3WU3A

Reduced-form structure of e.coli lon proteolytic domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
190
Chain Sequence
YGRADNENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A redox switch shapes the Lon protease exit pore to facultatively regulate proteolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Lon protease
total genus 63
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3wu3A01
4X64I 2NPFA 2UU9I 4LF7I 4DV4E 2GS8A 2X36A 4JG4A 1N34I 1VISA 4DV1E 1HNZI 4JI0E 4KQVA 1Z0GA 4JI2E 4HACB 1ZM4A 3J80Q 2J7KA 4MYTA 4X65I 1OJ4A 1Z0EA 3J7AM 1U2RA 1A6FA 5LMNE 3LPSA 1ZM3A 3GONA 4X62E 4YHHE 2VQEI 4B3TE 2UXDE 1WUUA 4NXNE 4GKJE 4DU8A 2HHHI 2VQFI 5A2QQ 2V8PA 5FLXC 4JI8I 2E1RA 5A2QC 4JI1E 1N0UA 1Z0TA 1NHIA 4DR1E 1I94E 1H7SA 4LF8I 4DV5I 4DR4E 2UXBI 1HR0E 1K47A 3WU6A 1ZM2A 4YY3I 4PRVA 4DV3E 4B3ME 5BR8E 1KVKA 1Z5CA 1QZRA 3OTOE 4DR6E 1B62A 4DR3E 1BKNA 1H72C 4PU9A 4URLA 4DR7E 4DR7I 4JI6I 5LMUE 4DUZE 4DV2I 1XMQI 1FJGI 2UUCI 4DR3I 2HKJA 3B82A 4B3MI 3ZZ0A 3ZM7A 2BV3A 2DEIA 2V2VA 5GMEA 4JYAI 2UXCI 4YY3E 3ZKBA 2EFGA 5L3JA 4OX9I 2UUBI 2UUAE 4DR4I 4DV7I 4PRXA 4DR1I 4DXLA 3J81C 4JI8E 1B63A 1MU5A 4DV6E 1N32I 4GKJI 1ZXMA 2UUAI 3F0NA 4FWGA 1FWKA 4JI5I 1RREA 3ZZUA 1KKHA 4DPYA 2R42A 1MG7A 1IBMI 1FJGE 4JV5E 4DUZI 3K1JA 2X7IA 4LFBE 4JI6E 3D4JA 4P52A 4JI0I 3B8HA 4DR6I 3WU4A 1HNWE 3QT8A 4KHPI 2HKEA 1DARA 4DR5I 4LF9I 4DV4I 4AQYI 1KIJA 2LJPA 1KTVA 3H4LA 4DUYE 3T1YI 4DV3I 4X64E 4I3HA 4K0KI 2UXBE 4AQYE 2E5LE 4DR5E 4LF9E 1ZXNA 4HYMA 4DV5E 4KHPE 2BM1A 1HNWI 1D6TA 1EI1A 4JI1I 2VQFE 4JI4E 4WUBA 1XNQI 2F4VI 2VQEE 5FLXQ 3J7AG 2OI2A 4LFCE 1Z5BA 5LMNI 1IBLE 1IBLI 1Z0BA 4FW9A 4LFCI 4ED4A 4B3RI 2F4VE 3J81Q 4JI4I 4DV6I 1N32E 1Z0VA 4HY1A 2V2ZA 1Z59A 4B3SE 3HULA 2V2QA 2ZBKB 4DV7E 4LFAI 1N34E 3ZZTA 2UUBE 4OX9E 1H74A 4LF7E 2UU9E 5IT9C 4JYAE 2UXCE 1J5EI 4DU7A 4DUYI 3T1YE 4LF4E 1Z5AA 2ZITA 1MX0A 1XMOE 1RR9A 4LF5I 4LF6E 4FN5A 4DV2E 5LMUI 4FWHA 3V2UC 4LFBI 4GKKI 1N33E 4JV5I 1IBME 2BM0A 3CWVA 1PKPA 2V34A 4X66E 2ZM6E 4FWDA 1FI4A 2WW4A 2CZ9A 4JI5E 1PIEA 4DPWA 1Z0CA 4JI3I 3PYDA 5IT9Q 3QT5A 3LNUA 1NHHA 4NXME 3WU3A 4NXNI 5LL6R 3V5RA 4UTGA 2UXDI 4JI7I 4WUDA 4YHHI 4X62I 2AJ4A 4ZVIA 1NHJA 3Q1QA 3J80C 1PVGA 4Z7YA 4USMA 3QT7A 2UUCE 1HNXI 4X65E 4NXMI 1XMQE 2DEJA 1EA6A 4JI2I 1HNZE 1XNRI 2A2CA 4JI3E 3OTOI 4DV1I 4RPFA 3PYGA 4DPUA 5BR8I 3M6AA 4MYUA 5GMDA 4XTJA 1IBKI 1IBKE 1N0VC 1HR0I 4X66I 2R3VA 2HFUA 4DV0E 2VF3A 1XNRE 1I94I 4LF8E 4USKA 4DPXA 2HK3A 4R1FA 4DPTA 5IWAE 1UEKA 4DR2I 3ZKDA 1HNXE 2HHHE 4LF5E 1XMOI 3LTOA 4B3TI 3PYEA 4HACA 2Q2EB 1J5EE 4HXZA 3B78A 3QT6A 1H7UA 2HK2A 4JI7E 3T1HI 4P7AA 4EMDA 4LFAE 3JAMQ 3WU5A 1H73A 4B3SI 2XEXA 1FWLA 1S16A 1Z0WA 1ZM9A 1FKAE 4M1KA 4Z7CA 4B3RE 3T1HE 3K17A 1S4EA 2A2DA 1XHKA 1ELOA 2ZM6I 4WUCA 2HFSA 1XNQE 1NZ0A 1N33I 4GKKE 1FNMA 1N36E 4DR2E 5IWAI 3JAMC 4UT4A 1N36I 4LF6I 4DV0I 2E5LI 4LF4I 3PYFA 4K0KE
