3WV2A

Crystal structure of the catalytic domain of mmp-13 complexed with n-(3-methoxybenzyl)-4-oxo-3,4-dihydroquinazoline-2-carboxamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
166
Chain Sequence
YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTHFMLPDDDVQGIQSLYGPGDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagenase 3
publication title Thieno[2,3-d]pyrimidine-2-carboxamides bearing a carboxybenzene group at 5-position: Highly potent, selective, and orally available MMP-13 inhibitors interacting with the S1 binding site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 166
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3wv2A00
3F1AA 1KUGA 1GE6A 3V96B 4H1QA 2EROA 4IN9A 1K7GA 2MZHA 3VTGA 2MZEA 1ASTA 4J4MA 4IJOA 4DF9A 4GQLA 1SLMA 1GO7P 1ZXVA 1IAEA 1R54A 2OW1A 3B8ZA 4XBHA 1XUDA 1ZP5A 1QIAA 1BKCI 1HOVA 2QPJA 1EB6A 1FBLA 2J0TA 3DWBA 2OZRA 4A7BA 1H71P 1QUAA 3HBVP 1IADA 5CXAA 1CXVA 1IAAA 1D5JA 2DW1A 5D3CA 2ERPA 2HU6A 2E3XA 4R3VA 3U1RA 1FM1A 1SLNA 3LQ0A 1K7QA 2W14A 1OS9A 1OM6A 2A8HA 4H49A 3KHIA 2FV5A 1CGEA 2OW0A 4FU4A 1QJIA 4JPAA 1MMBA 3HY9A 5BOTA 5I4OA 2OY2A 2XS4A 1Z3JA 4PKUA 1HFCA 1XUCA 2W13A 2RJQA 2CLTA 2Y6DA 3B2ZA 1HY7A 4DD8A 1R55A 4WKIA 1AF0A 4H2EA 2POJA 1BSWA 1MMPA 1WNIA 1GE7A 4XM8A 1RM8A 2FV9A 4FXQA 3E8RA 5D7WA 3F15A 4JQGA 3EWJA 1UTZA 4G9LA 3OHOA 4L6TA 2JIHA 3WV2A 1JJ9A 4H82A 1HFSA 3LJZA 1XFXA 3LQBA 1CK7A 4H3XA 5H8XA 1KAPP 5D1SA 1KUHA 1KUFA 1Q3AA 1XFWA 1OO9A 1PWVA 1BQQM 4WKEA 3DSLA 4GWMA 3P24A 2O36A 2MZIA 1Y0VA 2OY4A 1BKCE 1AKLA 2MLRA 2X3BA 1C8TA 3BA0A 3F18A 4XM7A 3Q2HA 4PKWA 4JP4A 2YB9A 1XFVA 2WOAA 1I73A 1CQRA 1SU3A 1JK3A 3I7GA 1G9KA 1C3IA 2OW9A 5B5OA 4HX3A 2D1NA 3EDZA 1EUBA 1A86A 1L6JA 3EDHA 1K7IA 2OW2A 3K7LA 5I12A 2OVZA 1BUDA 5BPAA 3ZVSA 2W15A 4PKSA 3ZUKA 4WK7A 1EAKA 3DNGA 4CTHA 1UEAA 2JNPA 4XCTA 3TS4A 3UVCA 1D8FA 5BOYA 3N2VA 830CA 3AYKA 4PKTA 3ELMA 5B5PA 1OM8A 4Q1LA 1G4KA 1BM6A 966CA 1XFUA 2DDYA 3F16A 4PKVA 2YIGA 1BKCA 1FLSA 3Q2GA 1BQOA 1YP1A 4GF1A 3MA2A 4AUOA 1QJJA 3AYUA 3LGPA 3TVCA 4FVLA 4ILWD 2XS3A 3GBOA 3KMCA 1KUIA 1JH1A 4A3WA 1BUVM 3I7IA 3RTSA 3O2XA 1BZSA 3G5CA 1MNCA 1HV5A 1XFZA 1IAGA 2Z2DA 2OXUA 2DDFA 2TCLA 3DPEA 2SRTA 3RTTA 4FXYP 1JKYA 1SMPA 1AYKA 3LJGA 2W12A 5I2ZA 1J7NA 5L79A 456CA 5D1TA 1ATLA 3LEAA 4XM6A 1ZS0A 3SHIA 2WO8A 5D1UA 1SATA 1IACA 1GKDA 4JA1A 2ERQA 1ZXCA 1CGLA 3O64A 1YQYA 1PWPA 3LKAA 4I03A 3OHLA 2RJPA 4DV8A 1D7XA 1HTDA 1ND1A 4H30A 1GO8P 1KBCA 1A85A 1XURA 1OMJA 4G0DA 1B3DA 3LE9A 5LABA 1R1IA 2D1OA 3VI1A 1C7KA 1QICA 3LILA 3LIRA 3NX7A 3HDBA 4WZVA 3TSKA 1JAPA 3LUMA 1JIZA 1G12A 3HBUP 2KRJA 2W0DA 1ZTQA 4DPEA 2JT6A 4GR0A 2OXZA 2USNA 4I35A 2CKIA 3ZXHA 1O0QA 2V4BA 2X7MA 3KECA 1CAQA 3EDGA 2WO9A 1I1IP 4GR3A 1SRPA 2MLSA 3KWVC 1B8YA 1Y8JA 2O3EA 2OXWA 1KUKA 3N2UA 1DMTA 3P1VA 3EDIA 1QIBA 1Y93A 