3WU3A

Reduced-form structure of e.coli lon proteolytic domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
190
Chain Sequence
YGRADNENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A redox switch shapes the Lon protease exit pore to facultatively regulate proteolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Lon protease
total genus 63
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3wu3A01
4HACA 4GKJI 2V34A 4JI1E 4LFBI 1RREA 4DPTA 4DV7E 4JI5I 4USKA 1H7UA 3J7AG 1ZM9A 1FWLA 3ZZTA 3J7AM 4OX9E 1Z5BA 4KHPI 1DARA 1ZXMA 1B62A 1IBLI 1FJGE 2WW4A 1S4EA 4FW9A 4X62I 1XMOE 1XMQI 2F4VI 4DV3E 4DV5E 4FN5A 2UUBI 4FWGA 1HNXE 4LFCE 2HHHI 1H7SA 1XNQI 4ED4A 1S16A 4UT4A 4P7AA 1N34I 3CWVA 4K0KE 5LMNE 2A2DA 4JV5I 4Z7CA 1PVGA 4LF7I 4DUZI 3QT8A 4B3TE 3QT7A 1NHHA 5LMUE 2UXDI 1UEKA 4LFAE 4B3MI 3J80C 3H4LA 2V2VA 2ZM6I 1HNZE 4LF8I 3B78A 1KTVA 4DV4I 4JI8E 3WU4A 2UXBE 4DR2E 3B8HA 4DV0I 4MYUA 1RR9A 1IBKI 3F0NA 4X64I 1K47A 4DPYA 2VF3A 2LJPA 4DV0E 4B3RI 1XHKA 1HNWI 4JI8I 3ZKDA 4DV4E 4JI4I 1MG7A 1U2RA 4LFAI 4Z7YA 2UXDE 4DPWA 2X36A 2OI2A 3T1YE 4RPFA 4B3TI 4DV2E 3J81C 4LF7E 1OJ4A 1FI4A 1ZXNA 2BV3A 5GMEA 1PKPA 1H72C 4JV5E 2E1RA 4K0KI 4HYMA 5IT9C 1N34E 1FNMA 5IT9Q 1XNQE 2HHHE 3PYEA 4URLA 5GMDA 1HNXI 1PIEA 4DV3I 2F4VE 2VQEE 1XMQE 1XMOI 1NHIA 2CZ9A 4DU7A 2BM0A 1FJGI 3T1HE 1Z5AA 1ZM4A 3OTOE 4HXZA 3LNUA 1EI1A 1KKHA 2HK3A 4PRXA 3ZKBA 4M1KA 1Z0TA 5BR8E 2J7KA 4KHPE 4DR7I 1QZRA 4HACB 5LL6R 2E5LI 1XNRI 4B3SE 4FWDA 2V2QA 2XEXA 4GKKI 4JI5E 3Q1QA 4JI1I 4LFBE 4GKJE 1J5EI 4DUYE 4LF9E 1I94I 4DR3I 4JI0E 3PYFA 1Z0GA 1BKNA 4KQVA 4JI3I 3B82A 1N32E 4WUBA 3J81Q 2A2CA 2DEIA 2UUAE 2UUAI 4JYAE 4DV1E 4UTGA 1N0VC 1N36E 4AQYI 4JI0I 2Q2EB 4DR3E 4NXNI 1I94E 4LF9I 3WU3A 4XTJA 4DXLA 1J5EE 4PU9A 2UU9E 4R1FA 4NXME 3J80Q 4GKKE 1H73A 3ZZ0A 4DR4I 2ZBKB 4B3SI 2E5LE 1XNRE 4YHHI 4WUCA 4USMA 4DR7E 3ZZUA 5BR8I 4WUDA 1H74A 4X66E 4EMDA 3V5RA 3OTOI 3T1HI 1FWKA 2VQEI 2EFGA 4JI2E 2V2ZA 1WUUA 3V2UC 4DR5I 4JI6I 1IBME 3JAMQ 1NZ0A 4FWHA 1Z0EA 2V8PA 1Z0BA 2GS8A 3JAMC 3K1JA 4DV2I 2BM1A 3T1YI 1A6FA 1ELOA 5L3JA 1Z0WA 1HR0I 2UUCI 1B63A 4I3HA 2HKEA 4JI4E 5FLXC 1HNWE 4DR1E 4LF5I 4DR6E 4LF4E 5IWAE 4B3RE 3LPSA 2X7IA 2VQFI 4LF6I 4LF6E 5A2QQ 4X64E 2VQFE 3PYDA 1IBKE 2HKJA 4DR2I 5IWAI 1ZM3A 4LF4I 1ZM2A 2UXBI 1KIJA 4DR6I 4LF5E 4DR1I 4LF8E 2UUCE 1HNZI 1HR0E 2ZM6E 4B3ME 5LMUI 1KVKA 1Z59A 1Z0VA 4DU8A 1MU5A 2HK2A 1D6TA 4DUZE 4DPUA 3M6AA 4DPXA 3HULA 2DEJA 3D4JA 5LMNI 1IBMI 3K17A 4JI6E 4DR5E 3GONA 1NHJA 3WU5A 4LFCI 2UUBE 4JI2I 4DV5I 1VISA 3ZM7A 4MYTA 1FKAE 4X62E 2HFSA 1IBLE 5FLXQ 4X66I 2HFUA 1N0UA 3WU6A 4PRVA 2AJ4A 2NPFA 2R42A 2R3VA 4OX9I 4YHHE 4HY1A 4DR4E 4DV7I 4NXMI 2UU9I 3LTOA 1Z0CA 4NXNE 1N33I 4JG4A 4X65E 3PYGA 4P52A 3QT6A 4DV6E 1EA6A 4YY3E 4AQYE 1MX0A 1N36I 2UXCE 4DV1I 3QT5A 4JI7E 4JYAI 4JI7I 2ZITA 2UXCI 1N32I 5A2QC 4JI3E 4YY3I 4DV6I 1Z5CA 4X65I 4ZVIA 1N33E 4DUYI