chains in the Genus database with same CATH superfamily
1Y6ZA 4IZKB 3M7NG 4X64I 2NPFA 5C0XB 2UU9I 4LF7I 2JEBA 4DV4E 2GS8A 2X36A 2CGEA 4JG4A 1YHCA 1N34I 1VISA 4DV1E 5C0XA 1OYSA 3PRYA 1Y5YA 1HNZI 3K85A 4JI0E 2Z5CB 1UDNA 4KQVA 4FW3A 1Z0GA 2C38A 4JI2E 1E3PA 4HACB 1ZM4A 3J80Q 3PS3A 2J7KA 4MYTA 4X65I 2CG9A 2PO2B 1OJ4A 1Z0EA 2NN6D 3Q6NA 3J7AM 1U2RA 1A6FA 5LMNE 3LPSA 4OO1C 1ZM3A 3HJCA 3GONA 3L7ZB 1VI7A 4X62E 4YHHE 2VQEI 4B3TE 2UXDE 4FW5A 5K36D 1WUUA 3CDIA 4NXNE 4GKJE 4DU8A 2HHHI 2VQFI 5A2QQ 2V8PA 5FLXC 4JI8I 3CDJA 2E1RA 5A2QC 4JI1E 1N0UA 4FW6A 1Z0TA 1NHIA 5K36A 4DR1E 1I94E 1H7SA 4LF8I 4DV5I 4DR4E 4LPFA 2UXBI 2J65A 1HR0E 1K47A 3WU6A 1ZM2A 5DRRA 4PRVA 4YY3I 4DV3E 2PNZB 4B3ME 5BR8E 1KVKA 1Z5CA 2JEAB 1QZRA 3OTOE 4DR6E 1B62A 4DR3E 2GO4A 3M7ND 1P42A 1USVA 1BKNA 1H72C 4PU9A 4URLA 3P06A 4DR7I 4DR7E 4JI6I 5LMUE 5C0XC 3L7ZA 4DUZE 4DV2I 1XMQI 1FJGI 2UUCI 2NN6E 4DR3I 4IS9A 5C0XF 2HKJA 3B82A 4B3MI 3ZZ0A 3ZM7A 4FW7A 2PO0B 2BV3A 2DEIA 2GO3A 2V2VA 5GMEA 4JYAI 2NN6F 2UXCI 4YY3E 3ZKBA 4GQUA 2EFGA 4NBQA 5L3JA 4IZJB 5JEAD 4OX9I 2UUBI 1UDSA 5JEAB 2UUAE 4DR4I 5K36B 3M85D 1Y4SA 4DV7I 4PRXA 4DR1I 4DXLA 3J81C 1Y4UA 5C0XD 2O3ZA 4N3OA 4JI8E 2IOPA 1B63A 1MU5A 5ELWA 4AIMA 4DV6E 1N32I 4GKJI 4IZKA 2VESA 1ZXMA 2UUAI 3F0NA 4OZEA 4IFDF 4MQYA 4LCHA 4FWGA 1FWKA 4JI5I 2IOQA 2IERA 2IESA 1RREA 4FW4A 3ZZUA 1KKHA 2PNMA 1YH8A 4DPYA 2R42A 1MG7A 1IBMI 1FJGE 4BA2B 4JV5E 5DNXA 4DUZI 3K1JA 2X7IA 4LFBE 1OYRA 4JI6E 3D4JA 4P52A 4JI0I 3B8HA 4DR6I 3WU4A 1HNWE 3QT8A 1XXEA 4KHPI 2HKEA 1DARA 4DR5I 4LF9I 2O1UA 4DV4I 4AQYI 1KIJA 2LJPA 1KTVA 3H4LA 4DUYE 3T1YI 1R6MA 4DV3I 2GQ0A 4X64E 4I3HA 1RHYA 4K0KI 2UXBE 4AQYE 2E5LE 4DR5E 4LF9E 1ZXNA 4HYMA 4DV5E 4KHPE 2BM1A 1HNWI 4IFDE 1D6TA 1EI1A 3GMEA 4JI1I 2JEBB 1HK7A 2VQFE 4JI4E 4WUBA 3NZKA 1XNQI 2F4VI 2VQEE 2JT2A 5FLXQ 3J7AG 2OI2A 4LFCE 1Z5BA 5K36F 5LMNI 1IBLE 1IBLI 4OO1F 4QNKA 1Z0BA 4FW9A 4LFCI 5K36C 4ED4A 4MDTA 4B3RI 2F4VE 3J81Q 2PNLA 3GCMA 4JI4I 4DV6I 1N32E 1Z0VA 2Z5CA 4HY1A 5JEAC 2V2ZA 1Z59A 4B3SE 2Z5EA 3HULA 2C39B 2V2QA 2ZBKB 3U1YA 4DV7E 4LFAI 1N34E 3ZZTA 3B4TA 2UUBE 4OX9E 3GLLA 1H74A 4J3DA 4LF7E 2UU9E 4IZJA 5IT9C 3UHMA 1USUA 2WNRB 4JYAE 2UXCE 1J5EI 4DU7A 4DUYI 3T1YE 3U1KA 4LF4E 1Z5AA 2O1TA 2ZITA 1MX0A 1XMOE 1RR9A 4LF5I 4LF6E 4U3DA 4LCGA 4FN5A 4LCFA 5LMUI 4DV2E 4FWHA 3V2UC 4LFBI 4GKKI 1N33E 2CVEA 4JV5I 1IBME 2BM0A 3CWVA 5FWKA 1PKPA 2V34A 2BR2A 3PS1A 4X66E 2ZM6E 2C37A 4ISAA 3H1CA 4FWDA 1FI4A 2WW4A 2CZ9A 2JE6B 3P3GA 4JI5E 1PIEA 3P76A 4OO1B 4DPWA 1Z0CA 4OO1D 2BA0G 4JI3I 1UDOA 3PYDA 3Q6MA 5IT9Q 3QT5A 3LNUA 1NHHA 4NXME 3WU3A 4NXNI 5LL6R 4IFDC 3KRNA 3V5RA 4UTGA 2UXDI 3P3EA 4JI7I 1OYPA 5DRQA 4WUDA 4YHHI 5JEAA 4X62I 1Y60A 2AJ4A 2Z5BA 4ZVIA 1NHJA 3Q1QA 4BA2A 2NN6C 3PS2A 3J80C 1PVGA 2BA1D 4Z7YA 4OKGA 5JEAE 4MU3A 2O1VA 4USMA 1E3HA 3P3CA 3QT7A 1HNXI 4X65E 2UUCE 