3WU3A

Reduced-form structure of e.coli lon proteolytic domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
190
Chain Sequence
b'YGRADNENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lon protease
publication title A redox switch shapes the Lon protease exit pore to facultatively regulate proteolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 63
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3wu3A01
4LF7I 4DR7I 3H4LA 3ZKBA 1FWKA 4DV6I 4PU9A 4DR7E 1KIJA 1FJGE 4HACA 3CWVA 4KQVA 2Q2EB 3PYDA 2V8PA 2DEJA 4LF9E 4WUBA 4JYAI 3M6AA 2HFUA 1ZXMA 4JYAE 4FW9A 4YY3I 2ZITA 4Z7YA 1QZRA 5LL6R 4B3RI 4LF8E 2F4VI 1H73A 4B3RE 4DV2I 1MX0A 1OJ4A 2F4VE 2A2CA 1A6FA 4DV2E 1ZXNA 1HNZI 5GMEA 1DARA 4GKKI 4B3MI 1XNQI 2HHHI 4B3ME 2HFSA 1XNQE 4DPYA 2HHHE 3LNUA 4LF4E 4X64E 2E5LI 4DPTA 4M1KA 1J5EI 2E5LE 4NXMI 1Z0EA 3J81Q 4NXME 1ZM3A 2HKEA 4DV7I 2ZBKB 4X65I 4DV5I 1HR0E 4DV7E 2VQEI 1N32I 4DV5E 4ED4A 3K17A 4FWDA 4DV0E 4GKJI 1NHHA 3WU6A 5LMUI 4K0KI 4K0KE 4I3HA 3J81C 2J7KA 1KTVA 1VISA 2UUBE 4JI4I 4DV3I 1N36I 2UUCE 1MG7A 4JV5E 4DV3E 3ZKDA 5IWAE 2BV3A 4DUYI 4DXLA 1H72C 3T1HI 3J7AM 3T1HE 4ZVIA 4DR6E 4B3SI 3T1YI 1NHJA 2E1RA 1Z5BA 4HY1A 3T1YE 1N33I 3QT7A 1XNRI 1N0UA 4UT4A 1N33E 4JI1E 1XNRE 1PKPA 5FLXC 4PRVA 1FJGI 3QT6A 3PYGA 4AQYI 1XMQI 1B63A 4LF9I 4AQYE 1XMQE 4LFCE 2X7IA 1FNMA 4YHHI 1IBLI 5A2QC 2BM1A 4NXNI 4WUDA 2BM0A 1IBLE 4YHHE 4NXNE 2EFGA 2OI2A 4LF8I 3V2UC 1H7UA 4P52A 2DEIA 5IT9Q 1KVKA 4R1FA 1IBKI 1IBKE 2LJPA 1RREA 4DUZE 4LF4I 4X64I 5GMDA 4FN5A 4DR2I 4DV4I 4DV1E 1S16A 3OTOE 3GONA 5LMNI 4DR2E 4DV4E 4JI2I 4DR4E 2UUAI 5LMNE 4JI2E 2UUAE 2A2DA 4HYMA 5L3JA 3B82A 1HR0I 1ZM9A 4PRXA 4LF6E 2UXDE 4DV0I 4FWHA 1D6TA 1ELOA 1Z0WA 3ZZUA 3WU3A 1BKNA 3J7AG 2UU9E 4JI5E 3WU4A 4DR3I 1NHIA 4P7AA 1HNWI 2V2QA 4DR3E 1PIEA 1HNWE 2UUBI 1FWLA 2UUCI 4JV5I 4WUCA 4DU8A 5IWAI 3PYFA 1Z5AA 4X66E 1FI4A 4JI7I 2VQFE 4DR6I 4JI7E 1NZ0A 4JI0I 1XMOE 4JI3E 1Z0BA 4JI0E 4JI8I 1KKHA 2R42A 1IBME 4JI8E 1Z5CA 4JI1I 1S4EA 1PVGA 3F0NA 1ZM4A 2V34A 4X62E 3WU5A 1EI1A 1Z59A 3QT5A 4LFCI 2UXCE 1WUUA 3ZZTA 4LF5E 3B78A 3PYEA 1Z0TA 4LF7E 3D4JA 3B8HA 3JAMQ 3J80Q 1H74A 1ZM2A 4B3TI 2AJ4A 4DV6E 4B3TE 1I94I 4HXZA 1HNXI 2ZM6I 1I94E 1HNXE 4EMDA 2WW4A 2ZM6E 4DPWA 4DUZI 4LFBI 4KHPI 2HK3A 4LFBE 4YY3E 4KHPE 4DV1I 2V2ZA 2CZ9A 3OTOI 4MYTA 2VF3A 4DR4I 4MYUA 3ZZ0A 3JAMC 3J80C 3QT8A 3V5RA 3Q1QA 2HKJA 4DR1I 5IT9C 4UTGA 1HNZE 4LF6I 2UXDI 4DR1E 4GKKE 2HK2A 3LPSA 1H7SA 4OX9I 4URLA 4OX9E 1N0VC 4HACB 1J5EE 2UU9I 1U2RA 4JI5I 4Z7CA 1Z0GA 1FKAE 4JI6I 4FWGA 4JI6E 4DPXA 5BR8I 4X65E 4RPFA 5BR8E 2VQEE 1N32E 2R3VA 4X66I 1Z0VA 4XTJA 4LFAI 4GKJE 2VQFI 5LMUE 3LTOA 4DPUA 2X36A 4LFAE 1EA6A 1XMOI 4JI3I 3ZM7A 1N34I 1MU5A 2GS8A 2V2VA 1N34E 1K47A 1IBMI 4USMA 5FLXQ 1Z0CA 2UXBI 4DR5I 1XHKA 4JI4E 1RR9A 2UXBE 1N36E 1B62A 4DR5E 2NPFA 4JG4A 4DU7A 3HULA 4DUYE 4X62I 3K1JA 1UEKA 2UXCI 5A2QQ 4B3SE 2XEXA 4USKA 4LF5I
