3WU3A

Reduced-form structure of e.coli lon proteolytic domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
190
Chain Sequence
YGRADNENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLALQNEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lon protease
publication title A redox switch shapes the Lon protease exit pore to facultatively regulate proteolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 63
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2014-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3wu3A01
1J5EI 3LNUA 2BM0A 2Q2EB 4LF5I 4YHHI 4WUDA 2UUBE 4DV1E 2UXBI 5GMDA 2HFUA 3Q1QA 1A6FA 1XNQI 4LF9E 4JI1E 1KVKA 4KQVA 1FJGE 1H7UA 1Z0WA 4JI2I 4JI6E 4LF8E 4ED4A 1FI4A 4GKJE 5GMEA 2E5LE 1D6TA 4JI3E 4UTGA 4JI0E 4DV5E 1N36I 2UU9I 4DR3E 4DV4E 4PRXA 4X64E 1Z5AA 1IBME 4OX9I 4DUYE 1Z5CA 4USMA 2F4VE 4LF7E 3ZKDA 2DEIA 1ZM3A 4DPXA 1NZ0A 3T1HE 4B3TI 4MYUA 3JAMC 4ZVIA 1ZM9A 5A2QQ 1XMQI 4AQYE 1N0UA 4DV6I 2X7IA 1Z0TA 4JI5I 4B3MI 4DV3I 1XNRI 5L3JA 3H4LA 4LF6E 1B63A 4FWGA 2VQFI 1KKHA 4DR6I 1MU5A 3GONA 1XMOI 3J80Q 3T1YE 4MYTA 1HNWI 5IT9C 2UUAI 3QT8A 4DU8A 3PYGA 4DR2E 4B3SE 1Z0CA 2UUCE 4FW9A 4DR4I 1BKNA 3CWVA 1WUUA 2HKJA 2UXDE 4DUZE 4EMDA 3K1JA 4WUBA 1ZM4A 2VF3A 5FLXC 1ZXNA 5LL6R 2UXCI 1N33E 4JYAE 4JI8I 1HNXE 4LFBE 2ZITA 1RR9A 1NHJA 2NPFA 1KIJA 4DPTA 3JAMQ 4LFCI 1J5EE 1RREA 4DR5I 4YY3I 4LF5E 1PVGA 3J81Q 4USKA 2HK2A 4B3RI 1H72C 3LTOA 1Z0VA 3WU6A 4JV5I 1ZXMA 4GKKE 1N36E 2UU9E 2EFGA 3F0NA 5IWAI 1S16A 4OX9E 1QZRA 4DXLA 4LF4I 3HULA 3M6AA 4B3TE 2HHHI 3ZKBA 1XMQE 4X65I 2V2QA 4JI4I 3V5RA 1HR0I 1MG7A 4X62I 3B78A 4DV6E 4K0KI 4PU9A 4JI5E 4B3ME 2ZBKB 4X66I 4DV3E 3QT5A 4LF9I 2R3VA 1XNRE 1NHIA 4JI6I 4PRVA 3ZZUA 4FN5A 4DR1I 4DR7I 2VQFE 2A2CA 4DR6E 1XMOE 2VQEI 1N32I 1FKAE 1N34I 3D4JA 2V34A 4DV5I 2BV3A 2CZ9A 2HKEA 2F4VI 2HFSA 1MX0A 1UEKA 3K17A 4DR4E 2V2ZA 4P52A 4R1FA 1PKPA 4M1KA 4DPUA 4HACB 1DARA 2X36A 4NXMI 3B8HA 4DV2I 3WU4A 2ZM6I 2E1RA 4NXNI 1I94I 2UXCE 4DV7I 2HK3A 1FWLA 3OTOI 3ZZTA 2GS8A 5LMNI 4DR5E 4YY3E 1H7SA 4LFAI 3ZZ0A 2BM1A 1B62A 1H73A 4B3RE 1Z0GA 2XEXA 4DV0I 1FWKA 1Z59A 2WW4A 1IBKI 2UUCI 4JV5E 1XHKA 4YHHE 4HYMA 2UXBE 4Z7CA 1XNQE 4JI7I 5BR8I 2UXDI 1IBLI 5IWAE 4FWDA 4KHPI 4JI2E 1HNZI 5LMUI 3J7AG 3ZM7A 4Z7YA 3WU3A 2HHHE 1U2RA 3WU5A 1N33I 4JYAI 1S4EA 4X65E 1OJ4A 2R42A 5IT9Q 4JI4E 1Z5BA 4RPFA 1ZM2A 4JG4A 1KTVA 2V8PA 4X62E 4K0KE 4X66E 3LPSA 2DEJA 4DR1E 4DR7E 3QT6A 3PYFA 3V2UC 2VQEE 2UUBI 4DV1I 5FLXQ 1N32E 1N34E 4GKKI 4URLA 1K47A 4JI1I 4HACA 1FJGI 4I3HA 1VISA 4LF8I 2J7KA 4HY1A 4GKJI 2E5LI 1FNMA 1HNWE 2UUAE 4JI3I 3B82A 4JI0I 4WUCA 1EI1A 4DV4I 4DR3I 4X64I 2V2VA 1IBMI 4DUYI 4NXME 4LF7I 3J81C 4DV2E 2ZM6E 4DPWA 4NXNE 1I94E 3J7AM 4DV7E 3PYDA 3T1HI 1PIEA 3OTOE 4AQYI 5LMNE 4LFAE 4JI8E 4DV0E 4LFCE 4LF6I 1IBKE 4XTJA 2OI2A 3PYEA 2LJPA 2AJ4A 4JI7E 5BR8E 1EA6A 3T1YI 1IBLE 4FWHA 4KHPE 4UT4A 1HNZE 4B3SI 4DR2I 5LMUE 5A2QC 4P7AA 4DUZI 4DU7A 1ELOA 4LF4E 3QT7A 1Z0BA 4HXZA 1N0VC 1Z0EA 1H74A 4DPYA 1HNXI 4LFBI 2A2DA 3J80C 1NHHA 1HR0E
