3WUWG

Kir3dl1 in complex with hla-b*57:01.i80t
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
286
structure length
281
Chain Sequence
KPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGGTYRCFGSFRHSPYEWSDPSDPLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Mutational and structural analysis of KIR3DL1 reveals a lineage-defining allotypic dimorphism that impacts both HLA and peptide sensitivity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 56
structure length 281
sequence length 286
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuwG03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuwG02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuwG01
3TBYA 3IU3B 1RJZB 2QHRL 1IGML 2XNAA 1BF2A 5C7XL 2ZOKB 1AI1L 3PWPD 5INCA 5CEZD 5EO1B 3RNQA 2VN4A 1WQVT 5J11C 1FVDA 3BVNB 1AD9A 3KPRA 5HYQA 2ADGB 2M1KA 2ZOLA 1ND0B 1UKSA 3ZHLA 3MRIA 4KHXH 4APQC 1ULVA 1YQVL 1YEFH 2AKRB 3QIBC 1SMAA 1TNMA 2N4IA 4YGAB 3NIDF 1Q0XL 4L4TA 5SWSD 4FQ1L 4M43H 2VZUA 1DLFH 4ZOCA 2X10A 1UB5A 3I9GH 4AG4L 2ICWA 6CGTA 4JJ5A 3ALWA 1FVCB 3LZFL 4IJ3B 2VZ3A 3I6GA 5HI4D 2GSIA 1EIBA 2XQYK 1UENA 4N0UB 4DWHA 2ZG3A 2YR3A 5DQJA 4S10A 4XCEA 4PP1C 2VXQH 3UJIH 5CEXA 5DVOA 3I6LD 3MV8A 1DQJA 3MBEA 2GKIA 3EYQC 3RHWK 5SWZD 1FZKA 5JDSA 3F8UB 3PWUB 3AXLA 4LBEA 2GTWB 1KULA 3U1SH 5M95B 3ETBF 15C8H 5J13C 5CZXD 4JRYD 3KHOA 1JPGA 3GJFK 5ANME 3UTSB 3QRGL 4XVTL 2X4OA 5I1IL 1R3LB 1FDLL 5KN5A 3RPIA 4GKNA 1JE6A 3T2NL 1PLGH 4JG0H 4X0KB 3SDXB 1BFOA 1ZT7B 5DR5L 1INQA 2AABH 3L7EB 5TF1H 4NCC1 4HIHA 5I75B 1WWBX 4C83B 4BQ8A 4Y5XA 4H1LB 4B0MM 3QEHA 1LEKA 1B0GB 2PXYA 3HPJB 3B9KD 3Q3GB 4H8WC 3D69B 3OKMA 4OF3A 1VKXB 2V5TA 1F6AB 3QHZH 4WENB 5DJAA 1OQOA 1ED3B 4LLYB 1YEEL 3BPOC 4QCIA 1MVUB 4XAKE 5BRZA 4C56A 2NW2A 1Q72H 5F93C 5F7DA 3IRPX 5I1DB 4UT9L 3GFUA 2P48B 3O3AA 4J1UA 3OTTA 5BQ7A 2GJ6B 1FC1A 2NX5B 5EDXA 2R39A 1I1YB 4OFIA 4EXKA 2R0ZH 4KH2A 4P46D 5DJ2A 3V4VH 4JZJA 4JN2A 2JCCB 3V95A 5E0QA 2VDKL 3HNSL 1A1NB 4PJ7F 5ESVA 2DYPB 1DSFH 1U91B 4XPGH 1FZJB 4P2QD 4XPAH 2ZP0T 2QQLL 1BOYA 5D7IE 2YPLB 1HNGA 5CKGA 5LGHH 4ENED 1CS6A 4XCYB 5K33A 1HQRB 1FL6B 2V7NB 4X8JA 4M1GL 4PJEF 2FJFA 1E6OL 2AXGB 2R4SL 4P9HC 3MLXL 5L7XL 4CN4A 3ARGB 3VXRA 2IAND 3QIUC 3LQAH 3IYLW 1EDQA 3LB6D 4M7LL 1WIPA 1W0YT 4M7KL 1T1WB 3L1OL 2IH3B 4FTVB 4Y8DC 3DO7B 4MNQB 2Y06H 3GMQA 2WUCH 2X1PA 3N85L 4OV5A 3EYUL 2DL9A 5HYIA 2DQFA 4IOFD 4D0BB 3UC0L 5KVFH 1OWRM 4JKLA 3WLBB 1JBJA 1HINH 2VLME 1RZIA 1BQLH 4BH8A 4LLWB 4OZIE 4K7PH 4NKMB 4JZOA 4MLIA 4OZGF 5JOEA 4XBEL 4S2SB 1U58B 3ARZA 2CO6B 2P47B 3O9WD 1UXWB 3U4BL 1T7WA 5KSAD 4KJPC 3QWOB 1OAXH 4FP8H 5D70L 1PFCA 1NGWA 4I77L 2K1MA 3HC0A 4NQED 4KK9D 1GGBH 5LJYH 4G43A 1IZJA 4I18A 1PKQE 2MWCA 2V9QA 5CD5D 3DUSB 1WLHA 4XBGA 4HS8L 4DGVL 1WZ1L 1MSPA 4KXZI 3OXSB 3GSVB 4LPCA 2PYEB 5CGMA 4MA3B 1DBMH 5BO1H 1Z0MA 1X5FA 4MX7A 1ODAA 2NXYD 1S8DA 1DP0A 1UH4A 2DQCH 3HE7B 5JIIA 1KTKE 4DZ8A 4Q58C 4UBDC 2VERN 5E9DD 1AFVH 4BFEA 5DD3H 1JPTL 3WIHL 4LEXH 1SM3L 4NO0B 5H37H 2VDML 3KPLB 2DM7A 1R3KB 3MRCB 4WTXA 4LNRA 4KV5E 1Y6NR 1CXEA 1QEWA 5B38G 4Y2DA 1KIRB 4UTAH 3MMEB 3TIEB 5HVHB 4Z0XA 4XHJD 3FQNB 3HI1A 1NGYB 5HTSA 4QY8A 2EO1A 4O5LH 1ONQA 3ECBB 4CL7A 1HHKA 4JJHA 5AAMA 2KUTA 1JI1A 3BKMH 3ILQC 3TBTA 2PR4L 1K4DA 3NVQA 2DQGL 3WD5H 1JWUA 5I8CA 5EIVA 5E8PA 4HIJA 3RUGA 2FJGB 4Z7NE 2BVPA 3MJ7A 4JKWA 5EC1A 3ET9F 4UQ3A 1TZHB 4ZAKA 1NCBL 2D4FA 3O11A 4AQOA 2OTPA 4JN1L 1G1YA 2GK0B 4PG2A 1KC5H 2N1KA 3L5JA 2HVKA 4XTRC 5EZOH 3AMLA 3L5IA 5C0DB 1I7TB 2CLZB 1YYLL 5HDOA 4XVJL 5FUOL 5I76A 1U8OA 2V2WB 2LAAA 5KBNC 4O2FB 5J1SC 4FQJH 3Q6FA 2UV3A 4HK3J 4HSQA 4N0CD 4UB0L 1G9MH 1LD9A 3F7YB 3TZVA 4FQCH 3PWPA 4NQXA 4TSBH 4TSCH 4XX1E 3RY6A 5D6CB 3TNNA 4CVZB 1IM9A 4PY7B 1PZUB 3TLRA 3IETA 1NFDF 2NCMA 4LHUA 4F9LC 1MCPH 4IIQB 4JY4A 1Y6KR 4OAWA 5D72L 1NGXB 1F2XK 4M48L 1ZA3B 2COQA 3HZYA 3OGCB 3QNYA 3DROA 3HZKB 4NC0B 4P57A 4EN3C 1QTYT 4GAGH 4CNIB 4JCMA 5E99L 5CHNA 4CVXB 1JRHH 4F58H 1W0VA 5SWSA 3S4SB 4ZPVB 3C87A 5L0QB 2DL2A 2F53A 1A5FL 4HWNA 3DTXB 1H3PH 1CU4H 1LEGA 5J1AB 5DD1L 4K23H 1WAAA 5FK9B 2VOTA 1U3YA 5DJ0B 2FBOJ 5DJCA 4NJAL 1KLGB 3V0WH 1NAKH 1FYTA 2RCSL 4RQQA 2NTSP 4YX2L 1EGJH 1L0QA 1IEHA 5SWZA 2DWEA 3W9DA 3HRZA 3RWFA 3TV3H 5EO0A 4X6FA 1XZ0B 4NFDA 3QDGB 1J05B 3PHOB 1YECH 1QFWI 1BJ8A 4M5ZL 5DHVB 1TZIB 6FABH 4G7YH 3NIDE 2DF3A 1VADB 4Y19A 4ONOA 1D6EA 3QQ3A 4JRYA 5H94A 1KIPB 5C08A 4ZYKA 2X4SA 2X1XR 4YXLH 1YMHA 2VE6A 1H3TA 2Y23A 3SDAC 2Q7YA 1MWAH 5DA4A 4BZ2L 5ISZA 3SDDC 3L9RB 1QACA 2ICEB 2XV6B 1OGAB 4BK5A 4WI5A 1TJHH 3L3GA 1ADQA 3SE9H 5ILTH 1ZKAA 2VLJB 2AV1A 4OLUH 2A77L 5D93B 4QTIL 1K8DB 1PJ9A 1V8HA 2XZQH 3B9DA 4DOHB 1KB9J 5GJTH 4YE4L 4YBLC 2WWMD 3C6SB 1FCCA 4U3CA 4ZNEA 1CF8L 4XWOC 3A6OA 3SKOA 1W8NA 1A7OH 3DVNA 4MAYB 4RFEB 5C0FB 3I02A 1EUTA 3LSOA 5KS9F 2YMXL 1MPAH 1WK0A 1XGRB 4XNYH 2R1XB 1FLRL 5E6ZA 1WCBB 1FAIL 5GS3A 1D6VL 3CU7A 1E4XH 4GRLD 5FYKE 3EJYD 5IK3A 4YQXL 5CJ5A 4P2QA 3L3IB 4TRPL 5JHDB 1KJ2L 1VDGA 3O4OC 1BX2A 4U0RC 4LCUA 3REWB 3TC9A 4K9EC 5DUBA 5TPWH 4LKXA 3T0AA 3U9PH 5IV2A 3OKEB 4N5ED 2J6EH 2CK2A 1ZWIB 4F7TA 2X4NB 3MACH 4HXAL 3UAJD 2FHFA 1BJMA 1DEEA 