1R6LA 4NXMI 1XMQE 5DNLA 2DEJA 2BA0D 1EA6A 4QNJA 5C0XE 4JI2I 5DROA 1HNZE 1XNRI 5EKWA 2A2CA 4JI3E 3OTOI 2WP8B 4DV1I 4RPFA 3PYGA 2BA1G 4DPUA 5BR8I 3M6AA 2JEAA 4MYUA 5GMDA 4XTJA 1IBKI 4LOMA 1IBKE 1N0VC 1HR0I 2WP8A 4X66I 4AIDA 2R3VA 4IZJD 2HFUA 4DV0E 4MU4A 2VF3A 1XNRE 1I94I 4LF8E 4USKA 4DPXA 2HK3A 4R1FA 2PO0A 4DPTA 5IWAE 1UEKA 4DR2I 2JE6A 3ZKDA 1HNXE 2PO2A 2HHHE 4LF5E 1XMOI 3LTOA 4MU0A 2PO1B 2BR2B 4B3TI 3PYEA 4HACA 4MU1A 2Q2EB 2Z5BB 1J5EE 3M85G 4HXZA 3B78A 3QT6A 1H7UA 2HK2A 4JI7E 2AE8A 3T1HI 4P7AA 5DRPA 4OO1E 4EMDA 4LFAE 2PNZA 2C39A 3JAMQ 4BA1A 3WU5A 1H73A 4AM3A 4B3SI 2XEXA 4IFDD 1FWLA 1S16A 1Z0WA 4OO1A 2NN6A 3DD6A 2C38B 2O1WA 1ZM9A 1FKAE 4BA1B 4M1KA 4Z7CA 4B3RE 3T1HE 3K17A 1S4EA 1UDQA 3HKMA 2C37B 4IFDB 2A2DA 1XHKA 1ELOA 2F1DA 2ZM6I 5K36E 4U3BA 4WUCA 2HFSA 1XNQE 1NZ0A 2PO1A 1N33I 4IFDA 4GKKE 1FNMA 1N36E 4DR2E 5IWAI 3JAMC 4UT4A 5JEAF 1N36I 4LF6I 5EL9A 4DV0I 2NN6B 2E5LI 2WNRA 4LF4I 3PYFA 4K0KE
chains in the Genus database with same CATH topology
1Y6ZA 4IZKB 4X64I 2NPFA 2UU9I 4LF7I 4DV4E 2GS8A 2X36A 2CGEA 4JG4A 1N34I 1VISA 4DV1E 3PRYA 1HNZI 3K85A 4JI0E 2Z5CB 4KQVA 1Z0GA 4JI2E 4HACB 1ZM4A 3J80Q 2J7KA 4MYTA 4X65I 2CG9A 1OJ4A 1Z0EA 3Q6NA 3J7AM 1U2RA 1A6FA 5LMNE 3LPSA 1ZM3A 3HJCA 3GONA 4X62E 4YHHE 2VQEI 4B3TE 2UXDE 1WUUA 4NXNE 4GKJE 4DU8A 2HHHI 2VQFI 5A2QQ 2V8PA 5FLXC 4JI8I 2E1RA 5A2QC 4JI1E 1N0UA 1Z0TA 1NHIA 4DR1E 1I94E 1H7SA 4LF8I 4DV5I 4DR4E 2UXBI 1HR0E 1K47A 3WU6A 1ZM2A 4YY3I 4PRVA 4DV3E 4B3ME 5BR8E 1KVKA 1Z5CA 1QZRA 3OTOE 4DR6E 1B62A 4DR3E 1USVA 1BKNA 1H72C 4PU9A 4URLA 3P06A 4DR7I 4DR7E 4JI6I 5LMUE 4DUZE 4DV2I 1XMQI 1FJGI 2UUCI 4DR3I 2HKJA 3B82A 4B3MI 3ZZ0A 3ZM7A 2BV3A 2DEIA 2V2VA 5GMEA 4JYAI 2UXCI 4YY3E 3ZKBA 2EFGA 5L3JA 4IZJB 4OX9I 2UUBI 2UUAE 4DR4I 1Y4SA 4DV7I 4PRXA 4DR1I 4DXLA 3J81C 1Y4UA 4N3OA 4JI8E 2IOPA 1B63A 1MU5A 4DV6E 1N32I 4GKJI 4IZKA 1ZXMA 2UUAI 3F0NA 4FWGA 1FWKA 4JI5I 2IOQA 1RREA 3ZZUA 1KKHA 2PNMA 4DPYA 2R42A 1MG7A 1IBMI 1FJGE 4JV5E 4DUZI 3K1JA 2X7IA 4LFBE 4JI6E 3D4JA 4P52A 4JI0I 3B8HA 4DR6I 3WU4A 1HNWE 3QT8A 4KHPI 2HKEA 1DARA 4DR5I 4LF9I 2O1UA 4DV4I 4AQYI 1KIJA 2LJPA 1KTVA 3H4LA 4DUYE 3T1YI 4DV3I 2GQ0A 4X64E 4I3HA 4K0KI 2UXBE 4AQYE 2E5LE 4DR5E 4LF9E 1ZXNA 4HYMA 4DV5E 4KHPE 2BM1A 1HNWI 1D6TA 1EI1A 4JI1I 1HK7A 2VQFE 4JI4E 4WUBA 1XNQI 2F4VI 2VQEE 5FLXQ 3J7AG 2OI2A 4LFCE 1Z5BA 5LMNI 1IBLE 1IBLI 1Z0BA 4FW9A 4LFCI 4ED4A 4B3RI 2F4VE 3J81Q 2PNLA 4JI4I 4DV6I 1N32E 1Z0VA 2Z5CA 4HY1A 2V2ZA 1Z59A 4B3SE 2Z5EA 3HULA 2V2QA 2ZBKB 4DV7E 4LFAI 1N34E 3ZZTA 2UUBE 4OX9E 1H74A 4LF7E 2UU9E 4IZJA 5IT9C 1USUA 4JYAE 2UXCE 1J5EI 4DU7A 4DUYI 3T1YE 4LF4E 1Z5AA 2O1TA 2ZITA 1MX0A 1XMOE 1RR9A 4LF5I 4LF6E 4FN5A 4DV2E 5LMUI 4FWHA 3V2UC 4LFBI 4GKKI 1N33E 4JV5I 1IBME 2BM0A 3CWVA 5FWKA 1PKPA 2V34A 4X66E 2ZM6E 4FWDA 1FI4A 2WW4A 2CZ9A 4JI5E 1PIEA 4DPWA 1Z0CA 4JI3I 3PYDA 3Q6MA 5IT9Q 3QT5A 