3WVDB

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 50 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3wvdB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3wvdB02
2PVDB 3X24B 2DD4B 3QXEB 3QYHB 3A8LB 3HHTB 4Y28E 3A8OB 4OB3B 4RKUE 2DD5A 3QYGB 3VYGB 4FM4B 2DD5B 2PUOB 3A8GB 2DPPB 3A8MB 1UGPB 3LW5E 3X20B 3X28B 2DXCA 4KT0E 2CZ6B 1IREB 3WVDB 1UGSB 2ZPIB 2PVOB 3WVEB 2ZCFB 3VYHB 2ZPBB 4OB2B 2DD4A 2CZ0B 1AHJB 1QP3A 1PSEA 2CZ7B 2CZ1B 3X26B 5L8RE 3A8HB 1GXIE 1QP2A 1DJ7B 1JB0E 2CYZB 2ZZDA 2PUKB 2ZPFB 1PSFA 2O01E 1UGQB 4ZGDB 2WSFE 2ZZDB 3X25B 4L6V5 3QZ5B 4ZGEB 4ZGJB 3VYGA 2ZPHB 2DXBB 1V29B 2D0QB 2DXBA 2PVGB 2WSEE 4XK8E 3QZ9B 2ZPEB 2PU9B 2ZPGB 2DXCB 2QDYB 2AHJB 4OB1B 4OB0B 1UGRB 2WSCE
chains in the Genus database with same CATH superfamily
3SWNA 1QW1A 4IIMA 2MCNA 1OGUB 1S1NA 2F1LA 2YUPA 1ZQ1A 3JAME 1OIYB 4E6RA 3D7SB 3CCSA 2R5MA 1IGUA 4PJOE 4J8OA 5IHNA 1OU9A 5LJ5h 1UDLA 1KD1C 3FLGA 4XTZA 3PIOA 1M90R 3CCJT 5FRMA 3HRSA 4O6JA 3I56Q 1K73U 1FWZA 2O31A 1JKWA 2E6NA 1Q7YU 1UGPB 1VQ6Q 2Y4YA 4PFPA 4F14A 4HNVA 2RK2A 4F04B 1U8RA 4KRTA 3CPWA 1GRIA 1D1CA 3X28B 3TVTA 3GBQA 1C9BA 2RI2A 2GTJA 1H26B 3M0RA 2BPMB 3EFOB 1TWBA 1G3WA 2JTFA 4R0KA 3JCMb 5LL6S 5A2QE 1MV0B 2DRMA 2QF7A 3M55A 1QWFA 2BTTA 2KRMA 2DERA 3MEWA 2GCXA 4O5VA 5L8RE 2MYSA 3I5RA 2CYZB 3TSWA 1PD1A 1B3QA 2HBPA 2QG9B 2WXVB 1PM3A 5KCHA 4NL3A 1QLBA 1K8AR 2K7AA 2ZZDB 1ZBXA 4A63B 2SRCA 3L2QA 2BS4A 2X3XD 1HSQA 2CCHB 4Z8AA 4HCKA 4DEXA 1JO8A 3OYFA 1SF9A 2IPOB 2LCCA 2X51A 3EG1A 1GY3B 2WSEE 1KD1R 3DDPB 2O2OA 1M3BA 4LDUA 4IUPA 1G3SA 4J5YA 4X9CA 2C0TA 4RG8A 2JXBA 4BCIB 1UGRB 2KNBB 2OAWA 2CP5A 3J80E 1BI0A 4M77B 1YIJT 3TQ7P 2L2PA 3BG9A 5FW9A 4C5GA 2OI3A 5EJCA 3QDRB 4M77F 3CC4A 4BI4A 4JX4A 3POMA 1URCB 1VYTA 2E10A 2FEIA 2QA4A 1G2BA 2A08A 1VQKQ 5IAYA 1YJ9Q 2VYTA 5HBJB 1MMDA 4RTWA 4FM4B 4AFSC 4ZTJA 2K79A 3BLRB 3CCRQ 1B34A 3CCQT 2WACA 4DBQA 4IUQA 2VV5A 5IHKA 2QQ8A 2W0ZA 5CVIA 1G5VA 3A8MB 3RDVA 1I5LA 2D0NA 1YN8A 2QTXA 1NE8A 1OKVB 3QJYA 4P5NA 5CCAA 3AHUA 1QCOA 2CDTA 2OTJT 4PJLA 1XOVA 2OX7A 1VQLQ 2KYMA 2FG0A 2D9TA 2YUOA 4BI8B 2CZ0B 2PMIB 4IIOA 2FB7A 1TH7A 1VQ7T 4JLIA 2KSSA 4OMNA 3A8HB 4Y92A 3G33B 2E4HA 1V76A 4QQGA 2EQJA 2KMGA 4BCQD 4PJOA 5GAMh 2KMTA 5GJVB 1VQNQ 4DA4A 4NC6A 2DFUA 2LRQA 4E2FB 3G7ZA 8ATCB 1TUCA 4F7UE 4M7AD 3UF4A 1JOWA 1M1KR 6AT1B 3CCSQ 1WHMA 3VKGA 4OB0B 4C8QF 4CRIA 5GANj 4A4EA 4C8QD 4C92F 1OOTA 4M77G 3HTRA 1VQ9Q 3L1AA 2I0NA 4RTYA 1QVGS 3CMEA 2QFZA 4EMHA 3EGXB 3LX7A 1K9AA 1MV3A 2ZAEA 1B07A 3O5ZA 4OMMA 3RIRA 4BBSM 2WFYB 1H3HA 3VYGB 4BD3A 2QA4Q 2G3RA 2RQUA 2LVMA 4EC8B 1TD6A 2DVEA 3G71T 3NHNA 1RAGB 1VQ8A 5KYWA 2DPPB 1QVGP 3EGXA 4OMOA 1VQMA 4KH1B 1U5SA 1X69A 2FL7A 2LT1A 3LW5E 3G6EA 1VQKT 1KJWA 1FYNA 4J6XA 4CFXB 2D1XA 3OYLA 1YJ9T 2KROA 4M78F 2W99A 2HEQA 2QEXT 2CS7A 1M3AA 1GUXA 1NLOC 3CCVA 1KHIA 1OEBA 2CZ6B 5KYWB 2BZYA 2DL5A 3G6ET 5KE3A 1H27B 1UNLD 2K5FA 3CCUQ 3CCMT 2COYA 5CK9A 4EMKB 4HT9A 4IUVA 1WIEA 3BLQB 1P92A 2EPDA 3E9FA 3CD6Q 1H1SB 4FW1A 4E7KA 3JCMh 2X9HA 4BACA 3CPWP 3CCLT 2E1HA 2QDJA 3I5SA 2EUFA 3SHWA 1I1JA 2IW8B 2A28A 1M2OA 1RI9A 1X27A 2EQUA 2NUTB 2O9SA 4XTUA 3H41A 2L3SA 1YP5A 2J6OA 3INZA 4OP0A 2ECZA 3MEVA 1YJNA 4RTZA 4QKUA 4MMLA 5I11A 2L3QA 3CC4Q 2JOYA 2P4TA 2DXUA 3M0QA 2QGSA 3EJ1B 2KK4A 1WNLA 1QVFA 4C5EA 1M8VA 4LD9K 4PJMA 4QT7A 1VUBA 1KG1A 4CC2A 1IHVA 4M78G 2J6KA 2YRCA 3C95A 3HB9A 3F70A 2E5KA 4M6VA 3OB9A 1AWOA 1TG0A 4JJCA 4LOCA 3OYMA 3QUIA 4HL4A 3BW1A 3VRZA 1VYUA 1N8RU 1K9MR 2QI2A 1WGSA 1X6BA 2ABLA 1WHHA 3OYGA 3VS4A 3PTAA 3NTKA 3M53A 3VS6A 3MEUA 1YHQT 1VQ5Q 3SEMA 2DEQA 2DK3A 3HO8A 2YRDA 4LDXA 4LDWA 1AD5A 1BI1A 3TREA 2KT1A 4KGVB 1UGVA 1WJSA 3MY1B 2ED1A 2XKOC 4X9DA 1KQ1A 2OTLA 1NEBA 1M90C 1KQSS 2MPXC 2CP2A 1ZP2A 8AT1B 2EWNA 3OQ5A 3M9QA 1W2BS 1PC0A 3S3OA 3HKSA 3ULRB 2GTOA 2K4YA 5LJ3j 3OSVA 3QJ6A 4FIBA 3HZJA 1OV3A 3TCJA 3L2WA 2E70A 4XTYA 4MFEA 1S72A 3LWHA 4CXAB 3V8LA 3WVEB 3VYHB 2EYYA 2F2CA 4M78E 2E3IA 2PTKA 3OS1A 4HXJA 2B9RA 4TTHA 1AHJB 2DA9A 2V22B 4HKEA 4N0AC 3OYCA 1C6VX 4CFVB 1Q86R 4NSTB 1C1AA 3GOXA 2K6DA 3DLLA 3H8ZA 4FCYA 1M4ZA 2BS2A 1X01A 4AT1B 1D1BA 3RBBB 5LQFB 3CCQQ 2XD0A 4KBMB 3ER0A 5IXFA 1GUXB 2M02A 4F70B 1I0CA 4ZGEB 3QKJA 5KYXB 1BCMA 3DL1A 4M7AE 1QVGA 1TUDA 1JJ2A 4M7AA 3VU3C 4XU1A 1PHTA 5I22A 3CXCA 2OTLQ 5KYUB 2DXBA 1YI2A 1X6GA 4C8QE 3OS5A 1CKAA 2XHCA 2P0KA 4HLQA 3V8KA 