chains in the Genus database with same CATH superfamily
4IFDA 4HACA 5DRQA 4GKJI 2V34A 2PO2B 4JI1E 4LFBI 1RREA 1R6LA 3P3CA 4DPTA 4DV7E 4QNKA 4JI5I 2CVEA 4USKA 1H7UA 1E3HA 3GLLA 1ZM9A 3J7AG 3PS3A 4IFDD 1FWLA 3ZZTA 3J7AM 4OX9E 1Z5BA 4KHPI 2NN6C 1DARA 1ZXMA 1B62A 3PRYA 2Z5BA 5JEAB 1IBLI 1FJGE 2WW4A 4IZJA 4OZEA 1S4EA 4FW9A 4X62I 4OO1D 1XMOE 2Z5BB 1XMQI 2F4VI 4DV3E 4DV5E 4FN5A 2UUBI 4FWGA 1HNXE 4LFCE 4MU0A 2HHHI 1H7SA 1XNQI 2PO2A 3U1YA 1S16A 3CDIA 4ED4A 4UT4A 3DD6A 4P7AA 2WP8A 4LCHA 3L7ZA 1N34I 3CWVA 4K0KE 5LMNE 2A2DA 4JV5I 1HK7A 4Z7CA 5C0XC 1PVGA 4LF7I 1XXEA 4DUZI 3QT8A 4AIDA 4B3TE 3QT7A 1NHHA 5LMUE 2UXDI 1UEKA 4LFAE 5JEAA 4B3MI 5JEAF 3J80C 3H4LA 2V2VA 2ZM6I 1UDSA 1HNZE 2JE6B 4LF8I 4AM3A 5EKWA 3B78A 1KTVA 2PNZB 4DV4I 4JI8E 3WU4A 2UXBE 4DR2E 3B8HA 4DV0I 4MYUA 1RR9A 2IERA 1IBKI 3F0NA 3P06A 4X64I 1K47A 3U1KA 5JEAE 2PO1A 4DPYA 2VF3A 2LJPA 4DV0E 4B3RI 2NN6F 1XHKA 5DRRA 3M85G 2C37B 1HNWI 4JI8I 3ZKDA 4DV4E 4JI4I 1MG7A 1U2RA 4LFAI 4Z7YA 2UXDE 4DPWA 2X36A 2OI2A 3T1YE 2NN6E 4RPFA 4B3TI 4DV2E 3J81C 4LF7E 5K36E 1OJ4A 2BR2A 1FI4A 1ZXNA 2BV3A 5GMEA 1PKPA 1H72C 4JV5E 2E1RA 4K0KI 4HYMA 5IT9C 3PS2A 2BA0G 1USUA 2C39B 1N34E 1UDQA 1OYPA 1FNMA 2WNRB 3NZKA 5IT9Q 2NN6D 2HHHE 1XNQE 3PYEA 2PNLA 4URLA 5JEAD 4IZJB 5GMDA 1HNXI 1PIEA 5K36F 4IZJD 5K36B 4DV3I 5C0XA 2VQEE 1XMQE 2F4VE 1XMOI 1NHIA 2CZ9A 4DU7A 2BM0A 2JEBA 2BA1G 3T1HE 1FJGI 1Z5AA 1ZM4A 2PNZA 4FW3A 5C0XB 3OTOE 4OO1E 4HXZA 3LNUA 1EI1A 1KKHA 2HK3A 2IESA 4PRXA 5C0XD 3M85D 3ZKBA 4M1KA 1Z0TA 2IOQA 5BR8E 2J7KA 4KHPE 4DR7I 1QZRA 4HACB 1E3PA 5LL6R 2E5LI 4B3SE 1XNRI 4FWDA 2V2QA 2XEXA 3P3EA 4GKKI 4JI5E 4OO1F 1Y60A 2C38B 1Y6ZA 4JI1I 3Q1QA 4LFBE 4GKJE 2F1DA 1J5EI 4LCFA 4DUYE 4J3DA 1RHYA 4LF9E 1I94I 4BA1A 4BA2B 4DR3I 4JI0E 3PYFA 1Z0GA 1BKNA 4IS9A 4KQVA 4MDTA 4JI3I 3B82A 1N32E 4WUBA 4AIMA 3J81Q 2JEAB 2A2CA 2DEIA 2UUAE 2UUAI 4JYAE 4DV1E 4FW5A 4UTGA 1N0VC 4FW4A 2IOPA 1N36E 4IFDB 4AQYI 4JI0I 2Q2EB 4DR3E 2Z5CA 3P76A 4LOMA 5EL9A 4NXNI 1I94E 4LF9I 3HJCA 3WU3A 4XTJA 4DXLA 1J5EE 4PU9A 2UU9E 2CG9A 4R1FA 4NXME 2O1VA 1YH8A 3J80Q 4GKKE 1H73A 1VI7A 2O1UA 3ZZ0A 4DR4I 4BA2A 2ZBKB 3UHMA 5K36A 4B3SI 2E5LE 2C38A 1XNRE 4YHHI 2AE8A 4WUCA 4USMA 4DR7E 3ZZUA 5BR8I 4WUDA 1H74A 4X66E 4EMDA 3V5RA 4IFDC 3OTOI 3T1HI 2VESA 3PS1A 1OYSA 1FWKA 1OYRA 2GQ0A 2O1WA 5DRPA 2VQEI 2EFGA 4FW7A 4JI2E 4IZKA 4LPFA 2V2ZA 1WUUA 3V2UC 4DR5I 4IZKB 4JI6I 1IBME 3JAMQ 1NZ0A 2J65A 4FWHA 5C0XE 2WP8B 1Z0EA 2NN6A 2V8PA 2O1TA 1R6MA 1Z0BA 2GS8A 3JAMC 3K1JA 4DV2I 2BM1A 2JEBB 3T1YI 1A6FA 3KRNA 1ELOA 5L3JA 1UDNA 3K85A 1Z0WA 2BR2B 2PO0B 4OO1C 1HR0I 2O3ZA 2UUCI 1B63A 4I3HA 4QNJA 2HKEA 4JI4E 5C0XF 5FLXC 4LCGA 1HNWE 4DR1E 4LF5I 4DR6E 2PO0A 4MQYA 4LF4E 2JE6A 5IWAE 4B3RE 3LPSA 2X7IA 5DNXA 3M7ND 4IFDF 2VQFI 4LF6I 2C37A 3GMEA 4LF6E 5A2QQ 4X64E 3HKMA 4OKGA 2VQFE 3Q6MA 3PYDA 1IBKE 2HKJA 