3WUWG

Kir3dl1 in complex with hla-b*57:01.i80t
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
286
structure length
281
Chain Sequence
b'KPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGGTYRCFGSFRHSPYEWSDPSDPLLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Mutational and structural analysis of KIR3DL1 reveals a lineage-defining allotypic dimorphism that impacts both HLA and peptide sensitivity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 56
structure length 281
sequence length 286
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuwG03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuwG02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuwG01
3SCMA 3O11B 4CMHC 3BIKB 5GSRA 4PRPA 1E0OB 4CDGC 3V0WH 5M95B 3RWJB 3WS3A 2IPTL 3B2VH 4L29A 4YWGL 2XT1B 1CICA 3QWRA 4OGZA 4QHKJ 4R3SB 4DKFL 1NGYB 1JHLL 4LIQH 5GGTA 3L6FA 5ANMB 4FG6C 2DQTH 5EU5A 4H8WL 1A21A 2FB4H 2FO4A 3P2TA 3DTXA 4ZTPH 2ZNXA 5HVHC 1IGIH 2ADFL 1F2QA 1FGNL 3WFHB 4PJBA 5GGQL 2GUOB 2E3VA 4PR5B 4M3JA 1G9EA 4XVUD 1PZ5B 1N8ZA 2FIKA 3GHBH 1A6ZB 4ZOCA 5H8DA 1A7QL 2R2EA 5DJ8A 4XRCA 1YUHB 4RMRA 2Y7QB 1G7IB 1KELL 2NPLX 2VXQH 4WU7B 4ZXBD 1DUYB 3NGBC 4AIZA 2BFVL 2YBRB 1BQLL 2OTWB 4NKOB 2MQCA 1NUDA 1JNHB 3VGGA 2YSSB 2IJ0C 4LAQL 4A6YA 1N59B 2AV1B 5ICXA 1XGUA 1HK6A 3UTZB 3CJJA 2X4OA 5SV3A 1N5YH 1ZSDA 4LLWB 3SKNB 3NFSL 4JFOB 1CR9H 3EJYD 4GKSA 5IEKA 1QLRB 5D7LB 3UC0L 5C8JB 3D2UA 4KROB 4UOJA 2VDQL 1JGDA 2ESVE 2DQEL 5HGHB 5DZLA 1DL7L 1S7XA 1I9EA 4JRYB 2R2BA 3QQNA 3MLRH 1TQCB 4EN3B 3T4AB 1UA6L 1RZKL 2F58L 1H9VA 2NW2A 3D39E 4N9GA 2EE2A 3VFNA 2HRPL 1AXSA 5FO9B 2QTEA 5ESVA 5LXGL 5IK3B 3T77B 4NUGL 1RZ7L 1INQA 2B1HL 3TVMD 4D8PA 4CN6A 3BQUC 4G7VH 1CLZL 3MRBB 1R3JA 4U7MA 2P5WE 3BO8A 5EOQL 1FYTB 3C5JA 2Q8BH 4ZQKA 3LAFA 1OGTB 5KSBE 4KY1H 1AIFB 4QRPA 4LSRH 5SWSA 2ARWA 3A67H 4IRSC 1EMTL 5DD5L 1OARH 1YMME 1MRCL 2P5EE 2XY1A 1S5IH 5BV7B 3ZE0F 1INDL 2XG5A 4I48B 4IIQB 4PJ9C 4OF5A 4YHIB 5JIPA 5C0IB 1G0DA 2CR3A 2MKLC 3DMMB 5CEZE 2CDFB 5B38A 4PJHE 3OZ9L 1B90A 2E8ZA 4KZDH 2EEAA 4XAKE 3RWHB 2YUVA 4MA1C 3WIHH 4GRWF 2IALB 1NBVH 4XPFH 2AJYH 4Z18A 1P7QB 2OI9B 2YWZA 1P4IL 1X44A 4ZUSB 5KW9H 4JQXC 3NCEB 1XZ0B 5MHSE 4GXVL 4PBWD 3DUUA 3EOBB 4U6TA 4OBSA 3TH2T 2X4SB 1FQ9C 5GS0D 5IMMA 3DX6A 4DUXA 5JQ6H 3ARFC 4WWKC 2VH5L 5I0ZA 4MNQA 1OSZA 3PWVA 1QHOA 4OKVB 3PJSB 4QHMA 5IGXH 3RKPA 4QRSA 4GAGH 5JA9A 4OUUA 2VDRL 3T08A 4ENEC 4ZOBA 4R8WL 1OHQA 3VMNA 3MBXH 4OZGB 2NY0D 4MCZB 3MRNA 1KCUH 1U36A 4OQTA 3IU4H 4BZ2H 3AU1B 3BPNC 4KDTC 4XVSL 1QOKA 2JE8A 5DRNA 5T5FL 3RDTA 1QSEA 3BKCL 3RY4A 1O0VA 5DA0B 1VGKA 3VFTB 2BY3A 2FBJL 1IBGL 4LMQE 2R1XB 1RPQA 4KQ4H 1FFOB 4QRQB 1NL0L 2CKBL 3B9KD 3O4LB 4LEOB 5AZ2L 2NY6C 2VE6A 5TDPA 3UYPA 2PYFB 3QA3B 4Z7OF 3GZKA 3O9WA 1F58L 3KYKL 1UEYA 3QZWG 1CXHA 2Y5TA 1BIIA 1U0QA 4JKLA 3MRDA 1GIGL 5FOBB 1HKFA 1LDPH 5KSUA 2XTJC 3P9WB 5IB3A 4DWHA 4ZUUA 3IXTA 5HGDB 4QHNB 3KPOA 2DL9A 5C0DB 1Q9OA 1CVRA 1WAAF 4OV5B 5TGBA 5CZKA 1F4WL 4BQ6A 1R5IB 3RIFF 2FZ3B 3D6GA 5KS9F 3N0PB 3QIUC 4RGOH 3VFUB 3KPQA 5IVXB 1JI1A 3C09B 4NWUH 3RQ3A 2CLZA 2O5YH 1GAFH 1A1MA 3C87A 1HCVA 5HHOB 4P2RB 3O0RH 1BD2D 3V4PL 2CUIA 1IJ9A 1T04A 3AXLA 5I19L 2Q87A 1RUQL 4MD5B 4F2MB 4MA8L 1U8JA 5IHZA 2EH8L 3U83A 15C8L 3FTGA 2RCSH 5EU6B 2PXYB 3FQNA 5BRZE 2VXUH 3Q6GH 4NQCA 4G8EB 3HAEH 3IDGA 1AD9B 4G9FB 4FQJL 4R9HA 1DQQA 3QI9B 3RGHA 1QA9A 3CFBA 5IWLA 2Y36H 3QNXA 3PWPB 3WCYA 2P43B 2EDWA 4GRLA 3VRJB 4AZ8A 3D18B 2ZSVA 3MV01 4M7JH 2YUWA 4NNPL 3LS5L 3TZVC 2OJZL 4OGAC 1MVUA 1QTYT 5AAMA 2XZAH 1LVEA 5I6XB 1CD0A 4G6KL 3PWJA 4HT1L 3ARDA 35C8H 1VFOA 1BQUA 4PGBA 2XWBA 1ZT7A 4KU1A 1AC6A 4NFDA 4KMQA 2Q3AA 2NR6C 1L9MA 4DN3L 5I2IB 5F1SA 5GZND 5ILTH 4NOBA 1MF2L 4JKMA 1C5CH 3QUYD 4NQSB 3MLUL 1E28A 3KYNB 3FQWB 2IBGA 4QHUA 1LMKA 3AMKA 2YA1A 4UTBL 2D03H 2O93L 3W0WA 4HGKC 1J05B 1R3KA 3HC4L 1TJHH 1DQDH 2V17H 3MNZA 4M4RA 2HVKB 2J7LA 3IFLL 3V7AE 1IM9D 1PD6A 1ZHKB 4Y1AA 4ELME 2O61B 1XF2A 2L0DA 1NDMA 1NC4B 5HGAA 4QTHA 4WU5A 1OLLA 1S7QA 2APFA 3C6LC 3OJ2C 3VXSA 2W07A 1WBXB 1FFRA 4PJEB 4PV9B 1KIRB 5B3NA 5IUSA 4YK4B 4P46D 4NYLA 3VDBA 4HMEA 3ZDYF 2EDDA 4F15B 4F9LC 3MMEA 3DVGB 3LIZH 5D1QA 5FGBA 1XGYL 2CIKB 4Y4FB 1NMBH 1CE6A 5E08H 4M7ZC 4I13B 1B0GB 2Z8WC 5HPOA 1NGQL 1CXEA 2MHAB 1K8IA 1VA9A 3H9SB 4OM0L 1KSRA 5MI0B 3BRGC 1NCTA 1ONQB 1KJMB 4Q9BA 5CEZL 1HZHL 4L8BB 4WI4A 2JB5H 3GIZL 1DFBL 2ICCA 3GI8H 3VFVB 1E27A 5TE4H 5FO8A 2EXYC 1RY7B 2BVUA 1HDMB 4NZUH 5LGHH 5IW1A 1A14L 4OJFH 4I0PB 3WO4B 2ZUSA 4QF1B 3HG1E 2ZWLT 3G5XA 4U1HB 2DYPD 3ZZ1A 2V5SA 3SDXA 3I6KB 1CT8B 2CSPA 3CPLB 3FQXA 5GXBB 1JPSH 2PKDA 2RBLA 5FB8A 5HHPA 1J5OH 1R24A 1IAOB 3RRQA 4XPAL 4RMSA 4PJAB 4ZAKA 4FQXC 1CIUA 1MLCA 1NCWL 5J13C 3ARGA 5E95B 2XN9A 3QNZB 3WHE1 1A6TA 5C07E 3U4EA 3GSNA 3DO7A 2VC2H 1NMCC 4OCWH 5TH2B 3V6OA 2YC1A 4ZS7L 2RQ8A 1FL6A 3DLQR 3EYFB 2NX5D 4QXTA 4Y2DA 2BX5A 5DJXA 1JZ3A 2HG5A 2UYLB 3GSOB 1WLHA 1HHKA 3PWUB 4HK0B 4UIKL 3NFPB 4XMKL 5INDA 1HN1A 2EDFA 1KN4H 3MLYL 5CFHA 4WNQB 3L3GA 3O2DL 5C0RH 4BH7B 4GW5A 2PR4L 3VXTB 3HMXA 3FMGL 4WV1C 1ED3A 2R0ZH 1H3GA 3RTQB 3RY6A 2IANE 2RJMA 5TE7L 2VN4A 1VFAA 3EJZC 4OCSH 3QIBB 