5D2BA 2N8RA 4PKQA 3LK8A 1IABA 1MMQA 1CGFA 4WF6A 4GWNA 3EHXA 3USNA 1XFYA 4AXQA 3KEKA 1RMZA 1UMTA 4AIGA 2I47A 3AIGA 3HDAP 1G05A 3L0TA 1S4BP 1JIWP 5I3MA 2X3CA 3LUNA 4IUWA 5I43A 1JAOA 5CZMA 2AIGP 5I0LA 3DPFA 3L0VA 4L19A 1OM7A 1ROSA 1I76A 4L63A 4ON1A 2AYKA 1BIWA 3G42A 3LIKA 1UMSA 2Y6CA 5JMYA 4HMAA 2X3AA 3HY7A 1DTHA 4GR8A 4GUYA 4ZR5A 1MMRA 4PKRA 3F19A 4H84A 3HYGA 3LJTA 4AYKA 3KRYA 1PWWA 1OS2A 1ZVXA 2OI0A 1R1HA 3WV3A 3WV1A 3B92A 3HB2P 3TT4A 2JSDA 2DW0A 2PJTA 5CUHA 1YCMA 1CIZA 1D8MA 1UTTA 2L0RA 3CKIA 2JT5A 5L7FA 4QKZA 2K9CA 2E2DA 1PWQA 3LMCA 2DW2A 1PWUA 1GKCA 1O0TA 2K2GA 3K7NA 1GE5A 1GXDA 3DL1A 3KMEA 4JIJA 1USNA 3EHYA 4H76A 1YOUA 3KEJA 3F17A 1JAQA 1JANA 2J83A 1G49A 4EFSA 2OVXA 1R1JA
chains in the Genus database with same CATH superfamily
3F1AA 1KUGA 1GE6A 3V96B 4H1QA 2EROA 4IN9A 1K7GA 2MZHA 3VTGA 2MZEA 1ASTA 4J4MA 4IJOA 4DF9A 4GQLA 1SLMA 1GO7P 1ZXVA 1IAEA 1R54A 2OW1A 3B8ZA 4XBHA 1XUDA 1ZP5A 1QIAA 1BKCI 1HOVA 4L7AA 2QPJA 1EB6A 1FBLA 2J0TA 3DWBA 2OZRA 4A7BA 1H71P 1QUAA 3HBVP 1IADA 5CXAA 1CXVA 1IAAA 1D5JA 2DW1A 5D3CA 2ERPA 2HU6A 2E3XA 4R3VA 3U1RA 1FM1A 1SLNA 3LQ0A 1K7QA 2W14A 1OS9A 1OM6A 2A8HA 4H49A 3KHIA 2FV5A 1CGEA 2OW0A 4FU4A 1QJIA 4JPAA 1MMBA 3HY9A 5BOTA 5I4OA 2OY2A 2XS4A 1Z3JA 4PKUA 1HFCA 1XUCA 2W13A 2RJQA 2CLTA 2Y6DA 3B2ZA 1HY7A 4DD8A 1R55A 4WKIA 1AF0A 4H2EA 2POJA 1BSWA 1MMPA 1WNIA 1GE7A 4XM8A 1RM8A 2FV9A 4FXQA 3E8RA 5D7WA 3F15A 4JQGA 3EWJA 1UTZA 4G9LA 3OHOA 4L6TA 2JIHA 3WV2A 1JJ9A 4H82A 1HFSA 3LJZA 1XFXA 3LQBA 1CK7A 4H3XA 5H8XA 1KAPP 5D1SA 1KUHA 1KUFA 1Q3AA 1XFWA 1OO9A 1PWVA 1BQQM 4WKEA 3DSLA 4GWMA 3P24A 2O36A 2MZIA 1Y0VA 2OY4A 1BKCE 1AKLA 2MLRA 2X3BA 1C8TA 3BA0A 3F18A 4XM7A 3Q2HA 4PKWA 4JP4A 2YB9A 1XFVA 2WOAA 1I73A 1CQRA 1SU3A 1JK3A 3I7GA 1G9KA 1C3IA 2OW9A 5B5OA 4HX3A 2D1NA 3EDZA 1EUBA 1A86A 1L6JA 3EDHA 1K7IA 2OW2A 3K7LA 5I12A 2OVZA 1BUDA 5BPAA 3ZVSA 2W15A 1OZ9A 4PKSA 3ZUKA 3DTKA 4WK7A 1EAKA 3DNGA 4CTHA 1UEAA 3DTEA 2JNPA 4XCTA 3TS4A 3UVCA 3DTIA 1D8FA 5BOYA 3N2VA 830CA 3AYKA 4PKTA 3ELMA 5B5PA 1OM8A 4Q1LA 1G4KA 1BM6A 966CA 1XFUA 2DDYA 3F16A 4PKVA 2YIGA 1BKCA 1FLSA 3Q2GA 1BQOA 1YP1A 4GF1A 3MA2A 4AUOA 1QJJA 3AYUA 3LGPA 3TVCA 4FVLA 4ILWD 2XS3A 3GBOA 3KMCA 1KUIA 1JH1A 4A3WA 1BUVM 3I7IA 3RTSA 3O2XA 1BZSA 3G5CA 1MNCA 1HV5A 1XFZA 1IAGA 2Z2DA 2OXUA 2DDFA 2TCLA 3DPEA 2SRTA 3RTTA 4FXYP 1JKYA 1SMPA 1AYKA 3LJGA 2W12A 5I2ZA 1J7NA 5L79A 456CA 5D1TA 1ATLA 3LEAA 4XM6A 1ZS0A 3SHIA 2WO8A 5D1UA 1SATA 1IACA 1GKDA 4JA1A 2ERQA 1ZXCA 1CGLA 3O64A 1YQYA 1PWPA 3LKAA 4I03A 3OHLA 2RJPA 4DV8A 1D7XA 1HTDA 1ND1A 4H30A 1GO8P 1KBCA 1A85A 1XURA 1OMJA 4G0DA 1B3DA 3LE9A 5LABA 1R1IA 2D1OA 3VI1A 1C7KA 1QICA 3LILA 3LIRA 3NX7A 3HDBA 4WZVA 3TSKA 1JAPA 3LUMA 1JIZA 1G12A 1TVIA 3HBUP 2KRJA 2W0DA 1ZTQA 4DPEA 2JT6A 4GR0A 2OXZA 2USNA 4I35A 2CKIA 3ZXHA 1O0QA 2V4BA 2X7MA 3KECA 