4DR2I 5IWAI 2GO3A 1ZM3A 4LF4I 1ZM2A 2UXBI 1KIJA 4DR6I 2Z5CB 1Y4UA 4U3DA 4DR1I 4LF5E 5K36C 1Y4SA 5ELWA 4ISAA 4LF8E 2UUCE 2Z5EA 1HNZI 1HR0E 2CGEA 3H1CA 2ZM6E 2JEAA 4GQUA 4IFDE 4B3ME 5LMUI 2NN6B 1KVKA 1Z59A 1Z0VA 4DU8A 3GCMA 2BA1D 1MU5A 3Q6NA 2HK2A 1D6TA 5K36D 4DUZE 4DPUA 1USVA 3M6AA 4DPXA 3HULA 2BA0D 2DEJA 3D4JA 5LMNI 1IBMI 3K17A 4JI6E 5DROA 4DR5E 3GONA 1NHJA 4N3OA 3WU5A 4MU3A 4OO1B 4LFCI 3M7NG 2UUBE 2GO4A 4JI2I 4DV5I 1VISA 5FWKA 3ZM7A 2WNRA 4U3BA 4MYTA 1FKAE 1P42A 4X62E 3CDJA 2JT2A 1UDOA 2HFSA 1IBLE 2PNMA 5FLXQ 1YHCA 1Y5YA 2HFUA 4X66I 1N0UA 3WU6A 4PRVA 2AJ4A 2NPFA 2R42A 2R3VA 4OX9I 4YHHE 4HY1A 4DR4E 4DV7I 2C39A 5JEAC 4NXMI 2UU9I 3LTOA 2PO1B 4FW6A 4OO1A 3B4TA 1Z0CA 4NXNE 1N33I 4JG4A 4X65E 3PYGA 4P52A 3QT6A 4DV6E 1EA6A 4YY3E 3L7ZB 4AQYE 1MX0A 1N36I 2UXCE 4BA1B 4DV1I 3QT5A 4JI7E 4JYAI 5DNLA 4JI7I 2ZITA 2UXCI 1N32I 5A2QC 4JI3E 4YY3I 4DV6I 1Z5CA 3P3GA 4X65I 4ZVIA 1N33E 4MU1A 4NBQA 4MU4A 4DUYI
chains in the Genus database with same CATH topology
4HACA 4GKJI 2V34A 4JI1E 4LFBI 1RREA 4DPTA 4DV7E 4JI5I 4USKA 1H7UA 3J7AG 1ZM9A 1FWLA 3ZZTA 3J7AM 4OX9E 1Z5BA 4KHPI 1DARA 1ZXMA 1B62A 3PRYA 2Z5BA 1IBLI 1FJGE 2WW4A 4IZJA 1S4EA 4FW9A 4X62I 1XMOE 2Z5BB 1XMQI 2F4VI 4DV3E 4DV5E 4FN5A 2UUBI 4FWGA 1HNXE 4LFCE 2HHHI 1H7SA 1XNQI 4ED4A 1S16A 4UT4A 4P7AA 1N34I 3CWVA 4K0KE 5LMNE 2A2DA 4JV5I 1HK7A 4Z7CA 1PVGA 4LF7I 4DUZI 3QT8A 4B3TE 3QT7A 1NHHA 5LMUE 2UXDI 1UEKA 4LFAE 4B3MI 3J80C 3H4LA 2V2VA 2ZM6I 1HNZE 4LF8I 3B78A 1KTVA 4DV4I 4JI8E 3WU4A 2UXBE 4DR2E 3B8HA 4DV0I 4MYUA 1RR9A 1IBKI 3F0NA 3P06A 4X64I 1K47A 4DPYA 2VF3A 2LJPA 4DV0E 4B3RI 1XHKA 1HNWI 4JI8I 3ZKDA 4DV4E 4JI4I 1MG7A 1U2RA 4LFAI 4Z7YA 2UXDE 4DPWA 2X36A 2OI2A 3T1YE 4RPFA 4B3TI 4DV2E 3J81C 4LF7E 1OJ4A 1FI4A 1ZXNA 2BV3A 5GMEA 1PKPA 1H72C 4JV5E 2E1RA 4K0KI 4HYMA 5IT9C 1USUA 1N34E 1FNMA 5IT9Q 1XNQE 2HHHE 3PYEA 2PNLA 4URLA 4IZJB 5GMDA 1HNXI 1PIEA 4IZJD 4DV3I 2F4VE 2VQEE 1XMQE 1XMOI 1NHIA 2CZ9A 4DU7A 2BM0A 1FJGI 3T1HE 1Z5AA 1ZM4A 3OTOE 4HXZA 3LNUA 1EI1A 1KKHA 2HK3A 4PRXA 3ZKBA 4M1KA 1Z0TA 2IOQA 5BR8E 2J7KA 4KHPE 4DR7I 1QZRA 4HACB 5LL6R 2E5LI 1XNRI 4B3SE 4FWDA 2V2QA 2XEXA 4GKKI 4JI5E 3Q1QA 1Y6ZA 4JI1I 4LFBE 4GKJE 1J5EI 4DUYE 4LF9E 1I94I 4DR3I 4JI0E 3PYFA 1Z0GA 1BKNA 4KQVA 4JI3I 3B82A 1N32E 4WUBA 3J81Q 2A2CA 2DEIA 2UUAE 2UUAI 4JYAE 4DV1E 4UTGA 1N0VC 2IOPA 1N36E 4AQYI 4JI0I 2Q2EB 4DR3E 2Z5CA 4NXNI 1I94E 4LF9I 3HJCA 3WU3A 4XTJA 4DXLA 1J5EE 4PU9A 2UU9E 2CG9A 4R1FA 4NXME 2O1VA 3J80Q 4GKKE 1H73A 2O1UA 3ZZ0A 4DR4I 2ZBKB 4B3SI 2E5LE 1XNRE 4YHHI 4WUCA 4USMA 4DR7E 3ZZUA 5BR8I 4WUDA 1H74A 4X66E 4EMDA 3V5RA 3OTOI 3T1HI 1FWKA 2GQ0A 2O1WA 2VQEI 2EFGA 4JI2E 4IZKA 2V2ZA 1WUUA 3V2UC 4DR5I 4IZKB 4JI6I 1IBME 3JAMQ 1NZ0A 4FWHA 1Z0EA 2V8PA 2O1TA 1Z0BA 2GS8A 3JAMC 3K1JA 4DV2I 2BM1A 3T1YI 1A6FA 1ELOA 5L3JA 3K85A 1Z0WA 1HR0I 2UUCI 1B63A 4I3HA 2HKEA 4JI4E 5FLXC 