1I3GL 3DGCR 1TETL 2A6KB 3VH8A 5D6DC 3EYOB 1T2JA 1IKNA 4XNUL 3O6FD 3QJFB 2G60H 4PYGA 2IMNA 2I24N 4NYLB 1OSPL 2B4CC 1VEPA 1Z3GL 2QQKL 2R2HB 3PWNB 5ETUB 3BKYL 1NMBH 2DDQL 2BNQE 2R4RL 2MQ3A 1YNKL 4X99A 5E94A 1EMTH 1QFWM 2PW1A 4PJ7E 4RFOH 5D8JL 1MWAB 4NQDE 1A9BA 3KPPB 2WP3T 4EZMA 3UYOD 2Z8VC 3MC0A 3CFCL 1K2DA 4WWKB 4TSAL 1XR9A 1CVSC 1RJYB 4G8IA 3DYPA 5KOVC 3WN5C 2E27H 4PJEE 3WDHA 5KSAA 5C09E 3B2UC 3VDBA 1LE9A 5CMAA 2ZZUT 3BMVA 5C0BE 3E6HA 5I16B 3U4AA 1KCVH 4Q9RL 1BIIA 2ZSWA 3CVIL 1T66C 2AJYL 3IXAB 4NNYB 4OFKA 2O61A 4NPYA 3MCLL 4JREC 4OLXL 2XZZA 1YMMD 5DEFB 2LU7A 3WSQH 2MQ0A 2BVYA 4M93B 5DD0H 1NPUA 2VR9A 1GGCL 3SE8H 2CDFB 1UWGL 4ZODA 4P4RA 4RGNC 4HUVB 5EUKB 3IFOA 3O3BA 1KOAA 5GGRA 4OZGE 4ODXA 4S1RH 2A9MH 5IF0B 2R0LL 2PTTA 4BJLA 1A6AB 4HS6B 3KPNB 3FZUC 4J6RL 4PJ8C 2WBJA 2H1PL 1I7ZB 3SKJH 1DLHB 1OAKH 1A4JA 4YFLI 4E42A 1MY7A 5DEGB 2XZCH 5IBTH 5ALBH 2CDGB 4WW2F 4ZO6A 3SBWA 1PSKH 4MCYA 4RNRB 3A67L 2P8MA 2IF7A 1KN4H 4YHKH 1NFIB 5A2FA 5FA4B 5F7HA 1LILA 3DX8B 3DXAA 1H0DA 4LP5A 2DQUL 3WS3A 3P11H 2X4UA 5T1LD 1X5AA 2HP4A 1QO3A 5DRZA 1RJLB 5E7BA 5H2BB 2IAMC 1G7PA 1B0RA 1RK0B 4ZFGH 4DFHA 1UG9A 1QKZL 3O2WH 3EOTL 1A7RH 4BQCA 1BD2A 1IGFH 2XWBB 4Z78A 1HOCA 2HVJA 4NP4L 1I9IL 5TE7L 4NQCA 1E0OB 3PWJB 4NRZB 3H0TB 1YEHL 4YDJA 1CI5A 1A4KA 1WICA 1ZHBB 2A6IB 3AU1B 2DIBA 5KOMC 4QRQA 4F7PB 4XP4L 4BSWB 3FKUS 3DHMA 4F7MA 3BH9B 3OJ2C 2EXYD 1G84A 1I1AD 1VHPA 3CC5A 1OM3H 3OBAA 1U9KA 3E6FB 3VCLA 4CU6A 5IB2B 2D9CA 5GRUL 5MENE 3BGAA 3NCEB 1BZQK 1XIWA 1CFQB 3CDCA 5ID0B 5I1KH 5C2UB 2EH7L 5D1QC 5L6YL 2EKSA 2YSSB 3GMLA 35C8L 2KZWA 3RBSA 3T08A 1J88A 4JVWA 3V7AE 1OW0A 3QUKB 3IDIB 4Z95H 5DMIL 3RTQD 1HNFA 3VFRB 4GBXD 4OCRL 5INDA 1F90H 1U0QA 2EXWD 4J8RB 1KJ3H 5CD3B 5IUSA 3FQRB 3VFNB 1E4KC 3T0EE 1A7NH 4MMZC 5D2NC 1CICC 1RK1A 3SE4A 2AJZB 2B5IB 1NFDE 3MOBH 3D2UD 4R4ND 4D0CA 1MFDL 3N0PB 3B5TA 4OZ4A 4A2LA 4G5ZL 2R1WB 5GZND 3GHEH 4JFDA 4DGIL 4PBWD 3CNKA 3RWHA 1S7TA 3PDOA 3T3PF 4Z76A 2W65A 2ZNWA 1KCSH 5FUZH 2CR6A 4Z7WF 5DK2B 5ABDE 5FA3B 3CX5J 5CEZL 4ZFFB 4OCXH 3HMXA 3HUJF 3P0VL 2NLJB 4TUKL 3KPOB 4YDKH 2NY0D 2RGSA 3MXWL 4D8PB 3V6FB 2DYPD 3UTZA 1BM3L 2XKUA 1CLCA 1RUMH 4GT7A 3KPSE 3LMJH 1J86A 2YPLD 2BRRH 3LEYL 1NL0H 4QRPB 3K8MA 1B0WA 2OJZH 1L9NA 2D31B 1T4KB 5HGHA 2HLAA 4HXBL 2Y5TB 1W72B 3PL6C 3VXUB 4K7FB 3P9LB 1LK3L 3QISA 4XGZA 4IM8A 2DQIL 4P4KC 1MF2H 2EDKA 1HH6B 2Q8AL 2H2SC 2Z31C 4EQ2A 2EE9A 3OAUH 1KEMH 3HR6A 1I7UB 5A3IC 1KELH 1F42A 1JYXA 3M1BB 1N6UA 5BS0D 1NUGA 1BOGA 2XPGA 4ORZC 4U1GB 4AEEA 1I7RB 3MLPA 32C2A 3BPCB 4OKDA 1AQDA 5HHMB 4GW5B 1T04B 2H2PD 3VWJA 1ITBB 1P2CA 4OZFH 1QSFA 4PJXF 1S7XA 3O3EB 2MCPL 1B4JH 3GSNL 4GG8B 4NSKA 4HKBB 4WO4D 1TTUA 4G9DA 2FCBA 3BESR 1UQSB 2C4XA 5L9DH 1H15A 3VGDA 3UTTA 1JF1B 2BNUB 1MNUL 4V1DB 4R2GB 5LXGL 3EOBB 3G04A 1MHCA 4O2CA 4PLKC 2J88H 3MV9D 1H3GA 5HHNA 4LCCC 1OWWA 2OTWA 3LV3A 5KS9E 2O5XL 3D39D 2C3VB 4HX1A 5MERB 1XGPB 2PYED 3W0WA 5FYLE 5HYJA 1KB5H 5GSRB 3MLUL 3DSFL 3C5ZA 4XNQA 3ZDYF 4Z77A 3VXOA 1D3CA 4KRPC 4X4MA 4JFQA 3HE7D 3LY6A 3KYOB 1JUFA 1F5WA 4YO0A 3HS0A 4P3DB 4DUXA 4KK8D 5ANMB 3SGKA 4OI8A 4Y5YB 4K8RD 3DBXA 3NGBC 5ITFA 4KTDL 5A2LH 5IFHH 5FGCB 4NWUH 5T33L 4XXDB 7FABH 1BHGA 1W0WB 2HTLC 2FH8A 2VAAA 3L3KB 1MCFA 1J1XH 4JFXB 4OLZH 2ZSVB 3Q6GL 2BVQB 3EYFA 5CIPA 3W11C 5DRNA 3C6LB 4HIXH 4OCYH 1TJGL 2R2BA 4G6KH 2GJZB 2A6DA 1ZTXH 3WXWH 3VRJA 3TWCL 3GJEB 2X4RB 2Z35A 4HCRL 5DO2D 1LE5A 4PUBL 1FV1B 3JTSA 1NDMB 3BX7C 3GJFA 4XMLL 1FYHB 3LN5A 4OIIH 1U8QB 2WWKT 1MFAL 1N8ZB 5I19L 4PB9L 3MYJB 3IXTA 2EICA 3OR6B 2CUHA 4BA8A 3MRRB 3OF6A 2D7PA 5FKPA 4BQ9A 4OZFB 1TJIL 5EBMA 2HN7A 2F54D 4HV8A 1KTDA 4P5TD 5BXFA 1KXTB 2EEBA 5C0RL 5HGDB 2I60H 3DO3A 1BVKB 3P9MB 3T4YA 3C8HA 2DOCA 4KDTC 1RUPL 4LVNB 3QA3B 3RAJL 4Y16A 3O8XC 4L8BA 3UJTH 3MBXL 2ENYA 2A73B 2P5WA 1N4XL 3C60A 5E8NB 4UNVA 1DL7L 4ZOBA 3PGDA 1FFNA 5MHSD 4JFFE 2X09A 1HHGB 1X5YA 3FB6B 4OT1L 3SDYL 2MPAH 1RJZA 1RZKL 5IGXH 1O5DT 2BDNH 2ZOKA 4L8CB 2OL3L 3ULSA 5EO1A 3CSGA 3GMPB 4J4PA 1XF2B 3BVNA 5MEPB 5JXEC 2ADGA 1ND0A 4UIKL 3FO0H 3WLWD 4G9FE 4ZQKB 2AKRA 4P2RD 3LKRB 4PJDA 3GKWH 4CN1A 2DIAA 3IJSB 4ZG1A 3V5KB 1KTLB 4GXVL 3UTQB 4FHBD 2BFVH 2R2EB 1MI5D 4CADB 4JM2D 2BNRE 2JE8A 1KCUL 4XMKL 5KTEL 3LDBB 4OJFL 1FVCA 4UTBL 5IBLC 2FECI 4PGEB 4U7MA 2DTSA 4H20H 4N0UA 2W91A 3CH1B 3MO1B 1MCQA 3O81A 4NHUB 4WHYH 4GMSL 4WTZA 1IEAB 1BEYL 1A6ZB 1CDGA 1MCJA 4RGNE 4XC3L 3QUZD 4LAQL 4LLAA 1LO0L 3QXTA 1WSST 3PWUA 4G6AD 3FB7B 2AJSH 1NCCL 2GTWA 3HI5L 4ZTOL 5D7KE 5EG6C 4LVOC 3FONB 3UCRA 1TMCB 1CZ8H 2CSPA 4LPTA 3UTSA 1F4WL 2V17L 2VXTL 2AEQL 4H0IA 1MFEH 1AXTH 2MHAB 1R3LA 1LO4L 4AM0B 5AWNH 5CZVL 2R0WL 4OCSH 4X0KA 3F7QA 3SDXA 4OD1L 1ZT7A 2W60B 4UOW0 4LCWD 3L7EA 4IHOB 2HTKC 3H8NA 2VLJD 1E27B 4H1LA 1JZ5A 3U83A 5I74C 4D94A 1AH1A 1B0GA 5DD5H 3HPJA 3Q3GA 1FZOB 1XGQB 2W9EH 4LHUG 3D69A 4AL8L 2ERJC 3IKCB 1KCKA 3SDCB 1VKXA 4JM4L 4P49A 1JGVL 3BDYL 1F6AA 1UM4H 3OXRB 2X7LB 4G42B 4CAGA 1ED3A 5DUPH 4LLYA 1MVUA 3JBG7 4Y4HB 4CKVX 3FMGL 3U30B 5I1DA 5EORL 3N06B 3RDTD 4QOKB 4I3RH 3HA0A 3GGWB 4ZXBD 2GJ6A 2Z8WC 2DTMH 1LGVA 4L1HA 4GMTH 2NX5A 1I1YA 1KPVB 2D9QB 4NOFA 2CO7B 1XGUB 1WEJL 2JCCA 