chains in the Genus database with same CATH superfamily
1UDSA 1J5EI 2PO2A 4IZJD 3LNUA 2BM0A 2Q2EB 4LF5I 4YHHI 4WUDA 2UUBE 4DV1E 2UXBI 5GMDA 2HFUA 3Q1QA 1A6FA 1XNQI 4LF9E 2WNRB 4JI1E 1KVKA 4KQVA 1FJGE 1H7UA 1Z0WA 4JI2I 4JI6E 4LF8E 5DROA 4ED4A 4MU3A 1FI4A 1UDNA 4GKJE 5GMEA 2E5LE 1D6TA 4IFDE 3PS2A 4JI3E 3M85G 4OO1E 4UTGA 4JI0E 2NN6C 2O1WA 4DV5E 1N36I 4DR3E 4DV4E 2UU9I 4PRXA 5JEAE 4X64E 2BR2A 3DD6A 1Z5AA 1IBME 4OX9I 4DUYE 1Z5CA 4USMA 2F4VE 4LF7E 3ZKDA 2C39B 2DEIA 1ZM3A 4DPXA 4IZKA 2GO4A 1NZ0A 1R6LA 2JEBA 3T1HE 4B3TI 4MYUA 3JAMC 4ZVIA 1ZM9A 5DRQA 5A2QQ 1XMQI 4AQYE 4J3DA 1N0UA 2IERA 4DV6I 2X7IA 1Z0TA 4JI5I 4B3MI 5FWKA 4DV3I 2Z5EA 1XNRI 5L3JA 3H4LA 4LF6E 2NN6D 5C0XA 2PNMA 1B63A 4FWGA 2VQFI 1KKHA 4DR6I 1MU5A 3GONA 1XMOI 3J80Q 3T1YE 4MYTA 1HNWI 3H1CA 5IT9C 2UUAI 2PO0A 5K36C 3QT8A 4DU8A 3PYGA 4DR2E 4B3SE 1Z0CA 2UUCE 4FW9A 4QNKA 5EL9A 4DR4I 1BKNA 3CWVA 1E3PA 5ELWA 1WUUA 2HKJA 1RHYA 2UXDE 5JEAB 4FW7A 4DUZE 4EMDA 1Y5YA 3K1JA 1E3HA 5C0XB 1HK7A 4WUBA 1ZM4A 1YH8A 2VF3A 5FLXC 1ZXNA 5LL6R 2UXCI 1N33E 4JYAE 2JT2A 4JI8I 1HNXE 5DRPA 2Z5BB 4LFBE 2ZITA 1RR9A 4ISAA 1NHJA 2WNRA 1KIJA 3KRNA 2NPFA 4DPTA 3JAMQ 4LFCI 1J5EE 1RREA 1Y4UA 4DR5I 2VESA 4YY3I 3PS1A 4LF5E 5K36D 1PVGA 3J81Q 4USKA 2HK2A 4B3RI 4IS9A 1H72C 3LTOA 1Z0VA 3WU6A 4BA2B 4JV5I 2BA0G 4U3DA 2PNZB 1ZXMA 4GKKE 2C39A 3M85D 1N36E 2UU9E 2EFGA 3F0NA 5IWAI 1S16A 2CVEA 2JEAB 4OX9E 1QZRA 4DXLA 1P42A 3B4TA 4QNJA 4LF4I 2C37A 3HULA 2WP8B 3M6AA 4B3TE 2HHHI 1XXEA 5DRRA 3ZKBA 5EKWA 1XMQE 2PO1B 4X65I 2V2QA 2NN6E 4JI4I 1OYSA 3V5RA 1HR0I 1MG7A 4FW5A 4X62I 3B78A 4DV6E 4K0KI 4PU9A 5C0XC 4JI5E 4B3ME 2ZBKB 4X66I 4DV3E 4OO1F 3QT5A 4LF9I 4NBQA 2R3VA 1XNRE 5JEAF 1NHIA 4U3BA 2C37B 4JI6I 4PRVA 3P06A 3ZZUA 4FN5A 4DR1I 4DR7I 5C0XF 2VQFE 2A2CA 4DR6E 4LCHA 1XMOE 4IFDA 2VQEI 4OO1A 1N32I 1FKAE 1N34I 3D4JA 2V34A 4DV5I 5JEAA 2BV3A 3Q6MA 3HJCA 2CZ9A 2HKEA 2F4VI 2HFSA 1MX0A 1UEKA 3K17A 4DR4E 2V2ZA 4P52A 4R1FA 2AE8A 1PKPA 4M1KA 4DPUA 3UHMA 4HACB 4LPFA 1DARA 2X36A 2Z5BA 1OYRA 4AIMA 1USUA 4NXMI 3B8HA 4DV2I 3WU4A 5C0XD 2ZM6I 4MDTA 4IFDB 2E1RA 5K36E 4OO1B 4MU1A 4NXNI 1I94I 2UXCE 3Q6NA 4DV7I 2HK3A 1FWLA 3CDJA 4BA1B 3OTOI 2Z5CB 3ZZTA 3P76A 2NN6B 3P3EA 2GS8A 5LMNI 4DR5E 4YY3E 1H7SA 4OZEA 4BA2A 4LFAI 3ZZ0A 2BM1A 1B62A 2IESA 2PNZA 3PRYA 2F1DA 1H73A 4B3RE 1Z0GA 2XEXA 2JEAA 4DV0I 1FWKA 1Z59A 2WW4A 1IBKI 2UUCI 1USVA 4JV5E 1XHKA 2BA1G 2BA0D 3GCMA 4HYMA 4YHHE 2UXBE 4Z7CA 2IOQA 4JI7I 5BR8I 1XNQE 2UXDI 2WP8A 1IBLI 5IWAE 4FWDA 4KHPI 4JI2E 1HNZI 2PO1A 4FW3A 5LMUI 2JE6B 3J7AG 3ZM7A 4Z7YA 3M7NG 3WU3A 2HHHE 1U2RA 3L7ZB 3WU5A 1N33I 4JYAI 1S4EA 4X65E 1OJ4A 2R42A 5IT9Q 4JI4E 1Z5BA 5K36B 3HKMA 4RPFA 1ZM2A 2O1TA 4JG4A 1KTVA 2V8PA 3GLLA 4X62E 4K0KE 3P3GA 4X66E 2GO3A 3LPSA 