1HNWE 4DR1E 4LF5I 4DR6E 4LF4E 5IWAE 4B3RE 3LPSA 2X7IA 2VQFI 4LF6I 4LF6E 5A2QQ 4X64E 2VQFE 3Q6MA 3PYDA 1IBKE 2HKJA 4DR2I 5IWAI 1ZM3A 4LF4I 1ZM2A 2UXBI 1KIJA 4DR6I 2Z5CB 1Y4UA 4DR1I 4LF5E 1Y4SA 4LF8E 2UUCE 2Z5EA 1HNZI 1HR0E 2CGEA 2ZM6E 4B3ME 5LMUI 1KVKA 1Z59A 1Z0VA 4DU8A 1MU5A 3Q6NA 2HK2A 1D6TA 4DUZE 4DPUA 1USVA 3M6AA 4DPXA 3HULA 2DEJA 3D4JA 5LMNI 1IBMI 3K17A 4JI6E 4DR5E 3GONA 1NHJA 4N3OA 3WU5A 4LFCI 2UUBE 4JI2I 4DV5I 1VISA 5FWKA 3ZM7A 4MYTA 1FKAE 4X62E 2HFSA 1IBLE 2PNMA 5FLXQ 4X66I 2HFUA 1N0UA 3WU6A 4PRVA 2AJ4A 2NPFA 2R42A 2R3VA 4OX9I 4YHHE 4HY1A 4DR4E 4DV7I 4NXMI 2UU9I 3LTOA 1Z0CA 4NXNE 1N33I 4JG4A 4X65E 3PYGA 4P52A 3QT6A 4DV6E 1EA6A 4YY3E 4AQYE 1MX0A 1N36I 2UXCE 4DV1I 3QT5A 4JI7E 4JYAI 4JI7I 2ZITA 2UXCI 1N32I 5A2QC 4JI3E 4YY3I 4DV6I 1Z5CA 4X65I 4ZVIA 1N33E 4DUYI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAC A;  4GKJ I;  2V34 A;  4JI1 E;  4LFB I;  1RRE A;  4DPT A;  4DV7 E;  4JI5 I;  4USK A;  1H7U A;  3J7A G;  1ZM9 A;  1FWL A;  3ZZT A;  3J7A M;  4OX9 E;  1Z5B A;  4KHP I;  1DAR A;  1ZXM A;  1B62 A;  1IBL I;  1FJG E;  2WW4 A;  1S4E A;  4FW9 A;  4X62 I;  1XMO E;  1XMQ I;  2F4V I;  4DV3 E;  4DV5 E;  4FN5 A;  2UUB I;  4FWG A;  1HNX E;  4LFC E;  2HHH I;  1H7S A;  1XNQ I;  4ED4 A;  1S16 A;  4UT4 A;  4P7A A;  1N34 I;  3CWV A;  4K0K E;  5LMN E;  2A2D A;  4JV5 I;  4Z7C A;  1PVG A;  4LF7 I;  4DUZ I;  3QT8 A;  4B3T E;  3QT7 A;  1NHH A;  5LMU E;  2UXD I;  1UEK A;  4LFA E;  4B3M I;  3J80 C;  3H4L A;  2V2V A;  2ZM6 I;  1HNZ E;  4LF8 I;  3B78 A;  1KTV A;  4DV4 I;  4JI8 E;  3WU4 A;  2UXB E;  4DR2 E;  3B8H A;  4DV0 I;  4MYU A;  1RR9 A;  1IBK I;  3F0N A;  4X64 I;  1K47 A;  4DPY A;  2VF3 A;  2LJP A;  4DV0 E;  4B3R I;  1XHK A;  1HNW I;  4JI8 I;  3ZKD A;  4DV4 E;  4JI4 I;  1MG7 A;  1U2R A;  4LFA I;  4Z7Y A;  2UXD E;  4DPW A;  2X36 A;  2OI2 A;  3T1Y E;  4RPF A;  4B3T I;  4DV2 E;  3J81 C;  4LF7 E;  1OJ4 A;  1FI4 A;  1ZXN A;  2BV3 A;  5GME A;  1PKP A;  1H72 C;  4JV5 E;  2E1R A;  4K0K I;  4HYM A;  5IT9 C;  1N34 E;  1FNM A;  5IT9 Q;  1XNQ E;  2HHH E;  3PYE A;  4URL A;  5GMD A;  1HNX I;  1PIE A;  4DV3 I;  2F4V E;  2VQE E;  1XMQ E;  1XMO I;  1NHI A;  2CZ9 A;  4DU7 A;  2BM0 A;  1FJG I;  3T1H E;  1Z5A A;  1ZM4 A;  3OTO E;  4HXZ A;  3LNU A;  1EI1 A;  1KKH A;  2HK3 A;  4PRX A;  3ZKB A;  4M1K A;  1Z0T A;  5BR8 E;  2J7K A;  4KHP E;  4DR7 I;  1QZR A;  4HAC B;  5LL6 R;  2E5L I;  1XNR I;  4B3S E;  4FWD A;  2V2Q A;  2XEX A;  4GKK I;  4JI5 E;  3Q1Q A;  4JI1 I;  4LFB E;  4GKJ E;  1J5E I;  4DUY E;  4LF9 E;  1I94 I;  4DR3 I;  4JI0 E;  3PYF A;  1Z0G A;  1BKN A;  4KQV A;  4JI3 I;  3B82 A;  1N32 E;  4WUB A;  3J81 Q;  2A2C A;  2DEI A;  2UUA E;  2UUA I;  4JYA E;  4DV1 E;  4UTG A;  1N0V C;  1N36 E;  4AQY I;  4JI0 I;  2Q2E B;  4DR3 E;  4NXN I;  1I94 E;  4LF9 I;  3WU3 A;  4XTJ A;  4DXL A;  1J5E E;  4PU9 