3MLSH 3KPTA 1A1NA 3OWEA 5GGVY 2DYPA 4PP2B 5I2IB 1ZSDB 1UKTA 1U91A 1FZJA 5DD6B 4UAOC 2X40A 2DS4A 5JIKA 2YPLA 3ALPA 3WO4C 3QAZB 1CIUA 5LGKA 1LQSR 4R9HA 4XCYA 1HQRA 1FL6A 2V7NA 1Z9MA 1YA5A 1KF9B 3A6CL 3CXHJ 2A74B 2AXGA 3OZ9H 1X9QA 4XWGH 2EIZB 3ARGA 3T3PE 4JQVA 5GSVB 1OTUD 1OAYH 4YHIB 3S34H 4YHPB 3UEZA 4EJ1C 4Z7WE 2EE2A 1T1WA 3QUXB 4OD3H 4AQ1B 4XI5C 4FTVA 3DO7A 5JQ6L 4MNQA 1FC2D 1U8MB 3HUJE 1A7BA 1JZ4A 4D0BA 3HAEG 3WLBA 5IEKB 5IMMB 4H88L 2VN7A 1LP9B 3RWJB 4LLWA 4NKMA 1V7NH 4OCLC 5IESL 4W6WB 3QG7H 2YS4A 3ARFC 5FV2A 4S2SA 2XKNB 1U58A 2DLHA 3W2DH 2EEDA 1UXWA 5FYKH 5J0BA 4Y4KD 5KW9H 3MRQB 3ARYA 4L1DA 3QWOA 3FN0H 3HMXL 4LK4A 2YPVL 3BXNB 2DB8A 4PR5B 3IFNH 4GAYB 3RUGF 1M05B 1F6FB 4WGVB 3DUSA 4X4XB 2B0SL 1NMAH 3EUUA 4LSRH 3GSVA 3OJMB 4LSSL 4TPRL 2R56L 2PYEA 1MJ7L 5E4EB 4MA3A 3GO1H 4FNLL 3ZO0A 5L2JB 2HFTA 5B21A 1GAFH 4U1MB 3HE7A 3U79A 4PJXE 1NCAL 4U1LB 1V3MA 4LEOB 1G0XA 3JV5A 5IP4A 4NO0A 3BPLC 4MNGE 1R3KA 3OV6A 5KANI 5HI4C 5B39B 1V7MH 3MRCA 4MNHB 3LPGA 2CXKA 5D71L 2VUOA 3ULUC 1NC4D 3GBMH 1KIRA 4HS3B 5IBUB 3MMEA 2E8ZA 2LTQC 3TIEA 4RX4D 2DBJA 4CN6A 2HYMA 1F13A 2F58H 1KEGH 3FQNA 3DI3B 3GSOB 5F6HJ 3VH8G 1NGYA 1S7QB 5FYKU 1TZGL 3KS0J 4H8WH 1FPTH 4XCCH 5JNYB 1SJHB 3JXAA 4HLZH 3FL7A 3ECBA 3ZDYE 5J11B 2ZCKL 5CZXC 2JELH 3CVHL 3VI3F 4LCYB 1I9RL 3QWRA 4O4YH 4APQB 4CDHA 2QSCH 2FJGA 1MFBL 2FJHB 3QIBB 4OLYL 4ZOEA 1TZHA 2F54A 1F8TL 1QG3A 1SJVA 3QI9D 1Q94B 1PG7X 4BM7A 3S37X 1WAAF 3B9KC 3D6GA 1CGSL 4U2YA 4NN6C 4HUMB 8CGTA 1CXLA 4D9LH 2GK0A 2FO4B 4FS0A 1L6XA 3JVGA 5C0DA 3U0TB 5SWQB 1I7TA 2CLZA 3KPRE 2RBLA 5I8KL 2ED7A 3C08H 1BQSA 1MQKH 1IGIL 2V2WA 3KLDA 4P9HH 4O2FA 1C7SA 4TTDD 3CX2A 2IADB 3F7YA 4AIZB 4I9WD 1HZHL 4L4TE 4P46C 2Q8BH 5D6CA 4CVZA 4HWEL 5KVGL 4PY7A 2QKIB 2R0KL 4GS7C 2MJWA 3MNZB 5J13B 4B7IA 4G7VL 4IIQA 4NBXB 2ED8A 1NGXA 4ZPTB 3TT3L 1ZA3A 2BX5A 3OGCA 3TYFB 2BNQB 3HZKA 1QLEH 4CNIA 2FATH 4CVXA 4NQDB 3U0WL 4LOUD 2VXSH 4MB4A 3D3VE 1HKLH 1NGQH 4FQXD 3SCMD 3S4SA 4HD9A 4ZPVA 4ETQB 3MV8E 4R26H 2D4DA 3LEXB 3MLRL 5IROC 3DTXA 1FBIL 3EDKA 3GI8L 4OFPA 5J1AA 5C09B 1H3UA 2DLTA 4N9GB 3IAQA 3ROLB 5C0BB 3TT1L 1HKFA 1UH2A 5FK9A 1SY6A 5JW4Q 5DJ0A 3BPOB 1KLGA 3T2QA 4F7EB 4ELKB 3MRDB 4U6XB 4HPOL 4IOFC 3WNLA 1BQUA 3EZ8A 4QTHB 3SKUD 4ELMB 1XZ0A 3QDGA 1J05A 1G6VK 5LVEA 3PHOA 2APVA 5DHVA 1TZIA 5D7LD 1VADA 1VB9A 3E8UH 1TQBC 3IU4H 3O9WC 2K3TA 3AGVA 1KIPA 4JFPB 2H26B 3ZKND 4XP6H 3CCHB 4JVUA 3HPLB 1HEZB 2ZG2A 4HQQL 1MCRA 4KK9C 2IPUG 3TA3D 5BRZE 4WEMB 3STBA 2I25N 2ICEA 3L9RA 4C56E 1OGAA 3V6OC 5CD5C 4JZNB 2VKXA 1N6QL 4D9RD 1JMXA 1A3LH 2VLJA 3B5GA 2IGFL 5CWSB 1K8DA 5ECJE 4DVBB 2NXYC 1IL1B 3QIUB 5T5NG 2ED9A 3MNWB 3G9VA 4NRYB 2GQHA 3C6SA 4X80H 1PG7W 4F37F 2NMSA 3VXUD 2ITDB 1SYSB 2Q76B 3HC3H 5HJ3B 1U8HB 2DWDB 3QFJB 1KT2B 1GGUA 4PV8A 4FQLH 4RFEA 4MAYA 4UOW1 5F8QC 1Q9OB 2WANA 5C0FA 1S5IL 2NPLX 1I8MB 3ZTNH 3V5DB 2FX8L 1XGRA 5DWUL 4J3XA 4ZUWB 1WCBA 5E8OB 1KSRA 4PJ5B 4XHJC 1OD7A 5BV7C 1IT9L 5HHMD 4JPKH 1JJUA 2EO9A 3VXRE 1AJ7H 4AIOA 3EIFA 1CL7I 1FFRA 5JHDA 3L3IA 3A6BL 5J8OA 3U7WL 3B9AA 2Y6SD 1CK0L 4ZTPH 3VG9C 3F62A 3UPRB 1A3RL 5ID1A 3REWA 3C09C 4Q7DA 5CBAB 3O2VL 3C9NB 4V1DD 2HG5B 4R2GD 3OKEA 1C5DB 2H45A 2W0KA 1EH9A 1SJXA 2J5LC 2X4NA 5IJVB 2DQDH 3HNTL 1YQ2A 3DRQA 3T1FB 3V52H 5IKCB 2A6KA 3EYOA 4G6JH 3QJFA 5FV1L 4NYLA 3WFEH 5GGVH 3PWNA 2R2HA 3BJLA 4WFFE 5ETUA 5DT1L 3CLFL 4NKOB 1MWAA 4AEHH 3T1WA 3KPPA 1CR9H 1OF2B 3B83A 3NTCH 3BO8B 4L3CB 4WWKA 5L8KB 1RJYA 3NH7H 4M7JL 5IQ7H 4KQ3H 4QRSB 5KJRL 1ZE3C 5AZEH 1F3RB 1SEQL 2XYCA 4PLOB 2NQCA 4Y4KA 4N0CC 4U05A 5DJDB 2OR8A 1CTNA 5EFIB 2Y4SA 5EA0H 4QYOB 5TQ0L 2ZKHH 2LVCA 5ADOL 1WC7B 3DWTA 5H8DA 1U8JB 5DRXB 3IDUA 1G7LB 3CZFB 4Q0XH 5E2UL 1WFUA 4PJIB 3IXAA 4NNYA 4XNZC 1R5IB 4TOYL 2J1KA 2FLRT 5DEFA 1YNLH 1FGVH 1GC1L 1JWSB 1NCTA 5JOPD 4KGLA 2Q3AA 4WIQA 5FYLH 2CDFA 1CGWA 4HUVA 2DKSA 4PRNB 5EUKA 2B2XL 2XTLA 2QHRH 1IGMH 5IF0A 1AI1H 2EDLA 1X5GA 4KZEL 3VXMD 5C07E 1LO2L 1PG7H 4PYHA 1A64A 4KAQL 1A6AA 4HS6A 3KPNA 3S37H 2Y7QB 1NSNH 4GKZB 2WZPD 4DN3H 4MXQD 4RDQG 1DUZB 2VABB 1AGCB 3RUGE 1G7HB 1I7ZA 2WQRA 1KENL 1DLHA 1YQVH 4NZRL 1HIML 1S78D 2DAVA 1JNJA 1GGYA 1NBVL 1Q0XH 1T80A 5T5NF 3BGMA 3BZDA 4L4VD 4AG4H 1Q1JL 4RNRA 1MAJA 1AHWC 3V9FA 3MRFB 1KNOB 3LZFH 5H35B 1NFIA 4EN3B 5FA4A 3DX8A 2BJML 3T09A 2RJMA 4KUZH 4NWTH 1UKQA 2OR9L 3IAPA 2WM0A 3IAGC 3NABL 1ORQB 2R1YB 5JW3L 4QHLA 1RJLA 3QI9A 4X98B 4LGSB 5TDNB 3SJVB 1MEXL 5H2BA 4P3CH 1RK0A 4K2UL 4KMLB 1UB6B 2XTJD 3NOIA 3H7BB 2GI7A 2XWBA 3PWPE 3QHFL 5IG7B 4LPVA 5CEZE 3FOLB 3VW3L 2WWMC 4KC3B 1TITA 3CFKB 3PWJA 4K8RL 4NRZA 3H0TA 1BWWA 1FNGB 3QRGH 4TTGA 4XVTH 3S3SA 1ZHBA 2A6IA 3AU1A 5EIIB 1U3ZA 1FDLH 4F7PA 4BSWA 3V79C 2CRMA 4HJJL 3VI3E 1OCWL 1WWCA 1P84K 3T2NH 1FL5B 3BH9A 1FL3B 3N1QC 2OCFD 4WNQB 1OAUL 5EU7C 5SWSE 1E4XI 3WJJA 1U3HC 3E6FA 3HZVB 3QUMB 4UV7L 4HUKB 2F53E 1YY9D 4LFHD 5IB2A 2J8HA 2NZ9D 4GRLC 4EI5C 4HMCA 5E7FA 5JO5B 3EJYC 1CFQA 2P8PB 5EZJB 1VERA 3QPQD 4M61B 3SDAB 5ID0A 1WAAE 2ZCHH 2YSSA 3BW9B 1WBYB 5F96L 1YEEH 3SDDB 3WEXB 3SCMA 3QUKA 3IDIA 2OZ4H 1YEIL 1ROWA 1WFOA 4UT9H 4XC1H 3VFRA 4ONFL 5E2VL 1TFHA 1J1OL 5E5MA 4N5EC 1NGZB 5SWZE 2XA3A 3UAJC 3UTPD 