1CAQA 3EDGA 2WO9A 1I1IP 4GR3A 1SRPA 2MLSA 3KWVC 1B8YA 1Y8JA 2O3EA 2OXWA 1KUKA 3N2UA 1DMTA 3P1VA 1XM5A 3EDIA 1QIBA 1Y93A 5D2BA 2N8RA 4PKQA 3LK8A 1IABA 1MMQA 1CGFA 4WF6A 4GWNA 3EHXA 3USNA 1XFYA 4AXQA 3KEKA 1RMZA 1UMTA 4AIGA 2I47A 3AIGA 3HDAP 1G05A 3L0TA 1S4BP 1JIWP 5I3MA 2X3CA 3LUNA 4IUWA 5I43A 1JAOA 5CZMA 2AIGP 5I0LA 3DPFA 3L0VA 4L19A 1OM7A 1ROSA 1I76A 4L63A 4ON1A 2AYKA 2YUFA 1BIWA 3G42A 3LIKA 1UMSA 2Y6CA 5JMYA 4HMAA 2X3AA 3HY7A 1DTHA 4GR8A 4GUYA 4ZR5A 1MMRA 4PKRA 3F19A 4H84A 3HYGA 3LJTA 4AYKA 3KRYA 1PWWA 1OS2A 1ZVXA 2OI0A 1R1HA 3WV3A 3WV1A 3B92A 3HB2P 3TT4A 2JSDA 2DW0A 2PJTA 5CUHA 1YCMA 1CIZA 1D8MA 1UTTA 2L0RA 3CKIA 2JT5A 5L7FA 4QKZA 2K9CA 2E2DA 1PWQA 1XAXA 3LMCA 2DW2A 1PWUA 1GKCA 1O0TA 2K2GA 3K7NA 1GE5A 1GXDA 3DL1A 3KMEA 4JIJA 1USNA 3EHYA 4H76A 1YOUA 3KEJA 3F17A 1JAQA 1JANA 2J83A 1G49A 4EFSA 2OVXA 1R1JA
chains in the Genus database with same CATH topology
3F1AA 1KUGA 1GE6A 3V96B 4H1QA 2EROA 4IN9A 1K7GA 2MZHA 3VTGA 2MZEA 1ASTA 4J4MA 4IJOA 4DF9A 4GQLA 1SLMA 1GO7P 1ZXVA 1IAEA 1R54A 2OW1A 3B8ZA 4XBHA 1XUDA 1ZP5A 1QIAA 1BKCI 1HOVA 4L7AA 2QPJA 1EB6A 1FBLA 2J0TA 3DWBA 2OZRA 4A7BA 1H71P 1QUAA 3HBVP 1IADA 5CXAA 1CXVA 1IAAA 1D5JA 2DW1A 5D3CA 2ERPA 2HU6A 2E3XA 4R3VA 3U1RA 1FM1A 1SLNA 3LQ0A 1K7QA 2W14A 1OS9A 1OM6A 2A8HA 4H49A 3KHIA 2FV5A 1CGEA 2OW0A 4FU4A 1QJIA 4JPAA 1MMBA 3HY9A 5BOTA 5I4OA 2OY2A 2XS4A 1Z3JA 4PKUA 1HFCA 1XUCA 2W13A 2RJQA 2CLTA 2Y6DA 3B2ZA 1HY7A 4DD8A 1R55A 4WKIA 1AF0A 4H2EA 2POJA 1BSWA 1MMPA 1WNIA 1GE7A 4XM8A 1RM8A 2FV9A 4FXQA 3E8RA 5D7WA 3F15A 4JQGA 3EWJA 1UTZA 4G9LA 3OHOA 4L6TA 2JIHA 3WV2A 1JJ9A 4H82A 1HFSA 3LJZA 1XFXA 3LQBA 1CK7A 4H3XA 5H8XA 1KAPP 5D1SA 1KUHA 1KUFA 1Q3AA 1XFWA 1OO9A 1PWVA 1BQQM 4WKEA 3DSLA 4GWMA 3P24A 2O36A 2MZIA 1Y0VA 2OY4A 1BKCE 1AKLA 2MLRA 2X3BA 1C8TA 3BA0A 3F18A 4XM7A 3Q2HA 4PKWA 4JP4A 2YB9A 1XFVA 2WOAA 1I73A 1CQRA 1SU3A 1JK3A 3I7GA 1G9KA 1C3IA 2OW9A 5B5OA 4HX3A 2D1NA 3EDZA 1EUBA 1A86A 1L6JA 3EDHA 1K7IA 2OW2A 3K7LA 5I12A 2OVZA 1BUDA 5BPAA 3ZVSA 2W15A 4PKSA 3ZUKA 3DTKA 4WK7A 1EAKA 3DNGA 4CTHA 1UEAA 3DTEA 2JNPA 4XCTA 3TS4A 3UVCA 3DTIA 1D8FA 5BOYA 3N2VA 830CA 3AYKA 4PKTA 3ELMA 5B5PA 1OM8A 4Q1LA 1G4KA 1BM6A 966CA 1XFUA 2DDYA 3F16A 4PKVA 2YIGA 1BKCA 1FLSA 3Q2GA 1BQOA 1YP1A 4GF1A 3MA2A 4AUOA 1QJJA 3AYUA 3LGPA 3TVCA 4FVLA 4ILWD 2XS3A 3GBOA 3KMCA 1KUIA 1JH1A 4A3WA 1BUVM 3I7IA 3RTSA 3O2XA 1BZSA 3G5CA 1MNCA 1HV5A 1XFZA 1IAGA 2Z2DA 2OXUA 2DDFA 2TCLA 3DPEA 2SRTA 3RTTA 4FXYP 1JKYA 1SMPA 1AYKA 3LJGA 2W12A 5I2ZA 1J7NA 5L79A 456CA 5D1TA 1ATLA 3LEAA 4XM6A 1ZS0A 3SHIA 2WO8A 5D1UA 1SATA 1IACA 1GKDA 4JA1A 2ERQA 1ZXCA 1CGLA 3O64A 1YQYA 1PWPA 3LKAA 4I03A 3OHLA 2RJPA 4DV8A 1D7XA 1HTDA 1ND1A 4H30A 1GO8P 1KBCA 1A85A 1XURA 1OMJA 4G0DA 1B3DA 3LE9A 5LABA 1R1IA 2D1OA 3VI1A 1C7KA 1QICA 3LILA 3LIRA 3NX7A 3HDBA 4WZVA 3TSKA 1JAPA 