A;  2UU9 E;  4R1F A;  4NXM E;  3J80 Q;  4GKK E;  1H73 A;  3ZZ0 A;  4DR4 I;  2ZBK B;  4B3S I;  2E5L E;  1XNR E;  4YHH I;  4WUC A;  4USM A;  4DR7 E;  3ZZU A;  5BR8 I;  4WUD A;  1H74 A;  4X66 E;  4EMD A;  3V5R A;  3OTO I;  3T1H I;  1FWK A;  2VQE I;  2EFG A;  4JI2 E;  2V2Z A;  1WUU A;  3V2U C;  4DR5 I;  4JI6 I;  1IBM E;  3JAM Q;  1NZ0 A;  4FWH A;  1Z0E A;  2V8P A;  1Z0B A;  2GS8 A;  3JAM C;  3K1J A;  4DV2 I;  2BM1 A;  3T1Y I;  1A6F A;  1ELO A;  5L3J A;  1Z0W A;  1HR0 I;  2UUC I;  1B63 A;  4I3H A;  2HKE A;  4JI4 E;  5FLX C;  1HNW E;  4DR1 E;  4LF5 I;  4DR6 E;  4LF4 E;  5IWA E;  4B3R E;  3LPS A;  2X7I A;  2VQF I;  4LF6 I;  4LF6 E;  5A2Q Q;  4X64 E;  2VQF E;  3PYD A;  1IBK E;  2HKJ A;  4DR2 I;  5IWA I;  1ZM3 A;  4LF4 I;  1ZM2 A;  2UXB I;  1KIJ A;  4DR6 I;  4LF5 E;  4DR1 I;  4LF8 E;  2UUC E;  1HNZ I;  1HR0 E;  2ZM6 E;  4B3M E;  5LMU I;  1KVK A;  1Z59 A;  1Z0V A;  4DU8 A;  1MU5 A;  2HK2 A;  1D6T A;  4DUZ E;  4DPU A;  3M6A A;  4DPX A;  3HUL A;  2DEJ A;  3D4J A;  5LMN I;  1IBM I;  3K17 A;  4JI6 E;  4DR5 E;  3GON A;  1NHJ A;  3WU5 A;  4LFC I;  2UUB E;  4JI2 I;  4DV5 I;  1VIS A;  3ZM7 A;  4MYT A;  1FKA E;  4X62 E;  2HFS A;  1IBL E;  5FLX Q;  4X66 I;  2HFU A;  1N0U A;  3WU6 A;  4PRV A;  2AJ4 A;  2NPF A;  2R42 A;  2R3V A;  4OX9 I;  4YHH E;  4HY1 A;  4DR4 E;  4DV7 I;  4NXM I;  2UU9 I;  3LTO A;  1Z0C A;  4NXN E;  1N33 I;  4JG4 A;  4X65 E;  3PYG A;  4P52 A;  3QT6 A;  4DV6 E;  1EA6 A;  4YY3 E;  4AQY E;  1MX0 A;  1N36 I;  2UXC E;  4DV1 I;  3QT5 A;  4JI7 E;  4JYA I;  4JI7 I;  2ZIT A;  2UXC I;  1N32 I;  5A2Q C;  4JI3 E;  4YY3 I;  4DV6 I;  1Z5C A;  4X65 I;  4ZVI A;  1N33 E;  4DUY I; 
#chains in the Genus database with same CATH topology
 4IFD A;  4HAC A;  5DRQ A;  4GKJ I;  2V34 A;  2PO2 B;  4JI1 E;  4LFB I;  1RRE A;  1R6L A;  3P3C A;  4DPT A;  4DV7 E;  4QNK A;  4JI5 I;  2CVE A;  4USK A;  1H7U A;  1E3H A;  3GLL A;  1ZM9 A;  3J7A G;  3PS3 A;  4IFD D;  1FWL A;  3ZZT A;  3J7A M;  4OX9 E;  1Z5B A;  4KHP I;  2NN6 C;  1DAR A;  1ZXM A;  1B62 A;  3PRY A;  2Z5B A;  5JEA B;  1IBL I;  1FJG E;  2WW4 A;  4IZJ A;  4OZE A;  1S4E A;  4FW9 A;  4X62 I;  4OO1 D;  1XMO E;  2Z5B B;  1XMQ I;  2F4V I;  4DV3 E;  4DV5 E;  4FN5 A;  2UUB I;  4FWG A;  1HNX E;  4LFC E;  4MU0 A;  2HHH I;  1H7S A;  1XNQ I;  2PO2 A;  3U1Y A;  1S16 A;  3CDI A;  4ED4 A;  4UT4 A;  3DD6 A;  4P7A A;  2WP8 A;  4LCH A;  3L7Z A;  1N34 I;  3CWV A;  4K0K E;  5LMN E;  2A2D A;  4JV5 I;  1HK7 A;  4Z7C A;  5C0X C;  1PVG A;  4LF7 I;  1XXE A;  4DUZ I;  3QT8 A;  4AID A;  4B3T E;  3QT7 A;  1NHH A;  5LMU E;  2UXD I;  1UEK A;  4LFA E;  5JEA A;  4B3M I;  5JEA F;  3J80 C;  3H4L A;  2V2V A;  2ZM6 I;  1UDS A;  1HNZ E;  2JE6 B;  4LF8 I;  4AM3 A;  5EKW A;  3B78 A;  1KTV A;  2PNZ B;  4DV4 I;  4JI8 E;  3WU4 A;  2UXB E;  4DR2 E;  3B8H A;  4DV0 I;  4MYU A;  