chains in the Genus database with same CATH superfamily
2NN6B 4LF7I 3PS2A 4DR7I 3H4LA 3ZKBA 3CDIA 1FWKA 5K36C 4DV6I 4PU9A 4DR7E 1KIJA 2C38B 2CG9A 1FJGE 4HACA 3P3CA 1YH8A 3CWVA 4KQVA 2Q2EB 3PYDA 2V8PA 2DEJA 4QNKA 2BR2B 4LF9E 4WUBA 4JYAI 4ISAA 1RHYA 2JEBA 3M6AA 2HFUA 1ZXMA 4AIMA 4JYAE 4FW9A 4IFDF 4YY3I 2ZITA 4Z7YA 1QZRA 5LL6R 4B3RI 4LF8E 1E3HA 3HJCA 3CDJA 1H73A 2F4VI 4B3RE 4DV2I 2PO1B 4MU0A 1MX0A 1OJ4A 2F4VE 2A2CA 1A6FA 4DV2E 1ZXNA 1HNZI 4FW7A 1Y6ZA 5GMEA 1UDQA 5DNLA 1DARA 4GKKI 4B3MI 1XNQI 2HHHI 2BA1D 4B3ME 2HFSA 1XNQE 2NN6C 2JEAA 4DPYA 2HHHE 3LNUA 4LF4E 2PNLA 2GQ0A 5ELWA 4X64E 2E5LI 4DPTA 2IOQA 4M1KA 1J5EI 2E5LE 4NXMI 1Z0EA 3J81Q 2Z5BB 4NXME 1ZM3A 2HKEA 2O1UA 3Q6NA 3UHMA 4DV7I 2ZBKB 2C37A 4X65I 4DV5I 1HR0E 3P3GA 5JEAE 4BA2A 4DV7E 1Y5YA 2IESA 2VQEI 1N32I 4DV5E 1UDSA 4N3OA 2PNZB 4ED4A 1R6LA 2Z5EA 3K17A 3M7NG 4FWDA 4DV0E 1YHCA 4GKJI 1NHHA 3WU6A 5LMUI 4K0KI 4MQYA 4K0KE 4MU3A 4I3HA 2WP8A 4OO1D 3J81C 2J7KA 1KTVA 2BR2A 2IOPA 1VISA 3NZKA 2Z5CA 2NN6F 1VI7A 2UUBE 4JI4I 4DV3I 4U3BA 1N36I 2UUCE 1MG7A 2O1TA 4JV5E 4DV3E 4OO1B 3ZKDA 5IWAE 2BV3A 4U3DA 4DUYI 4DXLA 1H72C 3T1HI 1P42A 2JE6B 4MU1A 3P76A 3J7AM 3T1HE 2PO1A 4ZVIA 4DR6E 3L7ZB 3P06A 4B3SI 3T1YI 1NHJA 2E1RA 1Z5BA 4HY1A 2PNMA 5C0XE 3T1YE 1N33I 3QT7A 1XNRI 1N0UA 4IZJD 4UT4A 1N33E 3M85D 4JI1E 1XNRE 2CGEA 1OYPA 1PKPA 5JEAD 5FLXC 2GO3A 4IFDA 4PRVA 4FW6A 4AM3A 3B4TA 1FJGI 3QT6A 3PYGA 5JEAB 2Z5BA 4AQYI 1XMQI 1B63A 4LF9I 4AQYE 1OYRA 1XMQE 4LFCE 2X7IA 1FNMA 4YHHI 1IBLI 5A2QC 2BM1A 4NXNI 4WUDA 3U1YA 2BM0A 1IBLE 4YHHE 4MU4A 4NXNE 2EFGA 2OI2A 4OO1C 4LF8I 2WNRB 3V2UC 2BA0G 1H7UA 4P52A 4BA1A 2DEIA 4J3DA 5K36A 5IT9Q 3PS1A 1KVKA 5C0XF 4OO1E 4R1FA 4QNJA 1IBKI 4IS9A 1IBKE 3K85A 2LJPA 4FW4A 1RREA 4MDTA 4DUZE 4LF4I 2O1WA 1HK7A 5C0XD 4X64I 5GMDA 4FN5A 4DR2I 4DV4I 4DV1E 1S16A 2VESA 3OTOE 3GONA 5LMNI 4DR2E 4DV4E 4JI2I 4DR4E 2UUAI 5DRRA 5LMNE 2JE6A 4JI2E 5C0XB 1R6MA 2UUAE 5JEAC 4IZKB 2A2DA 3L7ZA 1Y60A 4HYMA 3B82A 5L3JA 1HR0I 1ZM9A 2PO2A 3P3EA 4PRXA 4LF6E 2UXDE 3U1KA 4DV0I 4FWHA 2NN6A 4OO1F 4AIDA 1D6TA 1ELOA 1Z0WA 4LCHA 3ZZUA 3WU3A 1BKNA 3J7AG 2UU9E 2C38A 3GMEA 4JI5E 3WU4A 4DR3I 1UDNA 1NHIA 4P7AA 1HNWI 2V2QA 4OKGA 4DR3E 1PIEA 1HNWE 2BA1G 5DRPA 2PO0B 2UUBI 1FWLA 2UUCI 4JV5I 4WUCA 5DRQA 4DU8A 5IWAI 3PYFA 1Z5AA 2C39B 4X66E 1FI4A 4JI7I 2VQFE 2CVEA 4DR6I 4JI7E 1NZ0A 4JI0I 5JEAF 1XMOE 5C0XC 4JI3E 1Z0BA 4JI0E 4JI8I 1KKHA 2R42A 4LCGA 1IBME 4JI8E 1Z5CA 4JI1I 1S4EA 1PVGA 3F0NA 5EKWA 4FW5A 2O3ZA 3PRYA 1ZM4A 2V34A 4X62E 4IZJB 3WU5A 1EI1A 1Z59A 2C37B 3QT5A 4LFCI 4BA2B 2UXCE 1WUUA 3ZZTA 4LF5E 3B78A 3PYEA 1Z0TA 4LF7E 3D4JA 2PNZA 3B8HA 2O1VA 3JAMQ 3J80Q 1H74A 3DD6A 1ZM2A 4B3TI 2AJ4A 1Y4UA 4DV6E 4B3TE 1I94I 1USUA 2WP8B 1XXEA 4HXZA 2F1DA 1HNXI 5K36E 2ZM6I 1I94E 1HNXE 2Z5CB 2WW4A 5DROA 4EMDA 2ZM6E 5EL9A 4DPWA 3GCMA 4FW3A 4DUZI 