4IFDC 4IZJB 3CDIA 4OO1C 2O3ZA 2DEJA 4DR1E 4DR7E 2C38A 3QT6A 5JEAC 3PYFA 1OYPA 4FW6A 3V2UC 2VQEE 2UUBI 4DV1I 5FLXQ 1N32E 4IFDF 1N34E 4GKKI 4URLA 4LCGA 1K47A 4JI1I 1VI7A 4HACA 1FJGI 1Y4SA 4I3HA 1VISA 2PO2B 4LF8I 5C0XE 2J7KA 4HY1A 4GKJI 4FW4A 2E5LI 1FNMA 2O1UA 2NN6F 1HNWE 2UUAE 1UDQA 4JI3I 3B82A 5DNLA 4JI0I 4WUCA 1EI1A 4DV4I 4DR3I 4X64I 2V2VA 2C38B 1IBMI 4DUYI 4BA1A 4NXME 2Z5CA 4LF7I 3J81C 4DV2E 2ZM6E 2NN6A 4DPWA 4NXNE 1I94E 4LOMA 3J7AM 4IFDD 4DV7E 3PYDA 3T1HI 2BR2B 4OO1D 1PIEA 5JEAD 3OTOE 3NZKA 1Y6ZA 4AQYI 5LMNE 2CGEA 1UDOA 4AM3A 4IZKB 3U1YA 2JEBB 4LFAE 2O1VA 4JI8E 3K85A 2GQ0A 1Y60A 4DV0E 4LFCE 2PNLA 4LF6I 1IBKE 4XTJA 2OI2A 3GMEA 2BA1D 3PYEA 2LJPA 2JE6A 2CG9A 4MQYA 2AJ4A 4JI7E 5BR8E 1EA6A 3T1YI 1IBLE 5K36F 3U1KA 3L7ZA 4FWHA 4KHPE 4GQUA 4UT4A 1HNZE 4MU0A 2IOPA 4DR2I 4B3SI 2J65A 5DNXA 5LMUE 1YHCA 5A2QC 5K36A 3M7ND 4P7AA 2PO0B 1R6MA 4DUZI 4DU7A 4AIDA 1ELOA 4IZJA 3QT7A 4HXZA 1Z0BA 4LF4E 1N0VC 4N3OA 1Z0EA 3PS3A 4MU4A 1H74A 4LCFA 4DPYA 1HNXI 4LFBI 4OKGA 2A2DA 3P3CA 3J80C 1NHHA 1HR0E
chains in the Genus database with same CATH topology
1J5EI 4IZJD 3LNUA 2BM0A 2Q2EB 4LF5I 4YHHI 4WUDA 2UUBE 4DV1E 2UXBI 5GMDA 2HFUA 3Q1QA 1A6FA 1XNQI 4LF9E 4JI1E 1KVKA 4KQVA 1FJGE 1H7UA 1Z0WA 4JI2I 4JI6E 4LF8E 4ED4A 1FI4A 4GKJE 5GMEA 2E5LE 1D6TA 4JI3E 4UTGA 4JI0E 2O1WA 4DV5E 1N36I 2UU9I 4DR3E 4DV4E 4PRXA 4X64E 1Z5AA 1IBME 4OX9I 4DUYE 1Z5CA 4USMA 2F4VE 4LF7E 3ZKDA 2DEIA 1ZM3A 4DPXA 4IZKA 1NZ0A 3T1HE 4B3TI 4MYUA 3JAMC 4ZVIA 1ZM9A 5A2QQ 1XMQI 4AQYE 1N0UA 4DV6I 2X7IA 1Z0TA 4JI5I 4B3MI 5FWKA 4DV3I 2Z5EA 1XNRI 5L3JA 3H4LA 4LF6E 2PNMA 1B63A 4FWGA 2VQFI 1KKHA 4DR6I 1MU5A 3GONA 1XMOI 3J80Q 3T1YE 4MYTA 1HNWI 5IT9C 2UUAI 3QT8A 4DU8A 3PYGA 4DR2E 4B3SE 1Z0CA 2UUCE 4FW9A 4DR4I 1BKNA 3CWVA 1WUUA 2HKJA 2UXDE 4DUZE 4EMDA 3K1JA 1HK7A 4WUBA 1ZM4A 2VF3A 5FLXC 1ZXNA 5LL6R 2UXCI 1N33E 4JYAE 4JI8I 1HNXE 2Z5BB 4LFBE 2ZITA 1RR9A 1NHJA 2NPFA 1KIJA 4DPTA 3JAMQ 4LFCI 1J5EE 1RREA 1Y4UA 4DR5I 4YY3I 4LF5E 1PVGA 3J81Q 4USKA 2HK2A 4B3RI 1H72C 3LTOA 1Z0VA 3WU6A 4JV5I 1ZXMA 4GKKE 1N36E 2UU9E 2EFGA 3F0NA 5IWAI 1S16A 4OX9E 1QZRA 4DXLA 4LF4I 3HULA 3M6AA 4B3TE 2HHHI 3ZKBA 1XMQE 4X65I 2V2QA 4JI4I 3V5RA 1HR0I 1MG7A 4X62I 3B78A 4DV6E 4K0KI 4PU9A 4JI5E 4B3ME 2ZBKB 4X66I 4DV3E 3QT5A 4LF9I 2R3VA 1XNRE 1NHIA 4JI6I 4PRVA 3P06A 3ZZUA 4FN5A 4DR1I 4DR7I 2VQFE 2A2CA 4DR6E 1XMOE 2VQEI 1N32I 1FKAE 1N34I 3D4JA 2V34A 4DV5I 2BV3A 3Q6MA 3HJCA 2CZ9A 2HKEA 2F4VI 2HFSA 1MX0A 1UEKA 3K17A 4DR4E 2V2ZA 4P52A 4R1FA 1PKPA 4M1KA 4DPUA 4HACB 1DARA 2X36A 2Z5BA 4NXMI 1USUA 3B8HA 4DV2I 3WU4A 2ZM6I 2E1RA 4NXNI 1I94I 2UXCE 3Q6NA 4DV7I 2HK3A 1FWLA 3OTOI 2Z5CB 3ZZTA 2GS8A 5LMNI 4DR5E 4YY3E 1H7SA 4LFAI 3ZZ0A 2BM1A 1B62A 3PRYA 1H73A 4B3RE 1Z0GA 2XEXA 4DV0I 1FWKA 1Z59A 2WW4A 1IBKI 2UUCI 1USVA 4JV5E 1XHKA 4YHHE 4HYMA 2UXBE 4Z7CA 2IOQA 4JI7I 5BR8I 1XNQE 2UXDI 1IBLI 5IWAE 4FWDA 