1MCDA 4J8RA 4LRNH 1B2WL 3ZTJG 5CD3A 2FGWH 3FQRA 4YBLB 3VFNA 1XH3B 4L8DB 5F88B 3O6FC 2VDNL 3B2VL 4JRYE 3VXSD 3HNSH 4HG4J 2AJZA 5C08E 2YD2A 3DX9B 1UGNA 1N64L 1A0QL 5F1OB 2QQLH 2R1WA 3BFOA 4OLVL 3PJSB 4WI9A 5HD8D 3PG2A 2R9HD 1OARL 3T0VA 3QCVL 1DQLH 1H5BC 2VLKD 5C0CD 3MLXH 4LLQB 5L7XH 1RZ7L 5DK2A 5FA3A 4QXUH 4ZFFA 5FKAB 3VWKD 4M7KH 2NLJA 3O4OB 3K46A 3KPOA 5I30L 2EDHA 4U0RB 3VFSB 4PS4L 4ZNEE 3F5WB 1RVFH 2F19L 4D8PA 3V6FA 1MJ8L 3EYUH 4AK1A 1QSEB 1HXMB 3UC0H 2BVUA 4GAJL 1BQHB 5IR1B 4WTZG 1UA6L 4QRPA 4YR6B 4JANB 5C2BL 1RUKH 5CUSL 2D31A 1T4KA 1QUNA 2D0GA 4JFFB 5GGQL 2Y5TA 1W72A 4QHUB 4XBEH 4YHML 3VXUA 5FFLA 4K7FA 3P9LA 2X4PB 3EJZD 2AGJL 4JY6B 4P2QE 1I4FB 1SY6L 2Y36L 1AQKH 1HH6A 5D70H 4I77H 1HN1A 4ZOAA 4NN7C 4C4KT 1I7UA 4U1SB 2BZDA 1C8PA 4M03A 5AG8A 3M1BA 3WFHB 4HS8H 1BVZA 4YHLL 1WZ1H 4JHAH 4U6VL 1I7RA 3WN5B 4LAJH 3BPCA 3X11B 1JVKA 3IRZA 2WP3O 4GW5A 1KGCE 1T04A 2DLFL 3NCFB 4H1LG 4LHQB 3WKML 3WO3B 4G3YL 1CXFA 1NANH 5EUOB 3O3EA 4GG8A 2P43B 1I1FB 4HKBA 3QEGH 4K94C 5K9OB 3WIHH 1PY9A 1UQSA 2VDMH 1JF1A 4EXPX 2BNUA 2B1HL 3QUYD 4V1DA 3EOBA 2YBRB 2WW8A 2VNCA 4I8DA 4JREB 1NLDH 3MR9B 2C3VA 5MERA 1XGPA 5LAXB 4F8QA 5T3XD 2YXFA 4RGNB 1IKFL 5GSRA 3AY4C 5JLZB 5D1XD 5DTFB 2Z91B 4LQ1A 2ZUTA 4JDTL 4KJQC 3KYOA 4NQEE 4JEGB 1TVHB 2PR4H 1P84J 3MLYL 1DQQB 4PJ8B 5EZLB 3V6OE 4Y5YA 2X6MA 2CIIB 4BQBA 1FRGH 1YJDH 1P6FA 1WFTA 4PJFF 2NY2D 1QRND 3PUCA 5C8JB 2EKJA 2EXYC 4XXDA 3WIFB 3GMNB 1I1AC 1W0WA 3H9YA 4HUXB 3L3KA 2BSSB 4JFXA 2ZSVA 2BVQA 2P45B 1IAIL 3C6LA 4JN1H 4J3SA 3OJVC 4HKXB 1INEH 2M8XA 1MLBB 1U92B 2GJZA 1BJ1H 3GJEA 2X4RA 2C3XA 5GGTH 4OFDA 3CLEL 1DBAH 3O4LB 1YYLH 2G5RA 1FV1A 1NDMA 5FUOH 4HC1A 1VFAB 3RTQC 3RGHA 2HAZA 4GBXC 4PJDF 2IAMB 1U8QA 3RWGB 1N8ZA 3QIBD 3MYJA 3OR6A 1AP2B 5ALCL 3QDJD 3MRRA 1FAKT 2A38A 4OZFA 2I9TB 2JK5B 4XZUB 3RKDC 1T7XA 5D72H 5HGDA 4X6DB 5HYEA 5J7CC 2OK0L 3MLZL 1BVKA 3P9MA 3L7FA 4X9IA 3ZT7A 3ZT5A 1BF8A 4R4NC 3QA3A 4F9PC 5T3ZD 4KVCH 5E99H 3ZE2F 1IJ9A 3DXAE 4TVSa 4JG1H 2FRGP 1SVZA 4TVPD 1OP5K 5GZNC 4G8GB 4Y5VC 1NAMH 3DETD 2A73A 3TM6A 1AO7B 5E8NA 3NPSC 1G0YR 1TXKA 5D2LB 3V4PH 1A5FH 1HHGA 3FB6A 2XWJB 1QFWL 3B8SA 5F9DC 2QTEA 3VFWB 5DD1H 1KIUA 1P7QD 4L8CA 1EHNA 1QA9B 5IOPB 5D1QB 3B43A 2FSEB 2WMPA 3GMPA 4NJAH 3ISWA 5MEPA 4NQCE 2NY0C 3RVUD 3QO1B 3Q5TA 3OB8A 2RCSH 3CPLB 3ZKSD 5I71C 4ZQKA 5FAAA 4Y1AD 3ARDD 3T8XB 1Q38A 2EZ0C 3LKRA 3UXFA 3IJSA 2Y1VA 5IVOA 3V5KA 4D9QE 4ZFOL 1KTLA 3UTQA 1U42A 4P48A 4WWID 2R2EA 1I3RB 4CADA 1J0KA 3BMWA 2Z93B 5D2NB 4N8VB 1C5CL 2I07B 4JLRA 1CICB 3IDJB 5KVDL 4PGEA 4Z5RB 1KG0B 4LRIC 4PGJA 5HHOD 3QPXH 3CH1A 3MO1A 3HMWL 4FMKA 4NHUA 4MJ2A 1FE8L 4NN5C 1IEAA 4K3DH 1A6ZA 2OTUB 3OKKB 2N7BA 4BZYA 2FX9L 4OLWL 4QTIH 4N0YL 5ESQB 3TH2T 2H2PC 4WFHD 1U2CA 3FB7A 3RL1B 4OCNC 2JCCF 4CU7A 3ZL4L 2APTA 3SPVB 3FONA 4KVNL 4WO4C 1CF8H 5K59F 1FFOB 3EHBD 4YPJA 2MHAA 4MNGB 4AM0A 2E7HA 2YMXH 4WI4A 4NNPL 2W60A 3ESUF 4JFDE 1F3DJ 1F00I 1WIOA 3AM8C 4IHOA 5FDYA 1FLRH 3TBWB 1QYGL 1FAIH 2BOBB 1E27A 1WTLA 3LRGA 3PL6B 1D6VH 1PGRB 1JI2A 4B50A 1FZOA 3IVKB 5GISL 1MJJB 3ZLQC 2MNUA 3BH8B 4P4KB 4TRPH 3IKCA 3SDCA 1GRWA 2Z31B 3OXRA 5H37G 2X7LA 4G42A 4LF3B 4Y4HA 4KK8C 4CVUA 5CBEB 4K8RC 2V5MA 2CKNA 3FHQA 4QOKA 3GGWA 3VDCA 3O0RH 4HXAH 3LCYA 1KPVA 4HKZB 1QZ1A 1TETH 1XGUA 1T89C 1QR4A 2ZJSH 4DK6A 4QT5B 4M8VA 4XNUH 1U93B 4KU1A 1OSPH 4PBXA 4H25B 4A6YL 2ZWLT 1Z3GH 1GOGA 4PP2A 4ZUVB 3BKYH 1OTSC 5I2IA 1ZSDA 2WNGA 2DDQH 1JGLL 5DD6A 1YNKH 4AEIH 4DKEL 4R0LC 5D8JH 1MCOL 43C9B 4MQ7B 4LCCB 3RX7A 1I8LA 5DO2C 2AVGA 1I85A 5EU7E 3CFCH 4TSAH 2M2DA 1WITA 1DQTA 3GMOB 2A74A 3TJHD 1YPZF 2EIZA 2YUWA 3KPMB 5EB9A 4KRPB 5DZOA 5GSVA 4MXWL 4YHIA 5EH1A 4YHPA 4P5TC 5GS0H 3QUXA 3L6FB 1N0XL 4UBDD 2DLEA 4KJYB 4ZO9A 1U8MA 3NGBB 5F70A 4Q9RH 3CUPB 1PAMA 1HK6A 3K2MC 4MJIB 3CVIH 3JWDL 3QEQD 5IEKA 4LGPB 4ODBD 3K74B 5IMMA 4QEGA 3MCLH 4OLXH 3D3VB 1LP9A 1OY3B 3RWJA 3STLB 2NNAB 3BHBB 2VR4A 3DNKA 2L0DA 1FORL 3MV7D 4ISVB 3UDWA 1GGCH 3TO4D 1UWGH 2XKNA 1UWEL 5HYJE 1F4YL 2L4OA 3MRQA 4PB0L 3QCTL 3QDMB 4M6NH 5I73C 1MLCB 4U1NB 3BXNA 1KJ2B 4PR5A 3ILQD 4GAYA 4XCFL 2PW2B 1M05A 5KAQG 1ZLSH 1BAFL 4X4XA 4U1IB 2H1PH 3WLWC 3QHTC 4I0PC 4L29B 5L2JA 4FZEL 4WDIB 3E0GA 1D9KD 4U1MA 1HXYB 3VXTB 4I2XB 2ESVB 2D03L 4JM2C 5I8OL 2WWKO 4U1LA 1P9MC 3D25B 4CGTA 3MROB 1A6PA 3A67H 2OP4L 4LEOA 3P77B 1PY4A 1SEBB 1LHZA 3ZE0F 1YN6B 3UJJL 4MNHA 4N8PA 2R29H 2DQUH 4F2MB 3O8XB 1NCDL 4KWUA 4HS3A 4X7SL 5CJQL 3GSOA 5HHXL 1S7QA 3QUZC 4HULB 1DVFC 3FFCB 5JNYA 3QEUB 3JV4B 4I1NB 1CG9B 2M26A 1QKZH 1N3NB 3FRPA 5EOCH 1V3KA 1SJHA 5EPMB 3LOWA 3UZQA 5KZCD 3PQYD 4NP4H 3X14B 1I9IH 3MV11 3ZKXC 4RMVA 1YEHH 1NKOA 2X1QA 4XP9L 4LCYA 4APQA 3FT2B 4MJ6B 2NR6D 3KJ4C 1UZ6F 3CD4A 2FJHA 3QIBA 4PRBB 3TESA 5DUML 3QXWA 3O6MH 1UH3A 1IQWL 1R3IL 4K3JL 1BBDL 4PJFE 2P5WE 4KKBC 2K9UA 2W38A 3FTGB 4R90L 1Q94A 5I1LB 3P4NB 5GRUH 1L6ZA 4X7EC 2FIKB 1RZFL 3VFGL 3VFVB 3VMOA 4XPBH 2ITCB 1UCBL 2FO4A 35C8H 4MYWB 4JO3L 4KI5D 4L3ED 5CJOL 5SWQA 3U0TA 2FB4L 3WNOA 4HUNB 5DMIH 3RDTC 4YPGB 4Q6IC 4ZXBC 3AB0C 4KRNA 3BEVB 4PJDE 2IADA 1QQDB 1GL4B 4AIZA 2HT4C 5D4QA 2QKIA 2CJUL 4LVOB 4NHCL 1ZGLB 3MNZA 3ZKQD 5C1MB 1G9NL 2EDNA 