1S9XB 1JYXA 1YEFL 4D0CA 2CK2A 5JUEH 1KOAA 1T22A 3OX8B 4Z9KB 5F9AC 1A7BA 1XMWA 1TPXC 3JV6B 2HH0H 1X5HA 4YXHH 1HH6B 4EOWH 3QFJE 4PJFF 3ZSTA 4GRWH 2XNAA 5CIPH 2CK0H 3MLSH 4K23L 1MIEL 3PHOB 5C9JA 2P45B 3QAZC 2HWZH 3LEXA 4MA3A 4DKEL 3E2HB 5GS0H 3RU8L 3EYVB 1OGAA 2X4NA 1OAZH 3UJIL 3PE9A 1EIBA 4PJXA 4RGNE 1LNUB 5FCSH 1I9IH 4HQQL 3QIWC 5C0GA 1M7IB 4ETQA 4AEEA 2B4CL 3TYGH 2VLJA 1AQKH 4PGEB 2DJ4A 2MCG1 5L7XH 4F57H 3ULVL 1KJ2H 3D3VD 5D9SB 1UM4H 1DBJL 1I1AA 3L3DB 5D7IE 2JIXB 1ZVSB 3WYRA 1URLA 2JKXA 4YBQC 3HZYA 2GY5A 3BQUD 2ATPA 1QR1A 1IC4H 3IFPB 1IFHL 5EN2A 2X4QA 3DVFA 5MERB 2YPLB 1ACYL 1VCAA 5KSAB 3T2QA 5GS1C 2P24B 2VZ3A 4G6FB 4BFBD 1VENA 3FFCB 2XOTA 1FZMB 4HC1H 1BLNA 4MJIA 4JPKH 1MLBB 3WDJA 5I1KL 3NN8A 4L4VA 1MFEL 4WHCA 1YNKL 2ZG3A 3MA7B 4XWOD 1K6QL 4MAUH 3EGSB 4WI3A 2OL3L 2G60L 5E99L 4PJ9D 5AEAA 1VACB 1BZ7B 1BM3H 5GGRY 5HHVL 4HS6A 5I8CA 5C71A 4Z7NE 4KK9D 2ZCHL 3NZHL 5L6YH 3MV7A 4HS3B 4M61B 2B0SH 3E6HB 1ITBB 2E7LC 1QRNE 2ZUTA 4JPWH 3UTSE 3IDXL 5IQ9B 4XCFL 4WTXA 2R2HA 4BKLA 3O6FA 3VFPB 4YUEH 4NO3A 3WFCL 5JO5A 5K33A 3V95A 5AWNH 2EH7H 4O9HH 4WUUB 1NAKH 3HR5B 1T7XA 2MJWA 1T2JA 3ME0A 1DQLH 5HHXL 1G9NL 2OCFD 5EU4B 5FYLL 1XCTB 3P9MB 4LPCA 4KXZI 1ZWIB 4WWKD 2BC4A 4UT9H 2I07B 1CDGA 2UV3A 5HI4C 4XVTH 1G7QB 3CK0H 2H8PB 1MFAL 3QPXL 4YHZH 4P2QB 5LKNA 2Z35A 2D7OA 5CP3A 5C70A 4ZSOA 5KAQG 3F7QA 3PXJA 1LE9A 1ZVYA 2WQ8A 3VXUE 3I3EA 5JXEA 2NMSA 5E6ZA 3S7GA 5BZWA 5C0CA 5ENWB 1BFTA 3VA6A 2IQ9H 2JJUA 5MEND 2JCCA 4KV5E 3V0VB 3V6ZB 3BZFB 3S3JA 2GSGB 1XR8A 3IU3A 3GUTB 5EC2B 4PJIE 4RZCA 2GJZB 2DQFA 3PABA 4HJJH 1RJLA 3ZTJG 1JHKL 4XPGH 1UCBH 2OTPA 4RCAA 3TBWA 2NY6D 1S78D 4JFZH 4K9EC 4KRPC 5E8OA 3T65A 1D5IL 1XGTA 3OKKB 4RFOH 4I18A 3NCCB 4NO0A 1HCFX 4P5TA 3H8NA 1CDCA 5DRXB 1P4BL 1E4XH 2C1OB 4W81A 1N5AB 1MFCL 1J8HA 4L3ED 3OGCB 2CIIB 4RNRB 5FK9B 5LWYL 4LVEA 1FSKB 1IAKB 5EBMB 5AD0A 4LGSB 5E5RB 3ZE1E 3DUSB 4JZJA 2IFFH 5T1DL 3KPRE 4P9ML 1I8LC 2WWKO 5DJ0B 3QIUD 1MIMH 1YNLH 3CVHL 2X70B 4YHOH 3QUML 1RIHL 1J0KA 3CXDL 4WTZA 4R7DB 3W81A 5ESQB 4KI5F 4PRPB 5DLML 1QBMH 2ICWJ 1T7YA 5D2NA 4LPXA 4DK3A 3HAEB 1YEKH 3S35H 2QLVB 3VFWA 1D6EB 3H3KA 4YDLC 1W72L 1TQBB 4KI5D 4P23A 1YEIL 4DGIL 5IFJA 3L6FB 1JBJA 3VRLE 5KZCD 1PKQA 3V5KB 3ROLA 1K8DA 2VXVH 2ED8A 1RHFA 4OTXH 3CLFL 4JY4B 1OTTD 4WI6A 1D9KA 3GSWA 1IZJA 2YD3A 5DURB 4XNUH 2ARJA 2VDPH 1N8ZB 1ZLVK 1FORL 1H3PH 5DQJA 3RAJH 5L8JB 2R2EB 1ZHBB 4XRCB 4GXUN 1CTNA 4C56D 3H6JA 2OYPA 1V7NH 4G9DA 4AIZB 4NNXA 3TZVD 1IKFH 1GOHA 4ZOEA 2DAVA 1QEWA 1RAMA 4QXUL 2Y5EA 1A4KB 1GXEA 3AAZB 5FXCH 5GRJL 5CJ8A 2CJUH 2X4OB 5D7KE 3C5ZD 5FHAH 4H1LG 3RHWK 3X14A 2IMMA 1ORQA 4UNUA 4HZAA 4NIKB 5E8NA 2H6PA 3MYZA 3GRWL 1FAIH 1JGDB 1FRGL 1EEZA 4PP1C 2QSCL 1T6WA 5E94A 4QHLA 4KJYB 2R2BB 5LQBL 3CDYA 1JPST 4FFVC 2BERA 3EFDL 1VEPA 3LMJL 4K71B 3G9VA 3UJJL 3X11B 1RUPL 4OZFG 4KUZL 1J1PL 2NW2B 1JHTA 5DMIL 2HTLC 5FV2A 1BFSA 4JN1H 1AXSB 3CH1A 3QUZD 5D6DA 2ATKB 4YX2H 2P42B 5ESVB 2DKMA 4G43B 3QDMD 2ZKHH 4NDMA 4X8JA 1J8KA 4IDJL 1NJ9A 1FNSH 4JB9H 2SEBB 5CMAA 1CTOA 1GOFA 1NCCH 5JW4Q 3VXRD 2W0KA 4Z6AT 3OJMB 2WIIA 1MFNA 5C92A 4FTVE 2EICA 5SX4I 2FYYA 1DQJB 4CBPA 2GFBB 5CGTA 2NY3C 2UWEA 4B7LA 1II4E 2D9QB 4Z0BH 4G5ZL 4OZIF 3CSPA 1REIA 1C5BH 1CGWA 3B8SA 4Y5XC 1QFUH 3ARYA 4NO5A 5HXMA 2H2SC 3U0WL 1IC7H 5B38B 4WGWB 2EXYD 3G04B 1BZ9B 3SDDC 5IP4A 3ULUE 1FBIH 3UTPE 1LO0L 4X6DF 2X6MA 3PV7A 1B4RA 5DUPH 1ZA6B 3HUJA 2I9TB 2VXSH 3MLWH 3B3IA 1E4WH 5GQBA 5I1HH 1EZVY 2EDKA 4P0DA 2H2PC 3GI9L 1A1NA 4XPBL 3DUUB 1J18A 3BEWA 3WLBB 3TN0B 4LF3B 4ODVH 1OTUD 1M6OB 3RWDA 4YAQA 3DX6B 3H0TA 2OQJB 4HKXB 3V6FA 4MNQB 1AD0A 1OSZB 3CXHK 4IJ3B 1EHLH 4IRJC 4K94C 3ZLQC 4QRSB 1IGJB 3VMPA 3RWEB 1NGPH 4LQFH 1CDIA 4OD2B 5EBWB 5I8EB 5IR1B 1UWEH 3AREC 3MRNB 4PJBE 4NWTL 5JW4R 4AEFA 5GGSB 1A7OL 4RGNC 3RZCD 1PG7W 4GMSL 2ICWB 4N5EC 1IQWL 5T1LA 2KL6A 2B2XL 2A83B 4WI5A 5HY9A 2J6EL 4PJ5D 5DRNB 3FJTA 5DJ6A 1G7PA 4GRWB 1VGKB 5CIPB 3S36H 2UZIH 3INUH 1Q0YH 4GSDH 2OR8A 3X3FH 3I9GL 1VFMA 4Z78A 4NC0B 3HC0B 4CVUA 3EHBD 2DQDL 3NZ8A 4XC1L 3LS4L 1I3RA 1NFIB 3UBXG 4Y2OA 3WEXA 3PWNB 1SY6L 1XT5A 4WCYL 3VD5A 4RWYL 4H20L 2R8SH 1YY9C 4OAWA 4R7NB 1ZHLB 2OZ4H 5EUOF 1JNLL 5KSUB 2WSKA 3HB3D 4M3KB 4M1DH 1YQVH 1DSFL 1T83C 1KJ2B 1U8PB 3U48A 1Q9OB 3QO1A 1S7TA 4X4XB 5DHVH 2D7TH 4J2XA 4PJGB 3CDGB 2YPVL 1G6VK 1CD1B 1D5XB 3PWLA 4LHUD 5I18H 5JORB 4ESKA 1KB5A 2EYTA 4NQDD 3IAQA 3H9ZA 3VD3A 4TTDD 3ZDZF 4Q2ZB 3ECBA 3MROB 3BKML 3DECA 1W0VA 3CSGA 2DWEA 2AJVL 5KSVA 4YBQD 3T0EA 3QZWA 4ODUB 4LLVA 2J88L 5IHZB 3HNTL 3FB8A 3I6GB 4OD1L 4FQHB 4JFDA 4XMLL 4ZUWA 4JFED 1BFOA 4NQCB 4YGVA 5GRXG 4NKMA 4LAJH 2AEIT 4QEGA 1BP3B 2VQUA 1T0NA 5DEFA 1WCBA 3MREA 4JM2A 4X6BA 3RVXC 2BVQA 4WEBH 1A2YB 4QWWC 4DGYL 5TDNB 1R5WA 3VJ6B 3LRHA 1XIWA 2FSEA 3UTTB 1F00I 1JPFB 2O5ZL 4K7FA 5IHLB 1AQDA 4JDZB 1WWAX 4NKDA 1N3NA 4S0TD 5KVGL 2XWBB 3C08H 5K9KA 1UACH 4GT7A 4KK5C 4G8FB 2BNRE 2DBJA 4D0DA 2NXZC 1D6VH 3NTCH 1BGXH 1KPUA 1E28B 1X5FA 1UQSB 4S1DC 4L3AA 4JLRA 1ZANL 2AK4D 4AL8L 3KPNA 3PUCA 3EDKA 2IG2L 2D0FA 3BPLB 5HI4D 1Q8MA 2GCYA 1QBLL 3MNZB 4HAGA 2DQUH 4M5YL 2DLIA 5I9QB 1XAUA 4HBCL 4Y1AB 4JJ5A 1K3ZA 5BO1L 5CAYB 2ERJC 