3OYKA 3OW2P 3C4SA 2RD1A 3C94A 5KYYB 3F5XB 1SHGA 5DQWA 3G6EQ 4M7DD 1QKXA 2H3EB 1TSFA 2MF2A 4RTTA 3CCUT 1UJYA 4PJJA 1PKSA 2L5QA 5GAMf 1GCQA 2UZLB 4MFDA 3LLRA 2LDMA 2GNCA 2X4XA 2IVWA 1VQPA 3CD6T 4KUIA 5J3BA 2B8AA 1W4SA 2G77A 1KXUA 1XTDA 2RQTA 3O0GD 2M0OA 1E9HB 3CC7Q 1GBQA 1Q81U 4A4FA 1K73C 1V1CA 2QDLA 4AMCA 1QCFA 4BXXX 2HAXA 1SHFA 3L2VA 2J05A 1MGQA 5A0LA 1ZUYA 4PLIA 4Z89A 2UZDB 3L2RA 2P4RA 3WVDB 3ZEHA 2EYZA 4EOSB 3JB9I 4CI0C 1Q7YC 3OW2S 4M7DA 5IDPB 4FT2A 2JM8A 2LQ8A 1MUZA 1KC8R 1Y71A 3OY9A 1ZA1B 4LD6A 4JUVA 3JB9H 1IHWA 2LJ1A 3PVLA 3NPFA 5FU6B 3PVQA 3DDQB 4HNUA 2DIGA 2LW4A 2XDBA 1ZSZC 4DOWA 4D8DA 4JS5A 1D0YA 1FVVB 1GFCA 2GQVA 2LMJA 3QZ5B 3P8HA 1YIJQ 5KCOA 3CCLA 1RACB 2YXYA 1K9MC 1UNHD 1WHKA 3E9GA 1PG5B 5GAOn 2DYIA 2X4JA 1VQ4T 1ZUKA 1MNDA 2XICA 4PFZA 1OPLA 2JGZB 3MI9B 3PNWC 1I4K1 3ASKA 1O75A 2MOXA 2OTJA 2EVRA 3ZL7C 5KYNA 2PHGA 3QIIA 4JZ3A 4F7SB 2GFAA 1H92A 3CC2A 4XU3A 2VXEA 3CC2Q 5GAN4 4J9DA 2NYSA 3HSBA 2YWWA 4KRCB 2OTJQ 3CQTA 2VC8A 1Y96A 5FLXE 5GANd 2EJFA 5GAMj 2HKQB 2M51A 3RUXA 2DD5B 5KH6A 2R57A 5IT9E 3FIFA 1WFWA 5GAN6 4MDWA 2ROLA 5CKFA 3CMET 2YUNA 2M16A 2AKKA 5GMKj 4D8KA 4ELJA 5J39A 1TU0B 3CXCP 1K76A 4E7ZA 1WHJA 4JS4A 3CC7T 3M0SA 1A0NB 2PVOB 2HBWA 3V7SA 2VWFA 4QVCA 1JQQA 3CBMA 1BBZA 1AD6A 1Z9QA 3DKMA 1W1FA 2HL3A 2V8KA 4ELYC 3LH0A 3TU4K 3QYEA 4M78B 4BCQB 4YOZA 2OAUA 1WXBA 2E64A 4RUGA 3GIBA 3GTMS 1KFZA 1X43A 2CCIB 1OZ2A 1W2BP 4C92D 4N4GA 3EG2A 2CSIA 2EW3A 2MWPA 1NBEB 2EJGA 2CKKA 2XIDA 3EGUA 2HKNA 5AT1B 3EG9A 1WI7A 2EKOA 1WXTA 2K3XA 3EHQA 4FSXA 2DX1A 3QYBA 1LNXA 3G4SA 4BY6B 4DBFA 3QPHA 2AIRB 3UT1A 1X2KA 3TNWB 1SSHA 2QTVA 4M75G 4OF1A 3L2UA 2KI7A 3QG1A 4C0DB 4C8QB 5HBEB 1VQ5T 4MIMA 3JCMX 3H0HA 4EORB 2FHDA 2DVJA 2PVDB 4E7JA 1YFNA 5CKHA 5GMKm 2FO0A 3J7AF 4BCJB 2DD4B 1LJOA 4PJOB 1M9SA 4F6WB 1JBMA 1KC8U 3KHIA 4M7DE 1QWEA 1E6HA 4LUDA 4BE0A 2H8HA 1K8AC 3QYGB 4EOMB 5CAIA 4NOYA 1YI2Q 2HL5C 3TW6A 1XO2A 4M77E 4ATOA 4EOIB 3OYHA 1I8FA 3QHSA 2DL8A 3JSCA 3M5AA 2RNAA 3QDFA 2GQIA 3UA7A 4CFWB 5I21A 5HK0A 2RMOA 3VJPA 3EFOA 1AWWA 3SFMA 2EJ9A 3M0UA 4J83A 2BIVA 2EQKA 3OW2A 2QEXQ 1SKUB 2ZGWA 1OQKA 2ZPBB 4E7SA 1AVZC 4A54A 5FU6C 3I55Q 3GNGA 3VS3A 4AI6A 5CKBA 2RJDA 4QW2A 4B9XA 1MHNA 2JN0A 1ZSZA 2WEVB 2BZ8A 5HCKA 1FXXA 1YBYA 3EAEA 2YHTA 2RI5A 5I2SA 1BIAA 2PK9B 3X25B 4IMYB 2YUQA 2LJ0A 1WHGA 2JMCA 1Q86C 2FRYA 1GFDA 4J9EA 2FZKB 1HK9A 3M59A 1ZSZB 2JNGA 4PLLA 2O4XB 1BYMA 2EYWA 2R5AA 2C5NB 2XU8A 5GAN8 3MP8A 2RHZA 1UEBA 3QZ9B 2V8IA 4E7LA 4M78A 2RHIA 1YCSB 2MK5A 2DTHA 2K5LA 3H9NA 2MAMA 3A98A 3TEEA 4RMOA 5GMKl 4FU6A 1UB4A 4D6WA 5D6WA 2DXCB 2YRVA 1M1KU 4OB1B 2M9UA 2D8HA 3P8BB 1WYXA 2MWOA 1W70A 1N4MA 2I40B 1AZGB 4MZMA 1KQSP 1NPRA 3EFRA 3QYHB 1EIFA 4Y28E 1SG5A 1FMVA 4Y72B 4J6YA 4OMFB 2IIMA 2EQIA 3OS2A 4QQ6A 2X4WA 3RERA 4EOLB 2DF6A 4UN0A 4M75F 2EYQA 3V7CA 4M75D 1K8AU 3M0PA 3OYJA 2QASA 3EGDA 2UUEB 3U23A 1IZ6A 4LNPA 4C8QA 1VIEA 4XAXB 1G3TA 1YJWT 1T0HA 3RESA 4F7LB 2CJMB 1E7OA 2CSQA 1RL2A 3B57A 5LJ3f 1JSUB 1PWTA 4MZPA 3CXCS 2DO3A 1WZOA 3CCEA 1IREB 3SDZA 1EZZB 2V1RA 1FX7A 3M57A 4M77D 3CC2T 4EOPB 4AKIA 4AFUC 5GAN7 2D6FA 4DBHA 3LGLA 3JB9G 3OYIA 1RLPC 1MNEA 3S3MA 4KRDB 1TXQA 2RF0A 2X1NB 2CP3A 4JDSA 5LJ3h 3TNHB 4ELZC 1H28B 1DJ7B 1UHCA 3CCVT 2DL3A 5IHIA 2A3LA 2KXCA 3MCAB 3RMQA 4ZGDB 2IW9B 2PQWA 1VQOQ 3JB9F 2W9ZA 4QVDA 3MIAB 4ROCA 4M7DC 5FWBA 5LMKB 2QA4T 1PD0A 4Y91A 4AKHA 1Q86U 2ZPHB 2AZSA 1YITQ 1T3LA 4J9HA 4WTOB 3DLMA 4JJNK 4HVUA 1PNJA 3FDRA 4FYYB 1M5Q1 1Q82U 2HQHA 3EIDB 5CR2A 1AOJA 2HNIA 2ZPEB 2G6FX 2QEXA 1M27C 3SWNC 2CUBA 4M7AF 4AFQC 4BB7A 2H3JA 2A7YA 1ZUUA 2ZPGB 3L2ZA 4FYXB 3LQ5B 2DETA 2M1HA 4CFNB 4LDYA 2IVXA 1N8RC 3JRZA 1QMZB 4PJOF 1VQLA 3TNIB 3THKA 2IG0A 4M7AC 5HKCA 1JJ2P 4AG2C 4FW2A 5GAN2 4JX6A 4JLGA 4HT8A 2X4YA 4CC4B 2K5IA 5CQYA 4RKUE 3VV0A 4A53A 4Z02A 3FEOA 4KGZB 4XTWA 2CREA 3META 3NTHA 2C0OA 2KQWA 1VQ6T 1UJ0A 2DBKA 3VKIA 1M90U 1N8RR 3CCRA 4JPBW 1NPPA 2LQKA 1VQNA 3G4ST 1Y0MA 4G6LB 5BNJB 4X34A 4J9IA 2QK0A 5D7UA 4BE1A 1WX6A 2JUFA 2X35A 1FMWA 1H25B 2DXTA 4M75B 2DLPA 4YOOA 4HCZA 1N9RA 4QVZA 3M56A 2W96A 2DEUA 4QSHA 1VQ9T 3OYAA 2E41A 4OB2B 5FRNA 2GFUA 2AK5A 4HVVA 3URGA 1YWOA 2NLUA 5FU7B 1SRMA 2G9XB 1PSEA 2A37A 3EGDB 1K0SA 2J6FA 2LT4A 2QQRA 3I56T 3DTOA 4ANJA 2NUTA 3OMGA 1Q82R 2CP7A 5A0DA 2SEMA 2DM1A 2EIFA 2RN8A 4JJBA 4ZNXA 4FL6A 2KRSA 3JCMg 1N27A 3VRYA 2ED0A 4PL6A 1QQJA 