3LNUA 1NHHA 4NXME 3WU3A 4NXNI 5LL6R 3V5RA 4UTGA 2UXDI 4JI7I 4WUDA 4YHHI 4X62I 2AJ4A 2Z5BA 4ZVIA 1NHJA 3Q1QA 3J80C 1PVGA 4Z7YA 2O1VA 4USMA 3QT7A 2UUCE 1HNXI 4X65E 4NXMI 1XMQE 2DEJA 1EA6A 4JI2I 1HNZE 1XNRI 2A2CA 4JI3E 3OTOI 4DV1I 4RPFA 3PYGA 4DPUA 5BR8I 3M6AA 4MYUA 5GMDA 4XTJA 1IBKI 1IBKE 1N0VC 1HR0I 4X66I 2R3VA 4IZJD 2HFUA 4DV0E 2VF3A 1XNRE 1I94I 4LF8E 4USKA 4DPXA 2HK3A 4R1FA 4DPTA 5IWAE 1UEKA 4DR2I 3ZKDA 1HNXE 2HHHE 4LF5E 1XMOI 3LTOA 4B3TI 3PYEA 4HACA 2Q2EB 2Z5BB 1J5EE 4HXZA 3B78A 3QT6A 1H7UA 2HK2A 4JI7E 3T1HI 4P7AA 4EMDA 4LFAE 3JAMQ 3WU5A 1H73A 4B3SI 2XEXA 1FWLA 1S16A 1Z0WA 2O1WA 1ZM9A 1FKAE 4M1KA 4Z7CA 4B3RE 3T1HE 3K17A 1S4EA 2A2DA 1XHKA 1ELOA 2ZM6I 4WUCA 2HFSA 1XNQE 1NZ0A 1N33I 4GKKE 1FNMA 1N36E 4DR2E 5IWAI 3JAMC 4UT4A 1N36I 4LF6I 4DV0I 2E5LI 4LF4I 3PYFA 4K0KE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 I;  2NPF A;  2UU9 I;  4LF7 I;  4DV4 E;  2GS8 A;  2X36 A;  4JG4 A;  1N34 I;  1VIS A;  4DV1 E;  1HNZ I;  4JI0 E;  4KQV A;  1Z0G A;  4JI2 E;  4HAC B;  1ZM4 A;  3J80 Q;  2J7K A;  4MYT A;  4X65 I;  1OJ4 A;  1Z0E A;  3J7A M;  1U2R A;  1A6F A;  5LMN E;  3LPS A;  1ZM3 A;  3GON A;  4X62 E;  4YHH E;  2VQE I;  4B3T E;  2UXD E;  1WUU A;  4NXN E;  4GKJ E;  4DU8 A;  2HHH I;  2VQF I;  5A2Q Q;  2V8P A;  5FLX C;  4JI8 I;  2E1R A;  5A2Q C;  4JI1 E;  1N0U A;  1Z0T A;  1NHI A;  4DR1 E;  1I94 E;  1H7S A;  4LF8 I;  4DV5 I;  4DR4 E;  2UXB I;  1HR0 E;  1K47 A;  3WU6 A;  1ZM2 A;  4YY3 I;  4PRV A;  4DV3 E;  4B3M E;  5BR8 E;  1KVK A;  1Z5C A;  1QZR A;  3OTO E;  4DR6 E;  1B62 A;  4DR3 E;  1BKN A;  1H72 C;  4PU9 A;  4URL A;  4DR7 E;  4DR7 I;  4JI6 I;  5LMU E;  4DUZ E;  4DV2 I;  1XMQ I;  1FJG I;  2UUC I;  4DR3 I;  2HKJ A;  3B82 A;  4B3M I;  3ZZ0 A;  3ZM7 A;  2BV3 A;  2DEI A;  2V2V A;  5GME A;  4JYA I;  2UXC I;  4YY3 E;  3ZKB A;  2EFG A;  5L3J A;  4OX9 I;  2UUB I;  2UUA E;  4DR4 I;  4DV7 I;  4PRX A;  4DR1 I;  4DXL A;  3J81 C;  4JI8 E;  1B63 A;  1MU5 A;  4DV6 E;  1N32 I;  4GKJ I;  1ZXM A;  2UUA I;  3F0N A;  4FWG A;  1FWK A;  4JI5 I;  1RRE A;  3ZZU A;  1KKH A;  4DPY A;  2R42 A;  1MG7 A;  1IBM I;  1FJG E;  4JV5 E;  4DUZ I;  3K1J A;  2X7I A;  4LFB E;  4JI6 E;  3D4J A;  4P52 A;  4JI0 I;  3B8H A;  4DR6 I;  3WU4 A;  1HNW E;  3QT8 A;  4KHP I;  2HKE A;  1DAR A;  4DR5 I;  4LF9 I;  4DV4 I;  4AQY I;  1KIJ A;  2LJP A;  1KTV A;  3H4L A;  4DUY E;  3T1Y I;  4DV3 I;  4X64 E;  4I3H A;  4K0K I;  2UXB E;  4AQY E;  2E5L E;  4DR5 E;  4LF9 E;  1ZXN A;  4HYM A;  4DV5 E;  4KHP E;  2BM1 A;  1HNW I;  1D6T A;  1EI1 A;  4JI1 I;  2VQF E;  4JI4 E;  4WUB A;  1XNQ I;  2F4V I;  2VQE E;  5FLX Q;  3J7A G;  2OI2 A;  4LFC E;  1Z5B A;  5LMN I;  1IBL E;  1IBL I;  1Z0B A;  4FW9 A;  4LFC I;  4ED4 A;  4B3R I;  2F4V E;  3J81 Q;  4JI4 I;  4DV6 I;  1N32 E;  1Z0V A;  4HY1 A;  2V2Z A;  1Z59 A;  4B3S E;  3HUL A;  2V2Q A;  2ZBK