1R3IL 1TZHA 4ISVB 1GGCH 1HSBB 3OKNB 1KB9J 4RIRB 2CDEB 1OY3B 1JWSB 3MJ9L 2WNGA 5HI5C 3QISA 1MI5E 1QSEE 4WUKH 3VFMB 3VGFA 2OJEA 4R96B 3WLWC 5L88L 5E7BA 2AABL 3QG7L 3QUYB 4M43H 5IBTH 1HINH 5EU7C 4N90D 1GGBH 1S3KL 3QCTH 5CBEB 4RAVB 3UO1H 7CGTA 1EFQA 1F3JB 1FL5A 1KCVH 2CO7B 3RHWF 1K9TA 3GMRB 4P4KC 3SQOL 5IFHL 5J11B 3BPOC 5KVEH 1C7TA 2JJVA 2EC9T 1CGXA 1U3HD 5SWZD 3ULUL 1IM9B 4JGMA 3O3BA 4J3VA 2Y06H 5FO8B 4DVRH 3ZDXE 2F54D 4NN7B 5E00A 1TCRB 2X09A 5DMKA 1PKOA 4CJ1A 2NQCA 3OR7A 1VKXB 5GGVY 3C2AH 5TE6L 3RIAK 4KXZH 5HPMB 5FGCB 5D1XB 4NSKB 4LSSH 2GITA 1L6XA 3D0LA 4JVPA 4XHQA 3V5HB 3L5XL 2GTWA 1EO8L 2J3SA 5FB8B 3PL6C 3T8XA 2DQJL 5CINL 4B50A 1R24B 4YXLL 3OKMB 5HYSA 4ORGA 3RA7H 1FZJA 5GGTL 2EDEA 2VLRB 4P5MB 3BW9B 4F58H 3L3KA 4MD4B 3WFDL 2XN9B 5L0QB 4J6RH 3VXMD 1NMAL 1XF3B 3WV0A 2LFGA 3GSXA 3N1QC 1Q38A 3B5HA 1KFAL 2FL5A 3LB6D 2NTFB 2H3NB 2YC1B 3I02B 12E8H 3IJYA 3QEUB 2VJXA 2HT3C 4LLYB 1AGBB 3D85A 2WQRA 3OKEA 5I66A 1SBSH 1S9WA 1QSVA 2VQ1A 4QOKE 5GSVB 1YEHH 4Z77A 3GKWH 3CMOH 1MJUL 2W92A 4WY7H 4XNZC 3H9HA 4OZHB 2P8MA 3MPCA 5ABDE 2DYPB 4YDIH 4WO4D 4GW5B 4X7SH 3REVB 2JJSC 4A6YL 3W2DH 3BHBA 5GZOC 1T03H 5IIEB 5IOPB 5DT1H 5E9DA 3CDFA 4UIMA 3VCLA 4M7LH 5EOTA 4Y16D 4F7CB 2ADJB 4P5KB 1M05A 2VDOL 3L5JA 4XVJH 1A64A 1FNEA 4C83A 3ALPA 1B4JL 3HCVA 2LU3A 4U49A 5DJAA 4PB9L 1OP3H 3BGFC 1OD9A 4Y19A 2GTZA 5DK2A 3OB0K 4NNYB 4XT1C 4NT6A 3LEYL 4KRNA 5ID0A 2G5BA 4PP1D 3UZVB 3FHAA 3LEXB 4U2YA 3W0WE 4AEHH 2K1MA 3BWUC 3QEQE 3P4OA 5I1CH 4ZXBA 1JUFA 4WENB 5E8DH 1A0QH 4FFVD 3NCYP 3W9DA 4UAOC 3NCJL 1AY1L 2VZUA 1CL7I 1NCAL 5J6GB 2YRPA 4IBLT 3T04D 4KJQC 4APQB 1U95B 5C0BD 1IAII 1L6ZA 3VXSE 3AMLA 4WFED 3HC3H 3BGMA 1A6UH 3OL2A 5BXFB 1WISA 5ID1A 5K59E 1B2WL 4YJZL 5AYUL 2DLFL 5KVDH 3HI6L 5FF6B 4QRRA 5EN2B 3TJEH 4KUCF 4DOHE 4MQXC 2X4QB 2XFXA 3E6FB 2EIZB 4YH6A 2BCKB 1EV2E 2V9TA 2F53D 2XXMB 5FCUL 1G7MB 5ADOL 5D96B 1LEGB 2VLKA 2WK2A 2NY3D 2XA3A 4P2OD 4PJFB 4MSWA 5IB2A 4U1SA 5ALBH 3PP3K 2ITCA 1HEZA 5BS0D 4KHTL 4OGYH 1WIPA 3STLA 5LAXA 2EEDA 1ADQA 2H2SD 3IAGC 4MS8D 1T1ZB 3CFKB 3TVMA 3DXAD 4PBXA 5I8CB 3SDDD 1TZIA 5DJCB 3CSBA 4OCYL 4PP2A 5F9DC 3VWJD 1RUAH 4GMTL 3D3VB 2VAAB 5T1KA 5JR1H 2KQNA 4HWZB 1MCIA 3SE3C 4X99A 2J5LB 3SDXE 5ICYA 3OR6A 3IKKA 1OT1A 4YXKL 1KF9B 2ZJSL 1JK8A 1X9QA 4LASL 2W0PA 3GBNH 1P9MC 2ZCLH 4YBLC 1FO0H 5I1LA 4I4WA 1FIEA 5JOEA 1KEGL 3V2AR 4IOFC 5EC1A 3F12A 4UNTA 3WN5A 4C55A 4M6NL 4F37F 5KAQF 4IRJD 4GLRI 3V6OE 5GJSH 3O3EB 4JY6A 4OQTL 1PQZB 4F7TB 4YHYB 1INEL 3BD3A 4TVPL 3LDBC 3NABH 4OF6A 3RWGB 1YEEH 1JWUB 2WAHA 4Y5YB 1H15B 5HYJD 1DTUA 4Z7QE 2YMXL 1EHNA 2IBZX 4K8RC 4KQ3L 5JPNB 1F13A 3QQ4A 3FN0H 3I75B 4AMKL 32C2A 3JV4A 3O41A 4N5ED 5H94A 5SX4H 5BZWB 2YD7A 4AM0A 4PRNA 4Z7VF 2XQBL 2JCCB 4PJ8D 3PGFH 3VXNB 4LDOB 4DFIA 1IILE 1OWWA 3LD8B 1OAYL 4HFUL 4RZCB 3IF1A 1RJLB 5HHQA 2R0KH 5D7LE 2W65A 4BJLA 3GJFK 5DHVB 3BUTA 3T65B 4WWKB 4LPUA 1XF5A 1A5FL 4HIHA 4EDWH 5I76B 5D7JD 2EDRA 3SDCA 4YC2C 3U30B 3E3QE 4XNXH 3FZUC 5TQ2H 4L9LA 1N0XL 5EBGA 5E24E 3V52L 5DC9B 2PTTB 4AEIH 3IXAB 1OGAE 3I2CL 1OB1B 4FZ8H 3JSSA 3LEVL 2HJLB 4JZJB 1TVHB 5BQ7A 3DV6A 2Q76A 4PJXE 3TT1L 3K2UH 2VISB 4EDXB 1FFPB 3KPLB 5J9PB 4JM4H 3TBSA 4LNRA 4DZBA 3MQIA 1EEYB 2KQMA 4Q74A 4DKAA 5D2NB 4YZFE 2C5DC 3VFWB 1NCDL 1RZIB 2Q8AL 2DKUA 4HK3N 2YRZA 2IPKB 1SMOA 1T5XB 2Z8SA 1L0YA 1OOAA 4HXAH 3G5ZA 1ZHNB 3RUGE 2EZ0C 4O5LH 4TSBL 1TENA 1OAXL 5J06A 2R1YA 1A7NH 1YECH 2HJKA 25C8H 3ESVF 4L4VE 5IESH 3TT3L 4J12A 3GSWB 5EU3A 4OLYH 1U92A 2D31B 1PLGL 4EVNA 4XC3H 2WMPA 1PX4A 4Q9RH 3DHMA 3HPJB 3RVXD 5DQJB 1XGQA 3TF7C 4LPYA 3S5LG 4HMCA 4NZRL 2I5YL 5JHLH 5HHMD 4G9DB 4PJCB 4L4TA 4R90L 3P4NA 3T09A 3RIAF 1SBBA 3SKOA 3FT4A 3K0WA 3MRCA 1F4XH 3BDYL 4KK5D 5K9OA 2NXYB 4UBDC 1R3HA 4Z7WF 2NXZD 5KZCB 4B53A 2EYRB 4PLKC 3NOIA 4RISH 1P4LA 3C60B 4S1DD 1NKOA 4X7TB 4UB0L 5DD6A 3MV8D 3QDGD 3JBG7 4XCCL 2GJ6D 4NO2B 4OZGE 3ZKXB 2M26A 5I1IL 5D70L 2W60B 3WE6A 1SYVA 2OR7A 1BVKB 3QRGH 3QWOB 4J3XA 2X9XA 1NBYB 1X7QA 4MXWH 5EO0A 2W0FA 2BHUA 3IJHA 4M03A 3FO1B 1C16B 4C56B 4DVBA 1XH3A 3B5TA 2X9YA 1VPOL 2Q6WA 4ZSOE 1JHTB 1IGTB 4NPYB 3C8DA 5I15L 4M5ZL 4YDKL 4Y4HD 1TJIL 4NDMB 4GKNB 2DI8A 4O2FA 1F5WA 2PW2B 1RZGA 3O4LE 5TDOA 4RRPA 4GW1A 1QKZL 5JXAH 1ZLSH 3HKFA 1SM3H 4W4OC 1ND0A 1S5HB 3C5ZB 4LVNB 1G6RH 1NLDL 1UFUA 3NIGE 4PY7B 2WP3O 1EH9A 1IEAB 4U6YB 5IFAH 5DO2C 1CFNA 2LVEA 4UT7L 4RMVA 2VL5A 1AJ7H 3V4VL 2A9ML 1NAMB 4XXCA 1FDLH 5GIRB 4BFGA 4K3HA 1U8OB 1F97A 2AKRB 1QQDA 1JGEA 4NO5B 4OZFA 4M7LT 1MAKA 4PRID 3L9RB 4DTGL 2D7QA 3SBWA 1TMCB 4ZFFA 2W9LA 1J88A 5H35A 1A6WH 3NIFE 3OKLA 3QUZB 4BSVB 5F7HA 4R4FH 3BE1L 4P2RE 5FA4A 5HHOE 4PLNC 3KYOA 2GT9B 3MUGB 2NY1C 2WWKT 5CBAB 4MXVE 1RVFH 2PYEA 3HFML 4O58H 2FD6H 3EOTH 3B3IB 4KKBD 3NA4A 4HIXH 5DHYA 3FHQA 5EDXA 4QRUB 4UDTB 5JHDD 3R1GH 3BEWB 3DRQA 3S6CA 4OLUL 2UVFA 3GSNL 5D72H 3SGDI 1CFQB 4FMKA 4G7YH 4ZO6A 3H0TB 4FZEL 4G8GB 3QCUH 2RFXA 1AHWC 1JGLH 1I9RH 1DR9A 5ISZD 4G9FE 3WSQH 4X7EC 3EO9H 4FP8L 3RGVC 2Z8RA 2HJFA 1K3IA 2AJZA 4WHYG 4POZC 2H9GA 2Z91B 3Q3GB 4CNIA 3IYLW 2HT3D 5F8RC 3V7AG 1IL1A 4I3RH 1DBKL 5JOPE 2UUDK 1CK0L 4UV4H 2V5RA 4MNGB 3IDMB 3F7YA 4KMTH 3HZMA 3HMXL 1D5MB 