4EC9B 1ARKA 3HL8A 2A36A 5IF1B 4M75C 1TFBA 5I2MA 4NS5A 4ORZA 1RUWA 2RHYA 2FPEA 2RO0A 2RHXA 4DQ2A 5IH2A 4RODA 4XK8E 3FJPA 1KSWA 5EC7A 3QBYA 3RMSA 2AZVA 3RGFB 1OU8A 2VASA 2RJFA 4M7DB 2YLBA 5GAMe 1AEYA 3M4YA 4FSSA 1TTHB 4F7NB 1VOMA 5FROA 5GAN5 4PKCC 1T3SA 2NUPB 3G71Q 2QAZA 3X24B 2HZYA 3VKHA 1S72Q 3HHTB 2PJQA 1BU1A 2LCSA 5GAN3 1RAIB 1XJWB 4KULA 1W6XA 3BE3A 2DILA 2DZ9A 4J6WA 2LX7A 2E5QA 3NMZC 2NUZA 4BUGA 2DNUA 2W9FA 1VIFA 3CMEQ 3FJ5A 2ESWA 2JS2A 2JW4A 1JU5C 3A1PA 3CD6A 3KUFA 3GF5A 2I53A 3UDCA 1M2VB 1YCYA 1BCOA 1Z9ZA 2CUDA 3C0CA 1D09B 4JJDA 4BY1X 5FU7C 2C4GB 1NG2A 3PT9A 5CEIB 1VA7A 4JRPA 2UZEB 1MMAA 4M7DG 1O9KA 3BG5A 2HSEB 4N4IA 4MDXA 4OGCA 2DL4A 1X2QA 3M03A 2CZ7B 1RLQC 1Y96B 4EDUA 1ZHIA 3NFCA 4LN2A 1GXIE 5LJ3g 2ZZDA 2WIHB 2P84A 3K7AM 1N9SA 2WMBB 4C0FA 2O01E 2V1QA 4RTXA 1R0CB 1I07A 2EGEA 3MP6A 1YITA 3VS5A 3OSSC 2KBTA 3UWNA 1RADB 5DLOA 4PFOA 1K73R 2GGRA 3KFVA 1CSKA 1J3TA 1UECA 1VQ9A 1K4US 3NDQA 2NWMA 3CMAT 2RQVA 4DEYA 3OYNA 5FGKB 2KVQG 4EMKA 5GANe 3CMAQ 2QDYB 4C92B 2AHJB 2MIOA 4FYVB 4MMKA 4R55A 2C5VB 1YNZA 3JCMJ 2R58A 4BY6C 3LH5A 2EYXA 2RK1A 3JB9D 5L2WB 1PCXA 1YJWQ 2FZCB 2EBPA 1LOJA 1IXDA 5IXBA 4OGEA 5GAOp 3IQLA 4CC3A 1UG1A 1QCNA 4RCBA 3RKXA 1VQMT 1VQKA 2UZBB 1VQMQ 4E7IA 2FPFA 4PJOG 3LWIA 4C0GA 2F5KA 4EOOB 2RA2A 3HRUA 2CH4A 2K3BA 2Z0WA 3QWLA 1QVPA 2LNVA 3X20B 1ABQA 1QMCA 2L3RA 2KDSA 2CT4A 2RHUA 1WXUA 2O9VA 2JJ9A 1WPYA 3UATA 1TUGB 2KE9A 4QQDA 3CEYA 4WCIA 3CCMQ 1HD3A 3G1JA 1HJDA 2O88A 1GBRA 2R7GA 4GLKA 2DD4A 2P0PA 2EKHA 4BBRM 3J81E 2JTEA 3JCMd 3QWYA 4LUEA 5LJ5d 4LXCA 3X26B 2KRNA 3OBWA 1NEGA 4X1VA 3GP8A 2AKLA 4Z6YA 4BY7X 4II5B 1H24B 3CCET 2P0QA 3T9NA 3HRTA 1UGQB 3DOGB 4YC3B 4RCCA 1XQHA 3HFOA 2KGTA 3E2UA 3PMTA 3ME9A 1OL2B 3VYGA 4ROEA 4GLMA 3RKWA 5ICPB 4BDYA 1O9KB 1UE9A 3QHWB 1F1BB 2YDLA 1RAAB 3G71A 1D3BB 3I55T 1F5QB 1AWXA 2F69A 4F7UG 1VQ7A 2CP6A 4BCGB 2K2MA 2K2VA 2YLCA 2L8DA 2HQXA 3I55A 1KHCA 3M58A 3VS7A 1VQ6A 2HQEA 4FYWB 5CKDA 5KYYA 3I56A 2LNHB 3BHVB 2ENMA 4Z88A 4C92G 2CT3A 4CRLB 4M78C 4OMPA 4RTVA 4YTLA 1R0BG 2K9GA 1H3ZA 3REAB 5KYXA 1VQ5A 1NLPC 2DRKA 3DB4A 1WJQA 4M7AG 1NJIU 1I81A 4M7DF 2F2VA 1FMKA 3GNFB 3EOCB 1QVFP 3VUBA 1G3NC 1PRMC 1U06A 2LP5A 1RAEB 3HP9A 2LJ3A 1KQSA 1YJNT 1UHFA 3CCQA 4XU2A 2E6ZA 1WQ7A 2OJ2A 2DAQA 2JM9A 5DY9A 1UGSB 3EFSA 3CCJA 2ZCFB 3RNJA 1G83A 4OVAA 2M0YA 2RI3A 4BCMB 1WQWA 2JVVA 2HMAA 2DYBA 5HQ0B 1VINA 2HDAA 4AKGA 4C8QC 2E12A 4JRIA 2KXDA 3Q1JA 4UC4A 3SWNB 1M8MA 3EG0A 1IRXA 2RB6A 1JB0E 3LGFA 1VQOA 1OL1B 1PSFA 2VGMA 3JV3A 3DB3A 2L0AA 5C6SA 5CYIB 4TVRA 1R77A 2IW6B 2RQWA 4PNOA 4CC7A 5LJ5g 3QWXX 4DBRA 1ENWA 3E19A 1VQOT 1FINB 5GAOm 1RI0A 4JX5A 1T0JA 2XDPA 3FRNA 2A0FB 2NUPA 1P5EB 3CCMA 4JRQA 4R56A 5IHYA 3V7RA 1UNGD 2F5TX 1N6AA 2W10A 1H4LD 2ATCB 2LTOA 4XTVA 3RR6A 1LVKA 2Y4XA 1WLPB 3R6OA 2QQBA 1UTIA 2QYZA 3PFSA 3HFNA 4EIKA 1U3OA 2QQAA 3OBYA 4GY5A 4EOJB 2MMPA 1GL5A 2CGHA 3FB9A 2EQMA 3H0FA 3QXEB 1VQ8Q 4XU0A 2ROTA 3A8LB 1O9SA 4F6SB 1GCPA 3PO3S 2EGCA 4IUTA 4MZTA 4JZ4A 4BCFB 2E3HA 2IN3A 1XNIA 1NJIC 4EPCA 2JT4A 1Q81R 3R6NA 3JCMf 1H1RB 4RTUA 1QVFS 2AT1B 3A8GB 4HCCA 1OI9B 3TN8B 1K1ZA 2KR6A 2I2LA 5LJ3e 1KIKA 2HCKA 3CC4T 4EMGA 2VB6A 1E6GA 4B6MA 2VKNA 4ZN3A 3CBOA 4M78D 3JCMc 5EG2A 2DIQA 1EX4A 1H8KA 1UFFA 1SRLA 3M4GA 3KXTA 5IDNB 4BCOB 4CFMB 4E7HA 2FRWA 4I3ZB 2QGFB 3QSUA 4HCBA 1PRLC 2PUKB 2J06A 3MP1A 2WSFE 4FX3B 5GAMg 5LJ5j 2W2HA 4EONB 4L6V5 2F2WA 1U1TA 2LQWA 2CH4W 4C0DC 1QLYA 4L5GA 4XQ3A 3C12A 2DXBB 1YWPA 2DL7A 4F7UF 1IGQA 1B34B 4AFZC 2KAFA 3JB9J 4EOQB 2EFIA 3H0IA 4BCMD 1D0ZA 2B86A 4E47A 2VGNA 3HBLA 1Q82C 1OKWB 2C5XB 1Q95G 1X75C 1H641 2XI9A 5FWCA 3HPWA 4YOSA 2C5OB 2V26A 1YITT 1Y7XA 2D8JA 2KR3A 3S3NA 5LJ5e 1N5ZA 2WSCE 4KH0B 1MMGA 5I5ZB 4J9FA 1NJIR 1JXMA 1OZ3A 2JZ2A 1JSTB 3CCEQ 3WXMB 1ZLMA 3CMAA 3OMCA 4C5HA 5D6YA 2QXFA 1VQ4Q 5HK3A 4VUBA 2RQRA 3MJXA 4F16A 1GCQC 5LJ3d 2DMOA 1WA7A 2RJCA 3VS1A 2MI6A 1HYOA 3CC7A 2QQ9A 4C5IA 2DTIA 4C8QG 3GLXA 5CKEA 3FC3A 2KYBA 2BKDN 2FPDA 4BDZA 2K3YA 5GAMd 1G8XA 3MEAA 1BKBA 1M3CA 1H1QB 1X6OA 5HY6A 2OTLT 1H1PB 4PJOC 2LX9A 4J9BA 3CCJQ 4II1A 4BCNB 3A5ZB 3E1SA 3G4SQ 2VUBA 2CP0A 1QP3A 1HXDA 1IB8A 3UPUA 4CFUD 4K11A 2BS3A 1WDXA 3QO3A 5L23A 4OMLA 4HA8A 3RKYA 5HNBB 2WIPB 2FYKA 2BE7D 3MO8A 2WJ9A 2F2XA 2DZCA 1Y57A 2VXFA 5HVYB 1R8OB 1K0XA 3PMIA 2LZ6B 4F17A 2X3WD 4A4HA 2HD0A 1QKWA 1MMNA 3O8VA 4ZGJB 4BE2A 3JCMe 3TSZA 