3WUWG

Kir3dl1 in complex with hla-b*57:01.i80t
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
286
structure length
281
Chain Sequence
KPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGGTYRCFGSFRHSPYEWSDPSDPLLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and structural analysis of KIR3DL1 reveals a lineage-defining allotypic dimorphism that impacts both HLA and peptide sensitivity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
total genus 56
structure length 281
sequence length 286
ec nomenclature
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuwG03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuwG02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wuwG01
4QCIB 1IFHL 5L6YH 2D4DA 4M62H 3CFDB 1DLHA 2NY0C 3AAZA 1IL1B 1ZA6B 4OD3L 1WBZA 4F33A 1JK8A 1A21A 5HHXL 4JJ5A 1HEZB 2P8MA 5J6GB 2B2XH 3GMPA 3LV3B 4F3FB 1YJDC 1S8DB 2PKDA 3MJGX 4UQ2B 1DTUA 3MRQB 5DO2C 4OSUH 4Y2DD 2HJFB 1MY5A 3KS0H 5GRVK 1HQRB 4DQOL 2HWZL 1I85A 1ACYH 1SY6A 3QDGA 4X80L 5TFSL 1R3LA 4P2YA 4OLYH 4JFPA 1ZHLB 4L8BA 5ESAA 3K2UL 1XF4B 1ZK9A 2I9TB 2EE9A 3QIWB 4QOKD 4D0BB 1R3IL 4Y5XB 1KPUB 1N4XH 3NCYP 1DBML 3MRPA 1E6OL 2WUCL 3LOWA 5FO9B 3ARDB 1MJUH 5IM7B 3DX7A 5T3XE 2GFBA 1KCRH 2CDEB 3IF1B 5DD0H 2DQIL 3KYMA 4M00A 4NQDB 4YZFE 1NGZB 2LTQB 4YDKL 1T22B 5FM8A 3WFHA 1QLFB 5IK3B 1DLFL 1EGJH 4H20L 1JNJA 3RWJB 4OT1L 4Z7VF 3HG1E 5K33A 1Q9OA 4P23A 1FVDA 3U30B 2APWA 4M1DL 4PJXB 4Y1AB 2FDBP 4GRLC 3BKML 1MVUB 1B2WL 25C8L 2WWKT 4AIZA 4B5EA 4EUPH 5HVHC 4PRAB 5D93B 2ENYA 2YA2A 3JVGA 3GSUA 5DT1H 2BMKB 1IAII 2RAMA 4JRXA 2DMCA 3CMGA 1QD0A 4MMZC 5IWLC 4BQCA 4IMLB 2HFGL 3U2SA 1A1NA 1T6VN 4MNGE 1YEHL 2IF7A 2VLRB 4OCWL 2VABB 1CFVL 4ZTPL 1BEYL 1QRNB 2GQHA 4DEPB 4PJAE 4CVZA 4PJEA 5D1QC 1H9VA 3ARFB 5BMFH 3V5KA 2PTVA 1U3HD 5FO7A 3PP3H 3F12A 2FZ3A 4PV8B 4Y19D 3ARGD 1BFOA 4AJ0A 5CCKH 3GKZA 5FCSH 3DVIA 1S7WA 4W68A 5CP7B 5I19L 1SYVB 1B0RA 4ONOA 4MDJA 1MLBB 1DQTA 1U36A 2CJUL 3PV6B 5DZLA 3I6GA 3MUGA 3SKMB 1GGTA 5F9OH 4RZCB 1T7WA 5DURB 4JFHE 1SEBA 3X3GL 5DVNA 5HI3D 5JDJA 3HI1B 1G6RL 4QXWA 3ZDZE 1A7PH 43CAB 4FQ1L 4OQTH 4EN3B 4HQQL 2IAND 2NMSA 3T0ED 5LQBL 1DQQB 3RZCB 2I25N 1ZLUK 1X5GA 4IOFC 4M1GH 1MLCB 4JFYB 4Z77B 2IFFL 1CL7L 1MCPL 5ESVA 1P4IH 4M9OA 3RIFK 3EFDH 3DRTB 1DBMH 3CXHK 4M9PA 5DMKA 2ZG1A 3GSVB 1ZS8A 1PVHA 2O5YH 3PWLB 2AXFB 2J8UA 4LEOA 3KHQA 5CLTA 4EUPB 3SCMC 3OAYK 4G5ZL 5FKAB 3KXFD 3RGVB 1WJ3A 1KIQA 3WYRA 3K4DA 1JF6A 3VXRB 3L95B 4S0TD 4NKQB 5DQJB 3TBYA 1CFSB 5IHZA 3TYFB 2PCPB 1X5AA 1SBSL 5AYUL 2UVEA 3B43A 5C0BB 1SJEA 4JY6A 4JCMA 1JGDA 4HJGB 1NGWB 4HIHA 4R90H 4WFFD 5BW7C 4JZNA 1HQRA 2NY2B 1CI5A 2W60A 3LDBB 5CILL 2E27L 1U92B 2VDNL 4WUKH 3C5ZD 3EOBB 1LO2H 3W9DA 1JZ3A 4GW5B 2KH2B 4X6FA 2XNAA 3HZVA 4NYLA 1WZ1H 1LO5A 2VSDA 1QVOB 5IIEA 1YEHH 4XAWL 4AG4H 1QBAA 5HPMB 5IKCB 4FQLH 2APVA 4PGEA 1GOFA 1F45A 1T04A 1PFCA 3KYMB 2EO9A 2SEBA 3MSPA 4XWOC 1J05B 3PUCA 3QEQB 2NLJA 5BVJA 5CCKL 4QKXB 3HKFA 3FQNA 2VITA 1LK2B 4LIQL 1YC8A 1UKQA 4NO5B 3WS6C 4OLXL 4AT6B 3AM8C 5ID1A 1BD2A 3Q2CA 2FX8L 4P46A 2CIIB 4QY8A 1NC2B 2ICEB 4LSUL 4K23L 2I60H 4FTVD 5E1AA 1V3JA 3KYNA 3U0PB 4I2XA 4O00A 1FBIH 3EYSL 2PUQT 3P0YL 4KQ3H 5T1DH 3RUGB 3KYOA 3MCG1 3S5LB 5J1AB 5C08E 3BPNB 5BQ7A 1WK0A 5FYLH 1YEKL 4IMLA 5HBBA 5HDOA 2GSIB 3OTTA 3O6FA 1KCUH 4JPIA 3SKNB 2J6EA 4ZXBD 5F9DC 4R7NB 3EYUH 2DQEL 1F6AA 2EDQA 4DGIH 4X7DC 5C3LD 2H32B 2XZCL 1ITBB 2XXCB 3U7YL 4I3SH 4NFDA 3E1F1 1JWUB 4KVCL 3QDJE 1P9MC 2NY2D 5TQ2H 5EC2A 4JRYB 1ZMYA 3SDCD 4MA8H 2XQYK 1MCOL 1YEFH 5C07A 3EHBC 1PG7X 1RMFL 4YBHA 2ZG3A 2BSSB 3DTXA 4YFEA 2V9RA 1CGVA 1PG7L 1GC1L 1NQBA 1DQML 1MNUL 1IAIH 4LSRL 2ZSWA 5DD6B 1A2YA 4P2CG 3NPSB 4XMLH 4MB3A 5K9JH 4PJFE 2DQGL 4N8CL 3EDEA 4MVBD 4GXUN 4K9EC 1QSED 4JZJC 2VXTH 5TDNB 3VXNA 4TVSa 3PWLA 4HG4J 1CWVA 1WLHA 1YZZA 2KL6A 5I1CL 4GT7A 4B0MM 1JZ6A 1FRGH 3D25A 5EBWB 4M5ZL 3UTOA 1A47A 3FO9B 3JWOL 4HUXA 2H26B 5DMIL 2VR9A 3SDAC 2DLIA 3MR9B 4OLXH 5E00B 2VDKH 4EEEA 2X4QA 2JIXD 2ATPB 3RZCD 4GRLD 1AR1C 3GSNA 2P47B 2IPTH 4U1NB 1KJ3H 3CSYB 4R2GC 3S35X 7FABH 1YJDH 2RGSA 1G7IB 4FQJL 2CR3A 2BVPB 2CXKA 4NQUA 1LDPL 1QO3B 1FGVL 1YEJL 2B7DT 5I17B 1A7BA 3REVB 4KXZH 4NYLB 1TFHA 1F11A 3GSXA 5IBLC 3BP5B 4KC3B 3UO1L 3IGAB 2DRUA 1OAQH 4YHMH 3UJTL 4E5XB 2BP3A 3OKOB 4LCCB 4HIEB 4LPTA 1I8MA 5CEXB 3B6SA 4OLVH 5JDSB 1J0YA 4HIXL 1VERA 1DQJB 1JTTA 1AXTH 1HINH 2Y07L 3UJIH 5DEFB 4J3OC 3QRGH 2VAAA 2BC4A 4IRZH 2VDQH 3SGKC 2GK0B 3IDYB 1ERNA 4UTBL 1AGCB 4C56E 1S7XB 5GPRA 1FV1A 1QFWM 4X7TA 4ODVL 3RP1A 2XZAL 1MWAB 3CFKB 5BRZE 4KKCD 4OI7A 1NDMA 1HDMA 1Q0YL 1CCZA 1DANT 1R5IB 4M7LH 3GSWA 3CX5K 2FR4A 3D0VB 3C60D 3I3DA 1RD6A 3TWCH 2VWEE 1R24A 4UV7L 5E2TH 4ZSOB 4G3YL 4R0LA 3V6ZA 2NY3D 5C0EB 1C7TA 2ADGB 1KTDA 2AJZA 4FS0A 5DUMH 3VA2C 4MNGB 1VSCA 3GHEH 1BREA 1EEYA 1JI1A 1RU9L 4MXVF 4YGAB 3GO1H 4O5LL 3IJYA 4HKJB 2AQ1A 3QQ4B 4OCYL 5CLWA 4JDTL 2VOTA 3QCUH 5K9QG 5EU6B 3ZL4L 4L1DA 1I8KB 2J1KA 3SJVD 4BFIA 4MCZB 1DQDH 1VADB 4JO1L 3MRRB 1FO0A 5AZEH 4KRPD 3U4EB 3BQUC 2DBLL 1I7ZA 1BFVL 3RX5A 3HUJF 5KSAD 5E5MB 2YD7A 2F19L 1ND0B 3QDAA 4Y19B 3REWB 3O2VH 2YN3A 3KJ4C 5D7JB 5I71B 1CGXA 