2AJSH 4J8RA 2AV7A 1KCRL 3OKDB 4GRMA 1UXWA 2I25N 3N9GL 4L8SC 5LJYH 4GAYA 4JZOB 1TCMA 2JB6B 2ZOLA 5GZOD 3VG0H 3O2WL 5J6HA 1A9BB 5EIIA 1S7UB 1SMAA 2V7NB 3NZ8B 1OM3H 4OLVL 3WEXB 5CJBA 4FNLH 3RWIA 3MXVL 3DUHA 1HQRB 4CU6A 2CO6B 4JG0H 4X6CA 1BFVH 2IADA 3WKML 3QQ9D 3HE7C 3RJQB 5DMJB 4U1LB 3TO4C 3MA9L 4HJGB 1JZ2A 1KV3A 4X83A 1KNOA 2DMCA 2VAJA 4OCLC 3RZCB 5JIHA 3WNLA 3F58L 1YEGL 2HFEB 3P11L 4YO0A 5HDQL 4K94H 1AGCA 3M17A 3BRDA 3CFJA 3TBVB 2FRGP 43CAA 4R4NC 5DEGA 3UBXA 1OAKH 4WI7A 4N8PA 4PJ7A 5DTFB 3VXPB 3T0EB 3ZTNH 1FL3B 3MLXL 3MRRA 2L7UA 4YR6B 5LBSH 5MEOA 3MRQB 4LLVB 3H9SE 4MQXD 5D1ZA 4Z95L 5IF0B 1P6FA 4Z5RB 5KANI 4ZUWB 4C59B 2IH1A 2F8XC 5A2FA 3FOLA 5D7SH 1MRDL 1S7VA 2UWEE 1UKQA 5EFIA 3JWDH 1K85A 5IJVA 1KT2A 5JLZA 4JRWA 4XMPL 4ZOAA 4RA3A 3HZKB 2H26A 3G6JA 3MREB 3ZO0A 1MJ8H 3H9YA 1RZJL 4LU5H 4X6BB 4NBZB 3DSFH 4LIQE 5C2BL 4HH9B 1YPZF 2PN5A 1AGEA 4MWFA 1GGIH 3BQUA 4LSVL 4NQDB 4K7PH 1XIWB 3BPCB 3GMQA 1FO0B 5TPWL 4N0YL 4BYHA 4H26B 1BOYA 1S7RA 5CCKH 1N6UA 4IRSA 3MXWL 3RL2A 2C3VB 3QDJD 4IHOB 2KUTA 5DJDA 1CL7H 2J4WH 4GKZB 4LLAA 2DQHL 1QR4A 3VW3L 1BEYH 4UILH 2XZCL 1IAIH 4QNPE 1CYGA 1CGVA 3OAUL 1A7PH 4IOFD 5JNYB 3WFBL 4EN3C 3IFNL 3I3BA 5TF1L 4J3SA 4U1MB 2QV2A 5BOZG 3L5HA 1T3FB 1HIMH 2FECL 3BOVA 1DQMH 2V9RA 1TZHB 4NM8L 4K8RD 2P8PB 4Z8FL 1LILA 5IBLC 3WJJC 5A2JH 4YHMH 4X5XA 3MRIB 4RQQB 1HKLH 3CMGA 4NQXA 1W0WA 1GJIA 4IMLB 5DR5H 3ARFA 3SEPA 4OGXL 5B8CB 1NFDF 5DRZA 1V5JA 4LCYA 4MQ7B 5IROC 5I1DA 5E1AA 3OMZA 3MC0A 2YUXA 1WC7A 1KTLB 2AK4B 5DUMH 1CLOH 5GGRA 4YIQA 5BV7C 4BFIB 2Y23A 1I3GH 4PJDF 2IBZY 4ZO7A 1MCNA 3U36B 4IIQC 2BY2A 3EYQC 3DMMC 1DN2A 1IEHA 1RFDL 3OWEA 5DQ9B 4G80A 3FQTA 2H45A 4KDTA 1ZK9A 1VFBA 3T3PE 4IM8A 1I7ZA 5MENA 3B6SB 1CVSC 5J7CC 1NGWA 2B5IB 3DYMA 3OR7B 4PG9B 5CEXB 4NRZB 1X5IA 1OPGL 2V2XA 3DX9B 1YEDA 2PUQT 5MP6L 1KJ3H 3CUPB 1UENA 4QXGL 1HHJA 1I1FA 5HJ3A 1IT9H 4BH8A 2MMXA 2GTWB 2YPLE 4GLRH 4EXKA 2R1WA 3UTQB 5F71A 3MLVH 4I0KA 3UX9B 3GGWB 1CD9B 1F6LL 3UPAA 5KJRL 4RBPH 4JFDE 2QKIB 5GPRA 1E6JL 3C5SB 2FX8H 1WZMA 4PRDA 1NEZG 3MCG1 4KTDH 5EZLA 1U3HB 3BP5A 2VXTL 4GG6A 3HZVA 3EO0B 4OQ1A 3OKEB 5I66B 1U3YA 2F54B 2VQ1B 1WWCA 3MV9D 4JFHD 3NPZB 4JG1L 4KAQL 3H2WA 3TP4A 5E2UH 5CWSB 2P8MB 5HDBE 3S88H 5CD5D 1LO5A 5E2TH 1YYLL 1EDQA 4YQXL 2YOCA 4XAWH 5EOTB 1H0DB 2R69L 4NQEA 3DI3B 1YMHA 4B5EA 4E41A 3KPMB 4POUB 1CBVL 2Z4QB 1DBBH 2CGRH 4YDLB 1K5NB 3MJ7A 3VXMB 2A9NL 1WZ1L 2BSTA 4UBDD 5F7EL 1CZ8H 4AIXA 4EI5D 4TNWK 1KG0B 4PLKD 2H1PL 4V1DA 2A73A 2G5BB 2R0LL 2VLLB 4P2QE 2WZPD 1G1CA 3U4AA 1MHEA 3ZL4L 4Z7UE 5EO1A 5C08A 5IB4A 4ZMAT 3ARWA 4ZFGL 5JW3L 5GRWA 1B9ZA 3TZVA 4FXKA 4UINL 2WW8A 5F9OH 1KGCD 3RPIA 3C09C 3MGAA 4KPHL 1P5VA 5I73C 1R0AL 1G6RB 4WO4B 5F9WB 5T5NF 5C6TH 2NZ9C 3LHPL 2W9EH 4ODHL 1J1OL 1MCPL 4CU8A 3OJDB 1MJ7L 4Y16B 4KZEH 1Y0LA 3MACL 4FFYL 4JO2H 3HI1B 3GM0A 5FHBH 3MRFA 5CLWA 1HYSD 2P46B 4HZLB 1EFXD 5BVPH 3UZQA 5I30L 3DETC 2PXYC 5DVNA 1CE1L 1RIUH 4X9BA 4PS4L 5J57B 1U58A 1RJZA 1QSFD 1EVUA 4KJPD 3VRIA 3NCBB 3FO0L 5DO2D 3VFOA 2VLKB 3QI9C 4XP5H 3BZ4A 3JZ7A 1KTDB 1LP9A 1LQSR 5IB2B 3J8F7 4JAMB 4RDQG 1HEZB 2FO1A 1ULVA 3C6LA 1FFNA 2XTLA 4BQCA 3KAAA 3FFDB 4LMQI 4FQQA 4LVOB 5IQ7L 1ZLWH 4H5SA 3L1OL 4Y8AA 5I6XC 1IGIL 3BP6A 4UI2A 3LN9A 2GQHA 4D9QD 3BIAX 4F9LA 2GSIA 3DRTB 3VXRA 2OSLA 5T1KB 1MPAH 4K2UL 2NY1D 1YYML 1BBJA 4HCRA 3DSNA 4LLUB 5ITFA 1GRWA 3BZEA 4X99B 3GHBL 3IKCB 4JPVH 4P9HC 5L9DH 1GPOH 5FYJE 4LSUH 1P7KB 2F53B 3K1KC 1JL8A 2ESVD 5IM7B 4MVBD 3TWCH 3SY0A 4P2OB 1H3XA 2R9HC 4I4WB 5I8OL 4OZIA 5EC1B 2IPTH 5FGRA 4YWGH 1K4DB 4H0HB 5BS0B 1MRFH 2J8UF 1N5YL 4EUPA 3PHSA 4DKFH 5ETUB 1I1CA 2A0LC 1JHLH 3IDIA 1WIUA 4Q7DA 4D3CL 1P7HL 3KR3H 4BK5A 1NC2A 5T1MA 4H8WH 1S9KC 2OS7A 1WGOA 3VWJB 2BXYA 4KKCD 4X6DA 2FJFA 4YK4C 3NCFB 2ADFH 5KSBF 1RV6X 4KDWA 4U1GB 4LLQA 5H94B 3V6BR 2H32A 1FGNH 5IB5B 3D1MC 4F15C 1EJOL 4FQXA 2WM0A 2HLAA 5EBLA 5IG7B 4Y4FC 3BSZL 3NPSB 3BISA 4JFQB 2ZUQB 5E9DE 4HX1B 5F89B 3P3YA 3SKMA 4GG8A 1JGUH 1KCSL 2NY5L 5HHQB 3KHQA 5MI0C 1YMMD 1BQLH 2OTUB 4JDVB 3D48R 2X4TB 4Y19E 2YEZB 1AP2B 1WF5A 4KRLB 5FIEA 4HS8L 3K80A 3LQAC 3U2SA 1JN6B 2Q8BL 3HE7D 1T4KA 1QNZL 4KY1L 3WHXA 1IAMA 3FT3B 1Q0XH 3D39A 4LSRL 5HYJB 1UWXK 1YNTA 4HUXB 3A67L 4I0PC 3WO4C 5DEZA 1G9ML 2B39A 2DQEH 5HGBB 1KB5L 1QFWI 1DL7H 1IVLA 3SGDH 1CFBA 1KPRA 1MCJA 2CLVB 2P5WA 4ZFOB 4PJ8B 4KTEH 4DZBB 4F3FA 1B0WA 3GNMH 3VGEA 2VIRB 4KZDL 2FIRT 3KWWB 2XXCB 4K8RH 5L2KA 2F58H 4WW2A 4BK4A 2HRPH 3HA0A 2V9QA 4U1KB 4GW4A 1NGXB 1NBVL 2P5EA 5FV1L 2AJYL 3SDAD 4NUGH 1F42A 1RZ7H 4UQ3A 3CZFA 2B1HH 5D7JB 4X9GA 3MR9A 3OAZH 4LCCA 1DN0B 4HKJA 5EUOA 1CLZH 5IVZB 4OLZH 2F8VA 4IRZL 4NM4H 4YDVB 1JVKA 3ARRA 4QHKI 3GO1H 3S97C 2PTVA 1Y6NR 4JHAL 3TM6A 5CJQH 1GHFL 2D0GA 3QIWA 5JQ6L 3CCHB 4WFFD 5FECA 1YN6A 3O3AB 4HIEB 3TV3L 2GK2A 3GJEA 1XGQB 3LCYA 3JV0A 1T1YA 1F45A 3U46B 1MRCH 4OCRL 2EDBA 2PO6A 5DRWB 4JZNB 3LPGA 3RTQC 3MLTB 3IETB 1EGJA 4F33B 2GI7A 5DGQA 3MBXL 2FR4B 3QIBC 4RMQA 3MNVA 3HI5L 1OAQL 4YEEA 4BZ2L 1NGZB 1MAML 4P3DB 5GS1A 1MCFA 2C3GA 3FB7B 3WS6A 3SKOB 5FDWA 4I0CC 3U4BH 5C0JA 3AS1A 2XRAH 3TBYB 3EDJA 1JF6A 4UDUA 3VGBA 3E2HC 5DD6B 5GRVL 3ZYZA 4GXVH 1I1YB 3FRUA 