3WV2A

Crystal structure of the catalytic domain of mmp-13 complexed with n-(3-methoxybenzyl)-4-oxo-3,4-dihydroquinazoline-2-carboxamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
166
Chain Sequence
b'YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTHFMLPDDDVQGIQSLYGPGDED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagenase 3
publication title Thieno[2,3-d]pyrimidine-2-carboxamides bearing a carboxybenzene group at 5-position: Highly potent, selective, and orally available MMP-13 inhibitors interacting with the S1 binding site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 166
sequence length 169
chains with identical sequence B
ec nomenclature ec 3.4.24.-:
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3wv2A00
1A85A 1CXVA 3B8ZA 1AF0A 1EUBA 1MNCA 3Q2GA 2KRJA 2DW0A 4WK7A 1QJJA 3VI1A 4GR0A 1IADA 1JK3A 1UEAA 2XS3A 3DPFA 1IAGA 3P1VA 1C7KA 2E2DA 1IACA 1OM7A 1XFZA 2MZIA 1PWUA 1KAPP 1PWWA 4XBHA 2OW2A 2USNA 1Y93A 1KUFA 1CIZA 3G42A 3F15A 1OM6A 1BZSA 2EROA 4WZVA 4IN9A 4G0DA 4JQGA 1OO9A 5D1UA 2JT6A 2OI0A 1SMPA 1YQYA 2CKIA 3USNA 1AYKA 1XFYA 1C3IA 4DV8A 1BQOA 2WO8A 1UMTA 1ZTQA 3RTSA 1B3DA 3B92A 5I43A 5JMYA 3O64A 4AUOA 1O0TA 2MZHA 4FXQA 3DWBA 1CAQA 3I7IA 1BKCI 2FV5A 1GO8P 2O36A 1CQRA 1SATA 3EHYA 5BOYA 3LUMA 4H1QA 3HDAP 3AIGA 2DW2A 3HBVP 1XURA 4AYKA 3VTGA 2MLRA 2X3AA 4ON1A 1KUIA 1Z3JA 1HV5A 1ASTA 4HMAA 5CUHA 2OY2A 3HB2P 4GUYA 3DSLA 1WNIA 3N2UA 2WOAA 1JKYA 1G4KA 4XCTA 2W12A 4PKTA 1BSWA 2QPJA 3HYGA 2OZRA 4PKVA 1Y8JA 1R1HA 4A3WA 2DDFA 1AKLA 1YP1A 2I47A 2Y6CA 3V96B 1SLNA 2K2GA 2JNPA 2ERPA 3LJTA 2K9CA 2MLSA 3KECA 3LQ0A 1BIWA 2OW0A 2HU6A 3LIRA 3WV3A 3O2XA 4H76A 3EDHA 4G9LA 4JIJA 4HX3A 2YIGA 1GKDA 3LMCA 3CKIA 1ZP5A 3LGPA 1I76A 1XFWA 2W15A 1MMPA 1QJIA 5B5PA 2O3EA 3TS4A 3L0VA 3LQBA 4WKEA 2D1NA 3LILA 3LIKA 1HFCA 2AIGP 456CA 1BKCA 1Y0VA 3LJGA 1A86A 3NX7A 1JH1A 2V4BA 3N2VA 1DTHA 2JSDA 4WF6A 3LEAA 1CGEA 1ZXVA 2D1OA 966CA 5LABA 1K7QA 1R55A 2OY4A 1GE6A 4PKQA 3SHIA 3LE9A 2OW1A 1KUGA 2Y6DA 4PKWA 1D8MA 2AYKA 1HOVA 2SRTA 1I73A 1MMQA 1KUKA 5I0LA 3RTTA 3KEKA 2N8RA 3LJZA 4L6TA 1FLSA 2J0TA 1GKCA 4ZR5A 1FBLA 1OMJA 4ILWD 3DL1A 4FVLA 4A7BA 1JIZA 5I12A 3TVCA 3UVCA 1QICA 1SRPA 2CLTA 2OW9A 4PKRA 1JJ9A 1BUDA 3HY7A 3OHOA 4EFSA 2A8HA 3ELMA 1SLMA 5D7WA 1MMBA 2DDYA 3L0TA 2YB9A 3ZVSA 4IUWA 3TT4A 4FU4A 1D7XA 4H2EA 1KBCA 2FV9A 1J7NA 2X3CA 4GR3A 1XFUA 4FXYP 1RMZA 3KMEA 5CXAA 1BKCE 1IAAA 1QIBA 3I7GA 1C8TA 1OS2A 5I3MA 1G49A 1ZS0A 3LUNA 1G05A 3WV1A 1XFVA 3DNGA 4DPEA 1EAKA 1USNA 3E8RA 3KMCA 2OXUA 3K7NA 1R1JA 1QIAA 3DPEA 3EHXA 4XM8A 1L6JA 1D8FA 4AXQA 1D5JA 4PKSA 2TCLA 3ZXHA 4DF9A 3TSKA 4J4MA 3EDGA 4GWNA 4JP4A 5I2ZA 3WV2A 1HTDA 3K7LA 1JAOA 1S4BP 3F16A 3HY9A 4L63A 1EB6A 3U1RA 1JAPA 2XS4A 1ND1A 3F1AA 5D3CA 5D1SA 1PWQA 2E3XA 3EDIA 4H30A 2PJTA 4GF1A 1K7GA 2MZEA 4PKUA 