2OMNA 4ZPTA 5EBLB 3TYFA 4JFED 1MFDH 3ZDZF 1JNLL 1J1PH 1WCQA 2V9TA 4N0UE 4NQDA 5GGSA 3RZCC 2F8VA 2YD8A 3FT3B 4TYUA 4ETQA 1CLOL 3ZE2E 4K55A 5C0AD 5DFVD 4O9HL 3EO1B 3LEXA 5F89B 4NNXB 3BZFB 5I74B 2AXFB 5J4MA 1AXIB 3QDHA 1L7IL 1UC6A 1N59B 1DN0B 5C09A 5HVWA 4NC1E 2ERJB 3ROLA 5CEZH 5C0BA 1OTUC 2G2RB 3P0VH 2D7TL 4NM4L 4NCC2 4JFOB 2KH2B 4XWOD 4F7EA 2EDQA 4ELKA 3MRDA 3UTSE 2GTZB 3BQUC 3MXWH 4UT6L 1J7VR 3QRFM 2VWEE 1NBZB 5DK0B 4LPUA 5MEQB 4QTHA 3LEYH 4ELMA 4S1SL 4G6MH 2BC4B 1OLLA 2OSLB 4L8SC 5T1KB 4F7CB 1S9XB 5MP6L 4Y4KC 1LK3H 3WFZA 2EDWA 4U6TA 3HLAB 4JFPA 1ZV5A 2H26A 3DUHA 3CCHA 3DV6B 1CFBA 3NA9L 5DGRA 4WFGE 4UAOB 3VGBA 5C07B 1T1YB 5J9PB 2Q8AH 3HPLA 2P24B 1HEZA 1EO5A 3WO4B 2PETA 3LN9A 2ZPKL 5HHPB 2BK8A 2P5EB 4JZNA 4RMRA 3G08B 4KK6C 2VL5B 5IIEB 3L3JB 3MJ7B 5CWSA 2NX5E 4DVBA 4EDXB 1IL1A 2DLIA 3QIUA 3MNWA 4PTUA 4Q2ZB 3GSNH 4NRYA 1CDHA 1R5VB 5CLTA 2JCCE 5IM7B 2IG2L 2ITDA 4LKCB 1SYSA 2Q76A 5HJ3A 1U8HA 2DWDA 3QFJA 1KT2A 1P7HL 1MNUH 5K59E 5LXGH 4QHMB 1U8IB 1Q9OA 4HT1L 1VACB 2YPLE 1I8MA 3C8KB 3HC4L 3V5DA 4ORGB 1ADQH 4ZUWA 3ARFB 2O5XH 5E8OA 4PJ5A 3VFOA 2YC1B 1KLUB 5JXAL 4X7TB 1AC0A 1K9TA 4NQXB 3VMNA 4ODHH 2X4QB 4U3XA 2C1PB 3UPRA 3R8BB 4FTVE 1A6VL 4NKIL 4MNQE 4NKDB 5CBAA 3RX5A 3C9NA 2HG5A 2UWEA 1J8HD 1C5DA 4IMLB 4KTDH 4FN0A 5IJVA 5T33H 3UMTA 5KVEL 5IKCA 3WJLC 1S7VB 3UYRL 1C12B 5C86A 2IQ9H 1C1EL 4J12A 5IVXF 3BPLB 1TJGH 3I84A 4X9GA 4NKOA 3LN4B 3EYSL 1M7IB 1OF2A 3BO8A 2LTQB 4L3CA 4XMLH 5CSBA 3D39E 2E9IA 5FEBA 3RIAF 4QRSA 2PYEE 1MFAH 4YHOH 5I19H 4PB9H 3KYMB 4EIZC 3BD4A 5DJDA 1TJIH 2VTFA 4QYOA 5FCUH 1YPZE 4JFHE 3NZ8B 1A6UL 1GGIL 1NBYB 3GSNB 2O93L 1WC7A 1MFCL 1NUFA 4XMPL 5EO9B 1U8JA 5DRXA 1G7LA 3CZFA 2MKLC 1RUPH 5LG1A 4PJIA 4M1CD 1R5IA 2Z0BA 3O4LD 1JWSA 3M8OL 4FQXC 5LCVH 1UJ3C 3SCMC 3MBXH 1DTUA 1DL7H 4RAVB 2IAMD 4M6OL 4PRNA 2AV1B 1VESA 3EO9L 3B9KB 1RZKH 2PTVA 4N0FB 1B6DA 3LS5L 2OL3H 4NN6B 3L3DB 5E24E 3OAZK 2XZAH 2YEZB 4CMMB 2QR0B 4KUCF 1CFNB 2Y7QA 1RUAL 4GKZA 4EVNB 4POYA 1DUZA 2VABA 5KSUB 1SBSL 1AGCA 1A02N 1G7HA 5I8EB 3KR3L 4IRSD 1I3UA 3DGGB 3VFPB 1XEDA 3JWDC 4F8TA 4DKFL 3K0WA 4P46B 1UM6L 4GXVH 2F54E 4J7RA 4RGMC 4C54A 1MCHA 4GS7B 3PQYA 1KCUH 4XMKH 4F9LA 4HAGA 4XAWL 5GZOD 1IC5L 3MRFA 4UTBH 1WUNT 2VITB 4XVSL 4XP5L 3TP4A 1X6NA 5H35A 3ZKNC 4EN3A 2VDQH 2QSQA 5K9KB 1ZLWH 3TA3C 3ZE0E 1ZT4B 2VIRB 3UBXG 4F15C 1FGNL 1X5IA 2HJLB 1ORQA 2R1YA 2A83B 4GMSH 5T3XL 1BEYH 5TDNA 3SJVA 2BSED 3AS2A 4LAQH 5DJYA 1SVCP 1LO0H 2IANB 1UB6A 5AYUH 1ZLVH 4QWWD 5CP3A 3QQ9D 3H7BA 1FO0L 4BH7B 5IG7A 3GBLA 5JZ7D 3NZHH 4ZTOH 5I1JH 3FOLA 2CRIA 3PV6B 5F7WC 5J1TC 2BCKB 5CP7B 2WINB 3CFKA 3SKNB 1FNGA 2V17H 4QRRD 4ZUSB 4AYFA 5EIIA 1AGEB 4PJAB 1M7DB 4U3HA 3X3GH 5CZVH 3ROOB 5FECB 4P2RE 2R0WH 1FL5A 1FL3A 4XCNB 4WNQA 4OD1H 3REVB 1UZ6E 1JPSL 1NJ9B 1YZZA 2CKBL 1VPOL 1RI8A 3FQWA 3HZVA 3QUMA 4OZFG 2A6JB 1TQBB 3O9WB 3QFDB 5ACMA 3TPUB 4DVRL 2XXCB 2HFGL 5KSAB 5JO5A 5EZJA 4AL8H 4M61A 3SDAA 2OL3B 3LS4L 3KYNB 4JM4H 2C3WA 2Y6SC 4NQEB 1JGVH 3BDYH 3BW9A 1WBYA 3TGXA 4QKXB 1A22B 4JO1L 3SDDA 3WEXA 4NZUL 3K8LA 1NBQA 5EORH 1FNSL 1NGZA 2XA8H 1UWXK 2NXYB 4KMQA 4NQTA 3HE6D 2P44B 1WEJH 1XH3A 4L8DA 1YEJL 5F88A 2XKSA 5E9DB 3PL6D 5C6TH 4RGOL 3KLAB 3U7YL 2YD6A 3S35L 1QBLH 3DX9A 2F5AL 5T3ZL 4AJ0A 3VJ6B 3PJSA 4TVPL 3ZDZE 4BUHA 4NGHL 1OGAE 5DFTA 3U9UB 4D3CL 5BV7B 2VLJE 4OFYD 3ARED 1BBJB 4LLQA 4E42B 5HY9B 2AK4D 3M45A 4YH6A 4U1JB 3FB5B 2HRPH 3KWWB 3IDXL 4OCMC 5FKAA 1CD1B 1G7MB 1NGPL 3JZ7A 3VG9B 1PBYA 4GFTB 4J3TA 3VFSA 3F5WA 3C09B 5JQ6H 4TULL 5GRZA 1QBML 4KHXL 5B3JF 4LASH 2E7BA 1QSEA 1HXMA 4KROD 1YEFL 4MWFB 4HPYH 2J5LB 4PLKD 5IR1A 2OJEB 4YR6A 4JANA 5D6DA 4W70A 1QPPA 3O3UN 4JFFA 5CJXC 4QHUA 2V9RA 3H6JA 4QF1B 4LPWA 1NLBL 1X4XA 2X4PA 3RJQB 2BY0A 3SQOH 4HF5L 4KRPD 4JY6A 4OFVA 2VISB 1I4FA 3HMXH 1GHFH 4J3WA 4DUWA 3NFPB 2VXQL 3UJIL 4U1SA 3P4LA 3WFHA 3MUY1 2B0SH 3N1FC 2HJKB 1OAQL 4LSSH 4TPRH 2R56H 4MJID 3WN5A 3X11A 3KPQB 4FNLH 4P59L 1S78C 1O7SA 2X1WL 5EUOA 1K8IB 2RIKA 4M1DL 2EIEA 2VDRH 15C8L 3BT2L 1I1FA 2C4FT 5K9OA 1EJOL 3FQUB 2IBZY 2YBRA 4LMQE 3K3QA 4XNZB 3I6KB 1ZS8B 2XI9A 5CGYC 3MR9A 5D71H 1A7PH 4JE4B 5ICXB 1S7UB 3VFTB 4N68A 4HHAB 3ARQA 3L5XL 4U2ZA 4POZD 5LAXA 1JGUH 4NDMB 5JLZA 5DTFA 4NKQB 2Z91A 2XTJC 3SGJC 4DN4H 1ZLWK 3LKNB 1Q9WB 5HGGS 5EOTB 2ZCKH 1TVHA 1T7YA 3H42L 4PJGB 1DQQA 3CVHH 4PJ8A 5EZLA 1FFQA 4R4FH 2B20A 4R3SB 4QRTB 4JFZL 1I9RH 2CIIA 1MFBH 4U6HB 1LK2B 4OLYH 3NBNA 1ZLVK 1P4IL 4NJ9H 3UZVB 5C8JA 2DQTL 4LDLB 3NCBB 3WIFA 3GMNA 1F8TH 2EYRB 2R23B 2BSSA 3EDFA 3FN9A 2O26U 1ACZA 1YY9C 1AHWB 5ACLA 1EK3A 2YK1L 2NZ9C 5TQ2L 4XPGL 4OZHB 4JB9H 1CGSH 2D7NA 1RIVL 4HKXA 3MRKA 3QPQC 1MLBA 3QXUA 1F4XH 1U92A 5IVXE 2X42A 4JO4H 5C92A 1MCWW 3RA7L 4GRWF 3O4LA 5I8KH 2ID5A 3O6KL 1VFOA 1RD6A 4GSDH 5E5RB 3RVWD 1IGIH 1VFAA 5LWYH 1LO5B 5IVNA 2IAMA 4P2YA 1VEMA 3V0VB 1AP2A 3O2DA 1ZAGA 2BVTA 1HZHH 2I9TA 2JK5A 4HBCL 5KVGH 2R0KH 4R96B 5F97E 3TNMB 4HH9B 4XZUA 4G7VH 5BW7C 2LU3A 3AAZB 4IEFB 4X6DA 1MRCL 2GEEA 3TT3H 1S5HA 2D2OA 1HINL 2QJDA 2CK0H 3I2CH 5FO8B 3ABZA 2ATPB 1BQLL 3GM8A 3U0WH 2DLGA 1CFVL 3GJFH 3MRJB 5HD8C 4G8GA 1U3HB 3H3KA 2R9HC 1AO7A 3MA7B 3V6BR 3S36L 5D2LA 3MLRH 2XWJA 