2VVKA 1M2VA 5D6XA 2GBQA 1M30A 4PK4A 1VYVA 2PVGB 2DKGA 4J9CA 1IO6A 3BHTB 4M7AB 1YJ9A 1ZX6A 3PGGA 4N4HA 3BLHB 1D1AA 1JEGA 3BHUB 2LC4A 3BDUA 2WPAB 2V8JA 3PIPA 5C0MA 1JXOA 4C92C 1C0MA 1WHLA 4N0AA 1CKBA 3BG3A 4B9WA 3DJBA 4BCHB 1M1FA 1TOVA 1Q7YR 2COZA 4HNTA 3VS0A 3VUZA 1D3UB 3KBGA 1OPKA 2DMEA 3JCMV 4F6UB 1KC8C 2C6TB 3SD4A 2DD5A 2XMFA 1D0XA 1KD1U 4BCKB 3OA6A 2KT8A 3M54A 4EMKC 5AYFA 2PZ1A 2BZXA 4M77A 3BY7A 1VQPT 5EFQB 2PUOB 2O4XA 3NGPA 1KQ2A 3ZBDA 4ZN1A 3AT1B 1E7PA 5GMKe 3JCMQ 5GJWB 5CIUA 4M75E 4A4KA 1SEMA 2XK0A 4M75A 4HVWA 2QGGA 4XTXA 4BCPB 2RJEA 3REBB 1AZEA 1NYFA 1JJ2S 1WJRA 2EAYA 2DXCA 4KGXB 5A0GA 1NZ9A 2BUDA 3BDLA 3UA6A 2ZPIB 2C0IA 3CPWS 2WHBB 3CCVQ 3V8JA 2J7IA 2LQNA 3S6WA 1W98B 4GBQA 3OS0A 5HBHB 5DLQE 2CZ1B 2EGAA 3CCLQ 1YIJA 1OI1A 3L42A 1GH6B 4M4ZA 2GF7A 1S72T 3GPLA 3EH1A 1ZSGA 5GAOr 2PNIA 1AWJA 2C06A 4ME7A 1LCKA 4OGRB 1AISB 1PKTA 5DQVA 1Y07A 1RAFB 2DBMA 1M1KC 4C0ZA 1V29B 1ZA2B 2DE0X 2JTMA 3N5BB 4ESRA 3P8DA 5GANf 4V2SA 1NM7A 4M77C 4WF2A 2WMAB 1BU2A 4BI3A 5J26A 4F7UA 2L3PA 1UUEA 2RH2A 2PU9B 1RABB 2FVUA 1VQNT 2Y90A 1OYXA 7AT1B 5GANg 5ACBA 1BI2A 1U1SA 3MHXA 2BKZB 3H6ZA 1VYWB 4IURA 2XDDA 1M1GA 3BFMA 2JS0A 3ZFJA 1FKMA 5M9OA 5GMKi 3EH2A 4F7UB 2QQSA 1VQ7Q 4EOKB 3A8OB 4OB3B 4L59A 3SB2A 2YSQA 1RAHB 4OR5B 1BI3A 2RM4A 3OYDA 1D3BA 3M0TA 1G3YA 1BK2A 1OX8A 4NL2A 4KUDK 5CQXA 1Q81C 1ZBJA 2KY9A 3CPFA 3LYIA 5ECAA 4PJNA 4LE9A 2DJZA 1ABOA 1YJNQ 5CO7A 2HSPA 1VQ4A 3PE0A 3OYEA 4F7JB 2BE9B 3I35A 1ACMB 2DJQA 4DOVA 1I5OB 1JRIA 1YI2T 5GAOq 4CFUB 3I9QA 4KT0E 4IKFA 1YJWA 4ELLA 4OMQA 5DM7R 1BB9A 2XG8D 1YHQQ 5LJ5f 5KE2A 2L89A 1EFNA 3EG3A 3CCST 1NYGA 3MY5B 4A4GA 3JCMP 2YT6A 5KYUA 5IN1A 4RG2A 4PJOD 2DTOA 3MKDA 4Q5WA 3QHRB 3CCUA 1OIUB 1AT1B 1SSFA 1KK7A 2PK2A 5GMKh 1QP2A 3TW7A 3EHRA 1YHQA 1PKDB 2ZPFB 2RPNA 2KEAA 4JRKA 2E65A 3MPUB 4FT4A 3OYBA 3CCRT 2FZGB 1B7TA 3OYYA 2K57A 1BIBA 4J7IA 4LDVA 1SPKA 5GANh 2COWA 1VQ8T 4J9GA 3JCMW 1VQPQ 3CBPA 2D0QB 3VS2A 4IUUA 3EG9B 1VOLA 4AG1C 1OX9A 2JMAA 1TS9A 3H4CA 4C92E 5GAOl 1LPLA 4C92A 2LCLA 4J7FA 1W2BA 1VQLT 1OULA 4ZTFA 9ATCB 4BCND 1K9MU 3NTIA
chains in the Genus database with same CATH topology
3SWNA 3OBYA 4GY5A 2M1HA 2MMPA 4LDYA 1N8RC 1QW1A 2MF2A 2CGHA 3JRZA 4PJOF 3CCUT 1VQLA 3FB9A 2EQMA 5GAMf 2IG0A 2L5QA 4MFDA 4M7AC 3LLRA 2LDMA 1ZQ1A 5HKCA 3QXEB 4XU0A 2X4XA 2IVWA 3JAME 3A8LB 4KUIA 1VQPA 3CD6T 1O9SA 5J3BA 5GAN2 3CCSA 4JX6A 2B8AA 2R5MA 4JLGA 1W4SA 2X4YA 2G77A 4HT8A 4IUTA 2K5IA 4MZTA 5CQYA 4RKUE 4PJOE 4J8OA 3VV0A 4A53A 4Z02A 1XTDA 3FEOA 5LJ5h 1KD1C 1XNIA 2M0OA 1NJIC 3FLGA 4XTZA 4XTWA 4EPCA 3PIOA 3META 3NTHA 3JCMf 3CCJT 5FRMA 2KQWA 3HRSA 1VQ6T 1QVFS 3VKIA 3A8GB 4O6JA 1Q81U 1K73U 1FWZA 1M90U 4HCCA 1Q7YU 2E6NA 4A4FA 1K73C 2KR6A 3CCRA 2I2LA 5LJ3e 1NPPA 1UGPB 2LQKA 1VQNA 2Y4YA 3G4ST 4HNVA 2RK2A 4X34A 3CC4T 1U8RA 4EMGA 3CPWA 2HAXA 4BE1A 3L2VA 2JUFA 3X28B 1MGQA 2X35A 5A0LA 4PLIA 4ZN3A 3CBOA 4M78D 2DXTA 4M75B 3JCMc 2RI2A 5EG2A 3L2RA 2DIQA 4HCZA 1N9RA 4QVZA 3M56A 3WVDB 3ZEHA 3JB9I 4QSHA 4CI0C 1VQ9T 3OYAA 3M4GA 2E41A 4OB2B 1G3WA 2GFUA 2JTFA 1Q7YC 3URGA 5FRNA 3JCMb 2NLUA 5LL6S 5A2QE 3KXTA 5FU7B 3OW2S 2QF7A 3M55A 4M7DA 4FT2A 1PSEA 2LQ8A 3MEWA 2GCXA 4O5VA 1Y71A 5L8RE 3OY9A 4E7HA 2LT4A 2QQRA 4LD6A 3I56T 4JUVA 3QSUA 4HCBA 3JB9H 2CYZB 2PUKB 5FU6B 3OMGA 4HNUA 2HBPA 5KCHA 5A0DA 4NL3A 1QLBA 2DIGA 3MP1A 2XDBA 2WSFE 2ZZDB 4DOWA 1ZBXA 2EIFA 5GAMg 4FL6A 5LJ5j 4JS5A 2GQVA 3JCMg 4L6V5 1N27A 2BS4A 3QZ5B 1U1TA 3P8HA 3L2QA 4C0DC 4PL6A 5KCOA 3CCLA 3HL8A 4L5GA 4XQ3A 3C12A 4M75C 2DXBB 5I2MA 4NS5A 1K9MC 3OYFA 4F7UF 1B34B 3JB9J 2KAFA 2LCCA 2RHYA 3E9GA 2EFIA 5GAOn 2X4JA 2RO0A 1VQ4T 2RHXA 4DQ2A 2WSEE 4E47A 4XK8E 2VGNA 2XICA 3FJPA 3HBLA 1Q82C 4LDUA 3PNWC 2XI9A 1X75C 1H641 3QBYA 1G3SA 1I4K1 4IUPA 4J5YA 3ASKA 3RMSA 1O75A 3HPWA 4X9CA 2RJFA 2OTJA 4M7DB 4RG8A 2YLBA 1YITT 1Y7XA 3QIIA 5GAMe 1UGRB 2GFAA 3M4YA 3S3NA 5LJ5e 2WSCE 5FROA 3J80E 3CC2A 4XU3A 5GAN5 4PKCC 1BI0A 2VXEA 4M77B 1OZ3A 3X24B 1YIJT 2JZ2A 3BG9A 5GAN4 4C5GA 3HSBA 3VKHA 5EJCA 3QDRB 3HHTB 4M77F 3CC4A 3WXMB 4BI4A 3CMAA 4JX4A 3OMCA 2E10A 5GAN3 2QA4A 2VC8A 1Y96A 4C5HA 5FLXE 5D6YA 4KULA 2QXFA 5GANd 2EJFA 5IAYA 5GAMj 2DZ9A 4J6WA 2E5QA 2VYTA 4ZTJA 4FM4B 5HK3A 4VUBA 4BUGA 3RUXA 2DD5B 1B34A 3CCQT 1VIFA 2WACA 5LJ3d 5KH6A 2R57A 4IUQA 2VV5A 5IT9E 2RJCA 2QQ8A 3FIFA 2MI6A 5CVIA 3CC7A 2QQ9A 4C5IA 1G5VA 2DTIA 5GAN6 