B;  4DV7 E;  4LFA I;  1N34 E;  3ZZT A;  2UUB E;  4OX9 E;  1H74 A;  4LF7 E;  2UU9 E;  5IT9 C;  4JYA E;  2UXC E;  1J5E I;  4DU7 A;  4DUY I;  3T1Y E;  4LF4 E;  1Z5A A;  2ZIT A;  1MX0 A;  1XMO E;  1RR9 A;  4LF5 I;  4LF6 E;  4FN5 A;  4DV2 E;  5LMU I;  4FWH A;  3V2U C;  4LFB I;  4GKK I;  1N33 E;  4JV5 I;  1IBM E;  2BM0 A;  3CWV A;  1PKP A;  2V34 A;  4X66 E;  2ZM6 E;  4FWD A;  1FI4 A;  2WW4 A;  2CZ9 A;  4JI5 E;  1PIE A;  4DPW A;  1Z0C A;  4JI3 I;  3PYD A;  5IT9 Q;  3QT5 A;  3LNU A;  1NHH A;  4NXM E;  3WU3 A;  4NXN I;  5LL6 R;  3V5R A;  4UTG A;  2UXD I;  4JI7 I;  4WUD A;  4YHH I;  4X62 I;  2AJ4 A;  4ZVI A;  1NHJ A;  3Q1Q A;  3J80 C;  1PVG A;  4Z7Y A;  4USM A;  3QT7 A;  2UUC E;  1HNX I;  4X65 E;  4NXM I;  1XMQ E;  2DEJ A;  1EA6 A;  4JI2 I;  1HNZ E;  1XNR I;  2A2C A;  4JI3 E;  3OTO I;  4DV1 I;  4RPF A;  3PYG A;  4DPU A;  5BR8 I;  3M6A A;  4MYU A;  5GMD A;  4XTJ A;  1IBK I;  1IBK E;  1N0V C;  1HR0 I;  4X66 I;  2R3V A;  2HFU A;  4DV0 E;  2VF3 A;  1XNR E;  1I94 I;  4LF8 E;  4USK A;  4DPX A;  2HK3 A;  4R1F A;  4DPT A;  5IWA E;  1UEK A;  4DR2 I;  3ZKD A;  1HNX E;  2HHH E;  4LF5 E;  1XMO I;  3LTO A;  4B3T I;  3PYE A;  4HAC A;  2Q2E B;  1J5E E;  4HXZ A;  3B78 A;  3QT6 A;  1H7U A;  2HK2 A;  4JI7 E;  3T1H I;  4P7A A;  4EMD A;  4LFA E;  3JAM Q;  3WU5 A;  1H73 A;  4B3S I;  2XEX A;  1FWL A;  1S16 A;  1Z0W A;  1ZM9 A;  1FKA E;  4M1K A;  4Z7C A;  4B3R E;  3T1H E;  3K17 A;  1S4E A;  2A2D A;  1XHK A;  1ELO A;  2ZM6 I;  4WUC A;  2HFS A;  1XNQ E;  1NZ0 A;  1N33 I;  4GKK E;  1FNM A;  1N36 E;  4DR2 E;  5IWA I;  3JAM C;  4UT4 A;  1N36 I;  4LF6 I;  4DV0 I;  2E5L I;  4LF4 I;  3PYF A;  4K0K E; 
#chains in the Genus database with same CATH topology
 1Y6Z A;  4IZK B;  3M7N G;  4X64 I;  2NPF A;  5C0X B;  2UU9 I;  4LF7 I;  2JEB A;  4DV4 E;  2GS8 A;  2X36 A;  2CGE A;  4JG4 A;  1YHC A;  1N34 I;  1VIS A;  4DV1 E;  5C0X A;  1OYS A;  3PRY A;  1Y5Y A;  1HNZ I;  3K85 A;  4JI0 E;  2Z5C B;  1UDN A;  4KQV A;  4FW3 A;  1Z0G A;  2C38 A;  4JI2 E;  1E3P A;  4HAC B;  1ZM4 A;  3J80 Q;  3PS3 A;  2J7K A;  4MYT A;  4X65 I;  2CG9 A;  2PO2 B;  1OJ4 A;  1Z0E A;  2NN6 D;  3Q6N A;  3J7A M;  1U2R A;  1A6F A;  5LMN E;  3LPS A;  4OO1 C;  1ZM3 A;  3HJC A;  3GON A;  3L7Z B;  1VI7 A;  4X62 E;  4YHH E;  2VQE I;  4B3T E;  2UXD E;  4FW5 A;  5K36 D;  1WUU A;  3CDI A;  4NXN E;  4GKJ E;  4DU8 A;  2HHH I;  2VQF I;  5A2Q Q;  2V8P A;  5FLX C;  4JI8 I;  3CDJ A;  2E1R A;  5A2Q C;  4JI1 E;  1N0U A;  4FW6 A;  1Z0T A;  1NHI A;  5K36 A;  4DR1 E;  1I94 E;  1H7S A;  4LF8 I;  4DV5 I;  4DR4 E;  4LPF A;  2UXB I;  2J65 A;  1HR0 E;  1K47 A;  3WU6 A;  1ZM2 A;  5DRR A;  4PRV A;  4YY3 I;  4DV3 E;  2PNZ B;  4B3M E;  5BR8 E;  1KVK A;  1Z5C A;  2JEA B;  1QZR A;  3OTO E;  4DR6 E;  1B62 A;  4DR3 E;  2GO4 A;  3M7N D;  1P42 A;  1USV A;  1BKN A;  1H72 C;  