3UPRA 4YHPA 4U33A 1ZT1B 3WE6B 3O45B 1XF4B 5CP7B 3GMPA 1MCLA 2VH5H 3BN9D 4P2YA 5DFVC 5C9KA 2AGJL 3ULVF 1N4XH 3BP4A 5HHMB 2C3HA 2F19L 5C0FA 2VDRH 1MHHA 4LOUC 1MY7A 3Q5YA 4JFFD 3SOBH 3ULVD 1L7IL 5JOFB 4FS0A 2DKSA 4PTTB 4YLQT 5F3HA 5KSAC 4H1LB 1FYTD 4RGOL 1T66C 4XVSH 5DYOA 2E5EA 2NXZB 4TOYH 1GAFL 4O02L 1ZT4B 5BRZD 4RSVA 4PLJD 5D8JH 3BKCH 3O0RL 2HRLA 4K3EL 3MLPA 1CFNB 3U9PL 4ACPA 2VMFA 3QDGB 2GJ6B 4LCIL 2PCPB 3MRLA 1U8HA 4KK6D 4ZG1A 1CI5A 3RKDD 3DMMD 1GVIA 5ERWB 4NN6B 4TNWF 4X0KA 3N06B 1F58H 3KYKH 3FL7A 4M02A 4ZFFB 4OM1L 1YN7B 3Q6GL 1HSAA 1GIGH 1NDGB 1ERNA 4CVXB 2BVPB 3K8LA 5HVFB 5J56B 4Y4HB 3QH3A 4NZDA 2EDJA 4OFYA 2Y36L 3QUXD 5FYJL 4AENA 1RZ8A 4N1EA 3REWB 1SQ2N 1W2KT 3SJVA 5EWIL 2B1AH 2XZAL 1SJXA 2ZPKH 3KYMA 4LSPL 3C8KB 5T3ZD 2HT4C 5AUMB 4Z7OE 3MZGB 1BWWA 5FYLD 4JRXA 1RI8A 5DK0B 3G08B 3V4PH 2UUDH 2UY6A 1RJCA 4KMLB 1XR9B 1AKJA 5I19H 3OXSB 5ILTL 3KHOA 4MLSA 1RUQH 4RFEB 1LEKA 4CVZA 2P1YA 3D69A 4PRIB 4WHDA 5FA3A 1C5CL 3T3MF 2OL3A 4ZDHA 3EBAA 3RNQA 1WAAE 1WFOA 5AZEL 5KS9E 3VA2C 2DQIH 3S37L 4DAGL 1BD2E 1F02I 1DQDL 2V17L 4F80A 3JVGC 4GRMB 1YY8A 4FQJH 4U4BA 8CGTA 1VFUA 4Q6IB 1C5DA 3KPSD 2A1WH 4LRIC 3HPLA 5JHDB 3BH9A 2G2RA 4NNPH 3LS5H 2DJUA 2R39A 1RIVL 3LKNA 2W38A 2X4RB 1JWMB 1QHPA 3JTTB 1C1EH 3MRJA 1CWVA 3S37X 3LIZL 4DN3H 1FSKC 2HKHL 3LKRB 1NMBL 2FEEL 4AT6A 4I2XA 2BY0A 1MF2H 5IVXF 1IM3A 3MSPA 4QGTA 3QQ3A 4R0LA 4FQCL 4WGVB 4DCQA 1A1OA 5D6CB 3W39B 3WFZA 2BMKB 4UTBH 1C08B 4F9PC 1SJVA 4LHJB 4YO0B 5F7NC 3SO5A 2MNUA 3SCMC 4K3GA 3HC4H 3N1FC 3ZKND 1D5BA 1EERB 2X89A 1TETL 2YA2A 3SGKC 4O51B 1Z0NA 5LGHL 3ALXA 5DEGB 3UBXB 4YEFA 2HT2D 2BRRL 1B6UA 1TQBC 4OJFL 4BUHA 1F4YL 4XTRC 4RX4A 4U6HA 4U6XA 1KJVB 5C07D 4XHJD 5EU6D 3DETD 2PXYD 5SWQA 1WSST 4ZPVB 2IH3A 2WP3T 3I50L 1SJEB 2APBA 5F88B 1A6AB 1RJYA 1MHPL 5I71B 1RSFA 4N5UA 1S7VB 2X2YA 1IC5L 2Z31A 1XGYH 3MRKA 3P9LA 1N26A 1DBAH 2MFNA 5C0BA 3ARUA 4QTIL 3IFOB 3T2OA 5GJTH 1FVCA 1F8TL 3HG1A 3G6JB 4OIIH 2FWOB 3MRPA 2VNCA 4OCWL 4TRPH 3TNMA 1U9KA 1HZHH 3CVHA 4HDIB 4EJ1C 3QUMA 5D2LB 1DFBH 2IAND 1MCKA 1JFQL 4HUVA 2N1KA 3HRPA 3TESA 1Q9LA 2PW1B 5FO7B 4E0RB 1FVDA 2ID5A 4KKAD 3V0AC 3K74B 1U8NA 1A14H 4LPVA 4F7EB 2V7HA 5C0RL 3FO2A 5B4MC 4NKQB 4HF5H 3QFJD 1MAJA 3N1PC 4I5BA 2DIAA 4DFHA 1ETZA 5MEQB 1BVLB 2WWMC 3LKOB 3CFDA 4FABL 5HTSA 5CHNA 4OCSL 1EUTA 2DD8L 2YS4A 3VWKD 2R9HD 1OW0C 1T2QH 3DXAA 3U0TA 4XBEL 4XPAH 1OQOA 3SDDA 4K71C 1TVBB 3WXVL 3O6KL 1MCHA 1NCWH 2HH0L 2E6PA 2GK0B 4EOWL 3OTTA 4PJEF 2A0LD 2J8HA 1I4FB 2CK0L 1AO7A 4ZS7H 5KTEL 2EXWC 2MQ0A 1DDHA 4JN2B 4LVHC 4PUBH 1Z9SA 3L95B 4L1DA 3DGGA 3G6AA 1BX2B 1MH5A 4N8CL 4X5XB 4E9LA 4UIKH 4KWUA 4NQXB 4XMKH 1W0WB 3K1DA 4HW6A 4Y4KA 3MLYH 3QDJB 3O2DH 3PIQB 5E2VH 3RZWA 1PYWB 3TYGL 1AQKL 5MEPB 3JWOL 4F57L 5E1AB 3WMSA 1GC1C 5JMOC 1WFUA 4LKXB 4MAYA 2NX5E 1MVFA 1KPVA 5TE7H 4XPTL 4Z7NF 3UDWC 3AREA 4HGWA 4X6CE 4L8CA 2BNQD 4TSCL 1WQVT 3FOMB 2HFFA 3LRGA 4G80B 1A47A 1GZQB 4PV8A 1EAPB 4MJ5B 3TPKA 1VADB 4OD3H 1HQ4B 4MDJB 1V3MA 1I7ZB 1JTTA 4K3DH 5BVJA 2FBOJ 3C2SA 1H3UA 3FKUS 3P40A 4K23H 3CLEL 1NGWB 1MIEH 4O2CB 3IRZA 4W6WB 3UTSD 5JDSA 4PJAF 4DKEH 4Z7VA 4S2SB 3TA3D 5KN5A 4XBPA 1BM3L 4LCWB 1HHJB 3TYFA 1T0MB 3AS0A 4LDEB 1UCTA 3TN0C 3GSVA 4GBXD 4HQQH 1MWAA 2B0SL 4ZS6C 3MUY1 2EDOA 2B4CH 2P4AB 4M6OL 3AVEA 4XP4H 3ULVH 1KEMH 1CXLA 4JR9L 4WI8A 1DBJH 4PJFE 2Z93B 3TIEA 3VDAA 1IQDB 3QEHB 5AWNL 2EH7L 4L8DA 5E8EA 1MFDL 2C1PB 2NW3A 1DQLL 3ZKMD 4HWBA 5E7FA 4GG6B 4U3XA 1ACYH 4EQ2A 3RI5K 4XCNA 5CSBA 2EKJA 4X6FA 3VXUD 4U3HA 5I1KH 2WBJA 3D3VE 3H42H 1G0XA 3EDEA 1YNKH 2VO5A 4XVTL 3ILPA 3D25B 4F7PA 4YHZL 3PQYD 5E99H 3RTQD 1FZOA 5HBBA 3QIBD 5GS0C 4G8IA 1JYVA 1GSMA 5JW5A 4NQEB 4WDIA 4U1IA 4OUOA 4DZ8B 1QO3B 2F5BL 1VSCA 5J1AB 2IQ9L 4YFLI 1QFWH 2EDLA 4MNHA 4XCFH 1U93A 3KXFA 3V5DB 3WFCH 3HE6D 4HJJL 3VXQA 4XPGL 5EO1B 5C08B 4H25A 5IB4B 3FT2A 5T3ZH 4JFZL 2UZYB 2D4FA 4ONOA 1G9NH 5E4EB 5ESAA 5HHXH 5IT2L 3MV9B 5FYLH 3GB7A 4RFOL 1ZTXL 3T1FB 4WJ5B 2BSRB 1WFNA 1G7LA 2DICA 4MJ6B 3RPIB 1E4XL 4JCMA 1H5BB 1R3LA 3JTSB 3AB0B 5A16B 2GJJA 4OZ4A 4PJIA 1MFAH 1A8JH 4HPYL 4LOUD 2X4PB 1EXUA 4XXDB 1U8QB 2FHCA 2IFFL 2KPNA 3RJDA 2CKBB 3MRFB 1AH1A 1DJSA 1YNLL 3KDMB 1JYNA 1WTGT 1DEEB 3Q1SL 4Z7WA 2ZOKA 1IE5A 2HN7A 3FFCD 2QHRH 1KLUB 1A3RH 1J9CT 4EI5B 3X3GH 2AXGA 5ALCH 3RX7A 1QBML 4LLMB 4LBEA 1YEKL 3S35L 4M7KL 1AFVL 3LRSA 3KLDA 4XPHH 5DI8B 3P73B 1JHKH 5E5MB 1AGFA 2E8YA 5DJ2B 1D5IH 2AK1L 4JVWA 4U1JA 1OTSD 3EFFB 5MENE 4YHNB 2OP4L 4UQ2A 3X12B 5I75B 5LWYH 2OSLB 4UOW0 1QFPA 5ITFB 1RHHA 2VDPL 3BZEB 2DF3A 1H3PL 3S35X 4XBGA 1NUFA 3BI9X 4WFHD 1EFXB 3RAJL 4MA7L 1FV1B 4O00A 5T1DH 3GMNB 3LQZA 5DWUL 3VDCA 4L3CA 3LN4B 1ZS8B 1SJHB 3L3HB 3R0NA 3GSQA 3HLAA 2NY7H 1IKFL 1QSFB 3MGTB 1JMZA 1RIHH 4P4KA 3FAWA 4L3EE 3QUKA 1U8MA 3CXDH 3SY0B 1KLGB 4TUJB 3B43A 3BPLC 5DLMH 5SX5H 3F5WA 3W9EB 2IAMA 2P7TA 1G84A 3EYOB 5EPMA 5I9QC 1W72H 2VABB 1KXTB 4UU9A 4JO3L 3IDIB 1RUML 1YEIH 1H8NA 4DGIH 4M8QA 5JZ7D 1LDSA 1U91B 3CFCH 1CQKA 1FAIL 1PJ9A 5T1MB 4Q9QL 5I1AB 5HYQB 4D9RD 1YDPB 3IVKB 3CLFH 1T7VA 1OCWL 1YC8A 2F9BT 3PL6A 4J1UA 3SHSA 1BQHA 4HK3J 3TIDA 5GZNC 4JDTL 3NMEA 4GOSA 4HLZG 4QLRA 5D1QC 4KI5E 3QUYC 