3GI8H 4GRLB 4EI5B 3VFWA 1QA9A 5IOPA 2R8SH 5D1QA 3TT1H 1KTRL 1GGBL 2R2CA 2FSEA 4NZDA 5SX4H 3VWKC 1ACYH 5B39G 3BP4B 1F02I 1XF4B 3QO1A 3CVHB 4HUWB 5FB8B 2MFNA 4HPOH 1C16B 1ZHKB 3CPLA 3FCTB 1EAPB 3T8XA 2HKHL 1UZ8B 2FD6L 5EU4B 2BERA 1JNNL 4I9WE 1ETZA 1J0ZA 1E4KA 1XMWA 2W0PA 5FHBL 1I3RA 3O6FB 1AFVL 2Z93A 3FRPG 4ZD3L 5D2NA 2VSDA 4N8VA 2KQMA 1RY7B 2I07A 1AXSB 1CICA 1B88A 3IDJA 4PLJD 4YUEL 3EJZC 3B4NA 4I3SL 2CR3A 3CFBB 4Z5RA 1KG0A 4C57C 5JUEL 1DDHB 2VDOL 2H9GB 1N6QH 1OHQA 4K7PX 2X41A 2QL1A 2W9DL 1H5BB 1IEBB 3BWAB 3OKKA 2IGFH 5ESQA 4HFUH 3RL1A 5TE4L 3MLWH 3SPVA 1CL7L 1OOAA 2PN5A 3WD5L 5T1KD 3EYFB 4JAMB 3CAFA 1FFOA 3ARVA 4MNGA 1T0MA 4YLQT 3QUYC 2FL5B 2XN9D 1IC7L 1S5IH 5I15L 1YMMB 1T5XB 2BSRB 1M71B 3PWLB 4DW2L 3E3QC 4Y4FD 3MJ9A 5DC9B 5DWUH 3TBWA 4ZS6D 2BOBA 1N7MH 2F15A 1CD0A 3PGCB 3PL6A 4JQXC 5D7LE 1IT9H 2GYSA 1R3HB 1F4HA 4MS8D 4N5UA 3IVKA 1MJJA 4P4KA 3BH8A 5D1XC 2GW5A 3A6BH 3U7WH 1CK0H 2Z31A 4OM1H 2UZIL 4NN7B 2BY2A 4LF3A 3NACH 4XI5D 1A3RH 3JWNC 1MCIA 1R5WB 5CBEA 2V7HB 1RIHH 4D9RE 1LP9F 1WZMA 1HH9B 3BJ91 4OFYA 3SO3C 1DQDH 5GXBB 1G9ML 5L88H 4RMUA 2NY2C 4C4KO 4LCIL 2AK4A 3HNTH 4FQCL 4UDUB 4HKZA 4TSCL 5A1AA 3MREB 2AJVL 4PJFB 1O0VA 2H41A 2MMXA 1XAUA 5DZLA 4GG6B 3ARFD 2GSGB 3QUML 5DJ6B 2BHYA 4MQTB 4QT5A 4H1LH 1U93A 4QXTB 1B6UA 3T0WA 4HLZG 3VXUE 4H25A 5LBSH 2DQEL 4QRUB 4N1EA 4ZUVA 5DT1H 1S9YB 3NCJH 3CLFH 3ULSB 5IFJB 5JR1H 1IAKB 43C9A 4MQ7A 5F1IB 4LCCA 3SN6N 5T1LB 4PY8J 3W9EB 4B7LA 4M7JH 3GMOA 2HT3D 1CU4L 1U8KB 1SEQH 5HDBF 5HHME 4PJDB 3KPMA 5EU6B 4K23L 3RRQA 4PGDA 5ADOH 3L6FA 3W39B 2PF6A 3DVFA 3HCVB 4KJYA 2QADD 3HHRB 3CUPA 1T2XA 5EWIL 5E2UH 1EGJL 4V1DE 4MJIA 3CH8A 4BZ1L 3TV3L 5B3JE 1IGYB 4TOYH 3ULUD 3D3VA 3STLA 5AG9A 1DBBH 1GC1H 2NNAA 1I1AB 3BHBA 4JHZA 3DETC 4ISVA 6FABL 3VD4A 2CDEB 4OLEA 4EDWL 3CMOH 2YUXA 2B2XH 4PJBB 3QDMA 1CFTB 4M4RA 1MLCA 1EHLL 4M62H 4U1NA 4KZEH 1LO2H 1NKRA 1KJ2A 1MELA 2PW2A 4DAGL 4K9EL 3Q48A 3RVUC 4KFZC 3RTQB 3OL2A 4U1IA 4GBXB 4OTXL 1KENH 4L29A 1IBGL 1RULH 3ARDC 4Z8FL 4AMKH 4WDIA 5FGCE 4PGBB 4N9OB 4QHKI 3HNVL 5GJTL 1I9EA 1NBVH 1HXYA 3VXTA 4I2XA 2ESVA 3EO0B 4H0HB 2WBKA 5F7NC 2B4CL 3D25A 5B4MD 1Q1JH 3G5ZB 3MROA 2NY4D 1CQKA 3P77A 4RMQA 4XNXL 1JV5B 1SEBA 4HAFA 3D2UB 2W92A 4KDTA 1A7OL 4DGYL 1YN6A 4ZDHB 4U33A 2YWZA 4Q9CA 2BJMH 4F2MA 3O8XA 1RHHB 5IW1B 2OR9H 4Y5VB 1X4YA 2PTUA 5JOPE 4K71C 3NABH 3NPSB 4Z7QF 2WSKA 5JW3H 4RRPA 1X5XA 3BRGC 2IPKB 1JZ6A 1E4XL 1MEXH 5CCKH 3CDGB 1J0JA 3SHSA 3FFCA 1BLNB 3QEUA 3JV4A 3P30L 4YBQD 2ICWI 1CG9A 1N3NA 5HHVL 3OG4B 3LH2L 4NZTL 3F7PC 2NW3B 5EPMA 3VW3H 5E6IC 3X14A 5JW4N 5JXEA 2E6PA 2NY0B 4K8RH 5TPWL 3MJ8B 4PV9B 3MRLB 2J8UB 1NMCC 2QHLA 2EDBA 3FQXB 3EHBC 3V7AG 4LDOB 4G8EB 4WEBL 5I71B 3FT2A 2HRLA 4MJ6A 4HJJH 3WDJA 4CU8A 1OCWH 4NQVB 5DGQA 4PRBA 1UM5L 2JIXD 3P0GB 2FZ3B 1OAUH 2G60L 2R69H 1XGTB 3FTGA 3K2UL 2AK1L 2AJUL 5I1LA 4L4VE 1A9EB 4UV7H 2DN7A 3ZYOA 3P4NA 4ODTL 1SYVB 1NMBL 2FIKA 5HPMB 2IPTL 5BZWB 1EMTL 4U7KA 4RFOL 3VFVA 1YDPB 3BAEL 2DI9A 2E9JA 2ITCA 5F96H 1P6AB 1X3DA 3EDJA 4J3OC 5E8EB 5BS0B 3RPKA 4S1DC 2HKFH 1YEIH 4NN5B 4GRWE 1XCTB 5HXMA 5E2VH 4YJZL 4ELMF 4YPGA 1CD8A 5F72S 3ZYZA 1A1OB 3BEVA 1QQDA 2XTJE 4N1HB 3LIZL 2VZOA 4NFBA 4R8WL 5C70A 1ZGLA 4WO4B 1KCVL 2VDNH 2YD4A 4PGCB 4MZ2A 5BMFH 3L5WB 5J89A 4OV6F 5EBLA 1PX3A 4U6YB 1N5YL 1N64H 2PNDA 1A0QH 3WDIA 3WSQL 4OLVH 1HHJB 3FT3A 3MV9B 3PHQB 2H3NB 1TTFA 4Z18A 3D39B 3QCVH 5F9JB 1T20B 3EO1A 5E08H 3GK8L 5F89A 4OGYH 4NNXA 3BZFA 2AXFA 4S1RL 2AQ2A 3TJHC 4U49A 3O2DL 1N59A 2WUBH 5BZDA 1DN0A 3LQAC 2Z8RA 1YPZB 1U36A 4YAQB 2G2RA 2EDEA 4JFOA 5I30H 4P2OC 4PS4H 3I75B 5I18H 2GTZA 2F19H 1K85A 1KB9K 1MJ8H 2NYYD 5L2KB 1OAKL 3DHJA 3MRMB 4GAJH 5DMKB 1X44A 1NBZA 5DK0A 1UACL 5MEQA 3JV0A 5IBTL 3UTPE 4QO1A 5C2BH 5CUSH 2FWOB 3MUZ1 3OPZH 3LHPL 4QNPF 1KBGL 2BC4A 3TO4C 2OSLA 4YHMH 5T1KA 4F7CA 1S9XA 2PO6D 1KN2L 1KN4L 4I0KA 4YHKL 4FFZL 2AGJH 3HLAA 3PGFL 3DV6A 2DIJA 2FLBT 1SY6H 1T1YA 2Y36H 4NQUA 4R0LB 5C07A 5J9PA 2P24A 1H8OA 4GO6B 1U95B 3K7UA 3BEWB 5HHPA 2UWEF 4L5FH 2P5EA 3S96B 1MJUL 5F7EL 3G08A 4ZUTB 4YHLH 2MCG1 1JNHB 1NEZB 2VL5A 4P5MA 4W6YB 4JRXB 5IIEA 4U6VH 4QOKE 3L3JA 4JPVL 4ZFGL 3HB3C 3HG1D 3O2WL 1A7RL 3RWDB 4EDXA 1D9KC 4CJ1A 2F54B 5GRVL 3PNWB 4P5TB 4Q2ZA 5DHVH 1R5VA 2B39A 4M00A 1X6LA 5IM7A 4M5YL 4LKCA 5F7LB 2OBGA 2GT9B 2B1HH 2H32B 4QHMA 1KCRL 1KYOJ 1U8IA 2LV4A 2YA0A 1VACA 1CDYA 1RUQL 3C8KA 1R0AH 5I17B 4ORGA 4UMGA 3ARFA 4NM8L 5I0ZA 4PRHB 4TUJB 4JR9L 2YC1A 1IKFH 1KLUA 3SKMB 1FFPB 3GSWB 3R1GH 5I73B 4X7TA 3P4OB 2X4QA 3RVTC 1JCKA 2C1PA 3VXQB 2OI9C 4PJIF 4NKDA 2DJ4A 3KPSD 4I0PB 1PYWB 2NR6C 4IMLA 4P2RB 4FFWC 3PABB 5CFHA 1LP9E 4JDZB 3MJ9L 5D1ZD 3UROR 1S7VA 1MI5B 1WV7T 4JM2B 1WZLA 1C12A 2C4FU 2HFEA 3V8CA 2O5YL 1IAIH 2C9AA 5C3TA 2CQVA 4RMTA 4XBPB 4N8CL 3MLVH 4PJ9D 3LN4A 4ESKA 3LKQB 1FVEB 5JTWA 1M7IA 3CLEH 1JZ3A 3GHEL 4KI5C 1BQHG 4ZSOB 1PD6A 2NZIA 1Q0YL 5T3XE 1KCSL 2YZ8A 3QUZB 1DVFB 3KYMA 1G9MC 5GS1C 5ALCH 3D48R 4EOWL 4RZCB 3PXHA 3NZ8A 1K5NA 4OQ1A 5IHUL 1NBYA 3GSNA 1ZLUK 1JHKL 3QJHA 3ZKXB 2X9XA 2OK0H 5EO9A 3GUTB 3MLZH 4PRPB 3V6ZB 2BSTB 5FM5O 1QHOA 3LMJL 3KJ4B 3IS1X 1QRNE 2DQJH 1BVLB 1IGCL 4KTYA 4LCWB 3IDNB 