4MDWA 3GLXA 5CKEA 4C8QG 3A8MB 5CKFA 2BKDN 3FC3A 3CMET 1I5LA 2M16A 4BDZA 5GMKj 2K3YA 2QTXA 3KUFA 5GAMd 4ELJA 1NE8A 3GF5A 3MEAA 1BKBA 3UDCA 5J39A 1X6OA 5HY6A 2OTLT 1YCYA 3QJYA 4PJOC 2LX9A 5FU7C 4JS4A 3CC7T 4P5NA 5CCAA 3AHUA 2OTJT 4II1A 3PT9A 1XOVA 3A5ZB 2PVOB 4JRPA 3V7SA 4QVCA 3E1SA 3CBMA 4M7DG 3BG5A 2D9TA 2VUBA 3DKMA 4BI8B 2CZ0B 1QP3A 2FB7A 2V8KA 4N4IA 4OGCA 3LH0A 4ELYC 3TU4K 3QYEA 4MDXA 1TH7A 1HXDA 4M78B 1VQ7T 2CZ7B 2OAUA 1Y96B 4JLIA 2KSSA 4EDUA 3UPUA 3A8HB 2BS3A 2E64A 1ZHIA 3NFCA 1GXIE 3GIBA 3QO3A 4QQGA 2EQJA 2KMGA 5LJ3g 4HA8A 2ZZDA 3RKYA 1OZ2A 4C92D 4PJOA 1N9SA 2FYKA 4N4GA 4C0FA 3MO8A 2O01E 2WJ9A 2DZCA 2MWPA 5GAMh 2VXFA 1R8OB 2EJGA 2CKKA 2XIDA 3MP6A 3PMIA 2KMTA 1YITA 4A4HA 2HD0A 3O8VA 4ZGJB 4BE2A 4DA4A 3JCMe 4NC6A 3OSSC 3UWNA 2EKOA 2K3XA 5D6XA 5DLOA 4FSXA 3QYBA 1LNXA 3G4SA 4BY6B 2PVGB 2DKGA 1VQ9A 4M7AB 2LRQA 3QPHA 1YJ9A 3CMAT 3UT1A 3G7ZA 3PGGA 4N4HA 3OYNA 4F7UE 4M75G 4OF1A 3L2UA 4M7AD 2KVQG 2LC4A 4EMKA 5GANe 3QG1A 4C0DB 4C8QB 3BDUA 2V8JA 3VKGA 3PIPA 5C0MA 2QDYB 4MIMA 2AHJB 4OB0B 4C92B 4C92C 4MMKA 3JCMX 1VQ5T 4C8QF 2FHDA 4N0AA 4CRIA 5GANj 4A4EA 4C8QD 4C92F 4R55A 3BG3A 4B9WA 2PVDB 4M77G 4E7JA 3JCMJ 5CKHA 3L1AA 5GMKm 1M1FA 2R58A 1QVGS 3J7AF 4BY6C 2DD4B 4HNTA 1LJOA 2QFZA 2RK1A 3VUZA 3CMEA 1M9SA 4EMHA 3KBGA 3JB9D 4PJOB 3LX7A 3JCMV 1JBMA 1LOJA 1KC8U 3KHIA 4M7DE 4OGEA 1KC8C 5GAOp 3SD4A 3RKXA 4RCBA 1VQMT 2DD5A 3RIRA 4BBSM 4BE0A 1KD1U 1VQKA 1K8AC 3QYGB 3VYGB 3OA6A 4BD3A 3M54A 2G3RA 4NOYA 5AYFA 4EMKC 5CAIA 2LVMA 3TW6A 4M77E 2DVEA 3G71T 4E7IA 4ATOA 4M77A 3BY7A 1VQPT 4PJOG 3LWIA 1VQ8A 3OYHA 4C0GA 2F5KA 2PUOB 2O4XA 2RA2A 1I8FA 3ZBDA 3HRUA 2DPPB 3QHSA 1KQ2A 4ZN1A 3JSCA 3M5AA 1E7PA 5GMKe 3JCMQ 5CIUA 1VQMA 3QWLA 1QVPA 2FL7A 2LT1A 2XK0A 4M75E 2LNVA 3LW5E 4M75A 4A4KA 3G6EA 4XTXA 1VQKT 5I21A 5HK0A 2RJEA 3X20B 4J6XA 3OYLA 1YJ9T 3VJPA 4M78F 1JJ2S 1WJRA 2QEXT 3CD6A 2CS7A 2DXCA 2EAYA 3SFMA 2EJ9A 2L3RA 2KDSA 4J83A 5A0GA 2RHUA 3CCVA 1NZ9A 1KHIA 1WPYA 2BIVA 2EQKA 2CZ6B 3OW2A 2BUDA 3BDLA 2ZGWA 3CEYA 4QQDA 2ZPIB 3CPWS 3G6ET 5KE3A 3V8JA 2ZPBB 2K5FA 3S6WA 3CCMT 4GLKA 2DD4A 2P0PA 4EMKB 4IUVA 5CK9A 3OS0A 4HT9A 1P92A 5FU6C 4A54A 3GNGA 4BBRM 5DLQE 3J81E 3JCMd 5LJ5d 3E9FA 4E7KA 2CZ1B 4AI6A 3JCMh 3X26B 5CKBA 4BACA 2RJDA 3OBWA 3GP8A 1YIJA 4QW2A 4B9XA 2JN0A 1MHNA 1OI1A 3L42A 4Z6YA 3CCLT 2E1HA 2QDJA 1FXXA 2GF7A 1S72T 3GPLA 3CCET 2P0QA 1YBYA 3EAEA 3T9NA 2YHTA 1UGQB 2RI5A 3HRTA 5I2SA 1BIAA 4RCCA 5GAOr 1XQHA 2EQUA 3X25B 2C06A 3HFOA 4ME7A 4XTUA 1Q86C 3PMTA 3INZA 1Y07A 3ME9A 3MEVA 4OP0A 1YJNA 3VYGA 1M1KC 4MMLA 3RKWA 1HK9A 2JOYA 3M59A 4C0ZA 2P4TA 4BDYA 2DXUA 2JNGA 1V29B 4PLLA 2KK4A 1WNLA 2JTMA 2O4XB 1QVFA 1BYMA 2R5AA 1D3BB 2XU8A 5GAN8 3N5BB 3MP8A 3G71A 2RHZA 1UEBA 3P8DA 4C5EA 5GANf 3I55T 4LD9K 4V2SA 4M77C 1M8VA 4WF2A 3QZ9B 2V8IA 4E7LA 1VUBA 2RHIA 4M78A 4BI3A 1KG1A 2F69A 2DTHA 2K5LA 5J26A 4F7UA 4M78G 2MAMA 3TEEA 4RMOA 5GMKl 2RH2A 2PU9B 3C95A 2FVUA 4FU6A 3HB9A 1UB4A 4D6WA 4F7UG 1VQNT 3F70A 2Y90A 5D6WA 1VQ7A 4M6VA 2DXCB 1OYXA 2YRVA 3OB9A 5GANg 4OB1B 2M9UA 1M1KU 2K2VA 1BI2A 1U1SA 2YLCA 4LOCA 2HQXA 2L8DA 3OYMA 3QUIA 1KHCA 4HL4A 3MHXA 3P8BB 3I55A 3H6ZA 3BW1A 3M58A 2MWOA 1VQ6A 4IURA 2HQEA 2XDDA 5CKDA 1M1GA 3BFMA 1N8RU 3ZFJA 1FKMA 2QI2A 5M9OA 5GMKi 1WGSA 3I56A 4MZMA 1NPRA 4F7UB 3EFRA 2QQSA 3QYHB 1EIFA 3OYGA 4Y28E 3PTAA 3NTKA 3A8OB 4C92G 4OB3B 3M53A 4J6YA 4L59A 3MEUA 3SB2A 1YHQT 4M78C 1BI3A 2DEQA 3HO8A 1D3BA 2DK3A 2RM4A 4OMFB 4YTLA 3OYDA 4LDXA 4LDWA 3OS2A 1BI1A 4QQ6A 2X4WA 3TREA 1VQ5A 1G3YA 4M75F 3RERA 1H3ZA 1WJQA 3DB4A 2EYQA 4NL2A 4M75D 1WJSA 3V7CA 4X9DA 2XKOC 1K8AU 1NJIU 1I81A 4KUDK 4M7AG 1KQ1A 5CQXA 3OYJA 2OTLA 1KQSS 1Q81C 1M90C 4M7DF 1IZ6A 2KY9A 4C8QA 1VIEA 3CPFA 3LYIA 4XAXB 1G3TA 2EWNA 3OQ5A 3M9QA 3GNFB 1YJWT 3RESA 1W2BS 2DJZA 3VUBA 3S3OA 3HKSA 5CO7A 2K4YA 1VQ4A 1RL2A 3OYEA 3HP9A 5LJ3j 1KQSA 3OSVA 1YJNT 4DOVA 1JRIA 5LJ3f 3CCQA 1YI2T 3QJ6A 4FIBA 4MZPA 3HZJA 4XU2A 2E6ZA 3TCJA 5GAOq 3L2WA 3CXCS 2E70A 1WQ7A 2DO3A 4KT0E 4IKFA 4XTYA 1YJWA 4MFEA 3CCEA 2DAQA 5DY9A 1S72A 1IREB 3SDZA 5DM7R 3LWHA 1UGSB 2XG8D 3EFSA 3V8LA 5LJ5f 3CCJA 3WVEB 2ZCFB 1FX7A 2L89A 3VYHB 3M57A 5KE2A 4OVAA 3OS1A 4M78E 4M77D 3CC2T 3CCST 2RI3A 4A4GA 3JCMP 4AKIA 5GAN7 5IN1A 1WQWA 2JVVA 1AHJB 4RG2A 2DTOA 4C8QC 2D6FA 4HKEA 4AKGA 4N0AC 2E12A 4PJOD 4JRIA 4Q5WA 3OYCA 3LGLA 3JB9G 3OYIA 3CCUA 1SSFA 3Q1JA 4UC4A 