4LOMA 4LFBI 3M85G 2PO0A 4KHPI 2AE8A 2HK3A 4LFBE 1UDOA 4YY3E 4KHPE 3M7ND 4DV1I 2V2ZA 2CZ9A 2GO4A 3OTOI 4MYTA 2C39A 2VF3A 4OO1A 4DR4I 4MYUA 3ZZ0A 3JAMC 3J80C 4IFDD 3QT8A 3Q6MA 3V5RA 3Q1QA 2HKJA 4DR1I 5IT9C 4UTGA 1HNZE 4LCFA 4LF6I 2UXDI 4DR1E 4GKKE 2HK2A 4IFDB 3PS3A 3LPSA 1H7SA 4OX9I 5K36F 5FWKA 4URLA 2NN6E 4OX9E 1N0VC 4HACB 1J5EE 2UU9I 1E3PA 1U2RA 3H1CA 4JI5I 4Z7CA 3HKMA 4IZJA 1Z0GA 1FKAE 5DNXA 4LPFA 4JI6I 5JEAA 4FWGA 2JEBB 4JI6E 5K36D 4DPXA 5BR8I 4X65E 4RPFA 5BR8E 2VQEE 1N32E 1Y4SA 2R3VA 4X66I 2J65A 1Z0VA 4XTJA 4BA1B 4LFAI 4GKJE 2VQFI 5K36B 5LMUE 3LTOA 4DPUA 2WNRA 1OYSA 2X36A 4LFAE 1EA6A 3GLLA 1XMOI 4JI3I 3ZM7A 1N34I 2IERA 4NBQA 1MU5A 2GS8A 2V2VA 1N34E 1K47A 1IBMI 4USMA 5FLXQ 1Z0CA 2JEAB 2UXBI 4DR5I 4IFDC 1XHKA 4JI4E 1RR9A 1USVA 2UXBE 1N36E 1B62A 4DR5E 2NPFA 4OZEA 4JG4A 4DU7A 4IFDE 3HULA 2BA0D 4DUYE 4X62I 2NN6D 3K1JA 3KRNA 1UEKA 2JT2A 4GQUA 2PO2B 5C0XA 2UXCI 5A2QQ 4B3SE 4IZKA 2XEXA 4USKA 4LF5I
chains in the Genus database with same CATH topology
4LF7I 4DR7I 3H4LA 3ZKBA 1FWKA 4DV6I 4PU9A 4DR7E 1KIJA 2CG9A 1FJGE 4HACA 3CWVA 4KQVA 2Q2EB 3PYDA 2V8PA 2DEJA 4LF9E 4WUBA 4JYAI 3M6AA 2HFUA 1ZXMA 4JYAE 4FW9A 4YY3I 2ZITA 4Z7YA 1QZRA 5LL6R 4B3RI 4LF8E 3HJCA 2F4VI 1H73A 4B3RE 4DV2I 1MX0A 1OJ4A 2F4VE 2A2CA 1A6FA 4DV2E 1ZXNA 1HNZI 1Y6ZA 5GMEA 1DARA 4GKKI 4B3MI 1XNQI 2HHHI 4B3ME 2HFSA 1XNQE 4DPYA 2HHHE 3LNUA 4LF4E 2PNLA 2GQ0A 4X64E 2E5LI 4DPTA 2IOQA 4M1KA 1J5EI 2E5LE 4NXMI 1Z0EA 3J81Q 2Z5BB 4NXME 1ZM3A 2HKEA 2O1UA 3Q6NA 4DV7I 2ZBKB 4X65I 4DV5I 1HR0E 4DV7E 2VQEI 1N32I 4DV5E 4N3OA 4ED4A 2Z5EA 3K17A 4FWDA 4DV0E 4GKJI 1NHHA 3WU6A 5LMUI 4K0KI 4K0KE 4I3HA 3J81C 2J7KA 1KTVA 2IOPA 1VISA 2Z5CA 2UUBE 4JI4I 4DV3I 1N36I 2UUCE 1MG7A 2O1TA 4JV5E 4DV3E 3ZKDA 5IWAE 2BV3A 4DUYI 4DXLA 1H72C 3T1HI 3J7AM 3T1HE 4ZVIA 4DR6E 3P06A 4B3SI 3T1YI 1NHJA 2E1RA 1Z5BA 4HY1A 2PNMA 3T1YE 1N33I 3QT7A 1XNRI 1N0UA 4IZJD 4UT4A 1N33E 4JI1E 1XNRE 2CGEA 1PKPA 5FLXC 4PRVA 1FJGI 3QT6A 3PYGA 2Z5BA 4AQYI 1XMQI 1B63A 4LF9I 4AQYE 1XMQE 4LFCE 2X7IA 1FNMA 4YHHI 1IBLI 5A2QC 2BM1A 4NXNI 4WUDA 2BM0A 1IBLE 4YHHE 4NXNE 2EFGA 2OI2A 4LF8I 3V2UC 1H7UA 4P52A 2DEIA 5IT9Q 1KVKA 4R1FA 1IBKI 1IBKE 3K85A 2LJPA 1RREA 4DUZE 4LF4I 2O1WA 1HK7A 4X64I 5GMDA 4FN5A 4DR2I 4DV4I 4DV1E 1S16A 3OTOE 3GONA 5LMNI 4DR2E 4DV4E 4JI2I 4DR4E 2UUAI 5LMNE 4JI2E 2UUAE 4IZKB 2A2DA 4HYMA 5L3JA 3B82A 1HR0I 1ZM9A 4PRXA 4LF6E 2UXDE 4DV0I 4FWHA 1D6TA 1ELOA 1Z0WA 3ZZUA 3WU3A 1BKNA 3J7AG 2UU9E 4JI5E 3WU4A 4DR3I 1NHIA 4P7AA 1HNWI 2V2QA 4DR3E 1PIEA 1HNWE 2UUBI 1FWLA 2UUCI 4JV5I 4WUCA 4DU8A 5IWAI 3PYFA 1Z5AA 4X66E 1FI4A 4JI7I 2VQFE 4DR6I 4JI7E 1NZ0A 4JI0I 1XMOE 4JI3E 1Z0BA 4JI0E 4JI8I 1KKHA 2R42A 1IBME 4JI8E 1Z5CA 4JI1I 1S4EA 1PVGA 3F0NA 3PRYA 1ZM4A 2V34A 4X62E 4IZJB 3WU5A 1EI1A 1Z59A 3QT5A 4LFCI 2UXCE 1WUUA 3ZZTA 4LF5E 3B78A 3PYEA 1Z0TA 4LF7E 3D4JA 3B8HA 2O1VA 3JAMQ 