1RR9 A;  2IER A;  1IBK I;  3F0N A;  3P06 A;  4X64 I;  1K47 A;  3U1K A;  5JEA E;  2PO1 A;  4DPY A;  2VF3 A;  2LJP A;  4DV0 E;  4B3R I;  2NN6 F;  1XHK A;  5DRR A;  3M85 G;  2C37 B;  1HNW I;  4JI8 I;  3ZKD A;  4DV4 E;  4JI4 I;  1MG7 A;  1U2R A;  4LFA I;  4Z7Y A;  2UXD E;  4DPW A;  2X36 A;  2OI2 A;  3T1Y E;  2NN6 E;  4RPF A;  4B3T I;  4DV2 E;  3J81 C;  4LF7 E;  5K36 E;  1OJ4 A;  2BR2 A;  1FI4 A;  1ZXN A;  2BV3 A;  5GME A;  1PKP A;  1H72 C;  4JV5 E;  2E1R A;  4K0K I;  4HYM A;  5IT9 C;  3PS2 A;  2BA0 G;  1USU A;  2C39 B;  1N34 E;  1UDQ A;  1OYP A;  1FNM A;  2WNR B;  3NZK A;  5IT9 Q;  2NN6 D;  2HHH E;  1XNQ E;  3PYE A;  2PNL A;  4URL A;  5JEA D;  4IZJ B;  5GMD A;  1HNX I;  1PIE A;  5K36 F;  4IZJ D;  5K36 B;  4DV3 I;  5C0X A;  2VQE E;  1XMQ E;  2F4V E;  1XMO I;  1NHI A;  2CZ9 A;  4DU7 A;  2BM0 A;  2JEB A;  2BA1 G;  3T1H E;  1FJG I;  1Z5A A;  1ZM4 A;  2PNZ A;  4FW3 A;  5C0X B;  3OTO E;  4OO1 E;  4HXZ A;  3LNU A;  1EI1 A;  1KKH A;  2HK3 A;  2IES A;  4PRX A;  5C0X D;  3M85 D;  3ZKB A;  4M1K A;  1Z0T A;  2IOQ A;  5BR8 E;  2J7K A;  4KHP E;  4DR7 I;  1QZR A;  4HAC B;  1E3P A;  5LL6 R;  2E5L I;  4B3S E;  1XNR I;  4FWD A;  2V2Q A;  2XEX A;  3P3E A;  4GKK I;  4JI5 E;  4OO1 F;  1Y60 A;  2C38 B;  1Y6Z A;  4JI1 I;  3Q1Q A;  4LFB E;  4GKJ E;  2F1D A;  1J5E I;  4LCF A;  4DUY E;  4J3D A;  1RHY A;  4LF9 E;  1I94 I;  4BA1 A;  4BA2 B;  4DR3 I;  4JI0 E;  3PYF A;  1Z0G A;  1BKN A;  4IS9 A;  4KQV A;  4MDT A;  4JI3 I;  3B82 A;  1N32 E;  4WUB A;  4AIM A;  3J81 Q;  2JEA B;  2A2C A;  2DEI A;  2UUA E;  2UUA I;  4JYA E;  4DV1 E;  4FW5 A;  4UTG A;  1N0V C;  4FW4 A;  2IOP A;  1N36 E;  4IFD B;  4AQY I;  4JI0 I;  2Q2E B;  4DR3 E;  2Z5C A;  3P76 A;  4LOM A;  5EL9 A;  4NXN I;  1I94 E;  4LF9 I;  3HJC A;  3WU3 A;  4XTJ A;  4DXL A;  1J5E E;  4PU9 A;  2UU9 E;  2CG9 A;  4R1F A;  4NXM E;  2O1V A;  1YH8 A;  3J80 Q;  4GKK E;  1H73 A;  1VI7 A;  2O1U A;  3ZZ0 A;  4DR4 I;  4BA2 A;  2ZBK B;  3UHM A;  5K36 A;  4B3S I;  2E5L E;  2C38 A;  1XNR E;  4YHH I;  2AE8 A;  4WUC A;  4USM A;  4DR7 E;  3ZZU A;  5BR8 I;  4WUD A;  1H74 A;  4X66 E;  4EMD A;  3V5R A;  4IFD C;  3OTO I;  3T1H I;  2VES A;  3PS1 A;  1OYS A;  1FWK A;  1OYR A;  2GQ0 A;  2O1W A;  5DRP A;  2VQE I;  2EFG A;  4FW7 A;  4JI2 E;  4IZK A;  4LPF A;  2V2Z A;  1WUU A;  3V2U C;  4DR5 I;  4IZK B;  4JI6 I;  1IBM E;  3JAM Q;  1NZ0 A;  2J65 A;  4FWH A;  5C0X E;  2WP8 B;  1Z0E A;  2NN6 A;  2V8P A;  2O1T A;  1R6M A;  1Z0B A;  2GS8 A;  3JAM C;  3K1J A;  4DV2 I;  2BM1 A;  2JEB B;  3T1Y I;  1A6F A;  3KRN A;  1ELO A;  5L3J A;  1UDN A;  3K85 A;  1Z0W A;  2BR2 B;  2PO0 B;  4OO1 C;  1HR0 I;  2O3Z A;  2UUC I;  1B63 A;  4I3H A;  4QNJ A;  2HKE A;  4JI4 E;  5C0X F;  5FLX C;  4LCG A;  1HNW E;  4DR1 E;  4LF5 I;  4DR6 E;  2PO0 A;  4MQY A;  4LF4 E;  2JE6 A;  5IWA E;  4B3R E;  3LPS