4KHPI 4JI2E 1HNZI 5LMUI 3J7AG 3ZM7A 4Z7YA 3WU3A 2HHHE 1U2RA 3WU5A 1N33I 4JYAI 1S4EA 4X65E 1OJ4A 2R42A 5IT9Q 4JI4E 1Z5BA 4RPFA 1ZM2A 2O1TA 4JG4A 1KTVA 2V8PA 4X62E 4K0KE 4X66E 3LPSA 4IZJB 2DEJA 4DR1E 4DR7E 3QT6A 3PYFA 3V2UC 2VQEE 2UUBI 4DV1I 5FLXQ 1N32E 1N34E 4GKKI 4URLA 1K47A 4JI1I 4HACA 1FJGI 1Y4SA 4I3HA 1VISA 4LF8I 2J7KA 4HY1A 4GKJI 2E5LI 1FNMA 2O1UA 1HNWE 2UUAE 4JI3I 3B82A 4JI0I 4WUCA 1EI1A 4DV4I 4DR3I 4X64I 2V2VA 1IBMI 4DUYI 4NXME 2Z5CA 4LF7I 3J81C 4DV2E 2ZM6E 4DPWA 4NXNE 1I94E 3J7AM 4DV7E 3PYDA 3T1HI 1PIEA 3OTOE 1Y6ZA 4AQYI 5LMNE 2CGEA 4IZKB 4LFAE 2O1VA 4JI8E 3K85A 2GQ0A 4DV0E 4LFCE 2PNLA 4LF6I 1IBKE 4XTJA 2OI2A 3PYEA 2LJPA 2CG9A 2AJ4A 4JI7E 5BR8E 1EA6A 3T1YI 1IBLE 4FWHA 4KHPE 4UT4A 1HNZE 2IOPA 4DR2I 4B3SI 5LMUE 5A2QC 4P7AA 4DUZI 4DU7A 1ELOA 4IZJA 3QT7A 1Z0BA 4HXZA 4LF4E 1N0VC 4N3OA 1Z0EA 1H74A 4DPYA 1HNXI 4LFBI 2A2DA 3J80C 1NHHA 1HR0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E I;  3LNU A;  2BM0 A;  2Q2E B;  4LF5 I;  4YHH I;  4WUD A;  2UUB E;  4DV1 E;  2UXB I;  5GMD A;  2HFU A;  3Q1Q A;  1A6F A;  1XNQ I;  4LF9 E;  4JI1 E;  1KVK A;  4KQV A;  1FJG E;  1H7U A;  1Z0W A;  4JI2 I;  4JI6 E;  4LF8 E;  4ED4 A;  1FI4 A;  4GKJ E;  5GME A;  2E5L E;  1D6T A;  4JI3 E;  4UTG A;  4JI0 E;  4DV5 E;  1N36 I;  2UU9 I;  4DR3 E;  4DV4 E;  4PRX A;  4X64 E;  1Z5A A;  1IBM E;  4OX9 I;  4DUY E;  1Z5C A;  4USM A;  2F4V E;  4LF7 E;  3ZKD A;  2DEI A;  1ZM3 A;  4DPX A;  1NZ0 A;  3T1H E;  4B3T I;  4MYU A;  3JAM C;  4ZVI A;  1ZM9 A;  5A2Q Q;  1XMQ I;  4AQY E;  1N0U A;  4DV6 I;  2X7I A;  1Z0T A;  4JI5 I;  4B3M I;  4DV3 I;  1XNR I;  5L3J A;  3H4L A;  4LF6 E;  1B63 A;  4FWG A;  2VQF I;  1KKH A;  4DR6 I;  1MU5 A;  3GON A;  1XMO I;  3J80 Q;  3T1Y E;  4MYT A;  1HNW I;  5IT9 C;  2UUA I;  3QT8 A;  4DU8 A;  3PYG A;  4DR2 E;  4B3S E;  1Z0C A;  2UUC E;  4FW9 A;  4DR4 I;  1BKN A;  3CWV A;  1WUU A;  2HKJ A;  2UXD E;  4DUZ E;  4EMD A;  3K1J A;  4WUB A;  1ZM4 A;  2VF3 A;  5FLX C;  1ZXN A;  5LL6 R;  2UXC I;  1N33 E;  4JYA E;  4JI8 I;  1HNX E;  4LFB E;  2ZIT A;  1RR9 A;  1NHJ A;  2NPF A;  1KIJ A;  4DPT A;  3JAM Q;  4LFC I;  1J5E E;  1RRE A;  4DR5 I;  4YY3 I;  4LF5 E;  1PVG A;  3J81 Q;  4USK A;  2HK2 A;  4B3R I;  1H72 C;  3LTO A;  1Z0V A;  3WU6 A;  4JV5 I;  1ZXM A;  4GKK E;  1N36 E;  2UU9 E;  2EFG A;  3F0N A;  5IWA I;  1S16 A;  4OX9 E;  1QZR A;  4DXL A;  4LF4 I;  3HUL A;  3M6A A;  4B3T E;  2HHH I;  3ZKB A;  1XMQ E;  4X65 I;  2V2Q A;  4JI4 I;  3V5R A;  1HR0 I;  1MG7 A;  4X62 I;  3B78 A;  4DV6 E;  4K0K I;  4PU9 A;  4JI5 E;  4B3M E;  2ZBK B;  4X66 I;  4DV3 E;  3QT5 A;  4LF9 I;  2R3V A;  1XNR E;  1NHI A;  4JI6 I;  4PRV A;  3ZZU A;  4FN5 A;  4DR1 I;  4DR7 I;  2VQF E;  2A2C A;  4DR6 E;  1XMO E;  2VQE I;  1N32 I;  1FKA E;  1N34 I;  3D4J A;  2V34 A;  4DV5 I;  2BV3 A;  2CZ9 A;  2HKE A;  2F4V I;  2HFS A;  1MX0 A;  1UEK