4PJCF 3TH3T 4Q9QH 3GHBL 3IAQA 4YQXL 5C1MB 1FL3B 3N50A 3S3PA 4CVXA 3UTPD 1TZGH 5EIVA 4DTGH 1C8PA 1YQVH 1TETH 4JN1L 3BRGC 1DE4A 1NEZB 4WCYH 5HHNA 4DN4L 5MI0C 2J4WH 1IILE 4Q2ZA 5HY9A 3KPMA 2NTFA 3O2WL 5ACZA 4EVNA 5LBSL 3NIGE 2XA8L 3TJEL 2A1WH 5T5FL 1C7SA 4OZGB 5IG7B 1WTGT 4PJ9B 3TBVB 1T83A 3QQ9D 3SGDH 4DFIA 1P2CA 4TQEH 5LAXA 4K7PY 4UT9H 3MJ7B 1T2XA 3CZFB 1QACA 3V4UL 1NCTA 4HJ0C 3S36X 5JW4M 4XC1H 3K7UA 3MLTA 2EYRA 4Z76B 1TVHB 2K9UA 1G7IA 3OG4B 5CBAB 1T3FA 1ULVA 1IM9B 4PJGF 2MQ0A 5HVHB 1LEIA 4HKXA 5DJ8A 4JLRB 2HMIC 1YNLL 5LXGH 4YHNA 3LY6A 1JPTL 3DO3A 2NPLX 1ZGLA 4KV5F 3IU4L 2M26A 4L8SA 5HVFB 4N0UA 2JB5L 2BJML 3QJHB 4GRWE 4L8CA 4P2QB 3F7VA 3OGCA 4P46D 1QFPA 2XI9A 3WS6A 2Y36L 1FE8H 3O6KH 1FHGA 4PJ5A 3D39A 4RQQA 3OKEB 4UIMA 1DSFL 1B6UA 4TRPL 4WO4B 2V2WA 1FH5L 2V5RA 1MCCA 3WFDL 4ZPVA 1P84K 2BSTA 4L3EB 5I18H 2APXA 5EIIA 5IEKB 3QJFA 3DYOA 1BJ1J 5DJXB 2YD4A 5DRWB 1JHTA 2G5BB 4PRDB 1U9KA 4NZUH 1IAOB 1YMME 3V79C 4GUPA 4GFTB 4N1CA 4M1DH 2VH5H 1U0QA 1KG0A 5I2IA 1XR9A 2EKSA 1JNNL 3QWRA 4XVUC 5HYIA 3VXSB 3X13B 3MRIB 4AZ8A 4ODXA 4QGTA 4JM2F 5KSBB 1KLUB 5KSVA 3FB6A 4L9LA 4APQA 5JR1L 4O2FB 4DKFL 4OZFH 3CVHH 3HG1D 1OL0A 3ULVC 3EZJB 1BEYH 3E6FA 1A3QA 4KK8C 4M62L 4MAYC 4OZGE 4XVJL 2NNAA 3NFPB 5JUEH 2YPKA 3LKOA 4X9HA 3J8F7 3KPRB 3DUSB 3ZDYF 4F7MB 5HHXH 1N59A 4S1DC 2D7QA 1KCSL 1QKZL 5HYJA 1HXMB 2YWYA 1ORQB 4WGWB 1HH9B 1JHKL 1FL3A 1DCLA 1LGVA 4KHTL 1CF8L 4HDIB 5GGSY 2QJDA 3WMSA 2YXMA 1CYGA 3MXWH 3FB8B 4ALAH 3RA7L 4JPKL 1CICA 4IRJC 4XHJD 4DGVH 3NN8A 4UBDC 4MQTB 4Y2OA 5EN2A 4JQXA 2H6PB 3MQIA 4JZOB 5MEND 2DQJH 3ULUH 1CLYH 3B9EA 4RGMC 1S8DA 4HXAH 1CDYA 4LCUA 4FTVB 4RRPG 3VGBA 3RI5F 3GUTA 1IVLA 1NCUA 4WFEE 1J1XL 1QSEB 3BPLB 4GRMA 4OTXL 2BVOB 3IDGB 4OGAC 5GIRA 3VFGH 4MXQC 4O58L 1P2CB 3RGVC 3QHFH 4N8PA 4W81A 5IMOB 5I18L 2ADIA 4JFPB 3CLEL 4HWBA 5IB1B 5C08D 4KRPB 4RAHA 2A2QT 2J8UE 5BV7H 4UQ3B 1RIUL 2FEDD 3ROOA 2PR4H 4F7PA 1K8IB 1ITCA 1W0WA 4U6HA 5B3JE 3QXDB 4ZNEA 3KPSE 4KHXH 2ARJQ 4HLZH 2IGFH 4AQ1B 1B2WH 4RGNE 5ILTL 1JNNH 4YHLL 4V2CB 4CU8A 1IC5L 5CAYB 2CD0A 2G60L 5GGQH 1T89A 3MBXH 5IK3A 1T1WB 2AKRA 3OPZL 4WO4C 2VIRB 4Y4FA 3VI4E 3BQUB 3OAYH 4OCWH 3VXPA 2P5WB 3L5XL 1Z9MA 1TCRB 4MJ4A 3IU3A 3NA4A 3NABH 5GGRB 2HLAA 3OR6B 2JTDA 4FA8A 1OLZA 4KZEH 4Y7MA 4ZPVB 3H0TA 2R0KH 1QTYT 4MJIE 2ED9A 4MJ2A 4ZXBB 1J1PL 5IW6B 1B88A 5J89A 1RFDH 1F4WH 4GRWH 1AGDB 4PJ7B 4P2OA 5J1TC 2GTZB 2F54E 2D3VA 2Y72A 1PLGH 5H35A 2VDOL 4OLUL 1YNKL 4N5ED 1A7PL 1EEZB 2I60L 4NBZB 4AIZB 3V9FA 5D71H 1G1CA 2YSSB 2F5BH 2KUTA 1JV5A 3FHAA 5D7IB 1MF2H 5KSVB 4M1GL 1NBZB 1EEUA 3FAWA 2B4CC 4Z0XB 3PGFL 1MQ8A 2X1OA 4XTRD 3X12A 3L3JB 4RZCA 4ZD3H 2O5YL 3MCKA 4E42B 4QTIH 1MQKL 3E6FB 3QG7L 3NAAH 2ENSA 4JPWL 3GMQB 4N0FB 4PBXA 1IZKA 5C07D 4LCCC 1MCLA 4KTEL 4MB4A 1VPOL 4JKWA 4DJMA 3TPKA 3QBTB 4ESKA 1NDGB 4N9GB 2BSED 1G6VK 4Z8FL 1K2DA 1RZKC 2GHWB 3MGAA 5JXED 3ZYIA 2J8UB 4LEOB 3LS5L 1MHEA 2E27H 4Y4KA 5KG9A 4PJEF 2HYMA 4PGCB 4PR5B 3SHSA 1RHHB 1X9QA 1JN6B 2ZJSH 2EDBA 2YD5A 3BGAA 5CJ5A 5C09D 3C2SA 5T3ZD 2O26U 1JBJA 2YEZA 4Y1AD 3LKRB 4KWUA 3IKCA 4A6YL 3TV3H 3CVHB 3PGCA 5DHVA 1QBLL 4NRXB 3BZ4B 4PJCB 5BRZD 3OL2A 5FK9A 4DAGH 1KIQB 3VRLE 3WFBH 1DZBA 3AY4A 5F7YC 4E0RB 3TESA 4LLYB 4P57B 3FN3A 5GRJH 4LIQH 5IMLA 3T1WA 3HNTL 3ARVA 1YY8A 5CZKA 4XPAL 5C6WH 5DDHB 2D7TL 5SWSB 5CHNB 5D1ZB 2OTWA 1MELA 1OTUC 5I8CA 2JB6A 5CEYB 1WWWX 3WBDA 1FBIL 5T1DL 1G7PB 5TQ0H 1WTLA 2H8PA 5FUOL 3SE8H 2GSGB 4IRSB 3EGSB 5FYLL 1D5XA 3PGFH 1JGEB 3HHRB 5C2BL 2G2RA 1CE1L 5ICXA 3QCTL 1H15B 2YS4A 2AK4D 5HPMA 5IKCA 4F7EB 2RR3A 2VLME 4Z0BL 1T04B 5IFJA 3NAAL 1KB5L 1Z0MA 3B8YA 3KYNB 3IXTB 3ZSTA 4XNUL 4NUJA 4OZFA 4Z7OE 1WAAA 5GGTH 4HBQA 4LBEB 3S7GA 4ZSOE 5GRUL 4C4KT 4YBLB 2OZ4A 3TPUA 5CZVH 3TBWA 3PIQB 2CK2A 3U6RA 2WWMD 1YMMB 2EE3A 3JWDL 4NM8L 4X4ME 3FFDB 3QDJB 2R1XB 4GBXA 3I3BA 1P7HL 1RMFH 5F1OB 3X11B 5EC1A 4UT6L 4IRJD 5GHWL 2BVUA 3LS5H 4R4FH 4AH2A 1RK1A 3EYVB 3DECA 3U9UB 2NW3B 3GSOB 5ADPL 5L8LB 4LHUB 4NCC2 3RWDB 3WO3B 1MCSA 3C6SA 5D7IA 5DD3H 3V4VH 4NO0D 1EFXD 4MAYA 3E6HB 4LSTH 4Z0XA 4ZFFB 3CU7A 4OZHE 4J3SA 5ETUA 4XT1C 3C60A 2VLLB 5T1LB 2VXTL 1OB1B 1AO7A 12E8L 1EUTA 5FKPA 4K3DL 3T0EC 3T2OA 4EQ2A 1OP3K 4CMHB 4KI1A 1GAFL 5ERWA 4YX2L 1KIPB 2Z8SA 2IPUG 2QL1A 3GI9L 4MA3B 3AREB 2AEIT 1HZHH 5TH2A 1HHHB 3FB5A 5C0IA 2CGRL 1IEHA 1J18A 4G8GB 4RGOL 3RNKB 5C0CA 4IDJH 5HYFA 3RAJH 5F7MC 2ICWI 1X5KA 5FDWB 1CTNA 1TQBB 1JYVA 4OJFH 1MFEH 1XGRB 2WSKA 2K3TA 3ZE0F 4MWFA 4WHYG 4K3JL 1YPZB 1NLDL 5T33H 4IS6A 2FIRT 1HHGA 4BH7B 1N5YL 3CX2A 1FL6A 1NUFA 4TNWK 3HFMH 2E6JA 1MJ8L 1BOYA 3DI3B 3MV9E 4YXKL 3MYJB 1AD0B 1I3GH 4QRUB 4KDWA 3IKCB 3G6AA 1N0XL 3ULUC 1CDGA 5JA9A 2PYEE 1MY7A 2WW8A 5DRNA 1C1EH 5F71A 4P99A 2E3VA 2GT9B 4MNHB 4FABH 3BMWA 1R5VB 3U36A 4XP9L 4MAUL 4ETQB 3WV0A 3VFPB 4P2QE 3TT1L 3ARGB 3IGAA 1OQOA 2E7MA 3U0WL 4CBPA 1R3JB 3VXUD 2Z91B 4BSWB 2H9GB 1OY3B 4XC1L 3BIKA 4HWBL 5JQ6L 4XWOD 4HIIA 2JCCA 2XXMB 4M6NL 4YWGH 5CGTA 3U9PH 3A6BL 4GS7B 5TF0A 2AEQL 4JHWL 3HAEA 2RCSL 1RUAH 3RWGA 3BP5A 4KROB 5GRYA 1P53A 4HIEA 3RHWK 1FFQA 5I0ZA 1EMTL 5EU7E 5JDSA 4W70A 1I3UA 2G9HA 3O6KL 4U2ZA 4G80B 2EDTA 3EDDA 1LEKA 4PJ8B 5HDBE 