3DVNA 1FORH 1FZKB 3ZT6A 2XWTB 5ISZA 1MCCA 4OF7A 3DV4B 2WINB 4YX2L 1QG3A 2ESVB 3H7BA 5E6IA 2DDQL 3IDJA 1TDQA 1A02N 1EBPA 2ED9A 5CZVL 1FNSL 1Q9KA 2RIKA 5J11C 4QXUH 4YFLF 4MQSB 4P9HH 2L7JA 4PRHA 5C09A 3OB8A 5EIVA 1KYOJ 4NGHL 4Q0XL 4AH2A 3OHXA 1U8KA 1ORSA 3B4NA 4QRTB 4ERSH 4NN7C 3P0VH 3QULA 4C56E 4ZTOL 5LGJA 3ULUD 1KXQE 1UH2A 2J8UB 2JJSA 1K4CA 3PDOA 3B5GA 4Z0BL 5D1XC 3DX7A 2QSCH 1J0ZA 1OSPH 1NBZA 1C5BL 1UJ3B 3SCMD 4J3TA 1KIQB 1I3VA 4HIJB 2Z8VC 1IC7L 3EFDH 4F3FB 3S96B 4PRPD 4Z0XB 3QXTA 5KSBB 3LMJH 4WTZG 4CADA 4XCEA 1RUPH 1CICD 3QWRD 4FTVA 4KUZH 5INCA 3DBXB 5L0QC 5FYKD 5DMIH 4WW2B 1L7TH 1YMMB 4XTRD 4D2NA 4G6ML 1FG9C 4PPTA 2VXSL 2D4DA 2LTQB 3BKYL 3MLWL 4PJBF 3U9UB 4HKJB 4NHUA 4Z76B 1HI6B 5E8PA 4PJHB 3MCKB 1JTPA 1LP9E 5DURD 1HHIA 4U1NA 4IMKC 2XZZA 3OPZL 3QFDA 1IGYB 1ES0B 5FYKU 2NY4D 2YA0A 3FO9A 3LPFA 4F8QA 3QDME 4JEGB 3PHQB 5DS8A 3DYPA 2PO6B 2NLJA 2KZ1B 4J3WA 3VXRE 3F6IA 1G1YA 1UWEL 5DDHA 3TPUA 4QYOB 4G6JL 2YKLL 5EUKA 3MJGX 2CR6A 4YHKH 4QT5B 4J23A 5A3IC 3L7FA 3SDAB 1LO0H 3P77A 3QJFA 5B4MD 3H3PL 4LCUB 3GHEH 3G5YB 4R4BA 3BD4A 3D2UD 2AAVA 2WWMD 1CLYL 3RL1A 3ZHDA 4GSDL 3GJFA 3K8KA 4BSWB 3X3FL 1CGUA 1BQSA 1Z9LA 3BVNB 2HMIC 1F11B 4OZIE 4XPBH 2AXHA 5GS3A 4NHCL 1FLRL 4OFPA 3WNKA 1JTOA 4MNGE 2R8SL 1KIPB 5IMOA 1MHCB 3S5LB 4APQC 2AW2A 3WDIA 4ZYKB 2XICA 3QJHA 3BP4B 5IMKA 3OAYK 2CKNA 3RI5F 2X1QA 1UJTA 4X6DE 3L3IA 2EXWD 4HKZA 2R4SL 1MHHB 5L2JA 4XWGH 5ICZA 5JQHC 4HUUB 1EK3A 2Q20A 2E7BA 4NWTH 1UM6H 3PDGA 2VDNL 1UH3A 4D0BB 1P9MA 3LV3B 3GK8L 4M6MH 4JHWL 4WHTA 3QXAB 4QRPD 5SWSD 4ZD3H 5CUSH 5D96C 2J6EH 1A7RH 1XGRA 4KVNL 4NP4H 3SPVB 1TZGL 5J3HC 1E4KC 3I9GH 3MRLB 3LN5A 4NUJB 2DQDH 2AQ1A 4XB7A 3LS4H 4ODWB 3HS0B 3S4SA 5CD3B 1SY6H 4WCYH 1I7TA 1FVEB 4AQOA 1LEIA 1RZJC 4WFGE 3KPPA 4PJ5E 5GGSY 2R23A 5FKPB 1BHGA 1X5GA 3CC5A 1JNLH 2JELH 1Z0MA 5D5MA 1DSFH 3QH3B 2OBGA 2F74A 4JO1L 2J5LC 4JFFB 1ZEAH 1IC1A 5T3XE 2QL1A 1RZFH 2QQNH 4OT1L 5KVFH 4DN4H 2YN5A 1U8LB 3ZHKA 1NFDA 2DLEA 2YPVH 5E2WL 1YZZA 3TN0D 4F7MB 5L2KE 5BRZB 2ENSA 3MOBH 3PNWB 4MX7B 3CX2A 4ZS6D 4JREB 1R6VA 4XWOC 2Q7YB 3CVIL 4MNQD 3GMMB 2DLHA 5TFSH 4PJDA 3C08L 5B39G 3BKMH 2DOCA 4JVUA 3UCRA 2NTSP 1I7UB 4YHYC 2G9HA 5EUOE 1TXKA 2AJVH 1LEKB 1M71B 2G75A 3L7EB 4Y5YC 1D6VL 2BNUA 4KK9C 1BGXL 4OD1H 4XMLH 4XP9H 4TVPD 1TNNA 2WV3A 4NQDE 2PNDA 3CFIC 5IEHA 3STZA 1J0JA 5EA0L 3VD7A 3RDTD 1QSED 1UKSA 3QUXB 1FNGB 2BNRA 6FABL 5J12B 3ZDZE 2DQUL 3RX8A 3LD8C 2AJ3B 2E7MA 2IQAA 1VERA 3PF2A 2N56A 5IW6B 1KB9K 3SE4C 4JPIA 3FQRB 4MHHI 1GGCL 3U0PB 2HKFH 1T1XB 3IJSB 3BH9B 2JK5B 4DGYH 5I16B 4JFEE 2VSCA 3P4MA 2R4RH 2R0WH 3O9WD 2FJHA 3NFNA 1JNJA 4QY8A 4WUKL 3U30C 3KLAB 1RD6A 3HTLX 3DX8A 4Y89A 1QBBA 3CH8A 4N1HB 4PJGF 4YNYB 1MNUL 4JANB 4OLEA 5C0EA 4ELMB 2XWJB 4AT6B 1EA9C 4M43L 5IBTL 4GO6B 5F3BA 4CN4A 2DQCL 2NNAA 3QEGH 3BXNA 4YPJA 4JZJC 1GGBL 4R0LB 3QQ3B 1EX0A 4DCQB 3UO1L 5IMLB 3W5MA 2W59A 5GGUA 1G7JA 5JMRA 4ELKB 1MCQA 1MI5A 1S8DA 3PXHA 3VH8A 4ODXB 3IGAA 1K2DA 2IG2H 1ZA3B 4IS6A 4MMXC 2FGZA 4GAJL 4U31A 5D2NC 1QBLH 1NKRA 2X42A 4CW1B 1UZ8A 4M5YH 3KPSB 4JQVC 2HVJA 2D2OA 3S8WA 4HBCH 2ILLA 1S78C 5BO1H 2BJMH 1CF8L 1R3IH 1I7RB 1T20A 3EIFA 2AK4E 1HXYB 2J8OA 3MJ9H 1YQ2A 5SWQB 2MPAH 4LSSL 1WWBX 2X9WA 1UXSA 4NQCD 1XF1A 1NQBA 2K7QA 3MRHA 1D9KC 5L88H 4U2ZA 2AABH 3VE0B 2Z31B 2GAZA 3QG7H 1OWRM 3P9LB 1JPGA 2YD9A 1UGNA 3IAPA 3BWAB 2A74A 5DJYA 1S3KH 3HG1B 1HHHA 2ADIB 5I73B 3DROA 2WLYA 12E8L 3ISWA 3UTTD 2ICEA 4HCRL 3CVHB 3GSUA 5C0AA 5IFHH 3ARDD 1X4YA 2FJGA 3QUMB 5DFTA 2APWA 5F7DA 3ULUH 3LKSA 3WNMA 4D9LL 1J87A 5F9JB 3GKWL 3CMOL 1J7VR 4KI5C 2JTDA 1FVDB 2OLDA 2NXYC 5C07B 2V7HB 3FO2B 5TE6H 1W72B 4YDIL 3F7VB 3G5VA 4X7SL 3CDCA 5H2BB 3SJVE 5KOVC 3C60C 1OTTC 4XGZB 3O4OB 4HBQA 4OKDA 1T03L 1DBML 3CFDB 4OI7A 5DT1L 1HXMB 1CXFA 5CHNB 5SWZE 3ZKXC 4JRXE 4X4YB 3W0WD 1EO8H 4QOKA 1IGCL 5CINH 1NLBH 3KGRA 4JFPB 5FYKH 3K3QA 3QNYB 5IV2A 3LKQB 5GGTH 5E4IA 3CAFA 3GIVA 4BSJA 1ZMYA 4EI6B 4Y1AD 1ZGLB 3FCTB 4XX1E 5GISH 3PV6A 4J4PA 1KFAH 2FGWH 2H41A 1N6VA 4G42B 4PGCA 4XNQA 2IANB 3SGJC 5I1CL 4JFXA 1A0QL 3C5ZC 4LVNC 2YHGA 5D1QD 1I85C 2CXKA 2W0LA 3JUZA 3VXME 3QFJB 3AUVA 1AHWA 3OG6B 3EUUA 4NQVA 4HULB 3GMOA 3RGVA 1JF1A 1JZ7A 1LE5B 4KHXH 3VWKB 1Q9WA 3QEQA 3L5WA 5I1EL 4PGDB 5EZJB 3WL9B 3L3OA 4G6AC 5GS2D 4L8CB 3TJEL 3M1BB 2VDOH 1I8IB 4D94A 3BEVA 4I2XE 5FKAB 2Z0BA 3EOAA 4PB9H 2X40A 1P1ZB 1S9VA 2F8OA 4OLWH 3QUZC 2MQ3A 2P8LA 4LRNL 4L8SA 5EORH 3SDXF 3LEYH 5T3XL 5EB9A 2DBLL 5D7IB 3TEUA 3MODH 5ALBL 4XI5D 5CJXC 5D1XD 5I17A 2BSSB 3QHFH 1HOCB 2CLRA 1WZKA 4XBPB 3ES6B 3J7HA 5BJTA 1Y18A 2YPKB 4EEEA 3U6RA 3MFFA 4NRYA 4HIIA 2VLRD 5HYSG 1NCAH 3R06B 3T4YA 2XN9D 1HH9B 1EZVX 3P0YL 4YPGA 4L1HA 3V7MA 3ARSA 1OQXA 2VLMD 2AXFA 4HPOL 4M1CC 1HHGB 5GRZA 3TO4A 3TIEB 1B2WH 5CJOL 2DLFH 2BNQB 5AYUH 4ZO9A 1CFSB 4L8DB 1LK2A 4N8VA 4OZHF 2BVOA 3A6BL 4Y2DD 2FECI 2NW3B 4NBYB 1CG9A 3QXDB 5BW7A 1FN4A 3M45A 3DVIA 2A6DB 3EO1A 1U8IA 3DURA 1NSNH 4P48A 2DMKA 3VXOB 3GSRB 1GC1H 3ILQD 5FCUH 5C0BE 5LG1A 4XCNB 3O11A 3M8OH 1N2RB 3BIKA 4OCXL 2AVGA 4NC2B 1QRNB 3RWJA 4QCIB 2WBJB 1HYRC 3T0VA 3UTSB 1EGJL 3S98A 2Y6SC 5GJSL 2DQGL 4R3SA 3C6SB 3TA3B 3UYOD 1NGYA 4ZPTA 2QQLH 