSGA 3VE2A 3DZMA 4AKRA 1IZNA 3PGSA 2R4LA 2MHLA 2KZ7B 3UU2A 4D5UA 3HWBA 1ZHXA 4FRXA 4LSIA 3SZDA 1T16A 2JQYA 3LK2A 3BS0A 3PF1A 4FESA 4PR7A 4AZLA 2IWVA 2K4TA 3HOEA 3AA7A 5AFUK 3PGUA 2XMXA 4KR4A 5IYUA 3EMNX 1OSMA 4E1TA 5GTHO 2M07A 3PRNA 4C00A 3K19A 2Y0KA 2QTKA 4PUXA 2XE5A 2Y7SA 3G7GA 3AAAB 2YPVA 4O4UA 5DL7A 2JMMA 2J1NA 3NJTA 1HXTA 2YNKA 4FMSA 4O4XA 5B5EO 2F1VA 5GTIO 3SYSA 1Q9GA 5G3AA 2ZFGA 4O3WA 4U9CA 3T0SA 3VE1A 4N74A 1BH3A 4CTDA 4LSFA 2WJRA 3O0EA 3AAEA 3VY9X 4RJXA 2XG6A 2R8AA 1HXUA 3AA1B 3PGRA 3SYBA 4PJ0O 4GF4A 2R4OA 1BXWA 4FRTA 4G75A 4GCQA 2Y2XA 4FOZA 4KR8A 2J4UP 4D64A 3A0BO 4RLCA 3TZGA 1G90A 2LHFA 2R4PA 5FVNA 2XE2A 3AA0A 3JTYA 4FZLA 4AYDC 2PRNA 3AA6B 4E1SA 1ZHWA 3JCUO 4BUMX 2X9KA 2WVPA 4D65A 4LSHA 3C5OA 2KXPB 1QJ9A 3WI4A 1T1LA 2KZ7A 4N59A 4UB6O 4IL6O 3UAQA 4AYNA 4C4VB 3WI5A 3PQUA 3QRCA 5ADXK 4JCHA 1PHOA 1HXXA 2WJQA 2X27X 2ODJA 1S5LO 3GP6A 2LFUA 4N75A 3FYXA 4RL9A 2KDYA 3SY7A 3VY8X 3UPGA 6PRNA 2F1CX 5GV0A 3BRZA 1H6S1 1BT9A 2ERVA 3HW9A 3VZTX 3T24A 3POUA 4JFBA 4C69X 4UB8O 4G76A 5ADXL 1PRNA 3AAAA 4KRAA 2N2LA 5KAIO 3RBHA 2O4VA 1ORMA 4AFKA 4GHBA 3LK3B 3T20A 5TISO 3SY9A 3VZUX 2R89A 2K0LA 3WU2O 4AKMA 5JDPA 3A0HO 5EE2A 1THQA 3DWOX 5H2FO 3LK41 2Y0HA 2N2MA 4F4BA 4AKRB 1IZNB 3V8UA 2R88A 1ZHZA 4FZNA 2FGRA 1QJPA 2R4NA 1ZHYA 1GFPA 3AA1A 3KZIO 4GCPA 4N58A 4K3BA 1YS5A 1Q9FA 3LK2B 4XNKA 5DL8A 1MM5A 1GFQA 3QRAA 1GFOA 2W81C 5G26A 3AA7B 1GFNA 1GFMA 5DL5A 3PQSA 2XE1A 4FZMA 2AXTO 4B61A 2IWWA 3AA6A 4GCSA 2KC0A 1QJ8A 4AYMC 3HOLA 2F1TA 2KXPA 4O3XB 4C4VA 2XTQA 3DWNA 7PRNA 5G39A 5PRNA 8PRNA 5KAFO 3VZWX 4AYID 2M06A 2MNHA 1P4TA
chains in the Genus database with same CATH topology
3WU2O 5E79O 3A0HO 5H2FO 5GTHO 3JCUO 5B66O 5GTIO 3KZIO 4UB6O 4IL6O 5G38A 5B5EO 1S5LO 5G3AA 2AXTO 4UB8O 4PJ0O 5G39A 5KAIO 5KAFO 3A0BO 5TISO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 O;  5E79 O;  3A0H O;  5H2F O;  5GTH O;  3JCU O;  5B66 O;  5GTI O;  3KZI O;  4UB6 O;  4IL6 O;  5G38 A;  5B5E O;  1S5L O;  5G3A A;  2AXT O;  4UB8 O;  4PJ0 O;  5G39 A;  5KAI O;  5KAF O;  3A0B O;  5TIS O; 
#chains in the Genus database with same CATH topology
 3DA3 A;  5E79 O;  4LSE A;  4AUI A;  2GE4 A;  3POR A;  2XTR A;  4FQE A;  3AAE B;  3POX A;  5B66 O;  5DL6 A;  4K3C A;  2POR A;  2XE3 A;  1MM4 A;  2ZLD A;  3POQ A;  4O49 A;  4AYE C;  2Y0L A;  3DA4 A;  3KVD D;  4FT6 A;  4FSO A;  4XNL A;  5G38 A;  4Z3T A;  3LK4 2;  1E54 A;  1ZHT A;  4O3Z A;  2OMF A;  4QQ1 A;  4RLB A;  5AFU L;  2W80 C;  3LK3 A;  1MPF A;  4FSP A;  4FUV A;  4O3Y A;  5D5D A;  5T5F A;  4RJW A;  3BRY A;  3SZV A;  2FGQ X;  3AA0 B;  3A2S X;  1OPF A;  3NSG A;  3VE2 A;  3DZM A;  4AKR A;  1IZN A;  3PGS A;  2R4L