1ROSA 4JPAA 1GE5A 2J83A 4XM6A 1PWVA 2JIHA 2OVZA 3EDZA 3GBOA 1UTZA 3HDBA 2JT5A 4IJOA 3F18A 5D2BA 4I35A 2WO9A 2W13A 1DMTA 3F19A 1JANA 1BQQM 2OXZA 4L19A 2W0DA 4H3XA 3HBUP 830CA 2RJQA 1JIWP 3OHLA 1G12A 3AYKA 2DW1A 4H82A 3F17A 4AIGA 1H71P 1B8YA 1XUDA 3KEJA 5H8XA 2POJA 3KHIA 1R1IA 3EWJA 3P24A 2L0RA 4CTHA 1SU3A 1GO7P 3G5CA 4GWMA 1IABA 1Q3AA 4QKZA 5L7FA 2RJPA 3LK8A 1BM6A 5BPAA 3Q2HA 3B2ZA 3ZUKA 1R54A 4JA1A 3AYUA 4GR8A 1XFXA 1MMRA 1OS9A 1UMSA 2OVXA 1QUAA 1CK7A 2OXWA 1BUVM 1UTTA 1I1IP 1O0QA 5B5OA 1XUCA 1ATLA 4XM7A 2X3BA 1YOUA 4GQLA 1GXDA 4H84A 3KRYA 3MA2A 1GE7A 4DD8A 5BOTA 3KWVC 2W14A 2Z2DA 1RM8A 1G9KA 1ZXCA 4R3VA 5L79A 4H49A 1CGFA 5I4OA 5CZMA 3BA0A 1KUHA 1OM8A 3LKAA 5D1TA 4Q1LA 1HFSA 4WKIA 1CGLA 1ZVXA 2ERQA 1FM1A 1JAQA 1HY7A 2X7MA 1K7IA 1IAEA 1PWPA 1YCMA 4I03A
chains in the Genus database with same CATH superfamily
1A85A 1CXVA 3B8ZA 1AF0A 1EUBA 1MNCA 3Q2GA 2KRJA 2DW0A 4WK7A 1QJJA 3VI1A 4GR0A 1IADA 1JK3A 1UEAA 2XS3A 3DPFA 1IAGA 3P1VA 1C7KA 2E2DA 1IACA 1OM7A 1XFZA 2MZIA 1PWUA 1KAPP 1PWWA 4XBHA 2OW2A 2USNA 1Y93A 1KUFA 1CIZA 3G42A 3F15A 1OM6A 1BZSA 2EROA 4WZVA 4IN9A 4G0DA 4JQGA 1OO9A 5D1UA 2JT6A 2OI0A 1SMPA 1YQYA 2CKIA 3USNA 1AYKA 1XFYA 1C3IA 4DV8A 1BQOA 2WO8A 1UMTA 1ZTQA 3RTSA 1B3DA 3B92A 5I43A 5JMYA 3O64A 4AUOA 1O0TA 2MZHA 4FXQA 3DWBA 1CAQA 3I7IA 1BKCI 2FV5A 1GO8P 2O36A 1CQRA 1SATA 3EHYA 5BOYA 3LUMA 4H1QA 3HDAP 3AIGA 2DW2A 3HBVP 1XURA 4AYKA 3VTGA 2MLRA 2X3AA 4ON1A 1KUIA 1Z3JA 1HV5A 1ASTA 4HMAA 5CUHA 2OY2A 3HB2P 4GUYA 3DSLA 1WNIA 3N2UA 1OZ9A 2WOAA 1JKYA 1G4KA 4XCTA 2W12A 4PKTA 1BSWA 2QPJA 3HYGA 2OZRA 4PKVA 1XM5A 1Y8JA 1R1HA 4A3WA 2DDFA 1AKLA 1YP1A 2I47A 2Y6CA 3V96B 1SLNA 2K2GA 2JNPA 2ERPA 3LJTA 2K9CA 2MLSA 3KECA 3LQ0A 1BIWA 2OW0A 2HU6A 3LIRA 3DTKA 3WV3A 3O2XA 4H76A 3EDHA 4G9LA 4JIJA 4HX3A 2YIGA 1GKDA 3LMCA 3CKIA 1XAXA 1ZP5A 3LGPA 1I76A 1XFWA 2W15A 1MMPA 1QJIA 5B5PA 2O3EA 3TS4A 3L0VA 3LQBA 4WKEA 2D1NA 3LILA 3LIKA 1HFCA 2AIGP 456CA 1BKCA 1Y0VA 3LJGA 1A86A 3NX7A 1JH1A 2V4BA 4L7AA 3N2VA 1DTHA 2JSDA 4WF6A 3LEAA 1CGEA 1ZXVA 2D1OA 966CA 5LABA 1K7QA 1R55A 2OY4A 1GE6A 4PKQA 3SHIA 3LE9A 2OW1A 1KUGA 2Y6DA 4PKWA 1D8MA 2AYKA 1HOVA 2SRTA 1I73A 1MMQA 1KUKA 5I0LA 3RTTA 3KEKA 2N8RA 3LJZA 4L6TA 1FLSA 2J0TA 1GKCA 4ZR5A 1FBLA 1OMJA 4ILWD 3DL1A 4FVLA 4A7BA 1JIZA 5I12A 3TVCA 3UVCA 1QICA 1SRPA 2CLTA 2OW9A 4PKRA 1JJ9A 1BUDA 3HY7A 3OHOA 4EFSA 2A8HA 3ELMA 1SLMA 5D7WA 1MMBA 2DDYA 3L0TA 2YB9A 3ZVSA 4IUWA 3TT4A 4FU4A 1D7XA 4H2EA 1KBCA 2FV9A 1J7NA 2X3CA 4GR3A 1XFUA 4FXYP 1RMZA 3KMEA 5CXAA 1BKCE 1IAAA 1QIBA 3I7GA 1C8TA 1OS2A 5I3MA 1G49A 1ZS0A 3LUNA 1G05A 3WV1A 1XFVA 3DNGA 3DTIA 4DPEA 1EAKA 1USNA 3E8RA 3KMCA 2OXUA 3K7NA 1R1JA 1QIAA 3DPEA 3EHXA 4XM8A 1L6JA 1D8FA 4AXQA 1D5JA 4PKSA 2TCLA 3ZXHA 4DF9A 3TSKA 4J4MA 3EDGA 4GWNA 4JP4A 5I2ZA 3WV2A 1HTDA 3K7LA 1JAOA 1S4BP 3F16A 3HY9A 4L63A 