3J80Q 1H74A 1ZM2A 4B3TI 2AJ4A 1Y4UA 4DV6E 4B3TE 1I94I 1USUA 4HXZA 1HNXI 2ZM6I 1I94E 1HNXE 2Z5CB 2WW4A 4EMDA 2ZM6E 4DPWA 4DUZI 4LFBI 4KHPI 2HK3A 4LFBE 4YY3E 4KHPE 4DV1I 2V2ZA 2CZ9A 3OTOI 4MYTA 2VF3A 4DR4I 4MYUA 3ZZ0A 3JAMC 3J80C 3QT8A 3Q6MA 3V5RA 3Q1QA 2HKJA 4DR1I 5IT9C 4UTGA 1HNZE 4LF6I 2UXDI 4DR1E 4GKKE 2HK2A 3LPSA 1H7SA 4OX9I 5FWKA 4URLA 4OX9E 1N0VC 4HACB 1J5EE 2UU9I 1U2RA 4JI5I 4Z7CA 4IZJA 1Z0GA 1FKAE 4JI6I 4FWGA 4JI6E 4DPXA 5BR8I 4X65E 4RPFA 5BR8E 2VQEE 1N32E 1Y4SA 2R3VA 4X66I 1Z0VA 4XTJA 4LFAI 4GKJE 2VQFI 5LMUE 3LTOA 4DPUA 2X36A 4LFAE 1EA6A 1XMOI 4JI3I 3ZM7A 1N34I 1MU5A 2GS8A 2V2VA 1N34E 1K47A 1IBMI 4USMA 5FLXQ 1Z0CA 2UXBI 4DR5I 1XHKA 4JI4E 1RR9A 1USVA 2UXBE 1N36E 1B62A 4DR5E 2NPFA 4JG4A 4DU7A 3HULA 4DUYE 4X62I 3K1JA 1UEKA 2UXCI 5A2QQ 4B3SE 4IZKA 2XEXA 4USKA 4LF5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 I;  4DR7 I;  3H4L A;  3ZKB A;  1FWK A;  4DV6 I;  4PU9 A;  4DR7 E;  1KIJ A;  1FJG E;  4HAC A;  3CWV A;  4KQV A;  2Q2E B;  3PYD A;  2V8P A;  2DEJ A;  4LF9 E;  4WUB A;  4JYA I;  3M6A A;  2HFU A;  1ZXM A;  4JYA E;  4FW9 A;  4YY3 I;  2ZIT A;  4Z7Y A;  1QZR A;  5LL6 R;  4B3R I;  4LF8 E;  2F4V I;  1H73 A;  4B3R E;  4DV2 I;  1MX0 A;  1OJ4 A;  2F4V E;  2A2C A;  1A6F A;  4DV2 E;  1ZXN A;  1HNZ I;  5GME A;  1DAR A;  4GKK I;  4B3M I;  1XNQ I;  2HHH I;  4B3M E;  2HFS A;  1XNQ E;  4DPY A;  2HHH E;  3LNU A;  4LF4 E;  4X64 E;  2E5L I;  4DPT A;  4M1K A;  1J5E I;  2E5L E;  4NXM I;  1Z0E A;  3J81 Q;  4NXM E;  1ZM3 A;  2HKE A;  4DV7 I;  2ZBK B;  4X65 I;  4DV5 I;  1HR0 E;  4DV7 E;  2VQE I;  1N32 I;  4DV5 E;  4ED4 A;  3K17 A;  4FWD A;  4DV0 E;  4GKJ I;  1NHH A;  3WU6 A;  5LMU I;  4K0K I;  4K0K E;  4I3H A;  3J81 C;  2J7K A;  1KTV A;  1VIS A;  2UUB E;  4JI4 I;  4DV3 I;  1N36 I;  2UUC E;  1MG7 A;  4JV5 E;  4DV3 E;  3ZKD A;  5IWA E;  2BV3 A;  4DUY I;  4DXL A;  1H72 C;  3T1H I;  3J7A M;  3T1H E;  4ZVI A;  4DR6 E;  4B3S I;  3T1Y I;  1NHJ A;  2E1R A;  1Z5B A;  4HY1 A;  3T1Y E;  1N33 I;  3QT7 A;  1XNR I;  1N0U A;  4UT4 A;  1N33 E;  4JI1 E;  1XNR E;  1PKP A;  5FLX C;  4PRV A;  1FJG I;  3QT6 A;  3PYG A;  4AQY I;  1XMQ I;  1B63 A;  4LF9 I;  4AQY E;  1XMQ E;  4LFC E;  2X7I A;  1FNM A;  4YHH I;  1IBL I;  5A2Q C;  2BM1 A;  4NXN I;  4WUD A;  2BM0 A;  1IBL E;  4YHH E;  4NXN E;  2EFG A;  2OI2 A;  4LF8 I;  3V2U C;  1H7U A;  4P52 A;  2DEI A;  5IT9 Q;  1KVK A;  4R1F A;  1IBK I;  1IBK E;  2LJP A;  1RRE A;  4DUZ E;  4LF4 I;  4X64 I;  5GMD A;  4FN5 A;  4DR2 I;  4DV4 I;  4DV1 E;  1S16 A;  3OTO E;  3GON A;  5LMN I;  4DR2 E;  4DV4 E;  4JI2 I;  4DR4 E;  2UUA I;  5LMN E;  4JI2 E;  2UUA E;  2A2D A;  4HYM A;  5L3J A;  3B82 A;  1HR0 I;  1ZM9 A;  4PRX A;  4LF6 E;  2UXD E;  4DV0 I;  4FWH A;  1D6T A;  1ELO A;  1Z0W A;  3ZZU A;  3WU3 A;  1BKN A;  3J7A G;  2UU9 E;  4JI5 E;  3WU4 A;  4DR3 I;  1NHI A;  