1GGBH 3L9RB 4RWYL 4K7FB 1YDPA 4TRPH 3HUJA 1MI5D 2P48B 2UVFA 1BM3L 1MPAH 3D39D 1YMMA 1MAKA 2JJUA 3VFWB 4RIRA 5HYEA 2R69H 4ZFOB 2DOCA 2X4UA 3X17A 2OCFD 1HDMB 4M6MH 3JV6B 1ORSB 2JELH 4WFED 5L2KB 4D9QE 4WGVB 1OP5K 4RMTA 1L6XA 4H1LA 5BRZB 1S9XB 3UJJH 2LV4A 5KN5B 2PETA 4P3DA 5T1LA 4G6MH 2XPGB 3WSQH 1ETZA 2C7UA 1QFUL 2WINA 1CGSL 3O2DA 5EH1A 5FYJH 3FQWB 3VFVA 1D9KA 3HZMB 4I18B 1IKFH 1KTKE 4GQ9H 4UMGA 5C0CE 1X5ZA 3QXTA 1ZHLA 3HE7B 3HB3D 3QNYB 4Y4KC 4NHUB 2J6EL 4YHYB 1RZIA 4HBCL 4QOKE 3QIWA 3OKKA 4HMEA 3BO8A 1TQBC 3REWA 3TT1H 2L4OA 3MRPB 3MODH 1ZHBA 3VRJA 5C0FA 5LCVL 5C0RH 2EH7L 5D7IF 3WJLA 5I1LA 3MA7A 4OZGA 5IG7A 2NY3B 2UZIL 3NFNB 2YPLB 2WQ8A 3TBVA 1YPZA 4NGHH 4GG8B 2MCPH 1T03H 4LLQB 5FOBB 4JRXD 3FT3B 5C6TH 1WCBB 4IOIA 4U33A 4PJBB 1ZT1B 1RUAL 4XBGB 5J56B 3LRHA 5B21A 5E2UH 5HHPA 1X5YA 1W8OA 5HJ3B 3MRDA 4XBPB 3TN0A 3QAZC 1ONQB 1NFDE 2NY0B 5K9OB 5HHOE 4BSVA 4GRWB 5L7XL 1QP1A 5MENA 4N0CD 3B5GA 1JWSA 4YO0A 3K2UH 4HCRH 4LQFH 3QDGB 3MJ7A 2I5YL 2JJSA 2CDGB 2GJZA 5E6IB 2ZCKH 4J3UA 5KSUB 4OV5B 2IH1B 1KN2L 3B9VA 4F9LC 4DVRL 4XXDA 5HHVH 2X1PA 4PRBB 4BFEA 4GXVL 3O4LD 1W2KT 2DQIH 5KOMC 3BHBA 5HHOB 4Q74A 4M7JH 5IB4B 4RQQB 5JPMA 2VH5L 1S7WB 5CP7A 1YEDA 1X3DA 5ILTH 3QDGE 2D4FA 2NXZC 2IJ0C 4LPUA 2A74A 3O0RH 2MTPA 4LMQE 5D9SB 3GZKA 1S7VB 3INUL 1QLFA 4UV4L 3VRIB 3AB0C 1A1MB 1OVZA 2DB8A 3RWJA 5I8OL 4PY8I 4WW1B 4QHLB 4F7CA 3MV7D 3SDDC 4JKKA 1NANH 3TO2A 1KLGB 3ARUA 3VXUE 1KEGH 3R0MA 5B3JF 4R4BA 4ZOCA 4DN3L 4F57L 3ME0A 5D7IE 5T1KB 3ULSB 3VG0L 3OJDA 1WEJH 2WV3A 2FCBA 3EKCA 4FQIH 1MJ7H 2Y06H 5C0JB 4O2CB 5L8JB 4X9FA 3VGEA 3PF2A 4OCNC 4GUPB 4N0UE 1AGEA 1ZEAL 3O41B 4U1SB 3ZTJG 3HC0B 3K80A 1G9EA 3LRGA 4TUKH 3F7QA 3QUZC 3H9SE 5IEHB 4PJHE 2B5IC 4GKOA 5E2UL 4HK0B 4OZHB 4JVUA 3TGXA 5KN5A 3SKOA 5FHAH 4K71B 1I9EA 1B0RB 1WBYA 3LAFA 2X4RB 4FQ1H 1GZQB 4U3XA 2ZOKB 1JUFA 4NQCA 4PGDB 5DJZB 1FZOA 1L9NA 3T77A 4TYUA 2FGWL 3EYUL 1T7YA 4X4YB 3TH2T 3Q5TA 1GVIA 3DNKA 4YHIB 4AQOA 1CICB 4JDZA 1C16A 1OAKH 1IGCL 2R0LL 3DPBA 4XNYH 4P59H 5MP6L 4PB0L 3DXAD 4B41A 2E7HA 1HIMH 3DBXB 3U30C 4FTVA 1ZGLM 5IMKA 2VZ3A 1MCHA 5CWSB 2ZSVA 4X0KA 4X5WB 1XIWD 3IFNH 1JE6A 1HCVA 5D72L 5BO1L 3BEVA 2FHFA 2MQ3A 2VO5A 4P5TC 3KWWB 4LHUG 5C09A 4FZ8H 5F1NA 5SWQA 5HHPB 4NQCD 3QH3B 2WANA 1NCBH 5BCAA 4KRMB 3L1OL 3ARDC 2Q76A 2QADD 4K3HA 3QFJD 3UAJC 4UAOC 1BQLL 3UPCA 1H5BB 4I2XB 1UWEH 3LZFH 2HFEA 4RNRB 5HGDA 1DL7H 4RISL 1F13A 1D6EB 3RL1A 1BBDL 3OQ3B 1QQDA 2EDNA 3U7YH 3DSNA 4UDUB 3PHQB 5KZCD 5BZDA 1EXUB 5SWZD 4XP1H 1PQZB 4OF7A 4OZIE 4M6AA 4F7PB 1HHJB 5HI4C 1MFDL 4N0YL 3UTQA 1FSKC 4BZ1L 1OAUL 3BHBB 3AXLB 1KJ2L 1X5HA 5HYSB 1OW0A 2WIIA 2D7TH 5CP3A 2OBGA 2R56H 1UZ6E 3MV9A 4PJHF 4ODTH 2HP4A 3QEUA 1P4LA 2P24B 2ZNXA 3GJEB 3SE8L 5IW6A 4KUZL 2W0FB 3WXVH 4RGNB 2HT4C 1RJLA 3KXFE 3V7MA 4OAWA 3IDJB 5I73C 3P0YH 2OX5A 1J1OL 2YMXL 4NBYB 4P46B 4TNVK 3FO1B 1FDLH 4HIXH 4K8RD 1JGVH 3MRMB 4OGZA 3MLSL 4NM4L 5GS0L 2EDWA 5GZNC 3FO2A 4MLIA 2OTUA 3H9HA 4LGRB 4P59L 4GRLA 4Z5RA 3PQYA 2GUOA 1EVTC 3C2AL 3B9KD 4ZNCD 2X6MA 4HIJA 1KOAA 5C0JA 2YA1A 4IBLT 2VXQL 5FGBC 3QEQE 2ICCA 3O6FB 5DMJB 4PGZA 3K3QA 4LLUB 1RJZA 1FYTB 5AZ2L 4YC2B 1R3HB 1IRAY 2BNUA 2FL5B 2GYSA 5IESL 1S7TA 3ZYOA 1PG7W 3JV4A 3CDYA 4WDIA 3RVVC 2CUHA 1INQB 1QA9B 3QIWC 1GGCL 3PWUA 4LLVB 3FFCB 1BQLH 1F8TH 2C1PA 4NQCE 1B9ZA 2KPNA 4M4RA 3WJLC 1NANI 1T0MA 1M7DB 2VLJA 3M8OL 3Q6FA 4K2UH 3RVWD 4IMKA 3EIFA 4ZYKA 4XHJC 1F11B 1YPZE 1RK0B 1CN4A 4D9LL 1JN6A 1DQDL 1ACZA 3JBG7 3QXWA 2EXWD 2G5RA 4P23C 3LQAC 1CGWA 3KDMA 1I1FB 2YEZB 4TULH 4Z7QF 2F15A 4BKLB 1BX2B 1NCAH 4FQPA 3OJ2C 4XCYA 4OZIB 2X4TA 3WIHH 2NX5E 1HKFA 3MZGB 1S78D 5IWLA 3TBTA 2DKMA 5ALCH 4XCEB 3PHOA 4OF8A 5EBWA 4JJ5B 1MCIA 3HE6C 3I6LD 2IPTL 3LKQA 4YLQT 5SWSE 4XWGL 2FEDC 3LV3A 4F3FA 4NKOA 1MWAA 4OF0A 3V52H 4OUUB 1KNOA 2A6JA 2V17L 3CSYA 5DHVB 4N8VA 1NFIB 4Q6IA 3SCMD 3MLSH 2P8PA 4BK5A 2WMPA 2IBBA 1Z0NA 1ZVYA 5B3NA 3H8NA 1XF5B 1KJ2A 3BKYH 2IAMD 3LKNB 2COQA 1VACA 3EJYD 1WFUA 4NKMB 5ICXB 5A2KH 3IAPA 5CEXA 5I1HL 2R23B 3RWIB 1EERB 1CD8A 3CU1A 5I1KL 1O0VA 5D7KE 3T4YB 2Q7YA 2OSLB 3I02A 1VDGA 4HJJL 5LWYL 3VXUA 3OX8B 3JTTA 4WFHD 3T65B 4YHKH 2R4RH 4EZMA 2AEWA 4U6VL 2R8SH 2NXYB 4DKDC 4U1GC 1GGCH 2QKIB 3HMXA 5H8DA 5KAQG 4GG6B 2X1XR 4ZUUA 2UUDH 3LMJL 4K07A 2ICWA 1RZFL 1GH7A 2CMRH 3TC9A 4NUGL 1P7QD 5L8KB 2IH3B 5JW5A 4CRPA 3TP4A 2GCYB 4DOHE 4ZFOL 1KTLB 2JJWA 3MBEA 4WHDA 2WBKA 3TPUB 4NDMA 5BW7A 1HKLH 4PJ9A 2OL3B 3TF7C 1CLCA 4NQXA 3LQAL 3L7EB 3CFCH 5AG9A 2YR3A 1WSST 1X5XA 4XCCH 5DVKA 3AUVA 5DD0L 3T09A 2DBLH 5FB8A 1P7QB 2DLFL 3BW9B 3SKJH 4LHUA 3ARDD 1VKXB 1KB9K 5CJXA 2FHBA 3VD7A 5HD8D 2NY1D 5TH2B 1A6VL 3MLTB 3HFML 2XTLA 4ZOEA 4Z7NE 2HTKC 3IU4H 2XZQL 3NCCB 1P9MA 1WAAF 1TZGL 4V1DE 3CCHA 3MOAH 3OWEA 5D2NA 5D7JA 1Q1JH 4G6ML 1TETL 5EBMA 1QFUH 2AXJA 3RU8H 1EHLL 4L8SB 3MLXL 4GKNA 2L0DA 2V7HA 4LLWB 4IRSD 4D9RE 4N0RA 1HSBB 3AM8A 1G7JB 5IQ9A 1Z6JT 2EDXA 4MJIA 4HUVA 2X4SA 2V5YA 5E56A 5EBLA 4Q2ZB 5I1IH 2BNQB 1U8MA 1IAKA 2J12B 5DMKB 4F8TA 4OZHF 3WNPA 3ARDA 5IM7A 5C70A 2AXFA 1BX2A 3IF1A 3D18A 4LKCA 3BUYB 5H94A 3MACL 3GIVB 2RIKA 4BJLA 4EBQH 5DRNB 1R5WA 3MNVA 4XNXH 3ULVL 5ABDE 5IVOA 3S34H 2MCPL 