1TVIA 1EB6A 3U1RA 1JAPA 2XS4A 1ND1A 3F1AA 5D3CA 5D1SA 1PWQA 2E3XA 3EDIA 4H30A 2PJTA 4GF1A 1K7GA 2MZEA 4PKUA 1ROSA 4JPAA 1GE5A 2J83A 4XM6A 1PWVA 2JIHA 2OVZA 3EDZA 3GBOA 1UTZA 3HDBA 2JT5A 4IJOA 3F18A 5D2BA 4I35A 2WO9A 2W13A 1DMTA 3F19A 1JANA 1BQQM 2OXZA 4L19A 2W0DA 4H3XA 3HBUP 830CA 2RJQA 1JIWP 3OHLA 1G12A 3AYKA 2DW1A 4H82A 3F17A 4AIGA 1H71P 1B8YA 1XUDA 3KEJA 5H8XA 2POJA 3KHIA 1R1IA 3EWJA 3P24A 2L0RA 4CTHA 1SU3A 1GO7P 3G5CA 4GWMA 3DTEA 1IABA 1Q3AA 4QKZA 5L7FA 2RJPA 3LK8A 1BM6A 5BPAA 3Q2HA 3B2ZA 3ZUKA 1R54A 4JA1A 3AYUA 4GR8A 1XFXA 1MMRA 1OS9A 1UMSA 2OVXA 1QUAA 1CK7A 2OXWA 1BUVM 1UTTA 1I1IP 1O0QA 5B5OA 1XUCA 1ATLA 4XM7A 2X3BA 1YOUA 4GQLA 1GXDA 4H84A 3KRYA 3MA2A 1GE7A 4DD8A 5BOTA 3KWVC 2W14A 2Z2DA 1RM8A 1G9KA 1ZXCA 4R3VA 5L79A 2YUFA 4H49A 1CGFA 5I4OA 5CZMA 3BA0A 1KUHA 1OM8A 3LKAA 5D1TA 4Q1LA 1HFSA 4WKIA 1CGLA 1ZVXA 2ERQA 1FM1A 1JAQA 1HY7A 2X7MA 1K7IA 1IAEA 1PWPA 1YCMA 4I03A
chains in the Genus database with same CATH topology
1A85A 1CXVA 3B8ZA 1AF0A 1EUBA 1MNCA 3Q2GA 2KRJA 2DW0A 4WK7A 1QJJA 3VI1A 4GR0A 1IADA 1JK3A 1UEAA 2XS3A 3DPFA 1IAGA 3P1VA 1C7KA 2E2DA 1IACA 1OM7A 1XFZA 2MZIA 1PWUA 1KAPP 1PWWA 4XBHA 2OW2A 2USNA 1Y93A 1KUFA 1CIZA 3G42A 3F15A 1OM6A 1BZSA 2EROA 4WZVA 4IN9A 4G0DA 4JQGA 1OO9A 5D1UA 2JT6A 2OI0A 1SMPA 1YQYA 2CKIA 3USNA 1AYKA 1XFYA 1C3IA 4DV8A 1BQOA 2WO8A 1UMTA 1ZTQA 3RTSA 1B3DA 3B92A 5I43A 5JMYA 3O64A 4AUOA 1O0TA 2MZHA 4FXQA 3DWBA 1CAQA 3I7IA 1BKCI 2FV5A 1GO8P 2O36A 1CQRA 1SATA 3EHYA 5BOYA 3LUMA 4H1QA 3HDAP 3AIGA 2DW2A 3HBVP 1XURA 4AYKA 3VTGA 2MLRA 2X3AA 4ON1A 1KUIA 1Z3JA 1HV5A 1ASTA 4HMAA 5CUHA 2OY2A 3HB2P 4GUYA 3DSLA 1WNIA 3N2UA 2WOAA 1JKYA 1G4KA 4XCTA 2W12A 4PKTA 1BSWA 2QPJA 3HYGA 2OZRA 4PKVA 1Y8JA 1R1HA 4A3WA 2DDFA 1AKLA 1YP1A 2I47A 2Y6CA 3V96B 1SLNA 2K2GA 2JNPA 2ERPA 3LJTA 2K9CA 2MLSA 3KECA 3LQ0A 1BIWA 2OW0A 2HU6A 3LIRA 3DTKA 3WV3A 3O2XA 4H76A 3EDHA 4G9LA 4JIJA 4HX3A 2YIGA 1GKDA 3LMCA 3CKIA 1ZP5A 3LGPA 1I76A 1XFWA 2W15A 1MMPA 1QJIA 5B5PA 2O3EA 3TS4A 3L0VA 3LQBA 4WKEA 2D1NA 3LILA 3LIKA 1HFCA 2AIGP 456CA 1BKCA 1Y0VA 3LJGA 1A86A 3NX7A 1JH1A 2V4BA 4L7AA 3N2VA 1DTHA 2JSDA 4WF6A 3LEAA 1CGEA 1ZXVA 2D1OA 966CA 5LABA 1K7QA 1R55A 2OY4A 1GE6A 4PKQA 3SHIA 3LE9A 2OW1A 1KUGA 2Y6DA 4PKWA 1D8MA 2AYKA 1HOVA 2SRTA 1I73A 1MMQA 1KUKA 5I0LA 3RTTA 3KEKA 2N8RA 3LJZA 4L6TA 1FLSA 2J0TA 1GKCA 4ZR5A 1FBLA 1OMJA 4ILWD 3DL1A 4FVLA 4A7BA 1JIZA 5I12A 3TVCA 3UVCA 1QICA 1SRPA 2CLTA 2OW9A 4PKRA 1JJ9A 1BUDA 3HY7A 3OHOA 4EFSA 2A8HA 3ELMA 1SLMA 5D7WA 1MMBA 2DDYA 3L0TA 2YB9A 3ZVSA 4IUWA 3TT4A 4FU4A 1D7XA 4H2EA 1KBCA 2FV9A 1J7NA 2X3CA 4GR3A 1XFUA 4FXYP 1RMZA 3KMEA 5CXAA 1BKCE 1IAAA 1QIBA 3I7GA 1C8TA 1OS2A 5I3MA 1G49A 1ZS0A 3LUNA 1G05A 3WV1A 1XFVA 3DNGA 3DTIA 4DPEA 1EAKA 1USNA 3E8RA 3KMCA 2OXUA 3K7NA 1R1JA 1QIAA 3DPEA 3EHXA 4XM8A 1L6JA 1D8FA 4AXQA 1D5JA 4PKSA 2TCLA 