3BKJL 1RSFA 5DFVC 2HWZL 4RAVA 3GB7B 2IEPA 4PRID 1QFWH 3B9KA 4N0FA 2HA1A 4G6FB 4DKAA 3L3DA 2H8PB 1TDQA 2YEZA 5FHAL 4CMMA 1CLYH 2QR0A 3RP1A 4B53A 1CFNA 3NIFF 2Z4QB 4EVNA 1P4LB 2KDGA 3HI6L 5KSUA 1WGOA 2HH0H 3DVIA 1A6WL 4PV8B 3RDTB 5I8EA 3BE1L 3VFPA 3DGGA 4Q6IB 4ZXBB 3AB0B 2V5SA 4Z7UB 3IFPB 3ZYJA 3K81A 3VGFA 3LKOB 1B4JL 4P46A 5CINL 1U3HD 1ZHLA 4W4OC 4IRJD 4EI5D 1XFPA 2VITA 5GS2D 4MDJB 4LU5L 4GW4B 2VQ1B 4OF8A 4GLRH 5EN2B 5K9KA 1DBJL 1OPGL 4JKPL 3THML 3RZCB 1MCNA 3HMWH 3H3BC 2JIXA 1ZT4A 4HCRA 5ID1B 2VIRA 4TVPE 2HJLA 1FE8H 3T3MF 2A83A 5DYOB 4DFIA 5IROA 1PEWA 4YWGH 4Z7QE 4OLWH 4WCYH 4N0YH 3DRQB 2IANA 3MGOB 5FUCC 4WU5B 3IT8D 4X9FA 4BH7A 2YXMA 1JHTB 3PV6A 4HK3N 2BCKA 4KVNH 5CP7A 2WINA 3F12B 1T83C 3JSSA 3SKNA 3BQUB 4I13B 4ZUSA 1AGEA 1MRFL 4PJAA 1CDJA 1M7DA 3GHBL 3ROOA 5FECA 1BREA 2GFBB 4NNPH 4XCNA 3REVA 2AQ3A 1J1XL 1NJ9A 1JPST 1QYGH 3GIZL 1DJSA 4L8SB 2A6JA 1OT1A 3CIQA 4GUPB 3O9WA 3QFDA 3TPUA 4DUVA 4X6BB 4Y4KB 4HIXL 2EDXA 4OCYL 1ERNA 3TJEL 5ENWB 3DIFB 4G6KL 1MAKA 2OL3A 4QHKJ 3KYNA 1WTGT 2FX7H 4NQEA 4X9HA 1QNZL 4GQ9L 1FH5H 1X7QB 4LSQL 3CX5K 5EULV 4WHTB 3V6OA 4OIIL 1JFQL 4G9FD 5ACZB 4JHWH 3QH3B 1CD9B 3V0AC 2NY3D 4ELME 4ZFOB 1A7QL 2CLRB 4OB5L 5E9DA 4OSUH 1OB1B 5DVNA 5DQDL 4A6YH 3EJJX 3KLAA 3P73B 2ICWJ 3VA6A 1EZVY 3UO1L 4DKEH 2UVEA 5IVXB 3EW3B 3VJ6A 1MCOH 1M6OB 1NC4B 3UJTL 2VXUL 1J0HA 1JTTA 4KMTL 3U9UA 4DTGL 2MPAL 2HJFB 1BBJA 1GPOL 5EUOF 5HY9A 3T65B 4N8VG 2JJUA 3OKNB 4U1JA 3FB5A 4MQXD 5D7KD 3KWWA 4ZMAT 4MXWH 1RJCA 1CD1A 1G7MA 3A0OA 1EVTC 3BGMB 3NCMA 1N0XH 1KV3A 4JQIL 3MOAL 2X2YA 4NBYB 3MLTB 3FO0L 4UUJB 1J18A 2JJVA 4P23D 3QFJE 1XF5B 4FABL 3C2SA 4MWFA 4DEPC 3CK0L 4M1CC 4UI2A 3GKWL 2OJEA 3D18B 1N0LA 5A2JH 1N2RB 1L9MA 2XQBL 1FORH 4QHLB 4M3JA 3BYYA 3QI9B 4PJ5E 3GSUB 4QF1A 2CPCA 2EYSB 1UWEH 3JWOL 4FMFA 2OYPA 1MIML 1F4YH 4QNPE 3QCTH 5EU6D 5LQBL 4IRZH 5E6YA 2VISA 4KJQD 4WI6A 1U3JA 3NFPA 3UZEA 3HAEB 4XCFH 5CSZB 3S98A 3NIGF 2ZG1A 2HJKA 1BECA 2E6QA 2UWEE 4IRSC 4UOJA 3KPQA 4TQEL 4FZEH 4JGMA 5IB3B 1K8IA 2NY7H 1W72H 3MQIA 2Q86B 3ZE1F 1BPVA 2D03H 5I8OH 1CZ8L 2FDBP 5GZOC 5F71A 5F9OL 2OP4H 4GH7B 1K6QH 2XOTA 3FQUA 4A6YB 3OKDB 3Q1SL 3UJJH 5B22A 3I6KA 1ZS8A 1NCDH 5ICXA 1S7UA 3VFTA 1TVBB 4FQXB 1UJ3B 3SCMB 2AI0H 4HHAA 3MV7E 2F74B 1CWVA 1EEZB 4RAUB 5CJQH 5E5MB 4QGYA 3GDBA 5HHXH 1J5OL 3PWVB 5CJBA 1KIQB 4NDMA 3D85D 4QWWC 4LLMB 3QQ9C 4Y7MA 5HVGB 5JZ7C 4X6DF 3LKNA 1Q9WA 5EOTA 1X5JA 1T2QH 3RKDD 1G6RL 4LSPH 4PJGA 1MRDL 4PTTB 4R3SA 4QRTA 3MTRA 2DTML 3Q0HA 4U6HA 1LK2A 4PJIE 3N1GC 1A1MB 3RIAK 5JPNB 2Q20A 5E95B 3K1KC 1AE6H 5D2LF 1X4ZA 4S1QL 1IQWH 1R3IH 4K3JH 4RGMB 1BBDH 2DKMA 5EC2B 2EYRA 5IB5B 1IARB 1MCSA 2R23A 4UILH 2EDRA 4R90H 3RI5F 5D7LB 3WS6C 1AHWA 3GNMH 3RVXD 1WT5C 3D9AL 1YYML 4OZHA 1RZFH 3TIDB 4ZO7A 1RURL 2YD1A 5T5FL 4IDJL 3TA3B 3N50A 4UT7H 5CJOH 4F15B 2FB4H 3B3IA 3NAAL 4M9PA 3OZ9L 1LO5A 4X6CA 3C5JB 3EGSB 3V0VA 2EZ0D 3OSKA 4ALAH 3S34L 1E4WL 3HE6C 2CJUH 2FNBA 3GEWB 4NHCH 4R96A 3PE9A 1C5BL 3PQYE 4HH9A 3TNMA 1G9NH 3BP5B 5DHXB 3AAZA 1FLTX 4JPIB 2DMBA 2VKWA 1IAMA 4PRDB 5JOFB 5FO8A 1V3JA 2ATPA 3ULUL 1FNEB 1WF5A 4NQSB 3KS0H 1TIUA 3RBGA 12E8L 3MRJA 4HC1H 1U3HA 3MA7A 3U0PB 2LFGA 4O9HH 5JW4M 3IDMB 3SJVE 4FXGB 5KW9L 3AREC 4HIEB 1L7IH 4GRLA 4EI5A 2AXHA 3FN0L 3H9ZA 5LGJB 2RAMA 4E41B 4YC2C 2E7CA 4NM4H 3DMMD 4M3KB 3BP4A 5BVPL 1NMAL 1XF4A 4HUWA 3CVHA 5FB8A 4UT6H 1C16A 1ZHKA 4YNYB 3NIFE 4E0RB 3FCTA 4X5XB 1EAPA 4KROC 3E1F1 3SY0B 4RRPG 2D0FA 5GGSY 2UZXB 1GAFL 1UZ8A 4R7NB 2NY5L 1FG2B 5EU4A 4S1SH 2YKLL 3I3BA 4WTWA 3O6FA 2I26N 4G80B 5MP6H 1AXSA 1GZPB 2DQHL 4ZFZB 5A16B 3NA9H 3CFBA 3N9GL 1MREL 3MRGB 1OAZL 4BYHA 5AAWA 4OKVB 5F44A 3T77B 2ZPKH 2CLVB 1DDHA 4W4NA 5FDWA 4GRWH 2H9GA 5ADPH 4GXUN 3RWIB 5L2KD 3BWAA 1H5BA 1IEBA 4XCCL 5JHLL 5AZ2H 4JVPA 3T3ME 1N5AB 2RFXB 3R8QA 4L4TD 1VFBB 4ZNCD 5J06A 2ILLA 5DVLA 1MVFA 1IGJB 3O41B 1IE5A 2JELL 4LSDA 3TFKD 3EZJB 1IMHC 4JAMA 2QSCL 1OTSD 4NC2B 1VFMA 2V6HA 5DRWB 3BRDA 2FL5A 4HT1H 1HSBB 5FF6B 1YMMA 1T5XA 2BSRA 1M71A 3PWLA 4IOIB 3HC4H 3MV8D 3MBED 2J8OA 3BKCL 4HBQA 1JK8B 4KY1L 4POZC 4JRXD 3PGCA 4OBSA 4MAUH 1E6JL 8FABB 3QCUL 1R3HA 3BUYB 1Z9OA 4X4YB 4JKKA 5JXAH 4D9LL 4OBRA 3CXHK 3VXMB 4K3EL 4F3FB 5ELIA 1I8IB 2D7OA 1IAOB 2HT2D 1HCVA 1A6VH 1R5WA 3NCYP 3L7FB 2V7HA 2EDJA 1YN7B 5T1DH 5HVFB 1QSEE 1HH9A 4LARL 4HK0B 1CDUA 4UDUA 4YHZL 5FUCE 1QFUH 5KVEH 3OKLB 3MREA 4PJFA 4GG6A 3UYRH 3AS3A 2GSGA 4QXWA 5DJ6A 1OVZA 2NY1D 4PRHD 4L4VB 4QXTA 1C1EH 1UT9A 2PXYD 4TNVF 3RFZC 4MGXA 4JY5L 4QRUA 5AUMB 1QLEL 1S9YA 5I66B 4L9DA 5IFJA 4WV1C 1IAKA 5BRZD 4OM0L 5F1IA 4YXKH 4C56D 5T1LA 4R26L 2DM3A 3RVWC 4GRWB 3W9EA 4I0PD 3VXPB 1U8KA 3FB8B 3AY4A 4ZS7H 3RGVC 4MQSB 5EU6A 2EDDA 2VB5A 2XTJB 5JA9A 5EUOE 1KXQE 1A6UH 5GS0D 3KHQA 1GGIH 3WE6B 3W39A 3EFDL 1MFCH 3HCVA 4JLRB 2EH8L 4WFEE 4XMPH 4RISH 3KYKL 5J56B 2JJWA 1I9JL 3BISA 2NTFB 2D0HA 4PLNC 4B5EA 4FFVC 1IGYA 1QLFB 1A47A 1TENA 3DV4B 3U82B 1I1AA 3ZHDA 2ADFL 3M8OH 3KAAA 3WYRA 5BV7L 2F5BL 2CDEA 3O3DA 4WUUB 3WFDL 1DVFD 1TLKA 4PJBA 3AFLA 3VXRD 4XP6L 5SX4I 1AGBB 1CFTA 3J7HA 2ZUUA 3LS5H 1GXEA 4H5SB 2VH5L 5FM5M 3L3HB 3DVGB 4HZAA 5IHBA 4YZFF 1RUAH 3WFCL 1OP9A 4PRPD 1A3LL 