3GOXA 3SWNB 3S3MA 3DLLA 5GMKh 4JDSA 3H8ZA 5LJ3h 2RB6A 1QP2A 1M4ZA 4ELZC 3TW7A 1DJ7B 1JB0E 1YHQA 2BS2A 1X01A 3LGFA 1VQOA 2ZPFB 3CCVT 1PSFA 4JRKA 2E65A 2A3LA 3MCAB 4FT4A 3RMQA 3OYBA 3CCRT 4ZGDB 2VGMA 2XD0A 3DB3A 2PQWA 3OYYA 4KBMB 5C6SA 2K57A 4TVRA 3ER0A 3JB9F 1BIBA 4J7IA 4LDVA 4PNOA 4QVDA 5LJ5g 4M7DC 5GANh 4JRQA 4ZGEB 2QA4T 3QKJA 3E19A 4Y91A 4AKHA 1VQOT 1Q86U 1VQ8T 2ZPHB 3JCMW 3CBPA 3DL1A 4M7AE 5GAOm 1QVGA 4M7AA 1JJ2A 2D0QB 3VU3C 1RI0A 4JX5A 4XU1A 3CXCA 4IUUA 3DLMA 2XDPA 4JJNK 3FRNA 2DXBA 1YI2A 3FDRA 1M5Q1 4C8QE 1Q82U 3H4CA 3CCMA 3OS5A 4C92E 5CR2A 5GAOl 4R56A 2HNIA 2ZPEB 3V7RA 4C92A 3SWNC 2QEXA 4M7AF 2F5TX 1N6AA 2LCLA 2XHCA 2H3JA 4J7FA 4BB7A 1W2BA 2P0KA 1VQLT 2A7YA 3L2ZA 2ZPGB 4HLQA 2LTOA 4XTVA 3V8KA 3OYKA 2Y4XA 4ZTFA 3R6OA 3C4SA 2RD1A 3C94A 2QQBA 3PFSA 3HFNA 2QQAA 1K9MU 4M7DD 3NTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVD B;  3X24 B;  2DD4 B;  3QXE B;  3QYH B;  3A8L B;  3HHT B;  4Y28 E;  3A8O B;  4OB3 B;  4RKU E;  2DD5 A;  3QYG B;  3VYG B;  4FM4 B;  2DD5 B;  2PUO B;  3A8G B;  2DPP B;  3A8M B;  1UGP B;  3LW5 E;  3X20 B;  3X28 B;  2DXC A;  4KT0 E;  2CZ6 B;  1IRE B;  3WVD B;  1UGS B;  2ZPI B;  2PVO B;  3WVE B;  2ZCF B;  3VYH B;  2ZPB B;  4OB2 B;  2DD4 A;  2CZ0 B;  1AHJ B;  1QP3 A;  1PSE A;  2CZ7 B;  2CZ1 B;  3X26 B;  5L8R E;  3A8H B;  1GXI E;  1QP2 A;  1DJ7 B;  1JB0 E;  2CYZ B;  2ZZD A;  2PUK B;  2ZPF B;  1PSF A;  2O01 E;  1UGQ B;  4ZGD B;  2WSF E;  2ZZD B;  3X25 B;  4L6V 5;  3QZ5 B;  4ZGE B;  4ZGJ B;  3VYG A;  2ZPH B;  2DXB B;  1V29 B;  2D0Q B;  2DXB A;  2PVG B;  2WSE E;  4XK8 E;  3QZ9 B;  2ZPE B;  2PU9 B;  2ZPG B;  2DXC B;  2QDY B;  2AHJ B;  4OB1 B;  4OB0 B;  1UGR B;  2WSC E; 
#chains in the Genus database with same CATH topology
 3SWN A;  1QW1 A;  4IIM A;  2MCN A;  1OGU B;  1S1N A;  2F1L A;  2YUP A;  1ZQ1 A;  3JAM E;  1OIY B;  4E6R A;  3D7S B;  3CCS A;  2R5M A;  1IGU A;  4PJO E;  4J8O A;  5IHN A;  1OU9 A;  5LJ5 h;  1UDL A;  1KD1 C;  3FLG A;  4XTZ A;  3PIO A;  1M90 R;  3CCJ T;  5FRM A;  3HRS A;  4O6J A;  3I56 Q;  1K73 U;  1FWZ A;  2O31 A;  1JKW A;  2E6N A;  1Q7Y U;  1UGP B;  1VQ6 Q;  2Y4Y A;  4PFP A;  4F14 A;  4HNV A;  2RK2 A;  4F04 B;  1U8R A;  4KRT A;  3CPW A;  1GRI A;  1D1C A;  3X28 B;  3TVT A;  3GBQ A;  1C9B A;  2RI2 A;  2GTJ A;  1H26 B;  3M0R A;  2BPM B;  3EFO B;  1TWB A;  1G3W A;  2JTF A;  4R0K A;  3JCM b;  5LL6 S;  5A2Q E;  1MV0 B;  2DRM A;  2QF7 A;  3M55 A;  1QWF A;  2BTT A;  2KRM A;  2DER A;  3MEW A;  2GCX A;  4O5V A;  5L8R E;  2MYS A;  3I5R A;  2CYZ B;  3TSW A;  1PD1 A;  1B3Q A;  2HBP A;  2QG9 B;  2WXV B;  1PM3 A;  5KCH A;  4NL3 A;  1QLB A;  1K8A R;  2K7A A;  2ZZD B;  1ZBX A;  4A63 B;  2SRC A;  3L2Q A;  2BS4 A;  2X3X D;  1HSQ A;  2CCH B;  4Z8A A;  4HCK A;  4DEX A;  1JO8 A;  3OYF A;  1SF9 A;  2IPO B;  2LCC A;  2X51 A;  3EG1 A;  1GY3 B;  2WSE E;  1KD1 R;  3DDP B;  2O2O A;  1M3B A;  4LDU A;  4IUP A;  1G3S A;  4J5Y A;  4X9C A;  2C0T A;  4RG8 A;  2JXB A;  4BCI B;  1UGR B;  2KNB B;  2OAW A;  2CP5 A;  3J80 E;  1BI0 A;  4M77 B;  1YIJ T;  3TQ7 P;  2L2P A;  3BG9 A;  5FW9 A;  4C5G A;  2OI3 A;  5EJC A;  3QDR B;  4M77 F;  3CC4 A;  4BI4 A;  4JX4 A;  3POM A;  1URC B;  1VYT A;  2E10 A;  2FEI A;  2QA4 A;  1G2B A;  2A08 A;  1VQK Q;  5IAY A;  1YJ9 Q;  2VYT A;  5HBJ B;  1MMD A;  4RTW A;  4FM4 B;  4AFS C;  4ZTJ A;  2K79 A;  3BLR B;  3CCR Q;  1B34 A;  3CCQ T;  2WAC A;  4DBQ A;  4IUQ A;  2VV5 A;  5IHK A;  2QQ8 A;  2W0Z A;  5CVI A;  1G5V A;  3A8M B;  3RDV A;  1I5L A;  2D0N A;  1YN8 A;  2QTX A;  1NE8 A;  1OKV B;  3QJY A;  4P5N A;  5CCA A;  3AHU A;  1QCO A;  2CDT A;  2OTJ T;  4PJL A;  1XOV A;  2OX7 A;  1VQL Q;  2KYM A;  2FG0 A;  2D9T A;  2YUO A;  4BI8 B;  2CZ0 B;  2PMI B;  4IIO A;  2FB7 A;  1TH7 A;  1VQ7 T;  4JLI A;  2KSS A;  4OMN A;  3A8H B;  4Y92 A;  3G33 B;  2E4H A;  1V76 A;  4QQG A;  2EQJ A;  2KMG A;  4BCQ D;  4PJO A;  5GAM h;  2KMT A;  5GJV B;  1VQN Q;  4DA4 A;  4NC6 A;  2DFU A;  2LRQ A;  4E2F B;  3G7Z A;  8ATC B;  1TUC A;  4F7U E;  4M7A D;  3UF4 A;  1JOW A;  1M1K R;  6AT1 B;  3CCS Q;  1WHM A;  3VKG A;  4OB0 B;  4C8Q F;  4CRI A;  5GAN j;  4A4E A;  4C8Q D;  4C92 F;  1OOT A;  4M77 G;  3HTR A;  1VQ9 Q;  3L1A A;  2I0N A;  4RTY A;  1QVG S;  3CME A;  2QFZ A;  4EMH A;  3EGX B;  3LX7 A;  1K9A A;  1MV3 A;  2ZAE A;  1B07 A;  