4NN5B 3O6FC 4NQEB 3HCVA 3RA7H 4YNYB 1AO7E 1VCAA 4FQXB 4PLKD 4TVPD 5EU4A 5KZCB 4QRUA 5AEAA 3AVEA 4PLOB 5GSVA 1BVLB 4WFHE 1RZFH 4Y16A 4Y1AA 1C12B 4BSWA 2W0LA 1KXQE 1L6ZA 3S96B 5I74B 1WCQA 3V6BR 1LK3L 4POZC 5GGUA 3VXSA 3X13A 2OR8A 2DMBA 5DQ9A 1GGBL 3GMMB 4WV1B 4ZS7L 3BH8B 2AJYH 2DJ4A 5C9KA 4WI8A 1ZGLB 3HZYA 1JGLL 2C3XA 4HD9A 4FP8H 2ZNWA 2I5YH 3O4OB 3N1GC 1MWAL 5BOPA 3TO4B 4HG4K 1DSFH 4HS8H 5I73B 4F2MA 1KN4H 4NIKB 4WUUD 1MCQA 5C8JB 1QKZH 5ECJE 5CEZD 4CUCA 4ACPA 1J9CT 1ZVSA 3CLFL 2VXVH 2UWEB 1YY9D 3P11L 3ZHLA 5IB3A 1EGJL 2EDJA 4H0IA 4Y16D 5CD3B 4JFOB 3RWGB 1EO5A 1XF1A 4GAYA 5IBLD 1A6PA 3F62A 4HPOH 4WI7A 4ZTOH 43CAA 3MLZL 1HE7A 1FIEA 1AGFA 1BVKB 2IQAB 4PJXF 4EI5A 1NLBL 1LNUA 4H25B 4HUUA 2D0HA 1I7UB 5E9DB 2P42B 4CU7A 3QUYA 4QRSA 1NBVH 1NMBH 2P5EE 4TSCH 5I1IL 1TCMA 3BVNA 3HR6A 4L1HA 5CD5C 1JYXA 4MS8C 5I1GL 1S78C 4UINH 2VC2L 5ALBL 1TJGL 3LSOA 4G8FA 3PP4L 3MRJA 4LSVH 2CR6A 1JWUA 4QXUH 1T03L 2QHLA 3GM0A 4NN7C 4UQ3A 1T2QH 3KYKH 2P5EB 4JM2D 4Y4FD 1FN4B 3FRUA 4S1RL 1W0VB 4EI5D 4LQ1A 1FCGA 3L5WB 1RZ7L 5GGQL 1KB5B 3WIIH 2EEBA 1AO7D 5HYJB 3TEUA 4MJ6B 3NFNA 1DJSA 1S7RB 4GOSA 3NFSL 4DGVL 4PJDB 3SGKA 5EOCJ 2VR5A 3LPWA 2QQNL 1HSBA 1OT1A 4IJ3B 4YR6A 4PYHA 1RZIB 3VW3L 1TZIA 1FCCA 1JPSL 2IFFH 2HJLA 2OTPA 1HK6A 2P5WA 1OAKL 4R8WH 1KCUL 3G6JF 5HJ3A 5FF6A 3HE6A 1WISA 2NY6C 5J1SC 2DQEH 4JFDD 5JW4N 4WVRA 4GRWF 1A0QL 1J0IA 5K9QI 3QIUC 1R0AH 1RJYA 4DCQB 4JREB 1R5WB 3QUMB 1YNKH 4GRMB 5IMMB 3JWOC 3UEZA 5KS9B 3V0WH 35C8H 5HDBF 2BY3A 1RULH 1MAMH 5E6ID 2IH1A 3U46A 3T3MF 4TPRL 4WTXA 3W11C 4PRBA 4CVWA 4WU5B 1I1AB 3DOSA 4M03A 3L5HA 2KDGA 5IGXH 4HUWB 5MENB 4UI2A 4PJIB 4XNMA 4ZD3L 1C5CH 2XWJB 4GH7B 3RDTA 2GIYA 1KEGL 2X1QA 4ZUTA 1OTSC 1CDBA 3AB0B 4E5XA 3NGBB 1QFWL 2AJVL 4DZ8A 3QSKB 5CIPA 4V1DA 5FO8B 1OGAE 4ZPTB 1TZHB 5DTFB 4XP1L 3Q1SL 3ETBF 4PLJD 4PRHE 5JHLL 1U58B 2C4XA 2NY1C 4K9EH 5EU3B 2FLBT 3ZDXE 4M5ZH 4MD5B 5JZ7D 2HMID 1LEGB 4ODHH 3E8UL 4R3SB 4BZYA 1Q9LB 4OM1H 5D9SA 1OWRM 3MBEC 3UYRL 1IAIL 4X7TB 3ARBD 3MRLA 5F3BB 1ES0B 5F7WC 4LAQL 4PRPB 2Z31D 5DJCA 2QSQA 4K94C 4PR5A 1HI6A 1LDPH 4HCRA 4NJ9L 3TO2B 3TIDB 2O61A 4LNRA 2XKNB 3PWNB 1EEZA 3U83A 3VFSA 5MHSD 1BZ9A 4KRNA 2E9IA 1KB5H 3QFDA 3UTSA 3TBSB 4XNUH 3MRHA 5GJSH 1BBJB 5HGBA 4TTGA 1YMMD 3G9AB 4MD0A 3ROLB 3MRCA 3O3BB 4G7VL 5FYKH 3F5WB 3V0AC 1S7SA 4P5MA 3HMXH 1E4JA 1KPVB 4LVHB 4YDVB 4G8FB 4HKZA 2GJ6A 5FK9B 3TT3H 3KR3L 3X12B 4NN7B 1A9BB 3NOIA 3MOQA 2VZ1A 3B2VL 4Y8AA 3U1SL 5KW9H 2X70B 3QUZB 3CDGA 2R9HD 4JQIL 2NZ9D 5GRVL 2VDQL 5F3HA 1U8NA 4LOUC 3BPCA 4IJ3C 1W0VA 3V4VL 3DVGA 4R96A 3TA3A 2VLJD 4POZD 5FM5O 5IGXL 1ZT4B 3B4NA 3S35L 5A2IH 3HE7C 2XQBH 1VEPA 4LSRH 2ZJSL 5GS3A 2B4CL 2NY4B 4UV7H 5E2TL 5D2LA 4MLSA 4EDWH 4NQVB 5HSFA 3WUZA 4DK3A 3B3IA 5DUML 4EVNB 3DXAE 1PX4A 4Y5YB 4XB8A 4ELME 1LHZA 4IRJA 1G9NH 3OB0H 1P4BH 3K8LA 4OIAA 4TSAH 5IMKB 5KANI 3ARSA 4JQXC 1FNSL 4JM2B 4R2GD 4ZAKA 4Y16C 4PRIA 1OGAD 1IQWH 1KT2B 1BGXH 3HR5B 3SKUD 4L4TD 4UUJA 3ESVF 5D1QD 3NH7L 4J3WA 2GJJA 5E2WL 4NNXA 3UYRH 5HDQL 1PQZA 1KV3A 3CFKA 4YHOL 3RKDC 2NW3A 4JY5L 3C08L 1MOEA 5HDLA 2DF3A 3MV7B 3D0VA 3FQXA 4LFHD 4C54A 4WV1C 4K3EH 2CH8A 1D5IH 5IJVA 5J6HA 3QUXB 2R0ZL 4MXQD 5CD5D 4GKZB 4ELMF 2AJZB 2X9YA 3VGHA 4NQDA 5C0BE 3VXRE 3T0EB 4NQSA 3C8HA 1NCDH 4KJWD 3ZZ1A 5F7UA 1T1YB 1AXSA 2XA8H 1D5XB 2XZZA 4WNQB 1LP9F 1PKQA 1T4KA 3NCBB 1CDUA 3EO9L 3FKUS 2WM0A 1H8NA 3IDJA 4YZFF 4QRTA 5ERWB 1VADA 1Z9LA 4PJXA 4KKCC 2UWEE 4KPHH 4WO4A 4Y4FC 4CADB 5F89A 1O7VA 3MV8A 3SGJC 4NOBA 5I9QB 4EIZC 2X4NB 2BOBA 2DIAA 4Z5RB 2AEQH 3VXMD 3VWJD 1EDQA 1T0PB 3TBWB 1N5YH 2I9LB 5EFIA 3VD5A 1NFDA 5MERA 1G7MB 4WFFE 4P2OC 5EC1B 1KG0B 1CR9H 4PYGA 5C0AA 4AL8H 3BGMB 4HEPG 1AHWA 1F00I 4PGJA 4KRPC 1UFUA 1QRKA 2B1AH 1VB9A 3R8BB 4JFQB 4BUGA 4OIIL 3ZYJA 1W72H 1J87A 2QQKH 2XFXB 4Q9CA 4MAUH 1N4XL 5ETUB 2VABA 2F54B 1VGEH 2HFFA 5T1KD 2W38A 4KJQC 5DA4A 5GJTL 3VXMA 3EO1A 2W9DL 4ZYKB 1U8NB 1S7TB 3NH7H 1YN7A 3UC0H 4MHHG 4JFDA 5HDQH 3U0TB 2EYRB 5E4EC 2BRRH 4YQXH 4ZFZA 4OZIF 1ZLWK 4HDIA 4J6RL 1A3RH 5IB5B 3V5HB 4IIQC 5B8CB 4Z7UB 3DMMA 2XTJB 3DJ9A 3PNWB 4ISVA 3T2NH 2ESVB 1EHLH 1EFQA 3L95A 3MNZA 5I6XB 1S9WA 3QXAA 3I6KA 2WZPD 3LPGA 3O8XB 4WW2C 2AVGA 3IFLL 3GK8H 4KTDH 3KDMB 2VISB 3KLHD 1XFPA 3MYZA 4JDVB 3ES6B 3JTSA 5DC0A 1OCWH 2LTQC 3RZWA 5LCVH 5L2KD 1XIWA 3OV6A 2QSTA 1A14L 2NX5D 4OUOA 2IMMA 4PJFB 1I1YB 2X9WA 4M6ML 2VL5B 1A6UH 2P8PB 5JUEL 4XP4H 3TBTB 1G7HB 5KBNC 5E8OA 3LRSB 3RDTC 1WAAE 3WEXB 3MPCA 5IHZB 4XBEL 3B2UC 3TYGH 5LJYH 2BFVL 3VFTA 1F4XL 4DVBB 4CNIA 1RUQH 3QNZA 3HRZA 5EIQA 3S3JA 5HPOA 5I71C 5DK0A 1ROWA 1XR9B 2O5ZL 4PJGB 3T4YA 2EE2A 3OBAA 2RCSH 1EBPA 4QRRB 2JB5H 2DLGA 1QFHA 2EDDA 4MX7B 2K7QA 5JOPE 3SDAB 2W0KA 3S37L 1T1WA 5KS9F 3HI6L 2PYEB 1NEUA 1YEGH 2BHZA 5IIEB 2NX5A 2HLFC 3IU3B 1VGEL 1QLRA 3LIZH 4QRQA 1F97A 3A6CL 4CADA 2C3GA 3KG5A 5BJTA 4KKBC 1J0JA 3MV9D 1MCWM 3GSNH 2X4NA 3VXUB 2YN5A 3QIBC 1F3DJ 1KTLA 1YDPB 3FQNB 15C8H 4XVUD 3D9AL 4WI9A 5GS2H 3RWHA 5BQ7B 2E6PA 3TN0D 3X3FH 3F58L 4B50A 3VXTA 2FIKB 2HKFL 4HKBA 3H42L 4ORGB 3P73A 3BSZL 3AY4C 3ZTJH 1NCCL 4JG0L 3VGDA 2GTWA 1V5JA 3FT2A 4LGPB 4HX1B 2GCYA 1CFTA 3RTQD 2D31A 4JAMB 3FRPG 3IFPA 