3LUMA 1JIZA 1G12A 3HBUP 2KRJA 2W0DA 1ZTQA 4DPEA 2JT6A 4GR0A 2OXZA 2USNA 4I35A 2CKIA 3ZXHA 1O0QA 2V4BA 2X7MA 3KECA 1CAQA 3EDGA 2WO9A 1I1IP 4GR3A 1SRPA 2MLSA 3KWVC 1B8YA 1Y8JA 2O3EA 2OXWA 1KUKA 3N2UA 1DMTA 3P1VA 3EDIA 1QIBA 1Y93A 5D2BA 2N8RA 4PKQA 3LK8A 1IABA 1MMQA 1CGFA 4WF6A 4GWNA 3EHXA 3USNA 1XFYA 4AXQA 3KEKA 1RMZA 1UMTA 4AIGA 2I47A 3AIGA 3HDAP 1G05A 3L0TA 1S4BP 1JIWP 5I3MA 2X3CA 3LUNA 4IUWA 5I43A 1JAOA 5CZMA 2AIGP 5I0LA 3DPFA 3L0VA 4L19A 1OM7A 1ROSA 1I76A 4L63A 4ON1A 2AYKA 2YUFA 1BIWA 3G42A 3LIKA 1UMSA 2Y6CA 5JMYA 4HMAA 2X3AA 3HY7A 1DTHA 4GR8A 4GUYA 4ZR5A 1MMRA 4PKRA 3F19A 4H84A 3HYGA 3LJTA 4AYKA 3KRYA 1PWWA 1OS2A 1ZVXA 2OI0A 1R1HA 3WV3A 3WV1A 3B92A 3HB2P 3TT4A 2JSDA 2DW0A 2PJTA 5CUHA 1YCMA 1CIZA 1D8MA 1UTTA 2L0RA 3CKIA 2JT5A 5L7FA 4QKZA 2K9CA 2E2DA 1PWQA 3LMCA 2DW2A 1PWUA 1GKCA 1O0TA 2K2GA 3K7NA 1GE5A 1GXDA 3DL1A 3KMEA 4JIJA 1USNA 3EHYA 4H76A 1YOUA 3KEJA 3F17A 1JAQA 1JANA 2J83A 1G49A 4EFSA 2OVXA 1R1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1A A;  1KUG A;  1GE6 A;  3V96 B;  4H1Q A;  2ERO A;  4IN9 A;  1K7G A;  2MZH A;  3VTG A;  2MZE A;  1AST A;  4J4M A;  4IJO A;  4DF9 A;  4GQL A;  1SLM A;  1GO7 P;  1ZXV A;  1IAE A;  1R54 A;  2OW1 A;  3B8Z A;  4XBH A;  1XUD A;  1ZP5 A;  1QIA A;  1BKC I;  1HOV A;  2QPJ A;  1EB6 A;  1FBL A;  2J0T A;  3DWB A;  2OZR A;  4A7B A;  1H71 P;  1QUA A;  3HBV P;  1IAD A;  5CXA A;  1CXV A;  1IAA A;  1D5J A;  2DW1 A;  5D3C A;  2ERP A;  2HU6 A;  2E3X A;  4R3V A;  3U1R A;  1FM1 A;  1SLN A;  3LQ0 A;  1K7Q A;  2W14 A;  1OS9 A;  1OM6 A;  2A8H A;  4H49 A;  3KHI A;  2FV5 A;  1CGE A;  2OW0 A;  4FU4 A;  1QJI A;  4JPA A;  1MMB A;  3HY9 A;  5BOT A;  5I4O A;  2OY2 A;  2XS4 A;  1Z3J A;  4PKU A;  1HFC A;  1XUC A;  2W13 A;  2RJQ A;  2CLT A;  2Y6D A;  3B2Z A;  1HY7 A;  4DD8 A;  1R55 A;  4WKI A;  1AF0 A;  4H2E A;  2POJ A;  1BSW A;  1MMP A;  1WNI A;  1GE7 A;  4XM8 A;  1RM8 A;  2FV9 A;  4FXQ A;  3E8R A;  5D7W A;  3F15 A;  4JQG A;  3EWJ A;  1UTZ A;  4G9L A;  3OHO A;  4L6T A;  2JIH A;  3WV2 A;  1JJ9 A;  4H82 A;  1HFS A;  3LJZ A;  1XFX A;  3LQB A;  1CK7 A;  4H3X A;  5H8X A;  1KAP P;  5D1S A;  1KUH A;  1KUF A;  1Q3A A;  1XFW A;  1OO9 A;  1PWV A;  1BQQ M;  4WKE A;  3DSL A;  4GWM A;  3P24 A;  2O36 A;  2MZI A;  1Y0V A;  2OY4 A;  1BKC E;  1AKL A;  2MLR A;  2X3B A;  1C8T A;  3BA0 A;  3F18 A;  4XM7 A;  3Q2H A;  4PKW A;  4JP4 A;  2YB9 A;  1XFV A;  2WOA A;  1I73 A;  1CQR A;  1SU3 A;  1JK3 A;  3I7G A;  1G9K A;  1C3I A;  2OW9 A;  5B5O A;  4HX3 A;  2D1N A;  3EDZ A;  1EUB A;  1A86 A;  1L6J A;  3EDH A;  1K7I A;  2OW2 A;  3K7L A;  5I12 A;  2OVZ A;  1BUD A;  5BPA A;  3ZVS A;  2W15 A;  4PKS A;  3ZUK A;  4WK7 A;  1EAK A;  3DNG A;  4CTH A;  1UEA A;  2JNP A;  4XCT A;  3TS4 A;  3UVC A;  1D8F A;  5BOY A;  3N2V A;  830C A;  3AYK A;  4PKT A;  