3O5Z A;  4OMM A;  3RIR A;  4BBS M;  2WFY B;  1H3H A;  3VYG B;  4BD3 A;  2QA4 Q;  2G3R A;  2RQU A;  2LVM A;  4EC8 B;  1TD6 A;  2DVE A;  3G71 T;  3NHN A;  1RAG B;  1VQ8 A;  5KYW A;  2DPP B;  1QVG P;  3EGX A;  4OMO A;  1VQM A;  4KH1 B;  1U5S A;  1X69 A;  2FL7 A;  2LT1 A;  3LW5 E;  3G6E A;  1VQK T;  1KJW A;  1FYN A;  4J6X A;  4CFX B;  2D1X A;  3OYL A;  1YJ9 T;  2KRO A;  4M78 F;  2W99 A;  2HEQ A;  2QEX T;  2CS7 A;  1M3A A;  1GUX A;  1NLO C;  3CCV A;  1KHI A;  1OEB A;  2CZ6 B;  5KYW B;  2BZY A;  2DL5 A;  3G6E T;  5KE3 A;  1H27 B;  1UNL D;  2K5F A;  3CCU Q;  3CCM T;  2COY A;  5CK9 A;  4EMK B;  4HT9 A;  4IUV A;  1WIE A;  3BLQ B;  1P92 A;  2EPD A;  3E9F A;  3CD6 Q;  1H1S B;  4FW1 A;  4E7K A;  3JCM h;  2X9H A;  4BAC A;  3CPW P;  3CCL T;  2E1H A;  2QDJ A;  3I5S A;  2EUF A;  3SHW A;  1I1J A;  2IW8 B;  2A28 A;  1M2O A;  1RI9 A;  1X27 A;  2EQU A;  2NUT B;  2O9S A;  4XTU A;  3H41 A;  2L3S A;  1YP5 A;  2J6O A;  3INZ A;  4OP0 A;  2ECZ A;  3MEV A;  1YJN A;  4RTZ A;  4QKU A;  4MML A;  5I11 A;  2L3Q A;  3CC4 Q;  2JOY A;  2P4T A;  2DXU A;  3M0Q A;  2QGS A;  3EJ1 B;  2KK4 A;  1WNL A;  1QVF A;  4C5E A;  1M8V A;  4LD9 K;  4PJM A;  4QT7 A;  1VUB A;  1KG1 A;  4CC2 A;  1IHV A;  4M78 G;  2J6K A;  2YRC A;  3C95 A;  3HB9 A;  3F70 A;  2E5K A;  4M6V A;  3OB9 A;  1AWO A;  1TG0 A;  4JJC A;  4LOC A;  3OYM A;  3QUI A;  4HL4 A;  3BW1 A;  3VRZ A;  1VYU A;  1N8R U;  1K9M R;  2QI2 A;  1WGS A;  1X6B A;  2ABL A;  1WHH A;  3OYG A;  3VS4 A;  3PTA A;  3NTK A;  3M53 A;  3VS6 A;  3MEU A;  1YHQ T;  1VQ5 Q;  3SEM A;  2DEQ A;  2DK3 A;  3HO8 A;  2YRD A;  4LDX A;  4LDW A;  1AD5 A;  1BI1 A;  3TRE A;  2KT1 A;  4KGV B;  1UGV A;  1WJS A;  3MY1 B;  2ED1 A;  2XKO C;  4X9D A;  1KQ1 A;  2OTL A;  1NEB A;  1M90 C;  1KQS S;  2MPX C;  2CP2 A;  1ZP2 A;  8AT1 B;  2EWN A;  3OQ5 A;  3M9Q A;  1W2B S;  1PC0 A;  3S3O A;  3HKS A;  3ULR B;  2GTO A;  2K4Y A;  5LJ3 j;  3OSV A;  3QJ6 A;  4FIB A;  3HZJ A;  1OV3 A;  3TCJ A;  3L2W A;  2E70 A;  4XTY A;  4MFE A;  1S72 A;  3LWH A;  4CXA B;  3V8L A;  3WVE B;  3VYH B;  2EYY A;  2F2C A;  4M78 E;  2E3I A;  2PTK A;  3OS1 A;  4HXJ A;  2B9R A;  4TTH A;  1AHJ B;  2DA9 A;  2V22 B;  4HKE A;  4N0A C;  3OYC A;  1C6V X;  4CFV B;  1Q86 R;  4NST B;  1C1A A;  3GOX A;  2K6D A;  3DLL A;  3H8Z A;  4FCY A;  1M4Z A;  2BS2 A;  1X01 A;  4AT1 B;  1D1B A;  3RBB B;  5LQF B;  3CCQ Q;  2XD0 A;  4KBM B;  3ER0 A;  5IXF A;  1GUX B;  2M02 A;  4F70 B;  1I0C A;  4ZGE B;  3QKJ A;  5KYX B;  1BCM A;  3DL1 A;  4M7A E;  1QVG A;  1TUD A;  1JJ2 A;  4M7A A;  3VU3 C;  4XU1 A;  1PHT A;  5I22 A;  3CXC A;  2OTL Q;  5KYU B;  2DXB A;  1YI2 A;  1X6G A;  4C8Q E;  3OS5 A;  1CKA A;  2XHC A;  2P0K A;  4HLQ A;  3V8K A;  3OYK A;  3OW2 P;  3C4S A;  2RD1 A;  3C94 A;  5KYY B;  3F5X B;  1SHG A;  5DQW A;  3G6E Q;  4M7D D;  1QKX A;  2H3E B;  1TSF A;  2MF2 A;  4RTT A;  3CCU T;  1UJY A;  4PJJ A;  1PKS A;  2L5Q A;  5GAM f;  1GCQ A;  2UZL B;  4MFD A;  3LLR A;  2LDM A;  2GNC A;  2X4X A;  2IVW A;  1VQP A;  3CD6 T;  4KUI A;  5J3B A;  2B8A A;  1W4S A;  2G77 A;  1KXU A;  1XTD A;  2RQT A;  3O0G D;  2M0O A;  1E9H B;  3CC7 Q;  1GBQ A;  1Q81 U;  4A4F A;  1K73 C;  1V1C A;  2QDL A;  4AMC A;  1QCF A;  4BXX X;  2HAX A;  1SHF A;  3L2V A;  2J05 A;  1MGQ A;  5A0L A;  1ZUY A;  4PLI A;  4Z89 A;  2UZD B;  3L2R A;  2P4R A;  3WVD B;  3ZEH A;  2EYZ A;  4EOS B;  3JB9 I;  4CI0 C;  1Q7Y C;  3OW2 S;  4M7D A;  5IDP B;  4FT2 A;  2JM8 A;  2LQ8 A;  1MUZ A;  1KC8 R;  1Y71 A;  3OY9 A;  1ZA1 B;  4LD6 A;  4JUV A;  3JB9 H;  1IHW A;  2LJ1 A;  3PVL A;  3NPF A;  5FU6 B;  3PVQ A;  3DDQ B;  4HNU A;  2DIG A;  2LW4 A;  2XDB A;  1ZSZ C;  4DOW A;  4D8D A;  4JS5 A;  1D0Y A;  1FVV B;  1GFC A;  2GQV A;  2LMJ A;  3QZ5 B;  3P8H A;  1YIJ Q;  5KCO A;  3CCL A;  1RAC B;  2YXY A;  1K9M C;  1UNH D;  1WHK A;  3E9G A;  1PG5 B;  5GAO n;  2DYI A;  2X4J A;  1VQ4 T;  1ZUK A;  1MND A;  2XIC A;  4PFZ A;  1OPL A;  2JGZ B;  3MI9 B;  3PNW C;  1I4K 1;  3ASK A;  1O75 A;  2MOX A;  2OTJ A;  2EVR A;  3ZL7 C;  5KYN A;  2PHG A;  3QII A;  4JZ3 A;  4F7S B;  2GFA A;  1H92 A;  3CC2 A;  4XU3 A;  2VXE A;  3CC2 Q;  5GAN 4;  4J9D A;  2NYS A;  3HSB A;  2YWW A;  4KRC B;  2OTJ Q;  3CQT A;  2VC8 A;  1Y96 A;  5FLX E;  5GAN d;  2EJF A;  5GAM j;  2HKQ B;  2M51 A;  3RUX A;  2DD5 B;  5KH6 A;  2R57 