4F7PB 4KHTH 3NABL 1YEEL 5ANMA 5FFLA 1B0RB 1OTUC 2F53E 4GBXB 5F1NB 2EC9U 3FN0L 4XNYL 1DLHB 4PD4J 4OCYH 5A3ID 4YGAB 2AJUL 4GMTH 3T0XA 1NEZB 1J0HA 2GUOA 1FJ1A 3NIDF 4PR5A 2YZ1A 1BBDH 1PZ5A 3PGFL 4HHAB 1TTUA 5BS0E 1UB5B 4OFDA 5K9QI 1UVQB 1DQTA 1W8NA 1YUHA 2W1NA 2Y7QA 4PREB 1G7IA 3QWQB 4L5FH 4BZ1H 4WU7A 2AERT 2HMID 3ELAT 3DXAE 1DUYA 1OGAD 3RZCC 2FATH 2YBRA 5ADPH 2OTWA 4NKOA 1JNHA 3VXUB 1I8MB 3K8MA 4LLDB 4MCYB 2YSSA 1ZLUH 4JFYB 1N59A 2AV1A 1G7LB 3EJJX 1KEGH 4APQD 3BMWA 4UUJB 4XNXL 3WUWG 2VLJD 4NQTA 1V8HA 5TQ2L 4M6NH 3PQYB 1AO7E 3SKNA 4LLWA 3BRFA 4JFOA 4OQTH 2XPGB 4PJIB 2BXZA 1INEH 1I1AD 3EHBC 4AEIL 2VUOA 3LSOA 3BJ91 1KC5L 1QLRA 4TVPH 5D7LA 3T0EC 5C8JA 5F7FA 3I6LE 2ORBL 2Z9TA 2V2WB 3TCLB 5HGHA 2EYSB 1YEJH 2VB5A 2OR9H 5A40E 3K2UL 4PGJA 4JRYA 2MWCA 3S3SA 4HWNA 4QKXB 1IKNC 2ZOKB 3VI3F 1ACZA 3HB3C 4MJID 1L0QA 3UAJC 1NEUA 4EN3A 3T4AA 5KG9A 4L4VD 3HE6B 1OP3K 5DSCB 4MXQD 4LPWA 4LBEB 5J3HD 3BKJH 1OAYH 5HYJE 1UYWH 4FQPA 4TQEL 5FO9A 3QCVH 2QADD 3KPRB 4XZUB 3T77A 4NRXA 4P59H 3T2PA 1A5FH 1MOEA 4O5LL 5ITBH 4TTDC 3MV7D 1XIWC 1YECL 4Y88A 2IF7A 4P4RB 5A1AA 4K07A 1OGTA 1D5ZB 5EOCL 4UQ2B 1AIFA 2E27H 5EO9A 8FABB 2NYYD 1N0XH 2VDLH 1MUJB 3OF6A 4K9EL 4Z7VE 3V8OA 1A3LH 3O6FD 5DD0H 4Q9RL 3LEVH 3WXWL 4P57B 5D93C 2ADGB 4L3CB 5JHLL 4G3YH 3MJ8B 3RUGA 3TT1H 2KBGA 4I48A 4YHIA 2CDFA 1I8KB 4X5WB 4E42B 4LK4A 3BUYB 3RWHA 1F4XL 2YXFA 1TIUA 2IALA 3LVEA 1RQ5A 1P7QA 5F1IB 4ZUSA 3QO0A 2JCCF 4TSBH 4NJ9H 1XZ0A 1OAXH 5JXED 3F7PC 4O4YH 4DQOL 5C0CD 3EOBA 3TT3H 4TSAL 4KKLC 4J1UB 2X4SA 3QRGL 3NIGF 3TIDB 4EQ3A 5K9JL 3ZE2F 2C7UB 4LQ1A 5B8CC 1CFTB 3DVNB 3LKPB 4OKVA 3PJSA 3UYRL 4OB5H 2XKNB 2AEQL 3AS3A 4MDIB 5E6IB 1Q94B 5TJWK 4NO0D 4P5TD 4OZGA 5DUBB 1WBYB 2AQ3A 1UT9A 4R90H 3D0VB 3DOSA 5GGVL 4JKKA 1RK1B 5JXAL 1ZLSL 3AU1A 3KXFE 1J8HD 2BOBB 3BDYH 3SO3B 5A2KH 3OHXB 1RURL 1BOGB 3VFTA 2B5IC 5HHME 1AJ7L 1CDJA 4HJ0D 5AYQA 1FDLL 3O3DB 1FFOA 4QRQA 3O4LA 4LEOA 2DIBA 4XCCH 3MNWB 5I1IH 3QA3A 4RGMB 3FONB 5A2IH 3BDXA 4O2EB 2YD6A 3EW3B 1OF2B 2OXGA 1A6WL 4XCEB 4YE4L 5DVKA 5FOBA 2ZCKL 4FTVB 3AROA 4OSUL 4QHNA 2ZZUT 4Y5VB 4P23D 5C0DA 3MV8E 1RVFL 3UJTL 5I15H 4M5ZH 4YDKH 1GZPB 2EKSB 4O58L 4Z7WE 1TJIH 4OV5A 3RWCB 1FG2B 4I3SH 1R5IA 3EOTL 3MLZL 3CSYA 2OM5A 1U3HC 1QKZH 2A2QT 3D87B 1C12B 3BH8B 1D9KD 1T89C 2HAZA 3VFUA 4C54A 3R1GL 4X9HA 1AGDB 2PTUA 5D72L 5JDJA 3C9NB 4DW2L 5C6PB 4PJCF 1MREL 3TBTB 5HHOA 4P2RA 3QP3A 1B3JA 4UT7H 1J10A 1I9RL 3WSQL 5GS2H 5DD3H 4MD5A 3VFRB 1MHEB 3SCMB 1MJJA 1TLKA 2D7PA 3AFLA 4H0IA 5GSRB 4I3GA 1P84K 4DTGH 3WS3B 5DDHB 2OK0L 4L29B 2PXYA 1CICB 3QT2A 1U6AH 4FQ2H 3FAXA 1N7ML 5EU7E 2XQYG 3L7FB 5IBUG 2NXYD 3BE1H 4G9FA 3LB6C 3QJFB 3QI9A 5EU5B 2IC2A 2FO4B 4C4KO 3DTXB 3C60D 3PWPA 1RUKL 1UZ6F 1CLCA 3RL1B 3WFEL 4MLIA 3VRJA 4V2BA 1GGUA 3VFGL 4AYFA 4PJBB 2RGSA 4N1CA 4X9FA 1OM3L 3V4UH 4CKVX 1IGMH 3OAYH 2FIKB 2NY4B 4OLUH 3GSNH 5DJ8B 1GCFA 4FZEH 1DVFA 4WO4C 5F9WC 1BFVL 5I2IA 4XP6H 3ARBA 4HFWA 4Y16C 1V3KA 4A6YB 4UT6L 4NQSA 4HKZB 5ICXB 1XGUB 1V3LA 1Z6JT 4PB0H 1DBKH 3FQWA 4RRPG 3R8BB 1ZSDB 1Z3GH 4I77L 2DIJA 1KUMA 1J05A 1JJUA 4GKSB 4K94L 5M94B 4UOW1 5IEKB 3HMXH 5ISZE 1BF8A 1KCRH 1WK0A 3T0AA 1CCZA 3D2UB 3N9GH 1RMFL 2HVKA 2O5XH 4OIBA 3CD4A 4LSDA 2ZG2A 1ZHKA 1S7XB 2O61A 2APVA 4QGYA 4Q97A 2RHEA 1NC4A 3EZ8A 4H88L 1KTRL 1MCBA 5C7XL 5LBSL 3LN5B 4G6AD 2BVTA 4PRHE 1WBXA 5C09E 4PJEA 4PV9A 1JGVL 4LVOC 1KIRA 3ZYJA 5HVWA 3MBEA 3GKZA 4N9GB 3VFNB 1FP5A 4PYGA 1JZ4A 3HUJF 5D7SL 3KJ6L 1VDGA 1JZ6A 3CC5B 3WKMH 1INQB 2CIKA 4Y4FA 1FGVL 4D8PB 4LVHB 2F74B 1B0GA 5B22A 2MHAA 2CRIA 2VDKL 1R3JB 4RMTA 3BO8B 2ZUXA 3H9SA 4LU5L 3C5JB 1MWAL 3DSFL 4ZQKB 5B3JF 1ONQA 1KJMA 3P11H 4QRPB 4L8BA 5SWSB 5HDQH 5DXWA 3V79C 1KACB 2YD8A 3VFVA 4P2OC 4S11A 4G8GD 3JXAA 1V7MH 1HDMA 1LK3L 2OMBA 4M1CD 4HWBL 2G9HB 4I0PA 3Q2CA 4MS8C 2EDXA 3MLXH 3OKOA 1T1WA 4Z95H 1P6AB 2B20A 4KJWC 3VWJC 1I9JH 3I6KA 1CT8A 3CPLA 4N0FA 5IVOA 1PG7L 1IAIL 4U1GC 5T1LD 1QSZA 1MRDH 2ZSWA 4PJAA 3F62A 2Y6SD 4TULH 4XMPH 3NPSC 3QNZA 2RB8A 2ZUQC 1FH5L 2EDHA 1QVOA 1RZJH 4GS7B 5TH2A 5C2BH 1BF2A 2EDQA 3O81A 3NCMA 5IMMB 3EYFA 5HYFA 4LSVH 5FUCC 1JPTL 3D5OF 3JWOC 5B39A 3PWVB 2FJHB 3VGAB 2Y4SA 4QHMB 2UYLA 3GSOA 4YHML 5TPWH 1EBAA 1PG7X 3NFPA 4OUUB 3STBA 1ZXQA 2IGFH 3QHTC 3MXWH 4BH7A 4ALAH 1BIHA 3VXTA 4KI1A 2EECA 2IPUK 2LVCA 1X5JA 5CILL 1CLOL 3RTQA 2DQHH 3VW3H 1I3GL 5GGUB 1YPZE 3RDTB 1QSEB 5JW4N 4PJ8C 1P69B 3OAUH 1K2DB 3OX8A 3TO2A 3IFNH 2GIYA 1OAUL 5CP3H 5TF1H 3JWDC 2C26A 4KDVA 1E6OH 2VE6B 3T0ED 3O8XA 5TDPB 3PHOA 4PRBA 4NM8H 1SVCP 1T20B 3ARPA 3O9WB 3VI4F 2VKXA 4JFDD 5D7JC 2Y5TB 4NCDA 1IZKA 1BIIB 4HLZH 3MRDB 2WUCH 2BP3A 4YHLL 1KJ3L 3WD5L 5IB3B 4W6XB 4ZUUB 1UXSB 1SHMA 3UAJD 3IXTB 2LQRA 3KPOB 1LNUA 4JM2F 1MEXL 1M7IA 5TGBB 2X10A 4TNVK 1QFHA 4PGEA 3O2VH 4JO4L 3DJ9A 4JM2D 4X80L 1BECA 3L3DA 2JIXA 1ZVSA 3KPQB 2CLZB 4KTDL 3IFPA 1A1MB 1XIWD 1PGRB 1HILA 2VWEC 1RFDH 2YPLA 2EIBA 4LDLB 5KSAA 5D5ME 2P24A 4MB4A 3AXLB 1T04B 1FZMA 4CAGA 3TCXA 1MLBA 1U8JB 3LH2L 4F37K 3MA7A 3FTGB 3PP4L 3WIHA 1NFDE 3NCYS 1AC0A 1OPGH 1U41A 4FQ1L 3EGSA 3FQNB 5E70A 2A77L 5E2TL 1VACA 1BZ7A 2E6JA 3IDGB 2WIMA 4L4JA 3IRPX 4PJDE 1DQQB 4QOKB 5AG9A 4EBQL 