3ZXHA 4DF9A 3TSKA 4J4MA 3EDGA 4GWNA 4JP4A 5I2ZA 3WV2A 1HTDA 3K7LA 1JAOA 1S4BP 3F16A 3HY9A 4L63A 1EB6A 3U1RA 1JAPA 2XS4A 1ND1A 3F1AA 5D3CA 5D1SA 1PWQA 2E3XA 3EDIA 4H30A 2PJTA 4GF1A 1K7GA 2MZEA 4PKUA 1ROSA 4JPAA 1GE5A 2J83A 4XM6A 1PWVA 2JIHA 2OVZA 3EDZA 3GBOA 1UTZA 3HDBA 2JT5A 4IJOA 3F18A 5D2BA 4I35A 2WO9A 2W13A 1DMTA 3F19A 1JANA 1BQQM 2OXZA 4L19A 2W0DA 4H3XA 3HBUP 830CA 2RJQA 1JIWP 3OHLA 1G12A 3AYKA 2DW1A 4H82A 3F17A 4AIGA 1H71P 1B8YA 1XUDA 3KEJA 5H8XA 2POJA 3KHIA 1R1IA 3EWJA 3P24A 2L0RA 4CTHA 1SU3A 1GO7P 3G5CA 4GWMA 3DTEA 1IABA 1Q3AA 4QKZA 5L7FA 2RJPA 3LK8A 1BM6A 5BPAA 3Q2HA 3B2ZA 3ZUKA 1R54A 4JA1A 3AYUA 4GR8A 1XFXA 1MMRA 1OS9A 1UMSA 2OVXA 1QUAA 1CK7A 2OXWA 1BUVM 1UTTA 1I1IP 1O0QA 5B5OA 1XUCA 1ATLA 4XM7A 2X3BA 1YOUA 4GQLA 1GXDA 4H84A 3KRYA 3MA2A 1GE7A 4DD8A 5BOTA 3KWVC 2W14A 2Z2DA 1RM8A 1G9KA 1ZXCA 4R3VA 5L79A 2YUFA 4H49A 1CGFA 5I4OA 5CZMA 3BA0A 1KUHA 1OM8A 3LKAA 5D1TA 4Q1LA 1HFSA 4WKIA 1CGLA 1ZVXA 2ERQA 1FM1A 1JAQA 1HY7A 2X7MA 1K7IA 1IAEA 1PWPA 1YCMA 4I03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A85 A;  1CXV A;  3B8Z A;  1AF0 A;  1EUB A;  1MNC A;  3Q2G A;  2KRJ A;  2DW0 A;  4WK7 A;  1QJJ A;  3VI1 A;  4GR0 A;  1IAD A;  1JK3 A;  1UEA A;  2XS3 A;  3DPF A;  1IAG A;  3P1V A;  1C7K A;  2E2D A;  1IAC A;  1OM7 A;  1XFZ A;  2MZI A;  1PWU A;  1KAP P;  1PWW A;  4XBH A;  2OW2 A;  2USN A;  1Y93 A;  1KUF A;  1CIZ A;  3G42 A;  3F15 A;  1OM6 A;  1BZS A;  2ERO A;  4WZV A;  4IN9 A;  4G0D A;  4JQG A;  1OO9 A;  5D1U A;  2JT6 A;  2OI0 A;  1SMP A;  1YQY A;  2CKI A;  3USN A;  1AYK A;  1XFY A;  1C3I A;  4DV8 A;  1BQO A;  2WO8 A;  1UMT A;  1ZTQ A;  3RTS A;  1B3D A;  3B92 A;  5I43 A;  5JMY A;  3O64 A;  4AUO A;  1O0T A;  2MZH A;  4FXQ A;  3DWB A;  1CAQ A;  3I7I A;  1BKC I;  2FV5 A;  1GO8 P;  2O36 A;  1CQR A;  1SAT A;  3EHY A;  5BOY A;  3LUM A;  4H1Q A;  3HDA P;  3AIG A;  2DW2 A;  3HBV P;  1XUR A;  4AYK A;  3VTG A;  2MLR A;  2X3A A;  4ON1 A;  1KUI A;  1Z3J A;  1HV5 A;  1AST A;  4HMA A;  5CUH A;  2OY2 A;  3HB2 P;  4GUY A;  3DSL A;  1WNI A;  3N2U A;  2WOA A;  1JKY A;  1G4K A;  4XCT A;  2W12 A;  4PKT A;  1BSW A;  2QPJ A;  3HYG A;  2OZR A;  4PKV A;  1Y8J A;  1R1H A;  4A3W A;  2DDF A;  1AKL A;  1YP1 A;  2I47 A;  2Y6C A;  3V96 B;  1SLN A;  2K2G A;  2JNP A;  2ERP A;  3LJT A;  2K9C A;  2MLS A;  3KEC A;  3LQ0 A;  1BIW A;  2OW0 A;  2HU6 A;  3LIR A;  3WV3 A;  3O2X A;  4H76 A;  3EDH A;  4G9L A;  4JIJ A;  4HX3 A;  2YIG A;  1GKD A;  3LMC A;  3CKI A;  1ZP5 A;  3LGP A;  1I76 A;  1XFW A;  2W15 A;  1MMP A;  1QJI A;  5B5P A;  2O3E A;  3TS4 A;  3L0V A;  3LQB A;  4WKE A;  2D1N A;  3LIL A;  3LIK A;  1HFC A;  2AIG P;  456C A;  1BKC A;  1Y0V A;  3LJG A;  1A86 A;  3NX7 A;  1JH1 A;  2V4B A;  3N2V A;  1DTH A;  2JSD A;  4WF6 A;  3LEA A;  1CGE A;  1ZXV A;  2D1O A;  966C A;  5LAB A;  