4PU9 A;  4URL A;  3P06 A;  4DR7 I;  4DR7 E;  4JI6 I;  5LMU E;  5C0X C;  3L7Z A;  4DUZ E;  4DV2 I;  1XMQ I;  1FJG I;  2UUC I;  2NN6 E;  4DR3 I;  4IS9 A;  5C0X F;  2HKJ A;  3B82 A;  4B3M I;  3ZZ0 A;  3ZM7 A;  4FW7 A;  2PO0 B;  2BV3 A;  2DEI A;  2GO3 A;  2V2V A;  5GME A;  4JYA I;  2NN6 F;  2UXC I;  4YY3 E;  3ZKB A;  4GQU A;  2EFG A;  4NBQ A;  5L3J A;  4IZJ B;  5JEA D;  4OX9 I;  2UUB I;  1UDS A;  5JEA B;  2UUA E;  4DR4 I;  5K36 B;  3M85 D;  1Y4S A;  4DV7 I;  4PRX A;  4DR1 I;  4DXL A;  3J81 C;  1Y4U A;  5C0X D;  2O3Z A;  4N3O A;  4JI8 E;  2IOP A;  1B63 A;  1MU5 A;  5ELW A;  4AIM A;  4DV6 E;  1N32 I;  4GKJ I;  4IZK A;  2VES A;  1ZXM A;  2UUA I;  3F0N A;  4OZE A;  4IFD F;  4MQY A;  4LCH A;  4FWG A;  1FWK A;  4JI5 I;  2IOQ A;  2IER A;  2IES A;  1RRE A;  4FW4 A;  3ZZU A;  1KKH A;  2PNM A;  1YH8 A;  4DPY A;  2R42 A;  1MG7 A;  1IBM I;  1FJG E;  4BA2 B;  4JV5 E;  5DNX A;  4DUZ I;  3K1J A;  2X7I A;  4LFB E;  1OYR A;  4JI6 E;  3D4J A;  4P52 A;  4JI0 I;  3B8H A;  4DR6 I;  3WU4 A;  1HNW E;  3QT8 A;  1XXE A;  4KHP I;  2HKE A;  1DAR A;  4DR5 I;  4LF9 I;  2O1U A;  4DV4 I;  4AQY I;  1KIJ A;  2LJP A;  1KTV A;  3H4L A;  4DUY E;  3T1Y I;  1R6M A;  4DV3 I;  2GQ0 A;  4X64 E;  4I3H A;  1RHY A;  4K0K I;  2UXB E;  4AQY E;  2E5L E;  4DR5 E;  4LF9 E;  1ZXN A;  4HYM A;  4DV5 E;  4KHP E;  2BM1 A;  1HNW I;  4IFD E;  1D6T A;  1EI1 A;  3GME A;  4JI1 I;  2JEB B;  1HK7 A;  2VQF E;  4JI4 E;  4WUB A;  3NZK A;  1XNQ I;  2F4V I;  2VQE E;  2JT2 A;  5FLX Q;  3J7A G;  2OI2 A;  4LFC E;  1Z5B A;  5K36 F;  5LMN I;  1IBL E;  1IBL I;  4OO1 F;  4QNK A;  1Z0B A;  4FW9 A;  4LFC I;  5K36 C;  4ED4 A;  4MDT A;  4B3R I;  2F4V E;  3J81 Q;  2PNL A;  3GCM A;  4JI4 I;  4DV6 I;  1N32 E;  1Z0V A;  2Z5C A;  4HY1 A;  5JEA C;  2V2Z A;  1Z59 A;  4B3S E;  2Z5E A;  3HUL A;  2C39 B;  2V2Q A;  2ZBK B;  3U1Y A;  4DV7 E;  4LFA I;  1N34 E;  3ZZT A;  3B4T A;  2UUB E;  4OX9 E;  3GLL A;  1H74 A;  4J3D A;  4LF7 E;  2UU9 E;  4IZJ A;  5IT9 C;  3UHM A;  1USU A;  2WNR B;  4JYA E;  2UXC E;  1J5E I;  4DU7 A;  4DUY I;  3T1Y E;  3U1K A;  4LF4 E;  1Z5A A;  2O1T A;  2ZIT A;  1MX0 A;  1XMO E;  1RR9 A;  4LF5 I;  4LF6 E;  4U3D A;  4LCG A;  4FN5 A;  4LCF A;  5LMU I;  4DV2 E;  4FWH A;  3V2U C;  4LFB I;  4GKK I;  1N33 E;  2CVE A;  4JV5 I;  1IBM E;  2BM0 A;  3CWV A;  5FWK A;  1PKP A;  2V34 A;  2BR2 A;  3PS1 A;  4X66 E;  2ZM6 E;  2C37 A;  4ISA A;  3H1C A;  4FWD A;  1FI4 A;  2WW4 A;  2CZ9 A;  2JE6 B;  3P3G A;  4JI5 E;  1PIE A;  3P76 A;  4OO1 B;  4DPW A;  1Z0C A;  4OO1 D;  2BA0 G;  4JI3 I;  1UDO A;  3PYD A;  3Q6M A;  5IT9 Q;  3QT5 A;  3LNU A;  1NHH A;  4NXM E;  3WU3 A;  4NXN I;  5LL6 R;  4IFD C;  3KRN A;  3V5R A;  4UTG A;  2UXD I;  3P3E A;  4JI7 I;  1OYP A;  5DRQ A;  4WUD A;  4YHH I;  5JEA A;  4X62 I;  1Y60 A;  2AJ4 A;  2Z5B A;  4ZVI A;  1NHJ A;  3Q1Q