A;  2X7I A;  5DNX A;  3M7N D;  4IFD F;  2VQF I;  4LF6 I;  2C37 A;  3GME A;  4LF6 E;  5A2Q Q;  4X64 E;  3HKM A;  4OKG A;  2VQF E;  3Q6M A;  3PYD A;  1IBK E;  2HKJ A;  4DR2 I;  5IWA I;  2GO3 A;  1ZM3 A;  4LF4 I;  1ZM2 A;  2UXB I;  1KIJ A;  4DR6 I;  2Z5C B;  1Y4U A;  4U3D A;  4DR1 I;  4LF5 E;  5K36 C;  1Y4S A;  5ELW A;  4ISA A;  4LF8 E;  2UUC E;  2Z5E A;  1HNZ I;  1HR0 E;  2CGE A;  3H1C A;  2ZM6 E;  2JEA A;  4GQU A;  4IFD E;  4B3M E;  5LMU I;  2NN6 B;  1KVK A;  1Z59 A;  1Z0V A;  4DU8 A;  3GCM A;  2BA1 D;  1MU5 A;  3Q6N A;  2HK2 A;  1D6T A;  5K36 D;  4DUZ E;  4DPU A;  1USV A;  3M6A A;  4DPX A;  3HUL A;  2BA0 D;  2DEJ A;  3D4J A;  5LMN I;  1IBM I;  3K17 A;  4JI6 E;  5DRO A;  4DR5 E;  3GON A;  1NHJ A;  4N3O A;  3WU5 A;  4MU3 A;  4OO1 B;  4LFC I;  3M7N G;  2UUB E;  2GO4 A;  4JI2 I;  4DV5 I;  1VIS A;  5FWK A;  3ZM7 A;  2WNR A;  4U3B A;  4MYT A;  1FKA E;  1P42 A;  4X62 E;  3CDJ A;  2JT2 A;  1UDO A;  2HFS A;  1IBL E;  2PNM A;  5FLX Q;  1YHC A;  1Y5Y A;  2HFU A;  4X66 I;  1N0U A;  3WU6 A;  4PRV A;  2AJ4 A;  2NPF A;  2R42 A;  2R3V A;  4OX9 I;  4YHH E;  4HY1 A;  4DR4 E;  4DV7 I;  2C39 A;  5JEA C;  4NXM I;  2UU9 I;  3LTO A;  2PO1 B;  4FW6 A;  4OO1 A;  3B4T A;  1Z0C A;  4NXN E;  1N33 I;  4JG4 A;  4X65 E;  3PYG A;  4P52 A;  3QT6 A;  4DV6 E;  1EA6 A;  4YY3 E;  3L7Z B;  4AQY E;  1MX0 A;  1N36 I;  2UXC E;  4BA1 B;  4DV1 I;  3QT5 A;  4JI7 E;  4JYA I;  5DNL A;  4JI7 I;  2ZIT A;  2UXC I;  1N32 I;  5A2Q C;  4JI3 E;  4YY3 I;  4DV6 I;  1Z5C A;  3P3G A;  4X65 I;  4ZVI A;  1N33 E;  4MU1 A;  4NBQ A;  4MU4 A;  4DUY I; 
#chains in the Genus database with same CATH homology
 4HAC A;  4GKJ I;  2V34 A;  4JI1 E;  4LFB I;  1RRE A;  4DPT A;  4DV7 E;  4JI5 I;  4USK A;  1H7U A;  3J7A G;  1ZM9 A;  1FWL A;  3ZZT A;  3J7A M;  4OX9 E;  1Z5B A;  4KHP I;  1DAR A;  1ZXM A;  1B62 A;  3PRY A;  2Z5B A;  1IBL I;  1FJG E;  2WW4 A;  4IZJ A;  1S4E A;  4FW9 A;  4X62 I;  1XMO E;  2Z5B B;  1XMQ I;  2F4V I;  4DV3 E;  4DV5 E;  4FN5 A;  2UUB I;  4FWG A;  1HNX E;  4LFC E;  2HHH I;  1H7S A;  1XNQ I;  4ED4 A;  1S16 A;  4UT4 A;  4P7A A;  1N34 I;  3CWV A;  4K0K E;  5LMN E;  2A2D A;  4JV5 I;  1HK7 A;  4Z7C A;  1PVG A;  4LF7 I;  4DUZ I;  3QT8 A;  4B3T E;  3QT7 A;  1NHH A;  5LMU E;  2UXD I;  1UEK A;  4LFA E;  4B3M I;  3J80 C;  3H4L A;  2V2V A;  2ZM6 I;  1HNZ E;  4LF8 I;  3B78 A;  1KTV A;  4DV4 I;  4JI8 E;  3WU4 A;  2UXB E;  4DR2 E;  3B8H A;  4DV0 I;  4MYU A;  1RR9 A;  1IBK I;  3F0N A;  3P06 A;  4X64 I;  1K47 A;  4DPY A;  2VF3 A;  2LJP A;  4DV0 E;  4B3R I;  1XHK A;  1HNW I;  4JI8 I;  3ZKD A;  4DV4 E;  4JI4 I;  1MG7 A;  1U2R A;  4LFA I;  4Z7Y A;  2UXD E;  4DPW A;  2X36 A;  2OI2 A;  3T1Y E;  4RPF A;  4B3T I;  4DV2 E;  3J81 C;  4LF7 E;  1OJ4 A;  1FI4 A;  1ZXN A;  2BV3 A;  5GME A;  1PKP A;  1H72 C;  4JV5 E;  2E1R A;  4K0K I;  