3ELM A;  5B5P A;  1OM8 A;  4Q1L A;  1G4K A;  1BM6 A;  966C A;  1XFU A;  2DDY A;  3F16 A;  4PKV A;  2YIG A;  1BKC A;  1FLS A;  3Q2G A;  1BQO A;  1YP1 A;  4GF1 A;  3MA2 A;  4AUO A;  1QJJ A;  3AYU A;  3LGP A;  3TVC A;  4FVL A;  4ILW D;  2XS3 A;  3GBO A;  3KMC A;  1KUI A;  1JH1 A;  4A3W A;  1BUV M;  3I7I A;  3RTS A;  3O2X A;  1BZS A;  3G5C A;  1MNC A;  1HV5 A;  1XFZ A;  1IAG A;  2Z2D A;  2OXU A;  2DDF A;  2TCL A;  3DPE A;  2SRT A;  3RTT A;  4FXY P;  1JKY A;  1SMP A;  1AYK A;  3LJG A;  2W12 A;  5I2Z A;  1J7N A;  5L79 A;  456C A;  5D1T A;  1ATL A;  3LEA A;  4XM6 A;  1ZS0 A;  3SHI A;  2WO8 A;  5D1U A;  1SAT A;  1IAC A;  1GKD A;  4JA1 A;  2ERQ A;  1ZXC A;  1CGL A;  3O64 A;  1YQY A;  1PWP A;  3LKA A;  4I03 A;  3OHL A;  2RJP A;  4DV8 A;  1D7X A;  1HTD A;  1ND1 A;  4H30 A;  1GO8 P;  1KBC A;  1A85 A;  1XUR A;  1OMJ A;  4G0D A;  1B3D A;  3LE9 A;  5LAB A;  1R1I A;  2D1O A;  3VI1 A;  1C7K A;  1QIC A;  3LIL A;  3LIR A;  3NX7 A;  3HDB A;  4WZV A;  3TSK A;  1JAP A;  3LUM A;  1JIZ A;  1G12 A;  3HBU P;  2KRJ A;  2W0D A;  1ZTQ A;  4DPE A;  2JT6 A;  4GR0 A;  2OXZ A;  2USN A;  4I35 A;  2CKI A;  3ZXH A;  1O0Q A;  2V4B A;  2X7M A;  3KEC A;  1CAQ A;  3EDG A;  2WO9 A;  1I1I P;  4GR3 A;  1SRP A;  2MLS A;  3KWV C;  1B8Y A;  1Y8J A;  2O3E A;  2OXW A;  1KUK A;  3N2U A;  1DMT A;  3P1V A;  3EDI A;  1QIB A;  1Y93 A;  5D2B A;  2N8R A;  4PKQ A;  3LK8 A;  1IAB A;  1MMQ A;  1CGF A;  4WF6 A;  4GWN A;  3EHX A;  3USN A;  1XFY A;  4AXQ A;  3KEK A;  1RMZ A;  1UMT A;  4AIG A;  2I47 A;  3AIG A;  3HDA P;  1G05 A;  3L0T A;  1S4B P;  1JIW P;  5I3M A;  2X3C A;  3LUN A;  4IUW A;  5I43 A;  1JAO A;  5CZM A;  2AIG P;  5I0L A;  3DPF A;  3L0V A;  4L19 A;  1OM7 A;  1ROS A;  1I76 A;  4L63 A;  4ON1 A;  2AYK A;  1BIW A;  3G42 A;  3LIK A;  1UMS A;  2Y6C A;  5JMY A;  4HMA A;  2X3A A;  3HY7 A;  1DTH A;  4GR8 A;  4GUY A;  4ZR5 A;  1MMR A;  4PKR A;  3F19 A;  4H84 A;  3HYG A;  3LJT A;  4AYK A;  3KRY A;  1PWW A;  1OS2 A;  1ZVX A;  2OI0 A;  1R1H A;  3WV3 A;  3WV1 A;  3B92 A;  3HB2 P;  3TT4 A;  2JSD A;  2DW0 A;  2PJT A;  5CUH A;  1YCM A;  1CIZ A;  1D8M A;  1UTT A;  2L0R A;  3CKI A;  2JT5 A;  5L7F A;  4QKZ A;  2K9C A;  2E2D A;  1PWQ A;  3LMC A;  2DW2 A;  1PWU A;  1GKC A;  1O0T A;  2K2G A;  3K7N A;  1GE5 A;  1GXD A;  3DL1 A;  3KME A;  4JIJ A;  1USN A;  3EHY A;  4H76 A;  1YOU A;  3KEJ A;  3F17 A;  1JAQ A;  1JAN A;  2J83 A;  1G49 A;  4EFS A;  2OVX A;  1R1J A; 
#chains in the Genus database with same CATH topology