A;  3K17 A;  4DR4 E;  2V2Z A;  4P52 A;  4R1F A;  1PKP A;  4M1K A;  4DPU A;  4HAC B;  1DAR A;  2X36 A;  4NXM I;  3B8H A;  4DV2 I;  3WU4 A;  2ZM6 I;  2E1R A;  4NXN I;  1I94 I;  2UXC E;  4DV7 I;  2HK3 A;  1FWL A;  3OTO I;  3ZZT A;  2GS8 A;  5LMN I;  4DR5 E;  4YY3 E;  1H7S A;  4LFA I;  3ZZ0 A;  2BM1 A;  1B62 A;  1H73 A;  4B3R E;  1Z0G A;  2XEX A;  4DV0 I;  1FWK A;  1Z59 A;  2WW4 A;  1IBK I;  2UUC I;  4JV5 E;  1XHK A;  4YHH E;  4HYM A;  2UXB E;  4Z7C A;  1XNQ E;  4JI7 I;  5BR8 I;  2UXD I;  1IBL I;  5IWA E;  4FWD A;  4KHP I;  4JI2 E;  1HNZ I;  5LMU I;  3J7A G;  3ZM7 A;  4Z7Y A;  3WU3 A;  2HHH E;  1U2R A;  3WU5 A;  1N33 I;  4JYA I;  1S4E A;  4X65 E;  1OJ4 A;  2R42 A;  5IT9 Q;  4JI4 E;  1Z5B A;  4RPF A;  1ZM2 A;  4JG4 A;  1KTV A;  2V8P A;  4X62 E;  4K0K E;  4X66 E;  3LPS A;  2DEJ A;  4DR1 E;  4DR7 E;  3QT6 A;  3PYF A;  3V2U C;  2VQE E;  2UUB I;  4DV1 I;  5FLX Q;  1N32 E;  1N34 E;  4GKK I;  4URL A;  1K47 A;  4JI1 I;  4HAC A;  1FJG I;  4I3H A;  1VIS A;  4LF8 I;  2J7K A;  4HY1 A;  4GKJ I;  2E5L I;  1FNM A;  1HNW E;  2UUA E;  4JI3 I;  3B82 A;  4JI0 I;  4WUC A;  1EI1 A;  4DV4 I;  4DR3 I;  4X64 I;  2V2V A;  1IBM I;  4DUY I;  4NXM E;  4LF7 I;  3J81 C;  4DV2 E;  2ZM6 E;  4DPW A;  4NXN E;  1I94 E;  3J7A M;  4DV7 E;  3PYD A;  3T1H I;  1PIE A;  3OTO E;  4AQY I;  5LMN E;  4LFA E;  4JI8 E;  4DV0 E;  4LFC E;  4LF6 I;  1IBK E;  4XTJ A;  2OI2 A;  3PYE A;  2LJP A;  2AJ4 A;  4JI7 E;  5BR8 E;  1EA6 A;  3T1Y I;  1IBL E;  4FWH A;  4KHP E;  4UT4 A;  1HNZ E;  4B3S I;  4DR2 I;  5LMU E;  5A2Q C;  4P7A A;  4DUZ I;  4DU7 A;  1ELO A;  4LF4 E;  3QT7 A;  1Z0B A;  4HXZ A;  1N0V C;  1Z0E A;  1H74 A;  4DPY A;  1HNX I;  4LFB I;  2A2D A;  3J80 C;  1NHH A;  1HR0 E; 
#chains in the Genus database with same CATH topology
 1UDS A;  1J5E I;  2PO2 A;  4IZJ D;  3LNU A;  2BM0 A;  2Q2E B;  4LF5 I;  4YHH I;  4WUD A;  2UUB E;  4DV1 E;  2UXB I;  5GMD A;  2HFU A;  3Q1Q A;  1A6F A;  1XNQ I;  4LF9 E;  2WNR B;  4JI1 E;  1KVK A;  4KQV A;  1FJG E;  1H7U A;  1Z0W A;  4JI2 I;  4JI6 E;  4LF8 E;  5DRO A;  4ED4 A;  4MU3 A;  1FI4 A;  1UDN A;  4GKJ E;  5GME A;  2E5L E;  1D6T A;  4IFD E;  3PS2 A;  4JI3 E;  3M85 G;  4OO1 E;  4UTG A;  4JI0 E;  2NN6 C;  2O1W A;  4DV5 E;  1N36 I;  4DR3 E;  4DV4 E;  2UU9 I;  4PRX A;  5JEA E;  4X64 E;  2BR2 A;  3DD6 A;  1Z5A A;  1IBM E;  4OX9 I;  4DUY E;  1Z5C A;  4USM A;  2F4V E;  4LF7 E;  3ZKD A;  2C39 B;  2DEI A;  1ZM3 A;  4DPX A;  4IZK A;  2GO4 A;  1NZ0 A;  1R6L A;  2JEB A;  3T1H E;  4B3T I;  4MYU A;  3JAM C;  4ZVI A;  1ZM9 A;  5DRQ A;  5A2Q Q;  1XMQ I;  4AQY E;  4J3D A;  1N0U A;  2IER A;  4DV6 I;  2X7I A;  1Z0T A;  4JI5 I;  4B3M I;  5FWK A;  4DV3 I;  2Z5E A;  1XNR I;  5L3J A;  3H4L A;  4LF6 E;  2NN6 D;  5C0X A;  2PNM A;  1B63 A;  4FWG A;  2VQF I;  1KKH A;  4DR6 I;  1MU5 A;  3GON A;  1XMO I;  3J80 Q;  3T1Y