2A77H 3VGGA 1DFBH 2YPVL 2FJGB 3QWRD 4DKFH 1MJJA 1J0KA 3WUWB 3BJ91 4AMKH 4O4YH 5C0NC 4MQ7A 2OK0L 4XNQA 4GS7C 1UCBH 3VXMB 1OARL 4EDXA 1T80A 4OD3H 1CDIA 4WI4A 3WO4B 4NO2A 4GKNB 1IEBB 4RA3A 3IDXH 3L3GB 3BE1L 5EC2B 4WTZA 2EDYA 2FSEA 3RKDD 4PG9A 1A2YB 5ISZD 3D3VD 4NKIL 1I1RA 5D70H 3O2DL 2RJMA 3D0LB 1YUHB 3IDNA 2GW5A 4KMQA 5MEOA 4JO3H 1U8MB 3S88L 1FL5A 2G60H 4PRID 4S2SA 3INUH 5FGCE 1MCDA 4FQCH 2UV3A 5IOPA 2JK5B 1S9YA 4JFED 5CKAA 3DTXB 1UZ8A 3N85L 5IV2A 3LQZA 1D5ZB 1F3JB 5I16B 3G5VB 5F6HJ 2P5WD 2Z93A 1EH9A 2VLKD 3OSKA 5KS9E 3BN9D 2OI9C 1U6AL 5KSAA 4RAUA 4HH9B 4FFZH 2DWEB 4RMWA 2YBRB 2HAZA 2V7NB 1J10A 1Y0LA 2BNRB 4HC1H 4G7YL 4X6CE 1S7UB 2CXGA 4G8EA 4R4BB 4XZUB 2FRGP 4U7SA 5CZXD 3VFNB 4CU6A 3MNVB 2Y7QB 4YDKH 4PJ5E 3GMMA 3QP3A 4WV1A 3T2PA 4E0RA 1MEXL 1KN2H 4OI9A 1HHIA 4RDQG 1BQHG 1DLFH 2F53B 4H20H 4PJ7A 4FZ8L 2DN7A 4HWEH 2A0LD 4U0QB 2A6IB 1BVLA 4HGKC 1K3IA 4LMQI 5H37H 4TPRH 1CK0L 3MUJA 3MRGA 1W0YT 4LSSL 3ULUD 4P0DA 1BIIA 1P5UA 2MPAH 3F7YA 3O6LL 2R39A 1M4KA 1RUPH 1BD2E 2CRZA 4NO3B 1F58H 1T1XB 2DD8H 2AXGB 4JKMA 1WICA 3BH8A 5SWZE 3SGJA 1BBDH 4M43L 2P1YA 3QDMB 3HZYB 4PTTA 1CLZL 5I8OH 3HTLX 4J1UB 2GK0A 5DWUL 3C5ZC 5MEPA 3C5SA 5CSGA 1IGYB 3V4PL 2OZ4H 3HRPA 4KTEH 5KJRH 4I48A 2XN9E 4KTYA 4FQQA 2YXFA 5CEZE 1F4HA 4WW1A 3UBXI 3S8WA 3EYQD 3KLAB 3EBAA 4QXUL 4FQHA 4PJIE 5DMIH 3CXDL 5TDOB 1R24B 2V9QA 1DDHB 4FQIL 2Z31A 1I8IA 5DJAA 4F58L 1XF3B 2VKXA 5F1IA 2QQLH 1J86A 1CT8A 5DF0A 3AS1A 4XI5D 1QRND 2FIKA 1RZ7H 1IBGL 5DYOB 3TO4D 1KJ3L 3X11A 4LSDA 1NMCB 2IQ9L 4YK4B 1K6QL 5FOJA 5SWQB 1XAUA 4YGVA 5E2VH 5JW3H 1UACL 5FUOH 3IFPB 3VXQB 2DQDL 5C0EA 1BJMA 2FJGA 3OKDA 3RIAK 5I1JH 5GS0H 5HGAB 2ADFH 1BFTA 2HFEB 1EO7A 1FNAA 1PD6A 3OKNA 3ALXA 3RX7A 4JFFA 4ZODA 4NQCB 5EZJA 5EU6A 5HHMB 3VFUB 2MJWA 4YH6A 3HNSL 4FHBD 3VD3A 3UTTD 3WNLA 4CVXB 4PJDA 5FM4A 1AI1L 3ZE2F 3P77A 32C2B 4P3CL 5EOQH 3AREA 3N1PC 3DMMC 3V0WL 2P5EA 4NFBA 5L2JB 5HY9B 5J7CC 3ET9F 4Y8DC 4W4OA 1MAML 1OAYH 4L3ED 4MA7L 5HYSA 5IW1B 3EOAA 4HGWA 5FCUL 3JZ7A 5BO1H 5BVPH 1CVRA 4OZ4A 3RVTC 4J2XA 2B1HH 1LE9B 2ICWJ 2IANB 3KNBB 4HAFA 3T1FA 4MD4A 5F7FA 1U8LB 2JJVA 2GSGA 1XGTA 1GZPA 1HSAB 4IRSA 4ZNEE 1HHGB 4BH7A 4PLKC 5DD1L 1JGEA 4U1GB 5DWUH 5ISZB 1H15A 5T5NG 1OTTD 1WBZB 4F33B 6CGTA 1FVDB 1MIEL 2AEPL 2EIDA 4JANA 5BXFB 4YHPA 4XX1G 2OXGA 4OCYH 4X6CA 5HYJD 3QIBD 3P2TA 3JVGC 4KDTA 2BMKA 1LMKA 1BGXL 3IS1X 1HZHL 2OP4H 1S7QB 1B4RA 4N5UA 3D2UD 1QSFA 3U6RB 2IFGA 4MDIB 4JR9H 3CFEA 3PDOA 4KK8D 4LASH 5IROA 1V3MA 4ZAKD 3GMNB 2WK2A 2N1KA 3KJ6L 1TJHH 3RL2B 2EYTB 2R1XA 5E94A 4L8BB 1GPOL 1E28A 4XH2A 4YEFA 3FQRB 3Q6GH 4ODTL 1U93B 2A73A 4NO3A 2I07B 2R2BB 4XVTH 4N0CC 2DQCL 3GIZH 4DGYL 4RCAA 1LEGA 1MHPL 3QDMA 3FRPA 4N90D 2IALB 1MJ8H 3ILQD 5C0ND 2J88H 1BECA 2PXYB 1KGCD 1T22A 1DUZB 3VJ6B 3GMOB 3TJEH 5ID0A 3WKMH 4PJBF 1UQSA 1U8JA 4QO1A 4IIQB 4OV6F 4NZTH 4JZJB 2FEEL 2EDFA 1UXSB 4IDJL 1OAXH 3FO1A 3RAJL 1CU4L 4K7FA 3W0WE 2W9LA 5LGKA 1N64H 1MVUA 1DDHA 2H2SC 4TUOB 4FFWC 7CGTA 4NM8H 4C83A 2D03L 3RGVD 1JCKA 5ALCL 3L5JA 4YHKL 5E8DL 2VKWA 4N9OB 4AEEA 3MV8D 6FABL 4P5KA 2VMFA 2AGJH 5J0BA 5DLML 3QDMD 1UM5H 4QT5A 1BF2A 3D69B 3H2WA 3A6BH 4YGVB 1HXYB 4X9GA 3KPSD 4YDIH 1UM6L 5DUBB 4AL8L 4QRPB 4JM2C 4EUPG 3SCMB 5EUOF 1CVSC 4ODXB 5IB2B 2Y5EA 3I9GH 2YOCA 3VWKB 1G84A 2CPCA 3KPRA 3BP6A 1S7SB 3ECBB 3GJFK 2E8YA 1V7NH 2DI9A 5GRZA 4Z7VE 5KTEL 3EO0A 5GS1C 3CD4A 3G08A 3DHJA 2QQKL 4YC2C 4L29A 1JHLH 4KUCF 2AJUL 2OQJB 4Q7DA 1KUMA 5GJTH 2A0LC 4YBQD 3V0VA 4KAQL 3SDXA 4BQ8A 3VGFA 5CGYD 3C6LD 5F3HB 4S1QL 2P46B 3PL6C 2CLVB 4HPYH 4K7PX 3WFEL 3KJ6H 2AABH 5F8RC 1FC2D 4GSDL 4MNQB 5KSAC 5T3XL 1N8ZB 3RVXD 4LU5H 2VLRD 3KNBA 1G0YR 1NLDH 1ZWIA 2OR7A 3T2QA 5DD5L 3SJVE 5M7QA 1U8LA 3N06B 4R97B 2IPKB 1TQCB 3FB8A 1A9EA 1E6JH 2BRQA 2E7BA 1BHGA 2Q8BH 1LE5A 1I3GL 2P7TB 5EZLB 5C71A 2ADIB 2G75B 2BNRE 1GOGA 4NCDA 3EYOB 3VDCA 1GXEA 2F53D 2RQ8A 3ESUF 4OIBA 1XR8B 1Y18B 5JHDD 5IHBA 1HKLL 2HRPH 4RFEB 1I7RB 4FRWA 3BISA 5JIPA 4KPHL 4MMXC 3RWCA 1GRWA 1H3PH 4CN4A 4PS4H 1JWMA 2F58H 3MROA 4XVJH 5A16A 1QSFE 4MCYB 2CKBL 3U0WH 5HTSA 1UENA 3MLVL 3NZ8A 3PQYE 4PUBL 3OGOE 4QYOB 4OF6A 4RIRB 4HGMA 4HK3N 4XXDB 2F5AL 4ZUVA 3S5LG 2IEPA 4HV8B 4DKEH 2C26A 1C08B 1EPFA 1UG9A 2UZIH 1F4YL 5LWYH 3BZEB 3H3PL 5A40E 2R4RL 1AQKH 3DRQB 3P30L 5KVFL 3I2CH 3MRFA 1LO0H 1E4KC 1N6VA 4TSBH 4X7CC 2SEBB 4OGXH 3L5IA 1DBBH 4HWNA 3TNMB 4YPGA 3DX9B 1HH6B 1P6AB 1F90H 5EORH 3VRIA 3FQWA 3VFVB 5DMGC 5H2BA 5TGBB 2GTZA 3C5JB 4X99B 4HS8L 1KLGA 4OTXH 3LPFA 4BFBD 1JF1B 4LARL 3V6OE 2EKJA 1MPAL 4BA8A 4XGZA 4ZXBA 4YBLC 3MGTA 3NCMA 1NBZA 1XGUB 2BSRA 4U2YA 1Q38A 1WFOA 4LU5L 3HN3A 4FMKA 3SKJL 2DWDB 3CIQA 1IARB 3KPQA 3M07A 3ZKND 5DHYB 3VMPA 3EO1B 2IAMB 3LKPA 1U95A 3MJ6A 3MXVH 2X4QB 2FYYB 4OCRL 1LWRA 2MMXA 4PFEA 2R4SL 3RWFA 3R4DA 1JI2A 1KEMH 4HF5L 4X7SL 5DGRA 2KQMA 1BQHA 5ANMB 2BDNL 1YMHB 4OFVA 1H3GA 5IW3A 3V0VB 2APTA 2FWOA 3QPQC 4P9HH 1JTOA 1LD9A 4GW1B 3BDYL 4ZUWB 4Q97A 1I9RL 5KVEL 1C16B 3MFGB 3CNKA 1N6QH 5IQ9B 2DAVA 3VDAA 4IMKC 1FC1A 5INCA 3FOLB 1FVEA 2VISA 3QEHB 2HTLC 3WIFB 5IT2L 1RZKL 2Y5TB 5KVMC 2DQFA 4OCXH 4AM0A 4NBXB 3ES6A 3MNWB 3H3PH 2EDEA 5T3ZL 4I0PB 1YEDB 4NNYB 