 3F1A A;  1KUG A;  1GE6 A;  3V96 B;  4H1Q A;  2ERO A;  4IN9 A;  1K7G A;  2MZH A;  3VTG A;  2MZE A;  1AST A;  4J4M A;  4IJO A;  4DF9 A;  4GQL A;  1SLM A;  1GO7 P;  1ZXV A;  1IAE A;  1R54 A;  2OW1 A;  3B8Z A;  4XBH A;  1XUD A;  1ZP5 A;  1QIA A;  1BKC I;  1HOV A;  4L7A A;  2QPJ A;  1EB6 A;  1FBL A;  2J0T A;  3DWB A;  2OZR A;  4A7B A;  1H71 P;  1QUA A;  3HBV P;  1IAD A;  5CXA A;  1CXV A;  1IAA A;  1D5J A;  2DW1 A;  5D3C A;  2ERP A;  2HU6 A;  2E3X A;  4R3V A;  3U1R A;  1FM1 A;  1SLN A;  3LQ0 A;  1K7Q A;  2W14 A;  1OS9 A;  1OM6 A;  2A8H A;  4H49 A;  3KHI A;  2FV5 A;  1CGE A;  2OW0 A;  4FU4 A;  1QJI A;  4JPA A;  1MMB A;  3HY9 A;  5BOT A;  5I4O A;  2OY2 A;  2XS4 A;  1Z3J A;  4PKU A;  1HFC A;  1XUC A;  2W13 A;  2RJQ A;  2CLT A;  2Y6D A;  3B2Z A;  1HY7 A;  4DD8 A;  1R55 A;  4WKI A;  1AF0 A;  4H2E A;  2POJ A;  1BSW A;  1MMP A;  1WNI A;  1GE7 A;  4XM8 A;  1RM8 A;  2FV9 A;  4FXQ A;  3E8R A;  5D7W A;  3F15 A;  4JQG A;  3EWJ A;  1UTZ A;  4G9L A;  3OHO A;  4L6T A;  2JIH A;  3WV2 A;  1JJ9 A;  4H82 A;  1HFS A;  3LJZ A;  1XFX A;  3LQB A;  1CK7 A;  4H3X A;  5H8X A;  1KAP P;  5D1S A;  1KUH A;  1KUF A;  1Q3A A;  1XFW A;  1OO9 A;  1PWV A;  1BQQ M;  4WKE A;  3DSL A;  4GWM A;  3P24 A;  2O36 A;  2MZI A;  1Y0V A;  2OY4 A;  1BKC E;  1AKL A;  2MLR A;  2X3B A;  1C8T A;  3BA0 A;  3F18 A;  4XM7 A;  3Q2H A;  4PKW A;  4JP4 A;  2YB9 A;  1XFV A;  2WOA A;  1I73 A;  1CQR A;  1SU3 A;  1JK3 A;  3I7G A;  1G9K A;  1C3I A;  2OW9 A;  5B5O A;  4HX3 A;  2D1N A;  3EDZ A;  1EUB A;  1A86 A;  1L6J A;  3EDH A;  1K7I A;  2OW2 A;  3K7L A;  5I12 A;  2OVZ A;  1BUD A;  5BPA A;  3ZVS A;  2W15 A;  1OZ9 A;  4PKS A;  3ZUK A;  3DTK A;  4WK7 A;  1EAK A;  3DNG A;  4CTH A;  1UEA A;  3DTE A;  2JNP A;  4XCT A;  3TS4 A;  3UVC A;  3DTI A;  1D8F A;  5BOY A;  3N2V A;  830C A;  3AYK A;  4PKT A;  3ELM A;  5B5P A;  1OM8 A;  4Q1L A;  1G4K A;  1BM6 A;  966C A;  1XFU A;  2DDY A;  3F16 A;  4PKV A;  2YIG A;  1BKC A;  1FLS A;  3Q2G A;  1BQO A;  1YP1 A;  4GF1 A;  3MA2 A;  4AUO A;  1QJJ A;  3AYU A;  3LGP A;  3TVC A;  4FVL A;  4ILW D;  2XS3 A;  3GBO A;  3KMC A;  1KUI A;  1JH1 A;  4A3W A;  1BUV M;  3I7I A;  3RTS A;  3O2X A;  1BZS A;  3G5C A;  1MNC A;  1HV5 A;  1XFZ A;  1IAG A;  2Z2D A;  2OXU A;  2DDF A;  2TCL A;  3DPE A;  2SRT A;  3RTT A;  4FXY P;  1JKY A;  1SMP A;  1AYK A;  3LJG A;  2W12 A;  5I2Z A;  1J7N A;  5L79 A;  456C A;  5D1T A;  1ATL A;  3LEA A;  4XM6 A;  1ZS0 A;  3SHI A;  2WO8 A;  5D1U A;  1SAT A;  1IAC A;  1GKD A;  4JA1 A;  2ERQ A;  1ZXC A;  1CGL A;  3O64 A;  1YQY A;  1PWP A;  3LKA A;  4I03 A;  3OHL A;  2RJP A;  4DV8 A;  1D7X A;  1HTD A;  1ND1 A;  4H30 A;  1GO8 P;  1KBC A;  1A85 A;  1XUR A;  1OMJ A;  4G0D A;  1B3D A;  3LE9 A;  5LAB A;  1R1I A;  2D1O A;  3VI1 A;  1C7K A;  1QIC A;  3LIL A;  3LIR A;  3NX7 A;  3HDB A;  4WZV A;  3TSK A;  1JAP A;  3LUM A;  1JIZ A;  1G12 A;  1TVI A;  3HBU P;  2KRJ A;  2W0D A;  1ZTQ A;  4DPE A;  2JT6 A;  4GR0 A;  2OXZ A;  2USN A;  4I35 A;  2CKI A;  3ZXH A;  1O0Q A;  2V4B A;  2X7M A;  3KEC A;  1CAQ A;  3EDG A;  2WO9 A;  1I1I P;  4GR3 A;  1SRP A;  2MLS A;  