1K7Q A;  1R55 A;  2OY4 A;  1GE6 A;  4PKQ A;  3SHI A;  3LE9 A;  2OW1 A;  1KUG A;  2Y6D A;  4PKW A;  1D8M A;  2AYK A;  1HOV A;  2SRT A;  1I73 A;  1MMQ A;  1KUK A;  5I0L A;  3RTT A;  3KEK A;  2N8R A;  3LJZ A;  4L6T A;  1FLS A;  2J0T A;  1GKC A;  4ZR5 A;  1FBL A;  1OMJ A;  4ILW D;  3DL1 A;  4FVL A;  4A7B A;  1JIZ A;  5I12 A;  3TVC A;  3UVC A;  1QIC A;  1SRP A;  2CLT A;  2OW9 A;  4PKR A;  1JJ9 A;  1BUD A;  3HY7 A;  3OHO A;  4EFS A;  2A8H A;  3ELM A;  1SLM A;  5D7W A;  1MMB A;  2DDY A;  3L0T A;  2YB9 A;  3ZVS A;  4IUW A;  3TT4 A;  4FU4 A;  1D7X A;  4H2E A;  1KBC A;  2FV9 A;  1J7N A;  2X3C A;  4GR3 A;  1XFU A;  4FXY P;  1RMZ A;  3KME A;  5CXA A;  1BKC E;  1IAA A;  1QIB A;  3I7G A;  1C8T A;  1OS2 A;  5I3M A;  1G49 A;  1ZS0 A;  3LUN A;  1G05 A;  3WV1 A;  1XFV A;  3DNG A;  4DPE A;  1EAK A;  1USN A;  3E8R A;  3KMC A;  2OXU A;  3K7N A;  1R1J A;  1QIA A;  3DPE A;  3EHX A;  4XM8 A;  1L6J A;  1D8F A;  4AXQ A;  1D5J A;  4PKS A;  2TCL A;  3ZXH A;  4DF9 A;  3TSK A;  4J4M A;  3EDG A;  4GWN A;  4JP4 A;  5I2Z A;  3WV2 A;  1HTD A;  3K7L A;  1JAO A;  1S4B P;  3F16 A;  3HY9 A;  4L63 A;  1EB6 A;  3U1R A;  1JAP A;  2XS4 A;  1ND1 A;  3F1A A;  5D3C A;  5D1S A;  1PWQ A;  2E3X A;  3EDI A;  4H30 A;  2PJT A;  4GF1 A;  1K7G A;  2MZE A;  4PKU A;  1ROS A;  4JPA A;  1GE5 A;  2J83 A;  4XM6 A;  1PWV A;  2JIH A;  2OVZ A;  3EDZ A;  3GBO A;  1UTZ A;  3HDB A;  2JT5 A;  4IJO A;  3F18 A;  5D2B A;  4I35 A;  2WO9 A;  2W13 A;  1DMT A;  3F19 A;  1JAN A;  1BQQ M;  2OXZ A;  4L19 A;  2W0D A;  4H3X A;  3HBU P;  830C A;  2RJQ A;  1JIW P;  3OHL A;  1G12 A;  3AYK A;  2DW1 A;  4H82 A;  3F17 A;  4AIG A;  1H71 P;  1B8Y A;  1XUD A;  3KEJ A;  5H8X A;  2POJ A;  3KHI A;  1R1I A;  3EWJ A;  3P24 A;  2L0R A;  4CTH A;  1SU3 A;  1GO7 P;  3G5C A;  4GWM A;  1IAB A;  1Q3A A;  4QKZ A;  5L7F A;  2RJP A;  3LK8 A;  1BM6 A;  5BPA A;  3Q2H A;  3B2Z A;  3ZUK A;  1R54 A;  4JA1 A;  3AYU A;  4GR8 A;  1XFX A;  1MMR A;  1OS9 A;  1UMS A;  2OVX A;  1QUA A;  1CK7 A;  2OXW A;  1BUV M;  1UTT A;  1I1I P;  1O0Q A;  5B5O A;  1XUC A;  1ATL A;  4XM7 A;  2X3B A;  1YOU A;  4GQL A;  1GXD A;  4H84 A;  3KRY A;  3MA2 A;  1GE7 A;  4DD8 A;  5BOT A;  3KWV C;  2W14 A;  2Z2D A;  1RM8 A;  1G9K A;  1ZXC A;  4R3V A;  5L79 A;  4H49 A;  1CGF A;  5I4O A;  5CZM A;  3BA0 A;  1KUH A;  1OM8 A;  3LKA A;  5D1T A;  4Q1L A;  1HFS A;  4WKI A;  1CGL A;  1ZVX A;  2ERQ A;  1FM1 A;  1JAQ A;  1HY7 A;  2X7M A;  1K7I A;  1IAE A;  1PWP A;  1YCM A;  4I03 A; 
#chains in the Genus database with same CATH topology