4FQCL 3QUYD 4PJFF 3BEVB 5CKGA 2DDQH 5FYJD 3DV6B 3AAZB 4PB9H 1EUUA 5I1DA 3BZDA 3R1GL 5F7DB 2QR0B 1FFPA 4OCSL 5FGBA 1CD0A 4U0RC 1MRDL 3S37H 1A1MA 3G6JA 4YUEH 4AYFA 5TF1L 1Y18A 2E5EA 3MRNA 1R3IH 3TIEA 4M7ZB 4OB5H 4DVBA 4CAGA 1WWAX 4YK4C 4UBDD 3PWVA 2Z92B 3UTZA 5FGCB 1W72B 1T5XB 2AAVA 3FN0L 1M1SA 4G7YH 4QHMB 1TJGH 3QG7H 3RHWF 4LARH 4R0LB 3S36L 3V6ZB 4X9BA 4R0LC 2AV7A 3U4AA 4M3JA 4UDUA 5SWZB 4OGAD 4FN0A 1CBVH 4EJ1C 1JZ2A 1DVFD 4LK4A 1CXIA 1ZT7B 3PWPA 4H8WC 3F58H 2DMKA 1AIFA 4X98A 5IHLB 1P6FA 1Q9WA 1M05A 1VFUA 4HFWA 2NY5H 2XN9B 4EIGB 1DQJA 2OTWB 1A7NH 3MCLH 4PTUB 3O0RL 1SYSB 3NFSH 1SEQL 4FMFA 2Y25A 3ULVE 3DO7A 1UB5B 4RRPA 1HNGA 4KQ4L 3HC3L 2Y23A 4PV9B 4XP5L 3VW3H 3KYAA 1OHQA 4YBQC 1UWEL 1XGPA 3LZFL 4Y5VC 5F9JA 1I8LC 4ZTPH 3UMTA 3V4PH 3QDJA 4D2NA 4Z7OF 2OK0H 4LSPL 4RGND 3ULUE 2LVEA 1MH5B 1R0AL 2AK4B 1I9RH 4HUMB 1I7UA 4LBEA 4GRLB 1IQDB 4P4KD 3WKNA 4LF3B 3N9GL 1WITA 4NKIH 4AEIL 5EU5A 5FA4B 3B5TA 5DJYB 1NEZG 3RPIB 5F9OL 4YXHH 1KJ2H 4LSVL 1T83C 3QUMA 1SY6H 3QWQB 2VDRL 3ARFD 1IGIH 1U41A 5GS1A 3CFDA 4PJ9C 1B6DA 3V5KB 3G04A 4AEFA 4UILH 3WDHA 1MRCH 1T7ZA 4V1DD 3EUUA 1Q94A 2D7NA 1C5DB 1FG2B 4G9DA 4HZLA 2NY5C 4JFFD 3PWUB 4LLVA 2O93L 3UTTA 3D85D 1CFVH 1MCRA 2AQ2A 3DURA 5CBEB 4O58H 3DX6B 3QNXB 4L8SC 5D7JC 3G5VA 4PD4K 5ANME 5IJKA 4CMMB 5EPMB 2AK1H 4V1DB 1BOGB 3S97C 2PYFA 3P4NB 5BV7L 2ZUTA 5ISZE 3D3VE 1A0QH 3KLHC 4ZUSB 4RAUB 3QEHA 4UOW1 1GGIL 3A6OA 5D72H 3LS4H 1OP5H 2HVJB 4KUZH 4EUPA 1LILA 1D9KD 2VDNH 4Y88A 4L3EA 1OOAA 2W65B 3NIGF 4I3GA 3S35H 2HN7B 3BT2L 1NCBL 2QR0A 4UOJA 3DWTA 1QSZA 5DUPL 5DMGD 3O9WB 1A4JA 3HUJE 1AD9B 1X44A 2QQQA 2AJ3A 4PRDA 5DJCB 5I30H 1F4AA 4EOWL 5F7EL 2XKUA 4F37F 1Q72H 5D93C 4U3HA 4LPVA 4YAQA 1YYML 2DM7A 4Q0XL 5I74C 2BVTA 1VGKB 2OL3L 4OKVB 3F7YB 3VFNA 5KSBF 5K59F 1MFBL 4C56A 4HLJA 5KSBA 4OCMC 3EHBD 1MFAL 1ZT7A 2DTSA 3T0WA 4Y4KD 4URTB 1RUKL 1EVUA 4YFLF 3FQUA 3LN5B 2XKSA 1TNMA 2Z91A 4E41E 3CSGA 4WUUA 1MSPA 1VENA 3HNVH 3CDGB 4LLUA 4QGYA 2HVKB 2ZUUA 3BIKB 4ODHL 3G5YA 2IQ9H 1MI5B 2W92A 1WFNA 1AKJA 4PY7B 4KQ3L 1G6RB 5ELIA 4R97C 2FH8A 5BVJB 2AXGA 1R3KB 3P3YA 3L3KA 1OTUD 2Z31B 3BXNA 4QTHA 1ORQA 1D6VL 2NY4C 1BD2B 1EA9C 1SEBB 2XYCA 2GEEA 4QTIL 1MQKH 1OGTB 3T3ME 3WKML 5SX4I 1X5JA 4FQQB 3K4ZA 2X4OB 1U8IB 3O45A 3JV6A 4G80A 4NZTL 2V9TA 3B3IB 4N8VG 1A4KA 1EJ6A 4FNLH 5JOFB 3CK0H 4NQTA 4APQD 1TPXC 4GMSH 4QOKA 5DJYA 5GRXG 3OHXB 3QUYC 2AK4E 3ROLA 1UH2A 1WIPA 1P1ZA 3G6DL 4DUVA 1VFAA 5C7XL 4R7NA 1BWMA 4LSUH 2N56A 3RVUC 3CFJA 3RGVA 3QG6B 2RFXA 3EYSH 5ICYA 3RVWC 3P77B 4YDIL 1ED3B 3I75B 3OKLA 3MUZ1 1DVFB 4H1LG 4JHWH 1UJ3C 4LCWB 3STLA 5LG1A 4EOWH 2DQGH 1H3WM 4K94L 4KK6C 1MREH 2UWEF 4UZGA 5DQDL 1BZ7B 4F7MA 3LMJH 4P3DB 1UJTA 3U4BL 4JHAH 1KIRA 4OZGF 3HI5H 4L8DB 2PTUA 4ODUA 4OZFG 4C4KO 5EZJB 4UIKL 1UM4H 5KVGH 3IRZA 3SDXF 3IDIA 4GG8A 1OPGL 1G7JA 3RUGE 5I1KH 2PYFB 1U8QB 2XNAB 5TQ2L 3HZVB 4Y4HA 1XEDA 4GW4A 2ZOLA 5ISZA 1GHFL 1EZVY 1PJ9A 4EI5C 4PRHA 1XGYH 2Q20A 1W8NA 3I02B 4OFYD 2BOCB 3UBXB 2IANA 3OR7A 3QEQA 1GC1H 3FCTA 1D5MA 4OFDA 3V2AR 2VN7A 5ENWA 2HN7A 1S5IH 2BXZA 4P5TB 3QIUA 1PEZA 2CMRL 3H3KA 2HRLA 4YNYA 3DX8A 3WFZA 5JHDA 1DP0A 4RMRA 2I9LA 2GJZB 5E6IA 1J5OH 4AIXA 4DK6A 5E6YA 3BKCH 1CDHA 3ZKXB 4X6CB 1RUML 3QA3B 5C0DA 5K9OA 4BSVB 3V6FA 2Q6WA 3KXFA 2OR9H 4U1LA 4G8GE 5D7SH 1NCDL 1P5VA 3FB7B 3RWEA 1B4JH 1NGXB 4UB0H 1EAJA 3KPOA 4PRHD 1L9MA 2F58L 3FJTA 3CFEB 3PDOB 3DI2B 3L7FB 2XFXA 3KVQA 5E95B 1S7VA 3B6SB 3W11D 2WBJA 4QNPF 3Q3GA 2CKNA 5EO0A 1RUQL 5E1HB 4FQ2H 3WNOA 4Y5VA 2AJXH 1ADQL 3K4AA 3EFFB 2EZ0D 1DN2A 4U1MA 5E8EB 1I9IL 5DR5H 3E0GA 3IJSB 4Z7WE 1NDGA 4YDLB 1AGCA 1U8HB 3ARBA 4N1EA 2NY7H 1CGTA 3BDXA 1UH4A 3EJZD 2UYLB 4JDTH 2YD1A 3PNWA 4MQXD 4ISVB 4O2CA 3UAJD 3GMLA 1RHHA 2ESVD 4ONFH 1HXYA 3PV7A 3IJHB 3O41A 4U1SA 5J11B 3LH2L 2YA0A 1FNGB 2R2CA 3GBLA 3GSQA 4I77H 4ONGL 1FFNB 2MFNA 2AABL 2GITB 3CFCL 4XB7A 5TDNA 3VXNB 1QNZL 5D7LA 3PGCB 3QQ4A 4LGSB 5BV7B 3GNML 4PGDA 2V2TA 3D69A 1T21A 5T33L 1IE5A 3H42H 4S1SL 4NQEA 3WEXA 4WEMB 3LN9A 2MWCA 1OAZL 3GKWH 1E6JL 1MUJB 5DJDB 5F7NC 3HA0A 5T1MB 5IEHA 3CH8A 5IB2A 3H9SB 3HRZB 1EJOL 3DYPA 3BP6B 2ITDB 5JW4Q 4IHOB 4UV4H 4M7KL 4O5LH 4FP8L 4D8PB 1HOCA 3TH4T 1NLBH 3T77B 1NC4A 3TA3C 3MX0A 2I27N 3REVA 5HGHB 1DE4B 1NEZA 3DMMB 5FECB 1CFNB 2BCKB 2HH0L 1LE5B 5DI8A 4JDZB 3MLVH 3O6FD 4PUBH 1MCWW 4P48A 4MNQD 4QRQB 3QPXL 2CIKA 4LKXA 4DKEL 1G7LA 3TFKC 4GAGL 3OXSB 3A67L 3PP4H 5EUOA 1UB6B 1IEAB 1QPPA 3MJ8A 1KSRA 1I7RA 3S34L 4PGBA 2EDKA 1AE6L 3NZHL 1X5LA 4EXKA 5CUSH 2NY4D 3N85H 5IF0A 1I9IH 5DR5L 2DQHL 3FMGL 4LCYA 4XPFL 5FV2A 1Z3GH 3P4OB 4UT7L 1S7XA 3ULVD 5ESAB 3WS3A 4GBXC 4QHUA 4S0SD 2DS4A 1ACYL 1C08A 1Z9OA 4FFZL 5BS0B 3CDFA 3FT2B 1QBMH 3BEWB 5CJ8A 5IHUH 2GI7A 4S1DD 3LH2H 1I3RA 2H41A 2VSCA 2CDEA 5TDPB 4JG1H 4MCYA 3FO0L 1BM3H 5FYKD 5I8KH 1WQVT 2DBJA 3I85A 1HYSC 5KOVC 5F97E 2M1KA 3NTCH 3Q3GB 2PTTA 1FGNH 2A9NH 1KPUA 3CXHJ 5BS0E 3BZFB 4JFZH 2YRLA 5E5RB 3M1BA 2W07A 4DQOH 1JF1A 4I3RH 4KK6D 1I7ZB 1PZ5B 2BSTB 3QEUB 4WTZG 4B7IA 1F58L 4J8RA 4OZFB 1WVZA 4OCRH 4KJWC 3BPNC 4M02A 3L1OH 3MRLB 4PRPD 2H3NB 4U6XB 5JR1H 1KB5A 4KQ4H 1JPSH 2UYLA 4HF5H 2NXZD 2Y36H 3WL9A 1XGRA 25C8H 4OFPA 