4P7A A;  1HNW I;  2V2Q A;  4DR3 E;  1PIE A;  1HNW E;  2UUB I;  1FWL A;  2UUC I;  4JV5 I;  4WUC A;  4DU8 A;  5IWA I;  3PYF A;  1Z5A A;  4X66 E;  1FI4 A;  4JI7 I;  2VQF E;  4DR6 I;  4JI7 E;  1NZ0 A;  4JI0 I;  1XMO E;  4JI3 E;  1Z0B A;  4JI0 E;  4JI8 I;  1KKH A;  2R42 A;  1IBM E;  4JI8 E;  1Z5C A;  4JI1 I;  1S4E A;  1PVG A;  3F0N A;  1ZM4 A;  2V34 A;  4X62 E;  3WU5 A;  1EI1 A;  1Z59 A;  3QT5 A;  4LFC I;  2UXC E;  1WUU A;  3ZZT A;  4LF5 E;  3B78 A;  3PYE A;  1Z0T A;  4LF7 E;  3D4J A;  3B8H A;  3JAM Q;  3J80 Q;  1H74 A;  1ZM2 A;  4B3T I;  2AJ4 A;  4DV6 E;  4B3T E;  1I94 I;  4HXZ A;  1HNX I;  2ZM6 I;  1I94 E;  1HNX E;  4EMD A;  2WW4 A;  2ZM6 E;  4DPW A;  4DUZ I;  4LFB I;  4KHP I;  2HK3 A;  4LFB E;  4YY3 E;  4KHP E;  4DV1 I;  2V2Z A;  2CZ9 A;  3OTO I;  4MYT A;  2VF3 A;  4DR4 I;  4MYU A;  3ZZ0 A;  3JAM C;  3J80 C;  3QT8 A;  3V5R A;  3Q1Q A;  2HKJ A;  4DR1 I;  5IT9 C;  4UTG A;  1HNZ E;  4LF6 I;  2UXD I;  4DR1 E;  4GKK E;  2HK2 A;  3LPS A;  1H7S A;  4OX9 I;  4URL A;  4OX9 E;  1N0V C;  4HAC B;  1J5E E;  2UU9 I;  1U2R A;  4JI5 I;  4Z7C A;  1Z0G A;  1FKA E;  4JI6 I;  4FWG A;  4JI6 E;  4DPX A;  5BR8 I;  4X65 E;  4RPF A;  5BR8 E;  2VQE E;  1N32 E;  2R3V A;  4X66 I;  1Z0V A;  4XTJ A;  4LFA I;  4GKJ E;  2VQF I;  5LMU E;  3LTO A;  4DPU A;  2X36 A;  4LFA E;  1EA6 A;  1XMO I;  4JI3 I;  3ZM7 A;  1N34 I;  1MU5 A;  2GS8 A;  2V2V A;  1N34 E;  1K47 A;  1IBM I;  4USM A;  5FLX Q;  1Z0C A;  2UXB I;  4DR5 I;  1XHK A;  4JI4 E;  1RR9 A;  2UXB E;  1N36 E;  1B62 A;  4DR5 E;  2NPF A;  4JG4 A;  4DU7 A;  3HUL A;  4DUY E;  4X62 I;  3K1J A;  1UEK A;  2UXC I;  5A2Q Q;  4B3S E;  2XEX A;  4USK A;  4LF5 I; 
#chains in the Genus database with same CATH topology
 2NN6 B;  4LF7 I;  3PS2 A;  4DR7 I;  3H4L A;  3ZKB A;  3CDI A;  1FWK A;  5K36 C;  4DV6 I;  4PU9 A;  4DR7 E;  1KIJ A;  2C38 B;  2CG9 A;  1FJG E;  4HAC A;  3P3C A;  1YH8 A;  3CWV A;  4KQV A;  2Q2E B;  3PYD A;  2V8P A;  2DEJ A;  4QNK A;  2BR2 B;  4LF9 E;  4WUB A;  4JYA I;  4ISA A;  1RHY A;  2JEB A;  3M6A A;  2HFU A;  1ZXM A;  4AIM A;  4JYA E;  4FW9 A;  4IFD F;  4YY3 I;  2ZIT A;  4Z7Y A;  1QZR A;  5LL6 R;  4B3R I;  4LF8 E;  1E3H A;  3HJC A;  3CDJ A;  1H73 A;  2F4V I;  4B3R E;  4DV2 I;  2PO1 B;  4MU0 A;  1MX0 A;  1OJ4 A;  2F4V E;  2A2C A;  1A6F A;  4DV2 E;  1ZXN A;  1HNZ I;  4FW7 A;  1Y6Z A;  5GME A;  1UDQ A;  5DNL A;  1DAR A;  4GKK I;  4B3M I;  1XNQ I;  2HHH I;  2BA1 D;  4B3M E;  2HFS A;  1XNQ E;  2NN6 C;  2JEA A;  4DPY A;  2HHH E;  3LNU A;  4LF4 E;  2PNL A;  2GQ0 A;  5ELW A;  4X64 E;  2E5L I;  4DPT A;  2IOQ A;  4M1K A;  1J5E I;  2E5L E;  4NXM I;  1Z0E A;  3J81 Q;  2Z5B B;  4NXM E;  1ZM3 A;  2HKE A;  2O1U A;  3Q6N A;  3UHM A;  4DV7 I;  2ZBK B;  2C37 A;  4X65 I;  4DV5 I;  1HR0 E;  3P3G A;  5JEA E;  4BA2 A;  4DV7 E;  1Y5Y A;  2IES A;  2VQE I;  1N32 