 1A85 A;  1CXV A;  3B8Z A;  1AF0 A;  1EUB A;  1MNC A;  3Q2G A;  2KRJ A;  2DW0 A;  4WK7 A;  1QJJ A;  3VI1 A;  4GR0 A;  1IAD A;  1JK3 A;  1UEA A;  2XS3 A;  3DPF A;  1IAG A;  3P1V A;  1C7K A;  2E2D A;  1IAC A;  1OM7 A;  1XFZ A;  2MZI A;  1PWU A;  1KAP P;  1PWW A;  4XBH A;  2OW2 A;  2USN A;  1Y93 A;  1KUF A;  1CIZ A;  3G42 A;  3F15 A;  1OM6 A;  1BZS A;  2ERO A;  4WZV A;  4IN9 A;  4G0D A;  4JQG A;  1OO9 A;  5D1U A;  2JT6 A;  2OI0 A;  1SMP A;  1YQY A;  2CKI A;  3USN A;  1AYK A;  1XFY A;  1C3I A;  4DV8 A;  1BQO A;  2WO8 A;  1UMT A;  1ZTQ A;  3RTS A;  1B3D A;  3B92 A;  5I43 A;  5JMY A;  3O64 A;  4AUO A;  1O0T A;  2MZH A;  4FXQ A;  3DWB A;  1CAQ A;  3I7I A;  1BKC I;  2FV5 A;  1GO8 P;  2O36 A;  1CQR A;  1SAT A;  3EHY A;  5BOY A;  3LUM A;  4H1Q A;  3HDA P;  3AIG A;  2DW2 A;  3HBV P;  1XUR A;  4AYK A;  3VTG A;  2MLR A;  2X3A A;  4ON1 A;  1KUI A;  1Z3J A;  1HV5 A;  1AST A;  4HMA A;  5CUH A;  2OY2 A;  3HB2 P;  4GUY A;  3DSL A;  1WNI A;  3N2U A;  1OZ9 A;  2WOA A;  1JKY A;  1G4K A;  4XCT A;  2W12 A;  4PKT A;  1BSW A;  2QPJ A;  3HYG A;  2OZR A;  4PKV A;  1XM5 A;  1Y8J A;  1R1H A;  4A3W A;  2DDF A;  1AKL A;  1YP1 A;  2I47 A;  2Y6C A;  3V96 B;  1SLN A;  2K2G A;  2JNP A;  2ERP A;  3LJT A;  2K9C A;  2MLS A;  3KEC A;  3LQ0 A;  1BIW A;  2OW0 A;  2HU6 A;  3LIR A;  3DTK A;  3WV3 A;  3O2X A;  4H76 A;  3EDH A;  4G9L A;  4JIJ A;  4HX3 A;  2YIG A;  1GKD A;  3LMC A;  3CKI A;  1XAX A;  1ZP5 A;  3LGP A;  1I76 A;  1XFW A;  2W15 A;  1MMP A;  1QJI A;  5B5P A;  2O3E A;  3TS4 A;  3L0V A;  3LQB A;  4WKE A;  2D1N A;  3LIL A;  3LIK A;  1HFC A;  2AIG P;  456C A;  1BKC A;  1Y0V A;  3LJG A;  1A86 A;  3NX7 A;  1JH1 A;  2V4B A;  4L7A A;  3N2V A;  1DTH A;  2JSD A;  4WF6 A;  3LEA A;  1CGE A;  1ZXV A;  2D1O A;  966C A;  5LAB A;  1K7Q A;  1R55 A;  2OY4 A;  1GE6 A;  4PKQ A;  3SHI A;  3LE9 A;  2OW1 A;  1KUG A;  2Y6D A;  4PKW A;  1D8M A;  2AYK A;  1HOV A;  2SRT A;  1I73 A;  1MMQ A;  1KUK A;  5I0L A;  3RTT A;  3KEK A;  2N8R A;  3LJZ A;  4L6T A;  1FLS A;  2J0T A;  1GKC A;  4ZR5 A;  1FBL A;  1OMJ A;  4ILW D;  3DL1 A;  4FVL A;  4A7B A;  1JIZ A;  5I12 A;  3TVC A;  3UVC A;  1QIC A;  1SRP A;  2CLT A;  2OW9 A;  4PKR A;  1JJ9 A;  1BUD A;  3HY7 A;  3OHO A;  4EFS A;  2A8H A;  3ELM A;  1SLM A;  5D7W A;  1MMB A;  2DDY A;  3L0T A;  2YB9 A;  3ZVS A;  4IUW A;  3TT4 A;  4FU4 A;  1D7X A;  4H2E A;  1KBC A;  2FV9 A;  1J7N A;  2X3C A;  4GR3 A;  1XFU A;  4FXY P;  1RMZ A;  3KME A;  5CXA A;  1BKC E;  1IAA A;  1QIB A;  3I7G A;  1C8T A;  1OS2 A;  5I3M A;  1G49 A;  1ZS0 A;  3LUN A;  1G05 A;  3WV1 A;  1XFV A;  3DNG A;  3DTI A;  4DPE A;  1EAK A;  1USN A;  3E8R A;  3KMC A;  2OXU A;  3K7N A;  1R1J A;  1QIA A;  3DPE A;  3EHX A;  4XM8 A;  1L6J A;  1D8F A;  4AXQ A;  1D5J A;  4PKS A;  2TCL A;  3ZXH A;  4DF9 A;  3TSK A;  4J4M A;  3EDG A;  4GWN A;  4JP4 A;  5I2Z A;  3WV2 A;  1HTD A;  3K7L A;  1JAO A;  1S4B P;  3F16 A;  3HY9 A;  4L63 A;  1TVI A;  1EB6 A;  3U1R A;  1JAP A;  2XS4 A;  1ND1 A;  3F1A A;  5D3C A;  5D1S A;  1PWQ A;  2E3X A;  3EDI A;  4H30 A;  2PJT A;  4GF1 A;  1K7G A;  