5HI3C 4W4NA 1RV6X 2PXYD 4MWFB 1KELH 2CLRA 1EFXA 2MNUA 4AH2B 4NO0B 4P4KA 5D7LE 5I2IB 1QOKA 1MIML 3BI9X 1YECL 2DWEA 4BQ9A 1BFOB 4OQ1A 4U1IA 1QFWH 1UJ3A 5DFVD 35C8L 1JZ8A 3C8DA 1JHKH 3I6GB 3OB0K 1OAUH 4X6DF 4BQ6A 1H3VA 2IAMC 2V2TB 3L6FB 5C08B 1OB1A 1A6ZB 3S9DB 1HHIB 1IGIL 5FKPB 3TZVB 2O5XH 1HN1A 1T2QL 1V05A 3KYKL 4KI5E 5D70L 5JPNB 2FZ3B 3NFPA 4PV8A 1FAIH 3O6ML 1SJEB 1UACH 1VFMA 1FSKB 5DT1L 1FZMA 4Y4HC 2FSEB 4U7MA 3SQOL 1K4CB 5INCB 3MGOB 3CVHL 2AJVH 5TPWH 3GSVA 3QIUD 2N7AA 1BLNA 4PJDF 5FAAA 2DQTH 2IANE 5IV2B 4GW1A 1M6OA 3DIFB 4NRYB 4L9DA 4R26H 4R8WL 5CIPB 3WNKA 1KCVH 1CBVL 4DVRH 2B0SH 2XWTA 2CIKB 3SE9L 4GXVH 4G5ZH 2EECA 4NKOB 3FOMA 2EZ0C 3WIFA 3WLBB 3VWKC 4BKLA 3I3EA 4WW2A 5E99L 2NY5L 5D5MF 1AHWC 1W72A 4A2MA 3HR5A 3IDUA 4HQQH 4K23H 4LRIC 4Z7UE 4BELD 4C58B 3MV01 5IMOA 3VXRA 5F7DA 1RULL 4BUHA 5IEKA 1FNHA 3W9DB 1Q9KB 4L3CB 2CIIA 4QY8B 2F53A 3QHZL 2E7LA 1VACB 4ETQA 3PWPB 1NGQH 4WUKL 2ADFL 1JGDB 4HJGA 4LP4A 5L9DH 1C5CL 2H9GA 4NQEE 3M8OH 4NP4H 4FZEH 1I7TA 1Q8MA 4EDWL 2R0KL 5B4MD 3MRHB 5HGBB 1CD1A 3CSBA 1UZ6F 4AG4L 1IM3B 4XPGH 1KCLA 5TE6L 2XY1A 1NAMH 3Q1SH 3RDTD 4JFEE 2AKRB 3B2UD 2OM5A 1MJ7L 2H32A 2Y06L 5DGQA 4BK4A 2H45A 3QCVH 4G8IB 2NY6B 2CUMA 4YIQB 3N1FC 3BP4A 3HNVL 2BK8A 4KI5F 2X09A 4RA0C 5C0GB 2F5BL 5JW5B 1AP2A 2VE6B 2ADJB 2VXSH 3IT8D 5D6CB 3RY6A 5AUMA 1R6VA 1SJVA 2MSPA 3BOVA 5F93C 5GZOC 1I8IB 5DJAB 2QKIA 3RPIA 5F9JB 4MD4B 3G5XB 4PJ5D 3C08H 3B9DA 3VFWA 5DYOA 3U48A 2FGWH 5GGRY 2JIXB 3ZKNC 2VZUA 2ZSWB 4GQPH 1G9NL 1P4BL 2BXYA 3QULB 5C0AB 4NN6B 3WLWD 2AK4A 4Z6AT 1S5HA 2ARJB 2EYSA 4FNLL 5FYJU 3BDBA 5IFHL 1VPOH 2OXHA 5GZND 1OSPL 3TN0C 3RJDA 4NQXB 2C9AA 3IFNL 3LN4B 1WV7T 4PRIB 1FLTX 4XPBH 1FQ9C 5BZWA 3OKMB 2HG5B 5EOQL 1JZ5A 1OM3L 4KZDH 4CN1A 5JIKA 4Y1AE 4ERSH 1G9ML 1JPFB 1Q94B 4O2EA 2BVQB 3RTQC 3OXRA 1D5BA 4MQSB 4LSQH 1YEKH 3QHZH 4ZO7A 3VFRA 4KMTH 4QRRD 4K3GA 2Z4QB 4GKSB 1X6LA 3MFFB 2XV6B 4WWID 2XQBL 3HG1A 3MLPA 5IB4A 5JPMB 5K9KA 5GISH 1CR9L 5KTEH 2XZCH 4CMHC 2IALA 4WEUD 3CX5J 1NBYA 1MHHB 2J8OA 3BWAA 3L3IA 4N8CH 4NQSB 5D2LF 3MNZB 2X5PA 2QSCL 1VFOA 2YUVA 5DVLA 1DN0A 1KCKA 1MFAH 3KPLB 3FT4A 5CSZA 5A43C 3F7PC 4OD1L 2BNQA 5LGHH 3QCVL 1TMCB 3DGGA 1DANU 3T4AB 3VRLF 3SDDA 1U91A 4YXLH 4Y16B 4YHPB 1T6WA 4G6JH 1BMGA 4JFEB 2VAAB 3S96A 3TN0B 4NRXA 4PJCA 1BJ1H 3HPLA 5GGUB 5CJQH 2YC1A 5ITBH 1XF2A 1NL0L 1PZUB 3PJSB 4NNPL 2VAJA 1QSFB 4KMLB 1OQXA 1CFQB 2CDGA 3BD4A 4JFXA 4NZRH 3NACH 4IOSD 4RX4A 2YMXH 1OP3H 2LU7A 4YAQB 5I1CH 5IVXA 3RUGF 1MHPH 2M2DA 3G5YB 1RIHL 4OGYL 3IDMB 3ZL4H 5DFVC 1JHLL 4CJ1A 3VMNA 4L4VA 4JPVH 1VESA 2Y4SA 2Z35B 4UB0L 5I1AB 3GK8L 4KTDL 4ELKA 3WNMA 1YYLH 2PXYA 4HPYL 2EICA 4QTHB 3UJIL 2D9CA 4I9WD 3QXUA 4WTWA 1ZHKA 2V2XB 3SDYL 4Y5XC 4KU1A 7FABL 4HH8A 5AZ2H 5IFJB 5T3XH 4ORZC 1AKJB 5IESH 3GMQA 3D5OF 3BQUD 1LNUB 5ESQA 5D1ZC 4PRIE 5AAWA 1CXHA 4P4KC 5AUMB 4F8QA 3P9MA 4WWKB 4QF1B 3O4LE 3PIQA 4MA1B 1N8ZA 2L7JA 4X0KB 5J8OA 2XG5A 3MLRH 2VXUL 4HKBB 5JORA 3IB4A 2HWZH 4OLZH 3QULA 1DLHB 3P0GB 4M93C 1HINL 3BESR 4XAKD 1JL8A 1EIBA 4LLMB 5EZLA 4OLYL 2FR4B 5IVNA 4D9LH 5TJWK 3Q5YA 1A14H 4M1CD 2DIBA 5D7LD 4E41A 2Q76B 3GM8A 3U4EA 3NCFB 3O4LB 2FHCA 5DXWA 3EOTH 5AAMA 1OTSD 5KVDH 3ZDXF 4UQ2A 1K8DB 2CRIA 4XI5C 4XRCB 5EB9A 3CVHA 5D96C 1NCAL 2X4RA 5FM5M 5EU6D 1FPTL 4YDJA 1KJVB 5F96H 2RFXB 3GGWB 1BZQK 1OD9A 3CZFA 5GGSA 4RBPH 3STBA 4X4YA 1U8QA 2WLYA 3SDCA 5JZ7C 1YY8B 5BOZG 3JXAA 4HKXB 2EDLA 1OW0C 5FYKU 2GFBB 3UPRA 3MBED 3TCLB 4GLRI 1X4ZA 1UZ8B 2F9BT 4HHAA 5E7FA 2BDNH 2Z31C 5ADOH 1DR9A 3LVEA 2DKUA 4JO1H 1B4JL 3EGSA 2A77L 1WBXB 4P9HL 1FH5H 3BKYL 1U3HB 5EUOE 1IL1A 5JHDB 2FECI 3SE3A 4IRSC 2FX9H 4QEGA 3FL7A 2CRMA 1EV2E 5FF6B 4J4PA 4X5XA 4YFLI 1IFHH 5FXCH 1LDSA 5M94B 1B90A 4PLNC 2X40A 1NGZA 5ENWB 4PRAA 4R4ND 4ENED 2HJFA 4I4WB 3D2UA 4U6VH 2R8SL 1P7KB 4Z9KB 4NCC1 1JHTB 1A6AB 2G5BA 3U36B 5EO9B 4U1KA 4KDTC 1Q9OB 4KKLD 1ZSDA 3MXVL 4L8CB 4DZ8B 1R3JA 4WU7B 4GBXB 4ZUVB 4KV5E 5DVOA 5F7LB 3QAZB 5DHYA 2I9TA 5CBAA 1BIIB 3AREC 4G9FD 4G42B 2FL5A 4Y5VB 4TTDD 4J7RA 5FO9A 2WIIB 3TCXA 4W4OC 2NW2A 5F6HI 1QA9A 3BP7B 4ODWA 1F90L 3MRFB 1OARH 3QFJE 5I1AA 3L3HA 4XAKE 3EOTL 1U8OA 1YMHA 4OF5A 3RY6C 2XRAH 3ILPA 5E4IA 1T0MB 1ES0A 1FFRA 1L7IH 2V6HA 4JVWA 4UTAL 2YUZA 1YNLH 2VQ1B 5T3ZH 5C0IB 4LCWD 2AV1A 3MRMA 4ALAL 3X3FL 5E03A 3SKMA 1TITA 3TBSA 1U8HA 3ZT5A 1JJUA 1ZGLP 2HKFH 3V7AG 3MRCB 3O3BA 4XCFH 1IGMH 2JK5A 4MXWL 1NGYB 3RX8A 1X5IA 2DM3A 1IC4H 1NAKH 2W9EL 5FKAA 5FYJE 3MOBH 1P4IL 2FJFB 3O6LH 3ARQA 3H9YA 4BSJA 1KC5L 1ORSA 1RPQA 1K5NA 5IROC 4M7ZC 4PPTA 5EN2B 5ITFB 1CFSA 4JFYA 3DUHA 4WENB 2LQRA 3GSQB 8FABA 3QEGL 4ZQKB 1C5BH 3BPCB 3FFCD 2UY7A 4MD0B 3RTQA 5DK2A 4FQLL 3WN5B 4XRCA 3G6AB 2R69L 4POUB 1UCBL 1ETZB 5F72S 2Q86B 5JHLH 5HHMD 1N2RA 4Q6IC 3MUGB 1HXMA 4F15C 1A9BA 1KJVA 4NC2B 4MS8D 4R90L 3PXJA 2XWBA 4WHTA 4L4TB 2FWOB 2ZUYA 5LGJA 3ROOB 4OF3A 2NNAB 1WZMA 3ARGA 5C0BA 1W0WB 1LO2L 3QUXC 3RJQB 2R2EA 1NCNA 4L4JA 3EOAB 4HGWB 3TA3B 1TVBA 3PL6A 5J9PB 3MRGB 3OPZH 3UZEA 1G7LB 3FOLA 4LRNH 3SQOH 2YD3A 3VWJC 5F44A 1UB6A 2YPLA 1QBML 2X9XA 2M8XA 4HXBH 4BYHA 2BVOA 3IDGA 1P69B 4L4TE 4OZIA 1J88A 1QEWB 3W39B 5FECA 5EU6E 3HAEB 1WIUA 3H7BB 1MCPH 