1SBSH 3RTQA 5F7YC 4GBXA 3NIGE 1KFAH 3KR3H 3RVVD 4OGXH 4DKFH 3PV7A 5HPOA 4PGBA 3ILPB 1UM6H 4ODSL 4KKBD 3EO0A 4X80L 1EHXA 4Y88A 5KVMC 3G5ZA 3HC3L 4WFFD 3VXSB 4PLJC 3ZE1E 1IC5H 1JV5A 3JWOC 4XVSH 4XP5H 1G7JB 5F7KC 3D2UA 5DXWA 4G6FD 4FQLL 4F9PA 3RL2B 4ZDHA 1RHHA 5IW1A 3ESVF 3O4LE 4PJHB 5IFAL 1JIBA 3FT4B 4Y5VA 1FGNH 2G75B 3EKCA 5T3XH 2IPKA 1OP3K 4EBQL 4HUUB 1F3JB 2VLKB 5C0CB 3CDGA 4JPKL 3UP1A 1AJ7L 1BLNA 3K80A 2HT4D 1FO0H 2NW3A 2FEEL 5D7JC 3VWKB 1F4AA 3MRBB 1LEIA 1YY8B 4X6DE 3CZJA 3MJ8A 4PV9A 3MRLA 2J8UA 3MXVH 3FQXA 2I5YH 2EC8A 4G8EA 3BPNC 1MFNA 4NQVA 4Y2DD 3RZCD 3WUWB 4Q9BA 2VJXA 3INUL 3QZWB 4PGZA 2A1WL 2FZ3A 2V5YA 4Y4FC 4FQIH 4G8GE 1JPSH 1AO7E 1XGTA 1VPOH 4Z0BH 4ZS6C 3TH4T 5D2LE 1A9EA 3B9EA 1SYVA 4DVRH 1AR1D 5EBGA 1FJ1B 2HFGH 4MS8C 2P1YA 5HPMA 2EIBA 5BZWA 4LRIA 1YDPA 3GI9L 3LS4H 4M7LT 1GJIA 3NTCL 4HZLB 3SE3C 4JO1H 4U7SA 5JORB 3BQUD 5E8EA 5BS0A 3NH7L 1CYGA 4NZUH 1CGYA 2APFA 3OR7B 1J11A 1XCTA 5AZEL 3DI2B 4AH2B 2IQAB 1FNSH 1L7TH 2A9NH 1A1OA 1IM3B 5EA0L 5DURD 4ZAKD 3QIWC 3OKOB 5AD0B 3GMRB 3ZKMD 2APWA 2B7DT 1YEJH 4KHTH 4WO4A 1F11B 2VDLL 2XICA 5D2NE 4PGCA 3L5WA 5HYFA 3PIQB 1K4CB 3U7YH 3S35H 3QUYB 5TFSH 2F5AH 4U6YA 1HI6A 3WNMA 1JPFB 5GRJH 1HHJA 3MV9A 4TVPH 1G7IB 2H3NA 3PHQA 5EOQL 4NGHH 1K3IA 3AM8A 4KK6D 1EO7A 3D39A 5F9JA 4D3CH 1T20A 5JW4R 4QXGH 2CRZA 4LSVL 2HT3C 5B8CC 2YN3A 5IJKC 3TZVD 5D1XB 4Z7OF 1IM9D 1W2KT 1PG7L 4LVHC 1YPZA 3FOMB 3IDXH 1FO0B 1NGPH 1DQMH 2KPNA 4YAQA 4LHUD 5IMKB 3S37L 1NSNL 4DN3L 4JFYB 2BMKB 1CBVH 3I75A 2QADC 4OF0A 4TULH 1QBMH 5FYJD 5L2KA 1RMFL 5DJZB 3MRMA 3SO3B 5DMKA 5IHLB 4X7DC 2NY2B 1QRNB 4BSJA 1TQCC 4XP1L 1MCWM 3P0YL 4CW1B 3D5OF 3UPAA 3WFBH 1Z6JT 1T89A 2FWOA 4O02H 5MI0C 2F53D 2CKBB 4X6EB 1V5JA 3HR5B 1NLBH 3AMKA 1Y6MR 2AS5M 1WZKA 1B90A 4X4ZA 4HF5H 3R06B 4LP4A 4XPHL 4KPHH 4R0LA 3BSZL 5J6GB 4JPWH 4KUZL 4NWTL 2Q3ZA 4I4WB 1U95A 1ZHNB 3ARBD 3BEWA 1FYTD 3S96A 1G7QB 1UEMA 3I50H 2O5ZL 4ZUTA 2RHEA 1JNHA 1NEZA 2AW2A 3K1DA 1OAQH 4P3CL 4JRXA 2BHZA 1INDL 3BDBA 4Z7VB 1DEDA 4YK4C 1HHHB 3RWDA 4P59H 2AK4E 3QDJB 2NY5C 3PNWA 4M1DH 4P5TA 2QQNL 3BT2H 4Y19D 4IOSD 1BGXH 5B4MC 5C08D 2NY4C 1EJOH 1VGEL 2BOCB 1WWWX 2GT9A 3ULUF 1UADC 1T03L 2H32A 2LABA 3BYTA 4HWZB 2ADIB 5ISZD 5JIPA 3C2AH 1YEDB 4I48B 3WHXB 5I17A 1DCLA 3L5XH 3TN0C 4PRAB 4BFIB 4PRHA 4TUJA 3EDEA 5CSGA 5DF0A 4ONGL 1ZVYA 3SKMA 1FFPA 3MRHB 2IFFL 4YBQC 1FN4B 3GSWA 1P7QB 2E7LC 2ZCHL 4YXHL 3P4OA 1IC4L 3ZHKA 1SJEB 3STZB 3H42H 3VXQA 2OZ4L 4XC1L 2A0LD 3SEPA 4LQFH 3HN3A 4XXCC 3W82A 3KXFD 4JFZH 4HW6A 4I0PA 4YEEA 1PYWA 4FG6C 4MJIE 3IB4A 4PJCF 4Y1AB 3ARDB 4EQ3A 5GGSB 4P2RA 5IHZB 3PABA 4LRNL 1HSAB 1P4IH 3EDDA 4JDZA 2DQTH 2FGWL 1DE4B 4P99A 1MI5A 4JM2A 4AENB 3LEVH 4QLRA 1RZJL 1P9MA 3PHSA 2LE9A 2YK1H 5TQ2H 3QDME 4YFEA 2EC9T 1RIVH 2UY6A 4HJGB 4XBPA 4TNWF 3DSNA 5DMJB 5HHOB 3RU8L 3LKQA 1FVEA 5IB1B 3RA7H 3S8WA 4ZSOA 3DX7B 3O6KH 4K71B 5SV4A 1EJ6A 2GITB 5I1EH 1DQLL 3DOSA 5FGBC 3V7MA 1OLZA 4N90E 3QUZA 1KGCD 1DVFA 1BFVH 3VFUB 4QXUL 5EZIH 4W6XB 3CXDL 4KDVA 5DLML 1QBBA 4Q9QL 3H9SB 3NFNB 5EBWB 1CE6B 2ORBH 4HBCH 4RZCA 4I2XE 4K94L 4JKMA 2ESVE 5E6IB 1RVFL 4MD4B 1V05A 2W0LA 3S6CA 1MRCH 1NMCB 3GUTA 4PRPA 3V6ZA 2BSTA 1TCMA 1PVHA 1RUKL 1BVLA 1ORSB 3BN9D 1CFVH 3MYZA 3PDGA 4LCWA 3IDNA 43CAB 3S36H 3GB7A 5TE6L 3VD7A 1RIUH 3FFCE 1AQKL 3BP6B 4BQ6A 1XF1A 4PTUB 1RAMA 5KSBB 2CMRL 2H8PA 2Z4QA 1P4LA 4PJAF 4JHAL 2NYYC 4YZFE 3RDTA 1MAML 4Q6IA 4ZXBA 4Z7UA 3IFPA 2HKHH 2EDTA 2B1AL 2FD6H 3LKOA 1JNNH 2DICA 2XACC 5FHBH 3BUTA 4YBHA 3QEGL 1F58H 3VFOB 1EXUB 3UTOA 4ZD3H 5E2JA 4MHHG 3DUUB 4YUEH 2PO6C 5TDOB 2JB5L 4KI1A 1TPXC 4YEFA 4MDJA 4I3SH 4E41D 3TPKA 4GW4A 2AP2A 2VQ1A 4KKLD 1HHIB 5EN2A 3RIFF 3TCXA 1NLDL 1D5MB 5E70A 3RZCA 3QQ4B 2X70B 2LAGB 4N1CA 2XT1B 5GJSL 5CAYB 2WBJD 5JUEH 4J3VA 1BIHA 1DZBA 4OCWH 2VDOH 3S5LB 5DYOA 5FOBB 1DFBH 2UWEB 2W9DH 1J9CT 1ZT1B 3DLQR 2F8OA 2ZCLL 3GBNL 4RBPH 3VD3A 1NDGB 3MGOA 4WU5A 1CE1L 4HWBL 4HH8A 5TE4H 3T0EC 3T2OA 3TF7C 1CL7H 1JHTA 3F12A 5BJTB 2E9WA 4P2OB 3SO5A 4LVEA 3GSQB 3BQUA 4F80A 2JB6B 1AKJB 1FRGL 5HHQB 1A14L 3CFEB 1YJDL 2D7QA 3QEQB 3DXAD 3EAKA 4RWYL 1IC7H 2OM5A 5I15H 1QFHA 4HG4K 4DW2H 5A40E 2GFBA 3K8KA 3MV7B 5F21B 4DQOH 2NY6D 4HGKC 5IWLC 4O58H 3T2PA 3TO4B 4L8SA 4LDEB 1H3VA 4LSTL 4GUPA 4X6BA 3H2WA 5CP3H 5ENWA 1BD2D 1INEL 2JJSC 3DIFA 3E2HC 4X9BA 3Q5OA 5GGTL 3G6DH 1DBAL 2UZIH 1X7QA 4NQCD 4LLDB 3QNXB 4WHTA 2XG4A 3L95B 5ACZA 1JRHI 3QH3A 3BN3B 4UDTB 1AGDB 1U6AL 5DS8B 1HCFX 3VMPA 4D9QD 4LCIH 1OQXA 1OSZB 1D9KB 5D1ZC 2AJVH 4ZFOA 2CLRA 2JJTC 3QUMH 1IAII 1QFPA 4R97C 3FO1B 4C58B 4HFWB 1OB1A 2DQEH 1XIWD 4GXUM 5D7SL 3V5HB 4R7DB 5C7XH 3P73A 3MNVA 3S3JA 1ZANL 4KVCL 1J10A 4PJ9C 5IVXA 4JG1L 2XN9E 2DI8A 4ZO8A 1M6OA 1NC4A 2ENSA 1NAML 1U8NB 3LQZB 4OQTL 2P5EE 4RX4A 5F3BB 2OS7A 4LHJB 1IC1A 3V4PL 4GRMB 4EUPH 2XXMB 4PBVC 2HJFA 4A2MA 4WY7L 4JCLA 3T65A 1M4KA 2BVEA 3OKNA 4FQ1H 2E9BA 3PQYB 5KZCB 4Z7OE 1BMGA 3ARBA 4LMQI 5CZKA 2OI9B 3MLTA 4UUJA 5IMOB 1T22B 1F3DH 1S3KL 5EWIH 1XF5A 4BZ1H 4M8QB 5CGYD 3D18A 2PKDA 1UVQB 4JFDD 3WJLA 4D0DA 2K7PA 1N2RA 5I1CL 3WL9B 4EDWH 4HDIB 3GSUA 2EYSA 5DJYB 3BIKB 3MCKB 4BSVB 2FBJL 3KNBB 1EHLH 1I8KB 4PJGF 4HMEA 3QPXL 3MGAA