2MZE A;  4PKU A;  1ROS A;  4JPA A;  1GE5 A;  2J83 A;  4XM6 A;  1PWV A;  2JIH A;  2OVZ A;  3EDZ A;  3GBO A;  1UTZ A;  3HDB A;  2JT5 A;  4IJO A;  3F18 A;  5D2B A;  4I35 A;  2WO9 A;  2W13 A;  1DMT A;  3F19 A;  1JAN A;  1BQQ M;  2OXZ A;  4L19 A;  2W0D A;  4H3X A;  3HBU P;  830C A;  2RJQ A;  1JIW P;  3OHL A;  1G12 A;  3AYK A;  2DW1 A;  4H82 A;  3F17 A;  4AIG A;  1H71 P;  1B8Y A;  1XUD A;  3KEJ A;  5H8X A;  2POJ A;  3KHI A;  1R1I A;  3EWJ A;  3P24 A;  2L0R A;  4CTH A;  1SU3 A;  1GO7 P;  3G5C A;  4GWM A;  3DTE A;  1IAB A;  1Q3A A;  4QKZ A;  5L7F A;  2RJP A;  3LK8 A;  1BM6 A;  5BPA A;  3Q2H A;  3B2Z A;  3ZUK A;  1R54 A;  4JA1 A;  3AYU A;  4GR8 A;  1XFX A;  1MMR A;  1OS9 A;  1UMS A;  2OVX A;  1QUA A;  1CK7 A;  2OXW A;  1BUV M;  1UTT A;  1I1I P;  1O0Q A;  5B5O A;  1XUC A;  1ATL A;  4XM7 A;  2X3B A;  1YOU A;  4GQL A;  1GXD A;  4H84 A;  3KRY A;  3MA2 A;  1GE7 A;  4DD8 A;  5BOT A;  3KWV C;  2W14 A;  2Z2D A;  1RM8 A;  1G9K A;  1ZXC A;  4R3V A;  5L79 A;  2YUF A;  4H49 A;  1CGF A;  5I4O A;  5CZM A;  3BA0 A;  1KUH A;  1OM8 A;  3LKA A;  5D1T A;  4Q1L A;  1HFS A;  4WKI A;  1CGL A;  1ZVX A;  2ERQ A;  1FM1 A;  1JAQ A;  1HY7 A;  2X7M A;  1K7I A;  1IAE A;  1PWP A;  1YCM A;  4I03 A; 
#chains in the Genus database with same CATH homology
 1A85 A;  1CXV A;  3B8Z A;  1AF0 A;  1EUB A;  1MNC A;  3Q2G A;  2KRJ A;  2DW0 A;  4WK7 A;  1QJJ A;  3VI1 A;  4GR0 A;  1IAD A;  1JK3 A;  1UEA A;  2XS3 A;  3DPF A;  1IAG A;  3P1V A;  1C7K A;  2E2D A;  1IAC A;  1OM7 A;  1XFZ A;  2MZI A;  1PWU A;  1KAP P;  1PWW A;  4XBH A;  2OW2 A;  2USN A;  1Y93 A;  1KUF A;  1CIZ A;  3G42 A;  3F15 A;  1OM6 A;  1BZS A;  2ERO A;  4WZV A;  4IN9 A;  4G0D A;  4JQG A;  1OO9 A;  5D1U A;  2JT6 A;  2OI0 A;  1SMP A;  1YQY A;  2CKI A;  3USN A;  1AYK A;  1XFY A;  1C3I A;  4DV8 A;  1BQO A;  2WO8 A;  1UMT A;  1ZTQ A;  3RTS A;  1B3D A;  3B92 A;  5I43 A;  5JMY A;  3O64 A;  4AUO A;  1O0T A;  2MZH A;  4FXQ A;  3DWB A;  1CAQ A;  3I7I A;  1BKC I;  2FV5 A;  1GO8 P;  2O36 A;  1CQR A;  1SAT A;  3EHY A;  5BOY A;  3LUM A;  4H1Q A;  3HDA P;  3AIG A;  2DW2 A;  3HBV P;  1XUR A;  4AYK A;  3VTG A;  2MLR A;  2X3A A;  4ON1 A;  1KUI A;  1Z3J A;  1HV5 A;  1AST A;  4HMA A;  5CUH A;  2OY2 A;  3HB2 P;  4GUY A;  3DSL A;  1WNI A;  3N2U A;  2WOA A;  1JKY A;  1G4K A;  4XCT A;  2W12 A;  4PKT A;  1BSW A;  2QPJ A;  3HYG A;  2OZR A;  4PKV A;  1Y8J A;  1R1H A;  4A3W A;  2DDF A;  1AKL A;  1YP1 A;  2I47 A;  2Y6C A;  3V96 B;  1SLN A;  2K2G A;  2JNP A;  2ERP A;  3LJT A;  2K9C A;  2MLS A;  3KEC A;  3LQ0 A;  1BIW A;  2OW0 A;  2HU6 A;  3LIR A;  3DTK A;  3WV3 A;  3O2X A;  4H76 A;  3EDH A;  4G9L A;  4JIJ A;  4HX3 A;  2YIG A;  1GKD A;  3LMC A;  3CKI A;  1ZP5 A;  3LGP A;  1I76 A;  1XFW A;  2W15 A;  1MMP A;  1QJI A;  5B5P A;  2O3E A;  3TS4 A;  3L0V A;  