I;  4DV5 E;  1UDS A;  4N3O A;  2PNZ B;  4ED4 A;  1R6L A;  2Z5E A;  3K17 A;  3M7N G;  4FWD A;  4DV0 E;  1YHC A;  4GKJ I;  1NHH A;  3WU6 A;  5LMU I;  4K0K I;  4MQY A;  4K0K E;  4MU3 A;  4I3H A;  2WP8 A;  4OO1 D;  3J81 C;  2J7K A;  1KTV A;  2BR2 A;  2IOP A;  1VIS A;  3NZK A;  2Z5C A;  2NN6 F;  1VI7 A;  2UUB E;  4JI4 I;  4DV3 I;  4U3B A;  1N36 I;  2UUC E;  1MG7 A;  2O1T A;  4JV5 E;  4DV3 E;  4OO1 B;  3ZKD A;  5IWA E;  2BV3 A;  4U3D A;  4DUY I;  4DXL A;  1H72 C;  3T1H I;  1P42 A;  2JE6 B;  4MU1 A;  3P76 A;  3J7A M;  3T1H E;  2PO1 A;  4ZVI A;  4DR6 E;  3L7Z B;  3P06 A;  4B3S I;  3T1Y I;  1NHJ A;  2E1R A;  1Z5B A;  4HY1 A;  2PNM A;  5C0X E;  3T1Y E;  1N33 I;  3QT7 A;  1XNR I;  1N0U A;  4IZJ D;  4UT4 A;  1N33 E;  3M85 D;  4JI1 E;  1XNR E;  2CGE A;  1OYP A;  1PKP A;  5JEA D;  5FLX C;  2GO3 A;  4IFD A;  4PRV A;  4FW6 A;  4AM3 A;  3B4T A;  1FJG I;  3QT6 A;  3PYG A;  5JEA B;  2Z5B A;  4AQY I;  1XMQ I;  1B63 A;  4LF9 I;  4AQY E;  1OYR A;  1XMQ E;  4LFC E;  2X7I A;  1FNM A;  4YHH I;  1IBL I;  5A2Q C;  2BM1 A;  4NXN I;  4WUD A;  3U1Y A;  2BM0 A;  1IBL E;  4YHH E;  4MU4 A;  4NXN E;  2EFG A;  2OI2 A;  4OO1 C;  4LF8 I;  2WNR B;  3V2U C;  2BA0 G;  1H7U A;  4P52 A;  4BA1 A;  2DEI A;  4J3D A;  5K36 A;  5IT9 Q;  3PS1 A;  1KVK A;  5C0X F;  4OO1 E;  4R1F A;  4QNJ A;  1IBK I;  4IS9 A;  1IBK E;  3K85 A;  2LJP A;  4FW4 A;  1RRE A;  4MDT A;  4DUZ E;  4LF4 I;  2O1W A;  1HK7 A;  5C0X D;  4X64 I;  5GMD A;  4FN5 A;  4DR2 I;  4DV4 I;  4DV1 E;  1S16 A;  2VES A;  3OTO E;  3GON A;  5LMN I;  4DR2 E;  4DV4 E;  4JI2 I;  4DR4 E;  2UUA I;  5DRR A;  5LMN E;  2JE6 A;  4JI2 E;  5C0X B;  1R6M A;  2UUA E;  5JEA C;  4IZK B;  2A2D A;  3L7Z A;  1Y60 A;  4HYM A;  3B82 A;  5L3J A;  1HR0 I;  1ZM9 A;  2PO2 A;  3P3E A;  4PRX A;  4LF6 E;  2UXD E;  3U1K A;  4DV0 I;  4FWH A;  2NN6 A;  4OO1 F;  4AID A;  1D6T A;  1ELO A;  1Z0W A;  4LCH A;  3ZZU A;  3WU3 A;  1BKN A;  3J7A G;  2UU9 E;  2C38 A;  3GME A;  4JI5 E;  3WU4 A;  4DR3 I;  1UDN A;  1NHI A;  4P7A A;  1HNW I;  2V2Q A;  4OKG A;  4DR3 E;  1PIE A;  1HNW E;  2BA1 G;  5DRP A;  2PO0 B;  2UUB I;  1FWL A;  2UUC I;  4JV5 I;  4WUC A;  5DRQ A;  4DU8 A;  5IWA I;  3PYF A;  1Z5A A;  2C39 B;  4X66 E;  1FI4 A;  4JI7 I;  2VQF E;  2CVE A;  4DR6 I;  4JI7 E;  1NZ0 A;  4JI0 I;  5JEA F;  1XMO E;  5C0X C;  4JI3 E;  1Z0B A;  4JI0 E;  4JI8 I;  1KKH A;  2R42 A;  4LCG A;  1IBM E;  4JI8 E;  1Z5C A;  4JI1 I;  1S4E A;  1PVG A;  3F0N A;  5EKW A;  4FW5 A;  2O3Z A;  3PRY A;  1ZM4 A;  2V34 A;  4X62 E;  4IZJ B;  3WU5 A;  1EI1 A;  1Z59 A;  2C37 B;  3QT5 A;  4LFC I;  4BA2 B;  2UXC E;  1WUU A;  3ZZT A;  4LF5 E;  3B78 A;  3PYE A;  1Z0T A;  4LF7 E;  3D4J A;  2PNZ A;  3B8H A;  2O1V A;  3JAM Q;  3J80 Q;  1H74 A;  3DD6 A;  1ZM2 A;  4B3T I;  2AJ4 A;  1Y4U A;  4DV6 E;  4B3T E;  1I94 I;  1USU A;  2WP8 B;  1XXE