4HYM A;  5IT9 C;  1USU A;  1N34 E;  1FNM A;  5IT9 Q;  1XNQ E;  2HHH E;  3PYE A;  2PNL A;  4URL A;  4IZJ B;  5GMD A;  1HNX I;  1PIE A;  4IZJ D;  4DV3 I;  2F4V E;  2VQE E;  1XMQ E;  1XMO I;  1NHI A;  2CZ9 A;  4DU7 A;  2BM0 A;  1FJG I;  3T1H E;  1Z5A A;  1ZM4 A;  3OTO E;  4HXZ A;  3LNU A;  1EI1 A;  1KKH A;  2HK3 A;  4PRX A;  3ZKB A;  4M1K A;  1Z0T A;  2IOQ A;  5BR8 E;  2J7K A;  4KHP E;  4DR7 I;  1QZR A;  4HAC B;  5LL6 R;  2E5L I;  1XNR I;  4B3S E;  4FWD A;  2V2Q A;  2XEX A;  4GKK I;  4JI5 E;  3Q1Q A;  1Y6Z A;  4JI1 I;  4LFB E;  4GKJ E;  1J5E I;  4DUY E;  4LF9 E;  1I94 I;  4DR3 I;  4JI0 E;  3PYF A;  1Z0G A;  1BKN A;  4KQV A;  4JI3 I;  3B82 A;  1N32 E;  4WUB A;  3J81 Q;  2A2C A;  2DEI A;  2UUA E;  2UUA I;  4JYA E;  4DV1 E;  4UTG A;  1N0V C;  2IOP A;  1N36 E;  4AQY I;  4JI0 I;  2Q2E B;  4DR3 E;  2Z5C A;  4NXN I;  1I94 E;  4LF9 I;  3HJC A;  3WU3 A;  4XTJ A;  4DXL A;  1J5E E;  4PU9 A;  2UU9 E;  2CG9 A;  4R1F A;  4NXM E;  2O1V A;  3J80 Q;  4GKK E;  1H73 A;  2O1U A;  3ZZ0 A;  4DR4 I;  2ZBK B;  4B3S I;  2E5L E;  1XNR E;  4YHH I;  4WUC A;  4USM A;  4DR7 E;  3ZZU A;  5BR8 I;  4WUD A;  1H74 A;  4X66 E;  4EMD A;  3V5R A;  3OTO I;  3T1H I;  1FWK A;  2GQ0 A;  2O1W A;  2VQE I;  2EFG A;  4JI2 E;  4IZK A;  2V2Z A;  1WUU A;  3V2U C;  4DR5 I;  4IZK B;  4JI6 I;  1IBM E;  3JAM Q;  1NZ0 A;  4FWH A;  1Z0E A;  2V8P A;  2O1T A;  1Z0B A;  2GS8 A;  3JAM C;  3K1J A;  4DV2 I;  2BM1 A;  3T1Y I;  1A6F A;  1ELO A;  5L3J A;  3K85 A;  1Z0W A;  1HR0 I;  2UUC I;  1B63 A;  4I3H A;  2HKE A;  4JI4 E;  5FLX C;  1HNW E;  4DR1 E;  4LF5 I;  4DR6 E;  4LF4 E;  5IWA E;  4B3R E;  3LPS A;  2X7I A;  2VQF I;  4LF6 I;  4LF6 E;  5A2Q Q;  4X64 E;  2VQF E;  3Q6M A;  3PYD A;  1IBK E;  2HKJ A;  4DR2 I;  5IWA I;  1ZM3 A;  4LF4 I;  1ZM2 A;  2UXB I;  1KIJ A;  4DR6 I;  2Z5C B;  1Y4U A;  4DR1 I;  4LF5 E;  1Y4S A;  4LF8 E;  2UUC E;  2Z5E A;  1HNZ I;  1HR0 E;  2CGE A;  2ZM6 E;  4B3M E;  5LMU I;  1KVK A;  1Z59 A;  1Z0V A;  4DU8 A;  1MU5 A;  3Q6N A;  2HK2 A;  1D6T A;  4DUZ E;  4DPU A;  1USV A;  3M6A A;  4DPX A;  3HUL A;  2DEJ A;  3D4J A;  5LMN I;  1IBM I;  3K17 A;  4JI6 E;  4DR5 E;  3GON A;  1NHJ A;  4N3O A;  3WU5 A;  4LFC I;  2UUB E;  4JI2 I;  4DV5 I;  1VIS A;  5FWK A;  3ZM7 A;  4MYT A;  1FKA E;  4X62 E;  2HFS A;  1IBL E;  2PNM A;  5FLX Q;  4X66 I;  2HFU A;  1N0U A;  3WU6 A;  4PRV A;  2AJ4 A;  2NPF A;  2R42 A;  2R3V A;  4OX9 I;  4YHH E;  4HY1 A;  4DR4 E;  4DV7 I;  4NXM I;  2UU9 I;  3LTO A;  1Z0C A;  4NXN E;  1N33 I;  4JG4 A;  4X65 E;  3PYG A;  4P52 A;  3QT6 A;  4DV6 E;  1EA6 A;  4YY3 E;  4AQY E;  1MX0 A;  1N36 I;  2UXC E;  4DV1 I;  3QT5 A;  4JI7 E;  4JYA I;  4JI7 I;  2ZIT A;  2UXC I;  1N32 I;  5A2Q C;  4JI3 E;  4YY3 I;  4DV6 I;  1Z5C A;  4X65 I;  4ZVI A;  1N33 E;  4DUY I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...