1QA9B 1SEQH 3CFBB 3THMH 1SEBA 4HS3A 1DBBL 2CGRL 3QNXB 3CGTA 3E6HA 5I1GL 4U7KA 4GRLB 1KN2H 5KJRH 3QR2A 4JCLA 5IQ9A 1N6QL 2ZSVB 3PV6B 1E6JH 1MVUB 2F5AL 3VFPA 4JHZA 1Z9MA 5FUZL 4DGVL 3PWJB 3ARDB 4WUUA 1FLTX 4YDJA 2VXTH 4PGBB 1ZT7B 3CX5K 4KKLD 5EU4A 1XCTA 3O6LL 3P9MA 4JFXB 1ZWIA 1DUZA 5F9OL 2I07A 2QJDA 1CXIA 4JG1H 4UZGA 2R56L 3OBAA 1G7QA 1CDYA 3B83A 1H8OA 3S3PA 4QHUB 2H8PA 5FOJA 3RVWC 1JF1B 4TUOA 4P2QA 3MCLL 4XP1H 4Z7UA 4KZEL 3E0GA 3W0WB 1J0IA 4YQXH 1R3KB 3ZT7A 4CUCA 4U6VL 5FHBL 3C8HA 1OP5K 2R69H 4NN6C 5BVPL 3MV9E 1VB9A 2AEWA 1XF2B 1NDMB 2A9NH 5ENWA 5HGAB 4QTHB 4WU5B 1S9VB 1S7QB 2BK8A 4TPRL 4S1SH 4UMGA 3JVGA 3V0VA 3VXSB 4ZUVA 3N85L 1BJ1J 3BZFA 3V6ZA 4Y4HC 1J86A 5DFWH 4XP5L 2H1PH 1BJMA 5DQDH 5EC2A 3U7YH 3GUTA 2GJZA 3RPKA 2R0LH 2AEPL 4BELD 4NYLB 5I17B 3ZL4H 4M48L 5ELIA 4LRIA 2APXA 4I9WD 4DOHB 4ZFGH 5JW3H 2CLRB 3MMEB 2VERN 3OKKA 5D1QB 3EYUH 5FYJD 1CE6B 4UINH 4M9OA 4GJTB 3VGHA 1J1XH 5DRXA 4NRYB 1R0AH 1N5AA 3UXFA 1K8IB 4RNRA 3LHPH 4ODHH 1GGTA 1KTKE 1J1OH 4HV8A 2CRMA 1IAKA 5EZIH 5EBMA 1WEJH 1WICA 4FFYH 3MACH 3DUSA 5I74B 1E27B 4LSUL 5TQ0H 5FYJU 1KGCE 5DJ0A 2BVOB 3EO1B 2X70A 4F9PA 1CE1H 3DURB 5IW1B 4PS4H 1CDHA 2F15A 4WI9A 4ZNEA 1I3UA 1NAMH 1S9YA 4R7DA 4OCNC 5ESQA 4MJ4A 3FO0H 3SGKA 3HAEA 1CGSL 1D6EA 3G5XB 3QXVA 1ODAA 4L9DA 1MRFL 4KKBC 3SDXB 4Q6IC 3EOYG 3FQXB 3NA9L 5C0AE 4ZPTB 5HHPB 2EC8A 2DL2A 5E9DD 1HNGA 3S9DB 4U7SA 3KR3L 3V5KA 4ZAKB 1PSKL 1MLCB 5IQ7H 3L1OH 1CFVH 1QSFE 3ARGB 4GH7B 4JY4A 4X98A 1UKTA 3HMWL 1A6TB 3QG6A 3UP1A 3EYSL 3U4EB 3GSNB 4N0UE 4Y19D 3DO7B 1RULL 2K3TA 2X4UA 5IB1A 3BT2L 4K2UH 1FJ1B 1YYMH 3P4LA 1FL6B 4RBPK 4QXTB 4Y2DB 1ZHBA 5DJXB 4PGZA 2HG5B 1JGUL 1GOGA 1HHKB 4UV7L 5INDB 3MO1A 3SE9L 4HG4K 2CUHA 4D9QE 3L3GB 2FLRT 4BQ9A 1X4ZA 3X13A 2FX7L 5I8OH 1A4KA 3M07A 3AAZA 4HWUA 1Q72L 1ED3B 5ACZA 1Q0XL 4LGRB 1YJDC 1UADC 1VFAB 1AXTH 1QLFA 1QBAA 3LSOB 4D3CH 4D0CB 2QQQA 3TH4T 4QRRD 2NY2C 1T22B 2PF6A 5D1ZC 4KJYA 4LSTH 4NC1C 2XNAB 3U1SH 1OW0A 5F96L 3QQ9C 5I71C 4KTEL 2GYSA 5C9JB 3GNML 1JYWA 1EJOH 1DCLA 2VYRE 5KG9B 2VLKD 3QPQC 3X11A 4DEPB 3BSZH 4MA3B 4K8RL 1OGAB 2X4NB 3K4DA 2Y72A 1TTGA 2J8UE 2ATKA 1KCSH 1FAKT 2NY5H 3AY4A 2XG4A 4G43A 1CS6A 4PJXB 2VOTA 5FUOL 5B21A 5LCVL 3L3JA 3WUWA 4NRXB 1NCBL 5C0GB 2VQTA 4ETQB 2VLJB 2SEBA 4OLZL 3WBDA 3K4ZA 4HS8H 4MD0A 4NM4L 5T1KD 1I1AB 3GO1L 5CGYD 3NACL 1QNZH 5CJQL 5EO9B 4R26L 5HYEA 3HZYB 1QR1B 3GMLA 1PX3A 2ATPB 5F7KC 1JRHL 3ZKQD 1DQJA 2GFBA 1C7SA 2RR3A 1G9MH 4OCMC 1G7HA 1KB5H 2FDBP 3RUGB 3UROR 1BLNB 3UDWA 4H8WC 4MJIB 3ABZA 3NN8B 4L4VB 3RBSA 1KBGH 3G04A 4WIQA 1BZ9A 4WVRA 1BMGA 3U4BL 2QADB 5DD1L 4NKIL 1E4XI 4EUPG 4ODBD 4HS6B 1AXIB 2XRAL 1ZA6A 2I9TA 4KJWD 3MV7B 1FFQA 3QO0B 3QBTB 4IEFB 4TNVF 1ZLWK 4IRZH 5D71L 3WLBA 3FN3A 4X5LA 3TN0A 4LF3A 4AJ0A 2R2HB 1M6OA 4BKLB 4JHAH 3O6FB 1GHFH 4NO3B 5JO5B 2OQJA 4HKXA 3TV3H 5ANME 2KKQA 1N4XL 3KPTA 3TNNA 4CL7A 4P3CL 1IGJA 3RWEA 4OCRH 3OJVC 2AI0L 4OD2A 3AM8A 3ESUF 4KGJA 5EBWA 1N64H 2BC4B 5I8EA 5IR1A 4DK6A 3SOBL 3HI5H 1OAQH 3SDCD 5GGSA 1MAMH 1T5WA 4WFFE 3JV5A 3IDYB 2ICWA 1M4KA 4HWEL 5FM5M 2A83A 2Z35B 4K7PY 4TOYL 2MTPA 2R29L 1RZKC 4ZSOB 5D8JL 4X4MA 4LPTA 5CIPA 1LE9B 2CRYA 1A9EA 5C0CB 3RFZC 3HC0A 1QYGL 5HI3C 1NFIA 3PWNA 3MOAH 3VGDA 1XR8B 3IU3B 3T0BA 2DQFB 3PABB 4R7NA 1ZHLA 2A6KA 3W82A 2FX9L 3TBWB 2AGJH 5GRUH 3Q0HA 5E8OB 1FNLA 1CDUA 1XGTB 1GL4B 5KVMC 2F19H 4I18B 4NO0B 4P5TB 4R2GD 1KJ2A 1U8PA 4JRYE 4X4XA 3Q5TA 2L4OA 4PLOB 3CSYB 1L7IH 4IOSD 4PJGA 1J8HB 3CDGA 1Q1JL 4KRMB 1P2CA 4NOFA 1CD1A 1D5XA 4EIZC 2B1AL 5AD0B 5JORA 2ZPKL 3BZDA 3E8UL 1VGEL 4LHUG 2QQKH 4O02H 4HC1A 1U2HA 4Q2ZA 2X7LA 4K3EH 3MROA 3U9PH 3B9KA 1BAFL 4JFFE 4WWID 5DGRA 3ULVE 4M62H 4LCIH 4ODUA 2UY7A 1MJJB 3I6GA 4L4TD 1FYTE 3OXRA 4FQHA 4TVSa 1CU4H 4HD9A 5IJKC 2QSTA 4OM1H 2DQIL 4NZTL 1ROWA 4P23B 5FDYA 5IFJB 3BIBX 1PKQB 1UM5L 1K8DB 3ROLB 5FYJH 3G6DL 3TJHD 1TNMA 4W6YB 4Q6YA 5CEYA 1D9KB 1WAAA 1A2YA 2A1WL 5E4EC 3OAZK 1WZLA 1ZKAA 5TDNA 3VJ6A 2ARJB 2DTMH 5EWIH 5KS9A 2EE9A 3UTTA 4CVWA 1BD2A 4LSPH 4XH2A 1JPFA 2WUBH 4JDZA 1H5BC 1C1EL 1IGFH 1DVFB 3AB0C 3UBXI 5CD5C 4NNXB 4G8FA 2LAGB 3W11D 3UPCA 3ARBB 4HFWB 4KK8D 5I0DA 2ED7A 1QEWB 5SV4A 5FM8A 2YK1H 2BSED 2MCPH 1UQSA 5T3ZE 5AZEH 2XI9A 2C4FT 5FYLE 3X14B 4HXBH 3S37H 4DAGH 1T6VN 4EI5C 1ORQB 2V5TA 1JP5A 5E8NB 2H6PB 1EEZB 1PY9A 3RVWD 4JGUA 5E94B 3MOQA 4QHLB 1FE8L 3WIIL 4ISVA 4FXLA 1HSBA 3OKNA 4QXWA 1WIOA 5DZNA 4RIRA 1FIGL 2CDEA 3T3ME 1JWSA 1EEUA 1RIVH 3TLRA 2YD4A 1UB6A 2GHWB 3MBEB 3VFMA 5GHWL 4R96A 3KLHC 3CH1B 2QR0A 5I75C 4P49A 2VITA 4DKDC 3QUYA 2HKHH 4X8JB 1NFKA 1T0PB 3KPSE 1DBAL 3RX5A 1NJ9B 2PYED 1X5KA 1HYSC 2XA8L 5GJTL 5CMAB 5CBEA 4OIIL 3ZYOA 4FQCH 3A6CH 3QHZH 4RAVA 1MCOL 3ZYIA 1F3JA 4KJPC 4TRPL 2WIIB 3GMRA 2LABA 4X7FC 4ONGH 2FYYB 3KVQA 2UWEB 1IM9A 1TETH 1GGYA 5CZXC 1TCRA 3AS2A 3PDDA 2BRRH 4MQTB 4Q9CA 1F4YH 2DS4A 1VKXA 2RAMA 4HF5L 5DF0A 5HPMA 3OKOB 4P46A 1FNFA 5IVXE 5D1XA 4XX1G 1T1WB 4CU7A 4NSKA 4AG4L 3V5HA 3I50H 4CMMA 4N0FB 1MHPH 1T21A 3BAEH 1T2QL 3OKMA 2ZSWB 4LEXL 1IC5H 3HUJB 4P5MA 2VLRA 3ORJA 3BW9A 1ADQH 4MD4A 1DP0A 1EHAA 3O6MH 1JNNH 4I1NB 1QLEL 4QTIH 1A1NB 1XF3A 5EU6E 1F8TH 1QVOB 4FG6D 4S1QL 2NTFA 4MVBC