A;  4HXZ A;  2F1D A;  1HNX I;  5K36 E;  2ZM6 I;  1I94 E;  1HNX E;  2Z5C B;  2WW4 A;  5DRO A;  4EMD A;  2ZM6 E;  5EL9 A;  4DPW A;  3GCM A;  4FW3 A;  4DUZ I;  4LOM A;  4LFB I;  3M85 G;  2PO0 A;  4KHP I;  2AE8 A;  2HK3 A;  4LFB E;  1UDO A;  4YY3 E;  4KHP E;  3M7N D;  4DV1 I;  2V2Z A;  2CZ9 A;  2GO4 A;  3OTO I;  4MYT A;  2C39 A;  2VF3 A;  4OO1 A;  4DR4 I;  4MYU A;  3ZZ0 A;  3JAM C;  3J80 C;  4IFD D;  3QT8 A;  3Q6M A;  3V5R A;  3Q1Q A;  2HKJ A;  4DR1 I;  5IT9 C;  4UTG A;  1HNZ E;  4LCF A;  4LF6 I;  2UXD I;  4DR1 E;  4GKK E;  2HK2 A;  4IFD B;  3PS3 A;  3LPS A;  1H7S A;  4OX9 I;  5K36 F;  5FWK A;  4URL A;  2NN6 E;  4OX9 E;  1N0V C;  4HAC B;  1J5E E;  2UU9 I;  1E3P A;  1U2R A;  3H1C A;  4JI5 I;  4Z7C A;  3HKM A;  4IZJ A;  1Z0G A;  1FKA E;  5DNX A;  4LPF A;  4JI6 I;  5JEA A;  4FWG A;  2JEB B;  4JI6 E;  5K36 D;  4DPX A;  5BR8 I;  4X65 E;  4RPF A;  5BR8 E;  2VQE E;  1N32 E;  1Y4S A;  2R3V A;  4X66 I;  2J65 A;  1Z0V A;  4XTJ A;  4BA1 B;  4LFA I;  4GKJ E;  2VQF I;  5K36 B;  5LMU E;  3LTO A;  4DPU A;  2WNR A;  1OYS A;  2X36 A;  4LFA E;  1EA6 A;  3GLL A;  1XMO I;  4JI3 I;  3ZM7 A;  1N34 I;  2IER A;  4NBQ A;  1MU5 A;  2GS8 A;  2V2V A;  1N34 E;  1K47 A;  1IBM I;  4USM A;  5FLX Q;  1Z0C A;  2JEA B;  2UXB I;  4DR5 I;  4IFD C;  1XHK A;  4JI4 E;  1RR9 A;  1USV A;  2UXB E;  1N36 E;  1B62 A;  4DR5 E;  2NPF A;  4OZE A;  4JG4 A;  4DU7 A;  4IFD E;  3HUL A;  2BA0 D;  4DUY E;  4X62 I;  2NN6 D;  3K1J A;  3KRN A;  1UEK A;  2JT2 A;  4GQU A;  2PO2 B;  5C0X A;  2UXC I;  5A2Q Q;  4B3S E;  4IZK A;  2XEX A;  4USK A;  4LF5 I; 
#chains in the Genus database with same CATH homology
 4LF7 I;  4DR7 I;  3H4L A;  3ZKB A;  1FWK A;  4DV6 I;  4PU9 A;  4DR7 E;  1KIJ A;  2CG9 A;  1FJG E;  4HAC A;  3CWV A;  4KQV A;  2Q2E B;  3PYD A;  2V8P A;  2DEJ A;  4LF9 E;  4WUB A;  4JYA I;  3M6A A;  2HFU A;  1ZXM A;  4JYA E;  4FW9 A;  4YY3 I;  2ZIT A;  4Z7Y A;  1QZR A;  5LL6 R;  4B3R I;  4LF8 E;  3HJC A;  2F4V I;  1H73 A;  4B3R E;  4DV2 I;  1MX0 A;  1OJ4 A;  2F4V E;  2A2C A;  1A6F A;  4DV2 E;  1ZXN A;  1HNZ I;  1Y6Z A;  5GME A;  1DAR A;  4GKK I;  4B3M I;  1XNQ I;  2HHH I;  4B3M E;  2HFS A;  1XNQ E;  4DPY A;  2HHH E;  3LNU A;  4LF4 E;  2PNL A;  2GQ0 A;  4X64 E;  2E5L I;  4DPT A;  2IOQ A;  4M1K A;  1J5E I;  2E5L E;  4NXM I;  1Z0E A;  3J81 Q;  2Z5B B;  4NXM E;  1ZM3 A;  2HKE A;  2O1U A;  3Q6N A;  4DV7 I;  2ZBK B;  4X65 I;  4DV5 I;  1HR0 E;  4DV7 E;  2VQE I;  1N32 I;  4DV5 E;  4N3O A;  4ED4 A;  2Z5E A;  3K17 A;  4FWD A;  4DV0 E;  4GKJ I;  1NHH A;  3WU6 A;  5LMU I;  4K0K I;  4K0K E;  4I3H A;  3J81 C;  2J7K A;  1KTV A;  2IOP A;  1VIS A;  2Z5C A;  2UUB E;  4JI4 I;  4DV3 I;  1N36 I;  2UUC E;  1MG7 A;  2O1T A;  4JV5 E;  4DV3 E;  3ZKD A;  5IWA E;  2BV3 A;  4DUY I;  4DXL A;  1H72 C;  3T1H I;  3J7A M;  3T1H E;  4ZVI A;  4DR6 E;  