A;  4BA2 A;  2NN6 C;  3PS2 A;  3J80 C;  1PVG A;  2BA1 D;  4Z7Y A;  4OKG A;  5JEA E;  4MU3 A;  2O1V A;  4USM A;  1E3H A;  3P3C A;  3QT7 A;  1HNX I;  4X65 E;  2UUC E;  1R6L A;  4NXM I;  1XMQ E;  5DNL A;  2DEJ A;  2BA0 D;  1EA6 A;  4QNJ A;  5C0X E;  4JI2 I;  5DRO A;  1HNZ E;  1XNR I;  5EKW A;  2A2C A;  4JI3 E;  3OTO I;  2WP8 B;  4DV1 I;  4RPF A;  3PYG A;  2BA1 G;  4DPU A;  5BR8 I;  3M6A A;  2JEA A;  4MYU A;  5GMD A;  4XTJ A;  1IBK I;  4LOM A;  1IBK E;  1N0V C;  1HR0 I;  2WP8 A;  4X66 I;  4AID A;  2R3V A;  4IZJ D;  2HFU A;  4DV0 E;  4MU4 A;  2VF3 A;  1XNR E;  1I94 I;  4LF8 E;  4USK A;  4DPX A;  2HK3 A;  4R1F A;  2PO0 A;  4DPT A;  5IWA E;  1UEK A;  4DR2 I;  2JE6 A;  3ZKD A;  1HNX E;  2PO2 A;  2HHH E;  4LF5 E;  1XMO I;  3LTO A;  4MU0 A;  2PO1 B;  2BR2 B;  4B3T I;  3PYE A;  4HAC A;  4MU1 A;  2Q2E B;  2Z5B B;  1J5E E;  3M85 G;  4HXZ A;  3B78 A;  3QT6 A;  1H7U A;  2HK2 A;  4JI7 E;  2AE8 A;  3T1H I;  4P7A A;  5DRP A;  4OO1 E;  4EMD A;  4LFA E;  2PNZ A;  2C39 A;  3JAM Q;  4BA1 A;  3WU5 A;  1H73 A;  4AM3 A;  4B3S I;  2XEX A;  4IFD D;  1FWL A;  1S16 A;  1Z0W A;  4OO1 A;  2NN6 A;  3DD6 A;  2C38 B;  2O1W A;  1ZM9 A;  1FKA E;  4BA1 B;  4M1K A;  4Z7C A;  4B3R E;  3T1H E;  3K17 A;  1S4E A;  1UDQ A;  3HKM A;  2C37 B;  4IFD B;  2A2D A;  1XHK A;  1ELO A;  2F1D A;  2ZM6 I;  5K36 E;  4U3B A;  4WUC A;  2HFS A;  1XNQ E;  1NZ0 A;  2PO1 A;  1N33 I;  4IFD A;  4GKK E;  1FNM A;  1N36 E;  4DR2 E;  5IWA I;  3JAM C;  4UT4 A;  5JEA F;  1N36 I;  4LF6 I;  5EL9 A;  4DV0 I;  2NN6 B;  2E5L I;  2WNR A;  4LF4 I;  3PYF A;  4K0K E; 
#chains in the Genus database with same CATH homology
 1Y6Z A;  4IZK B;  4X64 I;  2NPF A;  2UU9 I;  4LF7 I;  4DV4 E;  2GS8 A;  2X36 A;  2CGE A;  4JG4 A;  1N34 I;  1VIS A;  4DV1 E;  3PRY A;  1HNZ I;  3K85 A;  4JI0 E;  2Z5C B;  4KQV A;  1Z0G A;  4JI2 E;  4HAC B;  1ZM4 A;  3J80 Q;  2J7K A;  4MYT A;  4X65 I;  2CG9 A;  1OJ4 A;  1Z0E A;  3Q6N A;  3J7A M;  1U2R A;  1A6F A;  5LMN E;  3LPS A;  1ZM3 A;  3HJC A;  3GON A;  4X62 E;  4YHH E;  2VQE I;  4B3T E;  2UXD E;  1WUU A;  4NXN E;  4GKJ E;  4DU8 A;  2HHH I;  2VQF I;  5A2Q Q;  2V8P A;  5FLX C;  4JI8 I;  2E1R A;  5A2Q C;  4JI1 E;  1N0U A;  1Z0T A;  1NHI A;  4DR1 E;  1I94 E;  1H7S A;  4LF8 I;  4DV5 I;  4DR4 E;  2UXB I;  1HR0 E;  1K47 A;  3WU6 A;  1ZM2 A;  4YY3 I;  4PRV A;  4DV3 E;  4B3M E;  5BR8 E;  1KVK A;  1Z5C A;  1QZR A;  3OTO E;  4DR6 E;  1B62 A;  4DR3 E;  1USV A;  1BKN A;  1H72 C;  4PU9 A;  4URL A;  3P06 A;  4DR7 I;  4DR7 E;  4JI6 I;  5LMU E;  4DUZ E;  4DV2 I;  1XMQ I;  1FJG I;  2UUC I;  4DR3 I;  2HKJ A;  3B82 A;  4B3M I;  3ZZ0 A;  3ZM7 A;  2BV3 A;  2DEI A;  2V2V A;  5GME A;  4JYA I;  2UXC I;  4YY3 E;  3ZKB A;  2EFG A;  5L3J A;  4IZJ B;  4OX9 I;  2UUB I;  2UUA E;  4DR4 I;  1Y4S A;  4DV7 I;  4PRX A;  4DR1 I;  4DXL A;  3J81 C;  