4P2OD 4LCYB 2ZCKL 5DI8B 5SX5H 4AT6A 5FUZH 4NN5C 1U42A 2ID5A 4WRLA 5F70A 5BXFA 3O9WD 5EA0H 4LLAA 3N9GH 4LCUB 3ZO0A 2APFA 4FTVE 5EUOB 5DJ2A 1J05A 1GGIH 1QUNA 3RVXC 2MKWA 4JM2A 2WP3O 2RB8A 3RUGA 2VDPL 1WWCA 5E99H 1IBGH 2DJSA 1KT2A 2CSPA 4ELMA 4QHKJ 3MXWL 5J6HB 4QLRA 1ZLUH 5D4QA 4NO5A 4P2OB 1K6QH 1RZGB 4XP6L 5EO9A 3K81A 3UTTE 2WNGA 4I0CC 4FXLA 1GSMA 4WU7A 3SKNA 4YHZL 4DWHA 1IC7H 3SY0B 1E28B 2EIBA 3MLZH 3ZKMD 2PTTB 1K8IA 2HFTA 4L3AA 3GFUA 4YHLH 1SEQH 5L2KA 1BJ8A 5CJXC 2C4FT 1WZ1L 5MHSE 4NP4L 2XN9D 4PTUA 1Z9SA 1EO8H 5DD1H 2FATH 3WHXA 3H0TB 4HFUL 1I4FB 1C5BL 5EU7C 1DUZA 3WUWG 2V5TA 1E4KA 3OKNB 4L5FH 4OM0L 1AXIB 1RIUH 4MQXC 5CJOL 3TO4C 1EK3A 4WI6A 3OZ9L 2LFGA 4MA7H 4QRTB 1BOGA 3U7AA 4JRYD 1G7MA 1RFDL 5JQHC 2D0GA 2QADC 3D6GA 2MQCA 4BFGA 1IAMA 4MA1C 1JMXA 1IAKB 5GGVY 4YE4H 5C07B 1JV5B 43C9B 5E9DD 3O3EA 1KBGH 2FX7L 3CFIC 3K1DA 3BYTA 4ZXBC 4UILL 5TPWL 3L3JA 3UTSE 2YD6A 3DUUA 4CGTA 1Q72L 1F6AB 4NRZA 1T1ZB 1WCBA 1LQSR 1QBLH 2XIDA 1UKTA 1P84J 3MR9A 2JF1A 3V6OC 4WI5A 4U1JA 3VMOA 5FIEA 3SKOB 1HIML 4OD2B 5IFHH 4JRYA 2Q86A 4R4NC 4ENEC 1RZJH 4OKVA 2LAAA 2Y07H 1A7OL 3F6LA 3PQYD 5HVGB 3AFLA 4TNWF 1RI8A 2R1YB 2ZCLL 1JWSB 1MAJA 5EBMB 5D8JH 3RIFF 1OSZB 2MHAB 4MDIA 4ZFGL 5EBGA 1OM3H 4KZDL 1L7TL 2HT4D 4TUKL 2DI7A 2JJTA 3OKOA 3BH9A 4Q9BA 1PDKA 3ARWA 4JFDB 4FXKB 3U0TA 5FGRA 2XA3A 3FQRA 2HVKA 4KK9D 5E08H 4MVBC 4BQBA 1PG7H 1K2DB 4K94H 1MREL 5DQDH 3G5ZA 1KLFA 1QO3A 3BT2H 2EH8L 4NKDB 5DEFA 5I15H 4Z0BH 4X6BA 3D48R 4X4XB 3MA9L 4FQXD 1TDQA 3C5ZB 5I76A 4JN2B 3QRFM 4PB0H 4HUXB 3FO9A 4E9LA 5IR1A 2PW1B 3JUZA 4RGMB 2AJ3B 2BY1A 3D3VA 1MFDH 1FRGL 1NDMB 3GJFH 4Y0GA 3ULVF 3DHMA 1CS6A 3OZ9H 3GSWB 3TVMB 1CGUA 1UXSA 5C7XH 2YRPA 1DEEB 3QUYB 5DK0B 2AGJL 2BNQD 1YEIL 3SO3C 1G7PA 3LRSA 1EEYB 1G7QB 3VFOA 3ILQC 3SQBA 4DW2L 1MI5E 4U1HB 2PYEA 4JM4L 1HHJA 1I9JH 4YFDB 4LFHG 1R5IA 3GSOA 1KGCE 3AXLA 3GMRB 4UOW0 2WQRA 1FO0B 4MAYB 4WCYL 1FNEB 3L3OB 3EDJA 4K3DH 4OLEA 5C2BH 5A2LH 3X14A 5C0GA 4OGYH 5DSCB 4GXUM 3MRBB 3STZB 3FRUB 5C0CD 3UYPA 2FB4L 1AP2B 2VE6A 5D1XA 5J4MA 1MFCL 2CLZA 2HKHH 3L5WA 1QR1B 5CD3A 5DRXA 1AXTL 4S1QH 1IGFL 1FG9C 2NX5B 3BN9C 5DJ0B 3PDDA 1OAXL 1KIPA 3NA9L 1OGTA 3CVIH 3C8KB 1T66D 3CK0L 4TQEL 4PS4L 1AGFB 1BVKA 1ODAA 4OJFL 4G8GA 3U9UA 4GAJH 3E3QE 2VB5A 4NUJB 4PG2A 2QBWA 3RY5A 1YQVL 3O3EB 2X7LA 3WXVL 2A6DA 5HVWA 2LAGB 4PREB 3M17B 5DEGB 1F4XH 4JKLA 4X5WA 2DLEA 4OSUL 3FFDA 1CE6A 3DUUB 4QCIA 5E2JA 3UZVB 1T1ZA 4U4BA 1FL6B 3S37X 1FYHB 2N4IA 2VZVA 5LKNA 2P7TA 3EJYC 5C0BD 1JRHI 1GYAA 4OGXL 3MRJB 2QV2A 5I0DA 1KYOJ 1Z5LA 4HX1A 1IEBA 4C59B 1INQA 1JNLL 1REIA 2H32H 2IMNA 3HS0B 4JHAL 4OCLC 3PL6D 4S10A 5GRUH 2L7UA 4RFEA 4GKSA 2CKBH 3WUWA 4PJIF 1EEQA 3KXFB 4U1LB 1CXKA 4YX2H 5J13C 1IQWL 2F5AH 2NCMA 1AY1L 2EXYC 1EHXA 3VWJA 5JIHA 4PJ9D 3LEVH 5F1SA 4YPJA 1SVCP 3VFPA 1ADQH 1MHHA 1JPFA 3OGCB 4YR6B 3BAEL 5I66B 1XF4A 3EYQC 4QHNA 5B22A 2Z4QA 3E3QC 4HH9A 5C0CB 3MLUL 5AYQA 3D39B 5DJ8B 3RBGA 3PABA 3NVQA 3MNWA 4NKDA 2Q87A 4K3EL 3BKMH 1SMAA 4X6BB 1FE8L 2UZXB 4JGJA 4OLWH 3MJ9L 5D7JD 3THMH 4K7PH 1QHPA 5IR1B 1N0XH 2WIMA 5LAXB 3TYFA 5KSAB 4RAVA 4KROD 4PJ8D 3LQMA 5EZIL 2YBRA 3T4AA 2FEEI 5I1HH 3KPPB 2XKNA 4RBPK 5HD8C 4I13B 4KGLA 5EO1A 3SOBL 4XNZB 1AGBA 1X4XA 3BDYH 1UH3A 5J3HD 4GAJL 3MRIA 1EZVX 4PRNA 4TUJB 1FFNA 4X6EB 3CDCA 1LEIB 1F42A 2Z8RA 3V4UH 4S1SH 1NGXA 1XF5A 4P9HC 1WT5A 3UPAA 1R5VA 3FMGH 3LKNA 3OKYA 3JWNC 4H5SA 2OJEA 1Z3GL 2EIEA 3C5SB 3O3UN 2PF6A 4OCXL 4LVOC 1ZHKB 2V2XA 3ZT6A 3BX7C 1H8SA 1D3CA 3BUTA 2VN4A 5EO0B 1FNEA 2EC9U 3L3OA 5T1MA 3R06A 3RVTD 1U8KA 3U7WL 5D1XB 1EGJA 1SYVA 2NY7L 3EDKA 2XPGA 4HWZA 2DQJL 4P4RA 4ELKB 3Q0HA 5D1QB 4O2FA 5TF1H 3FO0H 1NSNL 4PJCE 1HH9A 5KVDL 5F1IB 1XGPB 3CZJA 4RWYH 3HE7A 5C0RL 3FN0H 3Q6FB 4NZDA 4NHUA 2ILLA 1A7QH 4GAGH 5FUCC 5FYLD 3SO5A 5CGMA 1DQQA 3OKKB 1H3TA 3LKOB 4JB9H 3BD3A 3QIBB 4KK9C 3KYOB 3NCJH 1AE6H 5J1AA 1MLCA 1QNZH 4BH8B 5D7KD 5C6TL 2W0PA 3CFBB 5IP4A 4M8QB 3ARZA 2DYPA 3SDXE 5CINL 2DQHH 3OKDB 5INDA 3UTSB 3GNMH 3TNNB 4F9PC 1I1FA 4ZDHB 1ZS8B 4ZAKC 4FQXC 4FG6C 3O81A 4X8XA 5IF0B 2MPAL 4HKZB 3S3SA 5JIIA 5ADOL 3THML 4JFHD 5AD0A 1CIDA 1MUJA 4G9DB 1VHPA 3O4LA 3T0DA 2EO1A 3TIEB 3H9SA 4U6HB 3VE0A 3NIDF 5GIRB 1WF5A 2C7UB 2WINB 2FJHB 5F9WC 2J6EH 2WLZA 3EOBA 4JFZL 2AERT 1N6QL 4GW5A 5CFHA 2IGFL 3P4NA 1LP9B 2DJUA 5D2LE 4ETYA 1XCTB 3P4LA 4KGJA 1WZKA 1T4KB 4NKMA 2QQLL 1TCRA 1CQKA 2ZG2A 4X5XB 2HVJA 1EHAA 3D85B 4OZ4B 2O5ZH 1HHKA 1UGNA 3SPVB 2IG2L 3WFCL 1KENL 4MJ5B 4R7DB 1JRHH 3R1GH 4J8RB 5E2VL 4ZAKB 3NABL 5JW3L 5L0QC 4LP5A 1JF5A 2Q3ZA 2BOBB 4WWKD 5DHVH 2YUXA 2AP2A 4JRXE 3O9WA 3MMEB 3GSRB 4PJ7E 1INDH 1YEGL 3P4OA 1YECH 4U1KB 2CUIA 3MODL 4HUKB 3VFMA 3RL2A 1KCVL 2JKXA 3QQ3B 3VFGL 3SDDD 4AEIH 1BAFH 5I8EB 3C6LB 1L7IL 3S98A 3HNSH 5T5NF 2VXVL 5EOTB 4M7LT 3CLEH 4XNXL 3ULVH 1HWHB 4KVCH 4LDOB 5EZOH 2PO6B 3CMOL 3QI9A 2PR4L 4GKZA 1INEH 2V5MA 3AC0A 1ZLWH 1RHFA 5CGYC 4OV5A 1U8OB 5D1XC 2HFFB 3KPRE 5C08A 3ILPB 4XH2B 4I3RL 1IC4L 1NAKL 1ZE3C 2W9EH 3ZMRA 4G9FE 4AEHL 5HHOA 2NR6D 3KPSB 4Y89A 3DVFA 2FO4A 1WGOA 2HT3D 3F6IA 2LABA 3L3KB 1NMBL 2R29L 4N68A 4EI6A 4PJBE 4LPCA 4N9GA 3UTTB 5F7EH 4HW6A 4CL7A 5TE6H 4Z95L 4O4YL 5D2NB