E;  4MYT A;  1HNW I;  3H1C A;  5IT9 C;  2UUA I;  2PO0 A;  5K36 C;  3QT8 A;  4DU8 A;  3PYG A;  4DR2 E;  4B3S E;  1Z0C A;  2UUC E;  4FW9 A;  4QNK A;  5EL9 A;  4DR4 I;  1BKN A;  3CWV A;  1E3P A;  5ELW A;  1WUU A;  2HKJ A;  1RHY A;  2UXD E;  5JEA B;  4FW7 A;  4DUZ E;  4EMD A;  1Y5Y A;  3K1J A;  1E3H A;  5C0X B;  1HK7 A;  4WUB A;  1ZM4 A;  1YH8 A;  2VF3 A;  5FLX C;  1ZXN A;  5LL6 R;  2UXC I;  1N33 E;  4JYA E;  2JT2 A;  4JI8 I;  1HNX E;  5DRP A;  2Z5B B;  4LFB E;  2ZIT A;  1RR9 A;  4ISA A;  1NHJ A;  2WNR A;  1KIJ A;  3KRN A;  2NPF A;  4DPT A;  3JAM Q;  4LFC I;  1J5E E;  1RRE A;  1Y4U A;  4DR5 I;  2VES A;  4YY3 I;  3PS1 A;  4LF5 E;  5K36 D;  1PVG A;  3J81 Q;  4USK A;  2HK2 A;  4B3R I;  4IS9 A;  1H72 C;  3LTO A;  1Z0V A;  3WU6 A;  4BA2 B;  4JV5 I;  2BA0 G;  4U3D A;  2PNZ B;  1ZXM A;  4GKK E;  2C39 A;  3M85 D;  1N36 E;  2UU9 E;  2EFG A;  3F0N A;  5IWA I;  1S16 A;  2CVE A;  2JEA B;  4OX9 E;  1QZR A;  4DXL A;  1P42 A;  3B4T A;  4QNJ A;  4LF4 I;  2C37 A;  3HUL A;  2WP8 B;  3M6A A;  4B3T E;  2HHH I;  1XXE A;  5DRR A;  3ZKB A;  5EKW A;  1XMQ E;  2PO1 B;  4X65 I;  2V2Q A;  2NN6 E;  4JI4 I;  1OYS A;  3V5R A;  1HR0 I;  1MG7 A;  4FW5 A;  4X62 I;  3B78 A;  4DV6 E;  4K0K I;  4PU9 A;  5C0X C;  4JI5 E;  4B3M E;  2ZBK B;  4X66 I;  4DV3 E;  4OO1 F;  3QT5 A;  4LF9 I;  4NBQ A;  2R3V A;  1XNR E;  5JEA F;  1NHI A;  4U3B A;  2C37 B;  4JI6 I;  4PRV A;  3P06 A;  3ZZU A;  4FN5 A;  4DR1 I;  4DR7 I;  5C0X F;  2VQF E;  2A2C A;  4DR6 E;  4LCH A;  1XMO E;  4IFD A;  2VQE I;  4OO1 A;  1N32 I;  1FKA E;  1N34 I;  3D4J A;  2V34 A;  4DV5 I;  5JEA A;  2BV3 A;  3Q6M A;  3HJC A;  2CZ9 A;  2HKE A;  2F4V I;  2HFS A;  1MX0 A;  1UEK A;  3K17 A;  4DR4 E;  2V2Z A;  4P52 A;  4R1F A;  2AE8 A;  1PKP A;  4M1K A;  4DPU A;  3UHM A;  4HAC B;  4LPF A;  1DAR A;  2X36 A;  2Z5B A;  1OYR A;  4AIM A;  1USU A;  4NXM I;  3B8H A;  4DV2 I;  3WU4 A;  5C0X D;  2ZM6 I;  4MDT A;  4IFD B;  2E1R A;  5K36 E;  4OO1 B;  4MU1 A;  4NXN I;  1I94 I;  2UXC E;  3Q6N A;  4DV7 I;  2HK3 A;  1FWL A;  3CDJ A;  4BA1 B;  3OTO I;  2Z5C B;  3ZZT A;  3P76 A;  2NN6 B;  3P3E A;  2GS8 A;  5LMN I;  4DR5 E;  4YY3 E;  1H7S A;  4OZE A;  4BA2 A;  4LFA I;  3ZZ0 A;  2BM1 A;  1B62 A;  2IES A;  2PNZ A;  3PRY A;  2F1D A;  1H73 A;  4B3R E;  1Z0G A;  2XEX A;  2JEA A;  4DV0 I;  1FWK A;  1Z59 A;  2WW4 A;  1IBK I;  2UUC I;  1USV A;  4JV5 E;  1XHK A;  2BA1 G;  2BA0 D;  3GCM A;  4HYM A;  4YHH E;  2UXB E;  4Z7C A;  2IOQ A;  4JI7 I;  5BR8 I;  1XNQ E;  2UXD I;  2WP8 A;  1IBL I;  5IWA E;  4FWD A;  4KHP I;  4JI2 E;  1HNZ I;  2PO1 A;  4FW3 A;  5LMU I;  2JE6 B;  3J7A G;  3ZM7 A;  4Z7Y A;  3M7N G;  3WU3 A;  2HHH E;  1U2R A;  3L7Z B;  3WU5 A;  1N33 I;  4JYA I;  1S4E A;  4X65 E;  1OJ4 A;  2R42 A;  5IT9 Q;  4JI4 E;  1Z5B A;  5K36 B;  3HKM A;  4RPF A;  1ZM2 A;  2O1T A;  4JG4 A;  1KTV A;  2V8P A;  