A;  2MHL A;  2KZ7 B;  3UU2 A;  4D5U A;  3HWB A;  1ZHX A;  4FRX A;  4LSI A;  3SZD A;  1T16 A;  2JQY A;  3LK2 A;  3BS0 A;  3PF1 A;  4FES A;  4PR7 A;  4AZL A;  2IWV A;  2K4T A;  3HOE A;  3AA7 A;  5AFU K;  3PGU A;  2XMX A;  4KR4 A;  5IYU A;  3EMN X;  1OSM A;  4E1T A;  5GTH O;  2M07 A;  3PRN A;  4C00 A;  3K19 A;  2Y0K A;  2QTK A;  4PUX A;  2XE5 A;  2Y7S A;  3G7G A;  3AAA B;  2YPV A;  4O4U A;  5DL7 A;  2JMM A;  2J1N A;  3NJT A;  1HXT A;  2YNK A;  4FMS A;  4O4X A;  5B5E O;  2F1V A;  5GTI O;  3SYS A;  1Q9G A;  5G3A A;  2ZFG A;  4O3W A;  4U9C A;  3T0S A;  3VE1 A;  4N74 A;  1BH3 A;  4CTD A;  4LSF A;  2WJR A;  3O0E A;  3AAE A;  3VY9 X;  4RJX A;  2XG6 A;  2R8A A;  1HXU A;  3AA1 B;  3PGR A;  3SYB A;  4PJ0 O;  4GF4 A;  2R4O A;  1BXW A;  4FRT A;  4G75 A;  4GCQ A;  2Y2X A;  4FOZ A;  4KR8 A;  2J4U P;  4D64 A;  3A0B O;  4RLC A;  3TZG A;  1G90 A;  2LHF A;  2R4P A;  5FVN A;  2XE2 A;  3AA0 A;  3JTY A;  4FZL A;  4AYD C;  2PRN A;  3AA6 B;  4E1S A;  1ZHW A;  3JCU O;  4BUM X;  2X9K A;  2WVP A;  4D65 A;  4LSH A;  3C5O A;  2KXP B;  1QJ9 A;  3WI4 A;  1T1L A;  2KZ7 A;  4N59 A;  4UB6 O;  4IL6 O;  3UAQ A;  4AYN A;  4C4V B;  3WI5 A;  3PQU A;  3QRC A;  5ADX K;  4JCH A;  1PHO A;  1HXX A;  2WJQ A;  2X27 X;  2ODJ A;  1S5L O;  3GP6 A;  2LFU A;  4N75 A;  3FYX A;  4RL9 A;  2KDY A;  3SY7 A;  3VY8 X;  3UPG A;  6PRN A;  2F1C X;  5GV0 A;  3BRZ A;  1H6S 1;  1BT9 A;  2ERV A;  3HW9 A;  3VZT X;  3T24 A;  3POU A;  4JFB A;  4C69 X;  4UB8 O;  4G76 A;  5ADX L;  1PRN A;  3AAA A;  4KRA A;  2N2L A;  5KAI O;  3RBH A;  2O4V A;  1ORM A;  4AFK A;  4GHB A;  3LK3 B;  3T20 A;  5TIS O;  3SY9 A;  3VZU X;  2R89 A;  2K0L A;  3WU2 O;  4AKM A;  5JDP A;  3A0H O;  5EE2 A;  1THQ A;  3DWO X;  5H2F O;  3LK4 1;  2Y0H A;  2N2M A;  4F4B A;  4AKR B;  1IZN B;  3V8U A;  2R88 A;  1ZHZ A;  4FZN A;  2FGR A;  1QJP A;  2R4N A;  1ZHY A;  1GFP A;  3AA1 A;  3KZI O;  4GCP A;  4N58 A;  4K3B A;  1YS5 A;  1Q9F A;  3LK2 B;  4XNK A;  5DL8 A;  1MM5 A;  1GFQ A;  3QRA A;  1GFO A;  2W81 C;  5G26 A;  3AA7 B;  1GFN A;  1GFM A;  5DL5 A;  3PQS A;  2XE1 A;  4FZM A;  2AXT O;  4B61 A;  2IWW A;  3AA6 A;  4GCS A;  2KC0 A;  1QJ8 A;  4AYM C;  3HOL A;  2F1T A;  2KXP A;  4O3X B;  4C4V A;  2XTQ A;  3DWN A;  7PRN A;  5G39 A;  5PRN A;  8PRN A;  5KAF O;  3VZW X;  4AYI D;  2M06 A;  2MNH A;  1P4T A; 
#chains in the Genus database with same CATH homology
 3WU2 O;  5E79 O;  3A0H O;  5H2F O;  5GTH O;  3JCU O;  5B66 O;  5GTI O;  3KZI O;  4UB6 O;  4IL6 O;  5G38 A;  5B5E O;  1S5L O;  5G3A A;  2AXT O;  4UB8 O;  4PJ0 O;  5G39 A;  5KAI O;  5KAF O;  3A0B O;  5TIS O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...