3P06 A;  4B3S I;  3T1Y I;  1NHJ A;  2E1R A;  1Z5B A;  4HY1 A;  2PNM A;  3T1Y E;  1N33 I;  3QT7 A;  1XNR I;  1N0U A;  4IZJ D;  4UT4 A;  1N33 E;  4JI1 E;  1XNR E;  2CGE A;  1PKP A;  5FLX C;  4PRV A;  1FJG I;  3QT6 A;  3PYG A;  2Z5B A;  4AQY I;  1XMQ I;  1B63 A;  4LF9 I;  4AQY E;  1XMQ E;  4LFC E;  2X7I A;  1FNM A;  4YHH I;  1IBL I;  5A2Q C;  2BM1 A;  4NXN I;  4WUD A;  2BM0 A;  1IBL E;  4YHH E;  4NXN E;  2EFG A;  2OI2 A;  4LF8 I;  3V2U C;  1H7U A;  4P52 A;  2DEI A;  5IT9 Q;  1KVK A;  4R1F A;  1IBK I;  1IBK E;  3K85 A;  2LJP A;  1RRE A;  4DUZ E;  4LF4 I;  2O1W A;  1HK7 A;  4X64 I;  5GMD A;  4FN5 A;  4DR2 I;  4DV4 I;  4DV1 E;  1S16 A;  3OTO E;  3GON A;  5LMN I;  4DR2 E;  4DV4 E;  4JI2 I;  4DR4 E;  2UUA I;  5LMN E;  4JI2 E;  2UUA E;  4IZK B;  2A2D A;  4HYM A;  5L3J A;  3B82 A;  1HR0 I;  1ZM9 A;  4PRX A;  4LF6 E;  2UXD E;  4DV0 I;  4FWH A;  1D6T A;  1ELO A;  1Z0W A;  3ZZU A;  3WU3 A;  1BKN A;  3J7A G;  2UU9 E;  4JI5 E;  3WU4 A;  4DR3 I;  1NHI A;  4P7A A;  1HNW I;  2V2Q A;  4DR3 E;  1PIE A;  1HNW E;  2UUB I;  1FWL A;  2UUC I;  4JV5 I;  4WUC A;  4DU8 A;  5IWA I;  3PYF A;  1Z5A A;  4X66 E;  1FI4 A;  4JI7 I;  2VQF E;  4DR6 I;  4JI7 E;  1NZ0 A;  4JI0 I;  1XMO E;  4JI3 E;  1Z0B A;  4JI0 E;  4JI8 I;  1KKH A;  2R42 A;  1IBM E;  4JI8 E;  1Z5C A;  4JI1 I;  1S4E A;  1PVG A;  3F0N A;  3PRY A;  1ZM4 A;  2V34 A;  4X62 E;  4IZJ B;  3WU5 A;  1EI1 A;  1Z59 A;  3QT5 A;  4LFC I;  2UXC E;  1WUU A;  3ZZT A;  4LF5 E;  3B78 A;  3PYE A;  1Z0T A;  4LF7 E;  3D4J A;  3B8H A;  2O1V A;  3JAM Q;  3J80 Q;  1H74 A;  1ZM2 A;  4B3T I;  2AJ4 A;  1Y4U A;  4DV6 E;  4B3T E;  1I94 I;  1USU A;  4HXZ A;  1HNX I;  2ZM6 I;  1I94 E;  1HNX E;  2Z5C B;  2WW4 A;  4EMD A;  2ZM6 E;  4DPW A;  4DUZ I;  4LFB I;  4KHP I;  2HK3 A;  4LFB E;  4YY3 E;  4KHP E;  4DV1 I;  2V2Z A;  2CZ9 A;  3OTO I;  4MYT A;  2VF3 A;  4DR4 I;  4MYU A;  3ZZ0 A;  3JAM C;  3J80 C;  3QT8 A;  3Q6M A;  3V5R A;  3Q1Q A;  2HKJ A;  4DR1 I;  5IT9 C;  4UTG A;  1HNZ E;  4LF6 I;  2UXD I;  4DR1 E;  4GKK E;  2HK2 A;  3LPS A;  1H7S A;  4OX9 I;  5FWK A;  4URL A;  4OX9 E;  1N0V C;  4HAC B;  1J5E E;  2UU9 I;  1U2R A;  4JI5 I;  4Z7C A;  4IZJ A;  1Z0G A;  1FKA E;  4JI6 I;  4FWG A;  4JI6 E;  4DPX A;  5BR8 I;  4X65 E;  4RPF A;  5BR8 E;  2VQE E;  1N32 E;  1Y4S A;  2R3V A;  4X66 I;  1Z0V A;  4XTJ A;  4LFA I;  4GKJ E;  2VQF I;  5LMU E;  3LTO A;  4DPU A;  2X36 A;  4LFA E;  1EA6 A;  1XMO I;  4JI3 I;  3ZM7 A;  1N34 I;  1MU5 A;  2GS8 A;  2V2V A;  1N34 E;  1K47 A;  1IBM I;  4USM A;  5FLX Q;  1Z0C A;  2UXB I;  4DR5 I;  1XHK A;  4JI4 E;  1RR9 A;  1USV A;  2UXB E;  1N36 E;  1B62 A;  4DR5 E;  2NPF A;  4JG4 A;  4DU7 A;  3HUL A;  4DUY E;  4X62 I;  3K1J A;  1UEK A;  2UXC I;  5A2Q Q;  4B3S E;  4IZK A;  2XEX A;  4USK A;  4LF5 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...