1Y4U A;  4N3O A;  4JI8 E;  2IOP A;  1B63 A;  1MU5 A;  4DV6 E;  1N32 I;  4GKJ I;  4IZK A;  1ZXM A;  2UUA I;  3F0N A;  4FWG A;  1FWK A;  4JI5 I;  2IOQ A;  1RRE A;  3ZZU A;  1KKH A;  2PNM A;  4DPY A;  2R42 A;  1MG7 A;  1IBM I;  1FJG E;  4JV5 E;  4DUZ I;  3K1J A;  2X7I A;  4LFB E;  4JI6 E;  3D4J A;  4P52 A;  4JI0 I;  3B8H A;  4DR6 I;  3WU4 A;  1HNW E;  3QT8 A;  4KHP I;  2HKE A;  1DAR A;  4DR5 I;  4LF9 I;  2O1U A;  4DV4 I;  4AQY I;  1KIJ A;  2LJP A;  1KTV A;  3H4L A;  4DUY E;  3T1Y I;  4DV3 I;  2GQ0 A;  4X64 E;  4I3H A;  4K0K I;  2UXB E;  4AQY E;  2E5L E;  4DR5 E;  4LF9 E;  1ZXN A;  4HYM A;  4DV5 E;  4KHP E;  2BM1 A;  1HNW I;  1D6T A;  1EI1 A;  4JI1 I;  1HK7 A;  2VQF E;  4JI4 E;  4WUB A;  1XNQ I;  2F4V I;  2VQE E;  5FLX Q;  3J7A G;  2OI2 A;  4LFC E;  1Z5B A;  5LMN I;  1IBL E;  1IBL I;  1Z0B A;  4FW9 A;  4LFC I;  4ED4 A;  4B3R I;  2F4V E;  3J81 Q;  2PNL A;  4JI4 I;  4DV6 I;  1N32 E;  1Z0V A;  2Z5C A;  4HY1 A;  2V2Z A;  1Z59 A;  4B3S E;  2Z5E A;  3HUL A;  2V2Q A;  2ZBK B;  4DV7 E;  4LFA I;  1N34 E;  3ZZT A;  2UUB E;  4OX9 E;  1H74 A;  4LF7 E;  2UU9 E;  4IZJ A;  5IT9 C;  1USU A;  4JYA E;  2UXC E;  1J5E I;  4DU7 A;  4DUY I;  3T1Y E;  4LF4 E;  1Z5A A;  2O1T A;  2ZIT A;  1MX0 A;  1XMO E;  1RR9 A;  4LF5 I;  4LF6 E;  4FN5 A;  4DV2 E;  5LMU I;  4FWH A;  3V2U C;  4LFB I;  4GKK I;  1N33 E;  4JV5 I;  1IBM E;  2BM0 A;  3CWV A;  5FWK A;  1PKP A;  2V34 A;  4X66 E;  2ZM6 E;  4FWD A;  1FI4 A;  2WW4 A;  2CZ9 A;  4JI5 E;  1PIE A;  4DPW A;  1Z0C A;  4JI3 I;  3PYD A;  3Q6M A;  5IT9 Q;  3QT5 A;  3LNU A;  1NHH A;  4NXM E;  3WU3 A;  4NXN I;  5LL6 R;  3V5R A;  4UTG A;  2UXD I;  4JI7 I;  4WUD A;  4YHH I;  4X62 I;  2AJ4 A;  2Z5B A;  4ZVI A;  1NHJ A;  3Q1Q A;  3J80 C;  1PVG A;  4Z7Y A;  2O1V A;  4USM A;  3QT7 A;  2UUC E;  1HNX I;  4X65 E;  4NXM I;  1XMQ E;  2DEJ A;  1EA6 A;  4JI2 I;  1HNZ E;  1XNR I;  2A2C A;  4JI3 E;  3OTO I;  4DV1 I;  4RPF A;  3PYG A;  4DPU A;  5BR8 I;  3M6A A;  4MYU A;  5GMD A;  4XTJ A;  1IBK I;  1IBK E;  1N0V C;  1HR0 I;  4X66 I;  2R3V A;  4IZJ D;  2HFU A;  4DV0 E;  2VF3 A;  1XNR E;  1I94 I;  4LF8 E;  4USK A;  4DPX A;  2HK3 A;  4R1F A;  4DPT A;  5IWA E;  1UEK A;  4DR2 I;  3ZKD A;  1HNX E;  2HHH E;  4LF5 E;  1XMO I;  3LTO A;  4B3T I;  3PYE A;  4HAC A;  2Q2E B;  2Z5B B;  1J5E E;  4HXZ A;  3B78 A;  3QT6 A;  1H7U A;  2HK2 A;  4JI7 E;  3T1H I;  4P7A A;  4EMD A;  4LFA E;  3JAM Q;  3WU5 A;  1H73 A;  4B3S I;  2XEX A;  1FWL A;  1S16 A;  1Z0W A;  2O1W A;  1ZM9 A;  1FKA E;  4M1K A;  4Z7C A;  4B3R E;  3T1H E;  3K17 A;  1S4E A;  2A2D A;  1XHK A;  1ELO A;  2ZM6 I;  4WUC A;  2HFS A;  1XNQ E;  1NZ0 A;  1N33 I;  4GKK E;  1FNM A;  1N36 E;  4DR2 E;  5IWA I;  3JAM C;  4UT4 A;  1N36 I;  4LF6 I;  4DV0 I;  2E5L I;  4LF4 I;  3PYF A;  4K0K E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...