3GLL A;  4X62 E;  4K0K E;  3P3G A;  4X66 E;  2GO3 A;  3LPS A;  4IFD C;  4IZJ B;  3CDI A;  4OO1 C;  2O3Z A;  2DEJ A;  4DR1 E;  4DR7 E;  2C38 A;  3QT6 A;  5JEA C;  3PYF A;  1OYP A;  4FW6 A;  3V2U C;  2VQE E;  2UUB I;  4DV1 I;  5FLX Q;  1N32 E;  4IFD F;  1N34 E;  4GKK I;  4URL A;  4LCG A;  1K47 A;  4JI1 I;  1VI7 A;  4HAC A;  1FJG I;  1Y4S A;  4I3H A;  1VIS A;  2PO2 B;  4LF8 I;  5C0X E;  2J7K A;  4HY1 A;  4GKJ I;  4FW4 A;  2E5L I;  1FNM A;  2O1U A;  2NN6 F;  1HNW E;  2UUA E;  1UDQ A;  4JI3 I;  3B82 A;  5DNL A;  4JI0 I;  4WUC A;  1EI1 A;  4DV4 I;  4DR3 I;  4X64 I;  2V2V A;  2C38 B;  1IBM I;  4DUY I;  4BA1 A;  4NXM E;  2Z5C A;  4LF7 I;  3J81 C;  4DV2 E;  2ZM6 E;  2NN6 A;  4DPW A;  4NXN E;  1I94 E;  4LOM A;  3J7A M;  4IFD D;  4DV7 E;  3PYD A;  3T1H I;  2BR2 B;  4OO1 D;  1PIE A;  5JEA D;  3OTO E;  3NZK A;  1Y6Z A;  4AQY I;  5LMN E;  2CGE A;  1UDO A;  4AM3 A;  4IZK B;  3U1Y A;  2JEB B;  4LFA E;  2O1V A;  4JI8 E;  3K85 A;  2GQ0 A;  1Y60 A;  4DV0 E;  4LFC E;  2PNL A;  4LF6 I;  1IBK E;  4XTJ A;  2OI2 A;  3GME A;  2BA1 D;  3PYE A;  2LJP A;  2JE6 A;  2CG9 A;  4MQY A;  2AJ4 A;  4JI7 E;  5BR8 E;  1EA6 A;  3T1Y I;  1IBL E;  5K36 F;  3U1K A;  3L7Z A;  4FWH A;  4KHP E;  4GQU A;  4UT4 A;  1HNZ E;  4MU0 A;  2IOP A;  4DR2 I;  4B3S I;  2J65 A;  5DNX A;  5LMU E;  1YHC A;  5A2Q C;  5K36 A;  3M7N D;  4P7A A;  2PO0 B;  1R6M A;  4DUZ I;  4DU7 A;  4AID A;  1ELO A;  4IZJ A;  3QT7 A;  4HXZ A;  1Z0B A;  4LF4 E;  1N0V C;  4N3O A;  1Z0E A;  3PS3 A;  4MU4 A;  1H74 A;  4LCF A;  4DPY A;  1HNX I;  4LFB I;  4OKG A;  2A2D A;  3P3C A;  3J80 C;  1NHH A;  1HR0 E; 
#chains in the Genus database with same CATH homology
 1J5E I;  4IZJ D;  3LNU A;  2BM0 A;  2Q2E B;  4LF5 I;  4YHH I;  4WUD A;  2UUB E;  4DV1 E;  2UXB I;  5GMD A;  2HFU A;  3Q1Q A;  1A6F A;  1XNQ I;  4LF9 E;  4JI1 E;  1KVK A;  4KQV A;  1FJG E;  1H7U A;  1Z0W A;  4JI2 I;  4JI6 E;  4LF8 E;  4ED4 A;  1FI4 A;  4GKJ E;  5GME A;  2E5L E;  1D6T A;  4JI3 E;  4UTG A;  4JI0 E;  2O1W A;  4DV5 E;  1N36 I;  2UU9 I;  4DR3 E;  4DV4 E;  4PRX A;  4X64 E;  1Z5A A;  1IBM E;  4OX9 I;  4DUY E;  1Z5C A;  4USM A;  2F4V E;  4LF7 E;  3ZKD A;  2DEI A;  1ZM3 A;  4DPX A;  4IZK A;  1NZ0 A;  3T1H E;  4B3T I;  4MYU A;  3JAM C;  4ZVI A;  1ZM9 A;  5A2Q Q;  1XMQ I;  4AQY E;  1N0U A;  4DV6 I;  2X7I A;  1Z0T A;  4JI5 I;  4B3M I;  5FWK A;  4DV3 I;  2Z5E A;  1XNR I;  5L3J A;  3H4L A;  4LF6 E;  2PNM A;  1B63 A;  4FWG A;  2VQF I;  1KKH A;  4DR6 I;  1MU5 A;  3GON A;  1XMO I;  3J80 Q;  3T1Y E;  4MYT A;  1HNW I;  5IT9 C;  2UUA I;  3QT8 A;  4DU8 A;  3PYG A;  4DR2 E;  4B3S E;  1Z0C A;  2UUC E;  4FW9 A;  4DR4 I;  1BKN A;  3CWV A;  1WUU A;  2HKJ A;  2UXD E;  4DUZ E;  4EMD A;  3K1J A;  1HK7 A;  4WUB A;  1ZM4 A;  2VF3 A;  5FLX C;  1ZXN A;  5LL6 R;  2UXC I;  1N33 E;  4JYA E;  4JI8 I;  1HNX E;  2Z5B B;  4LFB