3KWV C;  1B8Y A;  1Y8J A;  2O3E A;  2OXW A;  1KUK A;  3N2U A;  1DMT A;  3P1V A;  1XM5 A;  3EDI A;  1QIB A;  1Y93 A;  5D2B A;  2N8R A;  4PKQ A;  3LK8 A;  1IAB A;  1MMQ A;  1CGF A;  4WF6 A;  4GWN A;  3EHX A;  3USN A;  1XFY A;  4AXQ A;  3KEK A;  1RMZ A;  1UMT A;  4AIG A;  2I47 A;  3AIG A;  3HDA P;  1G05 A;  3L0T A;  1S4B P;  1JIW P;  5I3M A;  2X3C A;  3LUN A;  4IUW A;  5I43 A;  1JAO A;  5CZM A;  2AIG P;  5I0L A;  3DPF A;  3L0V A;  4L19 A;  1OM7 A;  1ROS A;  1I76 A;  4L63 A;  4ON1 A;  2AYK A;  2YUF A;  1BIW A;  3G42 A;  3LIK A;  1UMS A;  2Y6C A;  5JMY A;  4HMA A;  2X3A A;  3HY7 A;  1DTH A;  4GR8 A;  4GUY A;  4ZR5 A;  1MMR A;  4PKR A;  3F19 A;  4H84 A;  3HYG A;  3LJT A;  4AYK A;  3KRY A;  1PWW A;  1OS2 A;  1ZVX A;  2OI0 A;  1R1H A;  3WV3 A;  3WV1 A;  3B92 A;  3HB2 P;  3TT4 A;  2JSD A;  2DW0 A;  2PJT A;  5CUH A;  1YCM A;  1CIZ A;  1D8M A;  1UTT A;  2L0R A;  3CKI A;  2JT5 A;  5L7F A;  4QKZ A;  2K9C A;  2E2D A;  1PWQ A;  1XAX A;  3LMC A;  2DW2 A;  1PWU A;  1GKC A;  1O0T A;  2K2G A;  3K7N A;  1GE5 A;  1GXD A;  3DL1 A;  3KME A;  4JIJ A;  1USN A;  3EHY A;  4H76 A;  1YOU A;  3KEJ A;  3F17 A;  1JAQ A;  1JAN A;  2J83 A;  1G49 A;  4EFS A;  2OVX A;  1R1J A; 
#chains in the Genus database with same CATH homology
 3F1A A;  1KUG A;  1GE6 A;  3V96 B;  4H1Q A;  2ERO A;  4IN9 A;  1K7G A;  2MZH A;  3VTG A;  2MZE A;  1AST A;  4J4M A;  4IJO A;  4DF9 A;  4GQL A;  1SLM A;  1GO7 P;  1ZXV A;  1IAE A;  1R54 A;  2OW1 A;  3B8Z A;  4XBH A;  1XUD A;  1ZP5 A;  1QIA A;  1BKC I;  1HOV A;  4L7A A;  2QPJ A;  1EB6 A;  1FBL A;  2J0T A;  3DWB A;  2OZR A;  4A7B A;  1H71 P;  1QUA A;  3HBV P;  1IAD A;  5CXA A;  1CXV A;  1IAA A;  1D5J A;  2DW1 A;  5D3C A;  2ERP A;  2HU6 A;  2E3X A;  4R3V A;  3U1R A;  1FM1 A;  1SLN A;  3LQ0 A;  1K7Q A;  2W14 A;  1OS9 A;  1OM6 A;  2A8H A;  4H49 A;  3KHI A;  2FV5 A;  1CGE A;  2OW0 A;  4FU4 A;  1QJI A;  4JPA A;  1MMB A;  3HY9 A;  5BOT A;  5I4O A;  2OY2 A;  2XS4 A;  1Z3J A;  4PKU A;  1HFC A;  1XUC A;  2W13 A;  2RJQ A;  2CLT A;  2Y6D A;  3B2Z A;  1HY7 A;  4DD8 A;  1R55 A;  4WKI A;  1AF0 A;  4H2E A;  2POJ A;  1BSW A;  1MMP A;  1WNI A;  1GE7 A;  4XM8 A;  1RM8 A;  2FV9 A;  4FXQ A;  3E8R A;  5D7W A;  3F15 A;  4JQG A;  3EWJ A;  1UTZ A;  4G9L A;  3OHO A;  4L6T A;  2JIH A;  3WV2 A;  1JJ9 A;  4H82 A;  1HFS A;  3LJZ A;  1XFX A;  3LQB A;  1CK7 A;  4H3X A;  5H8X A;  1KAP P;  5D1S A;  1KUH A;  1KUF A;  1Q3A A;  1XFW A;  1OO9 A;  1PWV A;  1BQQ M;  4WKE A;  3DSL A;  4GWM A;  3P24 A;  2O36 A;  2MZI A;  1Y0V A;  2OY4 A;  1BKC E;  1AKL A;  2MLR A;  2X3B A;  1C8T A;  3BA0 A;  3F18 A;  4XM7 A;  3Q2H A;  4PKW A;  4JP4 A;  2YB9 A;  1XFV A;  2WOA A;  1I73 A;  1CQR A;  1SU3 A;  1JK3 A;  3I7G A;  1G9K A;  1C3I A;  2OW9 A;  5B5O A;  4HX3 A;  2D1N A;  3EDZ A;  1EUB A;  1A86 