3LQB A;  4WKE A;  2D1N A;  3LIL A;  3LIK A;  1HFC A;  2AIG P;  456C A;  1BKC A;  1Y0V A;  3LJG A;  1A86 A;  3NX7 A;  1JH1 A;  2V4B A;  4L7A A;  3N2V A;  1DTH A;  2JSD A;  4WF6 A;  3LEA A;  1CGE A;  1ZXV A;  2D1O A;  966C A;  5LAB A;  1K7Q A;  1R55 A;  2OY4 A;  1GE6 A;  4PKQ A;  3SHI A;  3LE9 A;  2OW1 A;  1KUG A;  2Y6D A;  4PKW A;  1D8M A;  2AYK A;  1HOV A;  2SRT A;  1I73 A;  1MMQ A;  1KUK A;  5I0L A;  3RTT A;  3KEK A;  2N8R A;  3LJZ A;  4L6T A;  1FLS A;  2J0T A;  1GKC A;  4ZR5 A;  1FBL A;  1OMJ A;  4ILW D;  3DL1 A;  4FVL A;  4A7B A;  1JIZ A;  5I12 A;  3TVC A;  3UVC A;  1QIC A;  1SRP A;  2CLT A;  2OW9 A;  4PKR A;  1JJ9 A;  1BUD A;  3HY7 A;  3OHO A;  4EFS A;  2A8H A;  3ELM A;  1SLM A;  5D7W A;  1MMB A;  2DDY A;  3L0T A;  2YB9 A;  3ZVS A;  4IUW A;  3TT4 A;  4FU4 A;  1D7X A;  4H2E A;  1KBC A;  2FV9 A;  1J7N A;  2X3C A;  4GR3 A;  1XFU A;  4FXY P;  1RMZ A;  3KME A;  5CXA A;  1BKC E;  1IAA A;  1QIB A;  3I7G A;  1C8T A;  1OS2 A;  5I3M A;  1G49 A;  1ZS0 A;  3LUN A;  1G05 A;  3WV1 A;  1XFV A;  3DNG A;  3DTI A;  4DPE A;  1EAK A;  1USN A;  3E8R A;  3KMC A;  2OXU A;  3K7N A;  1R1J A;  1QIA A;  3DPE A;  3EHX A;  4XM8 A;  1L6J A;  1D8F A;  4AXQ A;  1D5J A;  4PKS A;  2TCL A;  3ZXH A;  4DF9 A;  3TSK A;  4J4M A;  3EDG A;  4GWN A;  4JP4 A;  5I2Z A;  3WV2 A;  1HTD A;  3K7L A;  1JAO A;  1S4B P;  3F16 A;  3HY9 A;  4L63 A;  1EB6 A;  3U1R A;  1JAP A;  2XS4 A;  1ND1 A;  3F1A A;  5D3C A;  5D1S A;  1PWQ A;  2E3X A;  3EDI A;  4H30 A;  2PJT A;  4GF1 A;  1K7G A;  2MZE A;  4PKU A;  1ROS A;  4JPA A;  1GE5 A;  2J83 A;  4XM6 A;  1PWV A;  2JIH A;  2OVZ A;  3EDZ A;  3GBO A;  1UTZ A;  3HDB A;  2JT5 A;  4IJO A;  3F18 A;  5D2B A;  4I35 A;  2WO9 A;  2W13 A;  1DMT A;  3F19 A;  1JAN A;  1BQQ M;  2OXZ A;  4L19 A;  2W0D A;  4H3X A;  3HBU P;  830C A;  2RJQ A;  1JIW P;  3OHL A;  1G12 A;  3AYK A;  2DW1 A;  4H82 A;  3F17 A;  4AIG A;  1H71 P;  1B8Y A;  1XUD A;  3KEJ A;  5H8X A;  2POJ A;  3KHI A;  1R1I A;  3EWJ A;  3P24 A;  2L0R A;  4CTH A;  1SU3 A;  1GO7 P;  3G5C A;  4GWM A;  3DTE A;  1IAB A;  1Q3A A;  4QKZ A;  5L7F A;  2RJP A;  3LK8 A;  1BM6 A;  5BPA A;  3Q2H A;  3B2Z A;  3ZUK A;  1R54 A;  4JA1 A;  3AYU A;  4GR8 A;  1XFX A;  1MMR A;  1OS9 A;  1UMS A;  2OVX A;  1QUA A;  1CK7 A;  2OXW A;  1BUV M;  1UTT A;  1I1I P;  1O0Q A;  5B5O A;  1XUC A;  1ATL A;  4XM7 A;  2X3B A;  1YOU A;  4GQL A;  1GXD A;  4H84 A;  3KRY A;  3MA2 A;  1GE7 A;  4DD8 A;  5BOT A;  3KWV C;  2W14 A;  2Z2D A;  1RM8 A;  1G9K A;  1ZXC A;  4R3V A;  5L79 A;  2YUF A;  4H49 A;  1CGF A;  5I4O A;  5CZM A;  3BA0 A;  1KUH A;  1OM8 A;  3LKA A;  5D1T A;  4Q1L A;  1HFS A;  4WKI A;  1CGL A;  1ZVX A;  2ERQ A;  1FM1 A;  1JAQ A;  1HY7 A;  2X7M A;  1K7I A;  1IAE A;  1PWP A;  1YCM A;  4I03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...