E;  2ZIT A;  1RR9 A;  1NHJ A;  2NPF A;  1KIJ A;  4DPT A;  3JAM Q;  4LFC I;  1J5E E;  1RRE A;  1Y4U A;  4DR5 I;  4YY3 I;  4LF5 E;  1PVG A;  3J81 Q;  4USK A;  2HK2 A;  4B3R I;  1H72 C;  3LTO A;  1Z0V A;  3WU6 A;  4JV5 I;  1ZXM A;  4GKK E;  1N36 E;  2UU9 E;  2EFG A;  3F0N A;  5IWA I;  1S16 A;  4OX9 E;  1QZR A;  4DXL A;  4LF4 I;  3HUL A;  3M6A A;  4B3T E;  2HHH I;  3ZKB A;  1XMQ E;  4X65 I;  2V2Q A;  4JI4 I;  3V5R A;  1HR0 I;  1MG7 A;  4X62 I;  3B78 A;  4DV6 E;  4K0K I;  4PU9 A;  4JI5 E;  4B3M E;  2ZBK B;  4X66 I;  4DV3 E;  3QT5 A;  4LF9 I;  2R3V A;  1XNR E;  1NHI A;  4JI6 I;  4PRV A;  3P06 A;  3ZZU A;  4FN5 A;  4DR1 I;  4DR7 I;  2VQF E;  2A2C A;  4DR6 E;  1XMO E;  2VQE I;  1N32 I;  1FKA E;  1N34 I;  3D4J A;  2V34 A;  4DV5 I;  2BV3 A;  3Q6M A;  3HJC A;  2CZ9 A;  2HKE A;  2F4V I;  2HFS A;  1MX0 A;  1UEK A;  3K17 A;  4DR4 E;  2V2Z A;  4P52 A;  4R1F A;  1PKP A;  4M1K A;  4DPU A;  4HAC B;  1DAR A;  2X36 A;  2Z5B A;  4NXM I;  1USU A;  3B8H A;  4DV2 I;  3WU4 A;  2ZM6 I;  2E1R A;  4NXN I;  1I94 I;  2UXC E;  3Q6N A;  4DV7 I;  2HK3 A;  1FWL A;  3OTO I;  2Z5C B;  3ZZT A;  2GS8 A;  5LMN I;  4DR5 E;  4YY3 E;  1H7S A;  4LFA I;  3ZZ0 A;  2BM1 A;  1B62 A;  3PRY A;  1H73 A;  4B3R E;  1Z0G A;  2XEX A;  4DV0 I;  1FWK A;  1Z59 A;  2WW4 A;  1IBK I;  2UUC I;  1USV A;  4JV5 E;  1XHK A;  4YHH E;  4HYM A;  2UXB E;  4Z7C A;  2IOQ A;  4JI7 I;  5BR8 I;  1XNQ E;  2UXD I;  1IBL I;  5IWA E;  4FWD A;  4KHP I;  4JI2 E;  1HNZ I;  5LMU I;  3J7A G;  3ZM7 A;  4Z7Y A;  3WU3 A;  2HHH E;  1U2R A;  3WU5 A;  1N33 I;  4JYA I;  1S4E A;  4X65 E;  1OJ4 A;  2R42 A;  5IT9 Q;  4JI4 E;  1Z5B A;  4RPF A;  1ZM2 A;  2O1T A;  4JG4 A;  1KTV A;  2V8P A;  4X62 E;  4K0K E;  4X66 E;  3LPS A;  4IZJ B;  2DEJ A;  4DR1 E;  4DR7 E;  3QT6 A;  3PYF A;  3V2U C;  2VQE E;  2UUB I;  4DV1 I;  5FLX Q;  1N32 E;  1N34 E;  4GKK I;  4URL A;  1K47 A;  4JI1 I;  4HAC A;  1FJG I;  1Y4S A;  4I3H A;  1VIS A;  4LF8 I;  2J7K A;  4HY1 A;  4GKJ I;  2E5L I;  1FNM A;  2O1U A;  1HNW E;  2UUA E;  4JI3 I;  3B82 A;  4JI0 I;  4WUC A;  1EI1 A;  4DV4 I;  4DR3 I;  4X64 I;  2V2V A;  1IBM I;  4DUY I;  4NXM E;  2Z5C A;  4LF7 I;  3J81 C;  4DV2 E;  2ZM6 E;  4DPW A;  4NXN E;  1I94 E;  3J7A M;  4DV7 E;  3PYD A;  3T1H I;  1PIE A;  3OTO E;  1Y6Z A;  4AQY I;  5LMN E;  2CGE A;  4IZK B;  4LFA E;  2O1V A;  4JI8 E;  3K85 A;  2GQ0 A;  4DV0 E;  4LFC E;  2PNL A;  4LF6 I;  1IBK E;  4XTJ A;  2OI2 A;  3PYE A;  2LJP A;  2CG9 A;  2AJ4 A;  4JI7 E;  5BR8 E;  1EA6 A;  3T1Y I;  1IBL E;  4FWH A;  4KHP E;  4UT4 A;  1HNZ E;  2IOP A;  4DR2 I;  4B3S I;  5LMU E;  5A2Q C;  4P7A A;  4DUZ I;  4DU7 A;  1ELO A;  4IZJ A;  3QT7 A;  1Z0B A;  4HXZ A;  4LF4 E;  1N0V C;  4N3O A;  1Z0E A;  1H74 A;  4DPY A;  1HNX I;  4LFB I;  2A2D A;  3J80 C;  1NHH A;  1HR0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...