A;  1L6J A;  3EDH A;  1K7I A;  2OW2 A;  3K7L A;  5I12 A;  2OVZ A;  1BUD A;  5BPA A;  3ZVS A;  2W15 A;  4PKS A;  3ZUK A;  3DTK A;  4WK7 A;  1EAK A;  3DNG A;  4CTH A;  1UEA A;  3DTE A;  2JNP A;  4XCT A;  3TS4 A;  3UVC A;  3DTI A;  1D8F A;  5BOY A;  3N2V A;  830C A;  3AYK A;  4PKT A;  3ELM A;  5B5P A;  1OM8 A;  4Q1L A;  1G4K A;  1BM6 A;  966C A;  1XFU A;  2DDY A;  3F16 A;  4PKV A;  2YIG A;  1BKC A;  1FLS A;  3Q2G A;  1BQO A;  1YP1 A;  4GF1 A;  3MA2 A;  4AUO A;  1QJJ A;  3AYU A;  3LGP A;  3TVC A;  4FVL A;  4ILW D;  2XS3 A;  3GBO A;  3KMC A;  1KUI A;  1JH1 A;  4A3W A;  1BUV M;  3I7I A;  3RTS A;  3O2X A;  1BZS A;  3G5C A;  1MNC A;  1HV5 A;  1XFZ A;  1IAG A;  2Z2D A;  2OXU A;  2DDF A;  2TCL A;  3DPE A;  2SRT A;  3RTT A;  4FXY P;  1JKY A;  1SMP A;  1AYK A;  3LJG A;  2W12 A;  5I2Z A;  1J7N A;  5L79 A;  456C A;  5D1T A;  1ATL A;  3LEA A;  4XM6 A;  1ZS0 A;  3SHI A;  2WO8 A;  5D1U A;  1SAT A;  1IAC A;  1GKD A;  4JA1 A;  2ERQ A;  1ZXC A;  1CGL A;  3O64 A;  1YQY A;  1PWP A;  3LKA A;  4I03 A;  3OHL A;  2RJP A;  4DV8 A;  1D7X A;  1HTD A;  1ND1 A;  4H30 A;  1GO8 P;  1KBC A;  1A85 A;  1XUR A;  1OMJ A;  4G0D A;  1B3D A;  3LE9 A;  5LAB A;  1R1I A;  2D1O A;  3VI1 A;  1C7K A;  1QIC A;  3LIL A;  3LIR A;  3NX7 A;  3HDB A;  4WZV A;  3TSK A;  1JAP A;  3LUM A;  1JIZ A;  1G12 A;  3HBU P;  2KRJ A;  2W0D A;  1ZTQ A;  4DPE A;  2JT6 A;  4GR0 A;  2OXZ A;  2USN A;  4I35 A;  2CKI A;  3ZXH A;  1O0Q A;  2V4B A;  2X7M A;  3KEC A;  1CAQ A;  3EDG A;  2WO9 A;  1I1I P;  4GR3 A;  1SRP A;  2MLS A;  3KWV C;  1B8Y A;  1Y8J A;  2O3E A;  2OXW A;  1KUK A;  3N2U A;  1DMT A;  3P1V A;  3EDI A;  1QIB A;  1Y93 A;  5D2B A;  2N8R A;  4PKQ A;  3LK8 A;  1IAB A;  1MMQ A;  1CGF A;  4WF6 A;  4GWN A;  3EHX A;  3USN A;  1XFY A;  4AXQ A;  3KEK A;  1RMZ A;  1UMT A;  4AIG A;  2I47 A;  3AIG A;  3HDA P;  1G05 A;  3L0T A;  1S4B P;  1JIW P;  5I3M A;  2X3C A;  3LUN A;  4IUW A;  5I43 A;  1JAO A;  5CZM A;  2AIG P;  5I0L A;  3DPF A;  3L0V A;  4L19 A;  1OM7 A;  1ROS A;  1I76 A;  4L63 A;  4ON1 A;  2AYK A;  2YUF A;  1BIW A;  3G42 A;  3LIK A;  1UMS A;  2Y6C A;  5JMY A;  4HMA A;  2X3A A;  3HY7 A;  1DTH A;  4GR8 A;  4GUY A;  4ZR5 A;  1MMR A;  4PKR A;  3F19 A;  4H84 A;  3HYG A;  3LJT A;  4AYK A;  3KRY A;  1PWW A;  1OS2 A;  1ZVX A;  2OI0 A;  1R1H A;  3WV3 A;  3WV1 A;  3B92 A;  3HB2 P;  3TT4 A;  2JSD A;  2DW0 A;  2PJT A;  5CUH A;  1YCM A;  1CIZ A;  1D8M A;  1UTT A;  2L0R A;  3CKI A;  2JT5 A;  5L7F A;  4QKZ A;  2K9C A;  2E2D A;  1PWQ A;  3LMC A;  2DW2 A;  1PWU A;  1GKC A;  1O0T A;  2K2G A;  3K7N A;  1GE5 A;  1GXD A;  3DL1 A;  3KME A;  4JIJ A;  1USN A;  3EHY A;  4H76 A;  1YOU A;  3KEJ A;  3F17 A;  1JAQ A;  1JAN A;  2J83 A;  1G49 A;  4EFS A;  2OVX A;  1R1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...