A;  5IT9 E;  3FIF A;  1WFW A;  5GAN 6;  4MDW A;  2ROL A;  5CKF A;  3CME T;  2YUN A;  2M16 A;  2AKK A;  5GMK j;  4D8K A;  4ELJ A;  5J39 A;  1TU0 B;  3CXC P;  1K76 A;  4E7Z A;  1WHJ A;  4JS4 A;  3CC7 T;  3M0S A;  1A0N B;  2PVO B;  2HBW A;  3V7S A;  2VWF A;  4QVC A;  1JQQ A;  3CBM A;  1BBZ A;  1AD6 A;  1Z9Q A;  3DKM A;  1W1F A;  2HL3 A;  2V8K A;  4ELY C;  3LH0 A;  3TU4 K;  3QYE A;  4M78 B;  4BCQ B;  4YOZ A;  2OAU A;  1WXB A;  2E64 A;  4RUG A;  3GIB A;  3GTM S;  1KFZ A;  1X43 A;  2CCI B;  1OZ2 A;  1W2B P;  4C92 D;  4N4G A;  3EG2 A;  2CSI A;  2EW3 A;  2MWP A;  1NBE B;  2EJG A;  2CKK A;  2XID A;  3EGU A;  2HKN A;  5AT1 B;  3EG9 A;  1WI7 A;  2EKO A;  1WXT A;  2K3X A;  3EHQ A;  4FSX A;  2DX1 A;  3QYB A;  1LNX A;  3G4S A;  4BY6 B;  4DBF A;  3QPH A;  2AIR B;  3UT1 A;  1X2K A;  3TNW B;  1SSH A;  2QTV A;  4M75 G;  4OF1 A;  3L2U A;  2KI7 A;  3QG1 A;  4C0D B;  4C8Q B;  5HBE B;  1VQ5 T;  4MIM A;  3JCM X;  3H0H A;  4EOR B;  2FHD A;  2DVJ A;  2PVD B;  4E7J A;  1YFN A;  5CKH A;  5GMK m;  2FO0 A;  3J7A F;  4BCJ B;  2DD4 B;  1LJO A;  4PJO B;  1M9S A;  4F6W B;  1JBM A;  1KC8 U;  3KHI A;  4M7D E;  1QWE A;  1E6H A;  4LUD A;  4BE0 A;  2H8H A;  1K8A C;  3QYG B;  4EOM B;  5CAI A;  4NOY A;  1YI2 Q;  2HL5 C;  3TW6 A;  1XO2 A;  4M77 E;  4ATO A;  4EOI B;  3OYH A;  1I8F A;  3QHS A;  2DL8 A;  3JSC A;  3M5A A;  2RNA A;  3QDF A;  2GQI A;  3UA7 A;  4CFW B;  5I21 A;  5HK0 A;  2RMO A;  3VJP A;  3EFO A;  1AWW A;  3SFM A;  2EJ9 A;  3M0U A;  4J83 A;  2BIV A;  2EQK A;  3OW2 A;  2QEX Q;  1SKU B;  2ZGW A;  1OQK A;  2ZPB B;  4E7S A;  1AVZ C;  4A54 A;  5FU6 C;  3I55 Q;  3GNG A;  3VS3 A;  4AI6 A;  5CKB A;  2RJD A;  4QW2 A;  4B9X A;  1MHN A;  2JN0 A;  1ZSZ A;  2WEV B;  2BZ8 A;  5HCK A;  1FXX A;  1YBY A;  3EAE A;  2YHT A;  2RI5 A;  5I2S A;  1BIA A;  2PK9 B;  3X25 B;  4IMY B;  2YUQ A;  2LJ0 A;  1WHG A;  2JMC A;  1Q86 C;  2FRY A;  1GFD A;  4J9E A;  2FZK B;  1HK9 A;  3M59 A;  1ZSZ B;  2JNG A;  4PLL A;  2O4X B;  1BYM A;  2EYW A;  2R5A A;  2C5N B;  2XU8 A;  5GAN 8;  3MP8 A;  2RHZ A;  1UEB A;  3QZ9 B;  2V8I A;  4E7L A;  4M78 A;  2RHI A;  1YCS B;  2MK5 A;  2DTH A;  2K5L A;  3H9N A;  2MAM A;  3A98 A;  3TEE A;  4RMO A;  5GMK l;  4FU6 A;  1UB4 A;  4D6W A;  5D6W A;  2DXC B;  2YRV A;  1M1K U;  4OB1 B;  2M9U A;  2D8H A;  3P8B B;  1WYX A;  2MWO A;  1W70 A;  1N4M A;  2I40 B;  1AZG B;  4MZM A;  1KQS P;  1NPR A;  3EFR A;  3QYH B;  1EIF A;  4Y28 E;  1SG5 A;  1FMV A;  4Y72 B;  4J6Y A;  4OMF B;  2IIM A;  2EQI A;  3OS2 A;  4QQ6 A;  2X4W A;  3RER A;  4EOL B;  2DF6 A;  4UN0 A;  4M75 F;  2EYQ A;  3V7C A;  4M75 D;  1K8A U;  3M0P A;  3OYJ A;  2QAS A;  3EGD A;  2UUE B;  3U23 A;  1IZ6 A;  4LNP A;  4C8Q A;  1VIE A;  4XAX B;  1G3T A;  1YJW T;  1T0H A;  3RES A;  4F7L B;  2CJM B;  1E7O A;  2CSQ A;  1RL2 A;  3B57 A;  5LJ3 f;  1JSU B;  1PWT A;  4MZP A;  3CXC S;  2DO3 A;  1WZO A;  3CCE A;  1IRE B;  3SDZ A;  1EZZ B;  2V1R A;  1FX7 A;  3M57 A;  4M77 D;  3CC2 T;  4EOP B;  4AKI A;  4AFU C;  5GAN 7;  2D6F A;  4DBH A;  3LGL A;  3JB9 G;  3OYI A;  1RLP C;  1MNE A;  3S3M A;  4KRD B;  1TXQ A;  2RF0 A;  2X1N B;  2CP3 A;  4JDS A;  5LJ3 h;  3TNH B;  4ELZ C;  1H28 B;  1DJ7 B;  1UHC A;  3CCV T;  2DL3 A;  5IHI A;  2A3L A;  2KXC A;  3MCA B;  3RMQ A;  4ZGD B;  2IW9 B;  2PQW A;  1VQO Q;  3JB9 F;  2W9Z A;  4QVD A;  3MIA B;  4ROC A;  4M7D C;  5FWB A;  5LMK B;  2QA4 T;  1PD0 A;  4Y91 A;  4AKH A;  1Q86 U;  2ZPH B;  2AZS A;  1YIT Q;  1T3L A;  4J9H A;  4WTO B;  3DLM A;  4JJN K;  4HVU A;  1PNJ A;  3FDR A;  4FYY B;  1M5Q 1;  1Q82 U;  2HQH A;  3EID B;  5CR2 A;  1AOJ A;  2HNI A;  2ZPE B;  2G6F X;  2QEX A;  1M27 C;  3SWN C;  2CUB A;  4M7A F;  4AFQ C;  4BB7 A;  2H3J A;  2A7Y A;  1ZUU A;  2ZPG B;  3L2Z A;  4FYX B;  3LQ5 B;  2DET A;  2M1H A;  4CFN B;  4LDY A;  2IVX A;  1N8R C;  3JRZ A;  1QMZ B;  4PJO F;  1VQL A;  3TNI B;  3THK A;  2IG0 A;  4M7A C;  5HKC A;  1JJ2 P;  4AG2 C;  4FW2 A;  5GAN 2;  4JX6 A;  4JLG A;  4HT8 A;  2X4Y A;  4CC4 B;  2K5I A;  5CQY A;  4RKU E;  3VV0 A;  4A53 A;  4Z02 A;  3FEO A;  4KGZ B;  4XTW A;  2CRE A;  3MET A;  3NTH A;  2C0O A;  2KQW A;  1VQ6 T;  1UJ0 A;  2DBK A;  3VKI A;  1M90 U;  1N8R R;  3CCR A;  4JPB W;  1NPP A;  2LQK A;  1VQN A;  3G4S T;  1Y0M A;  4G6L B;  5BNJ B;  4X34 A;  4J9I A;  2QK0 A;  5D7U A;  4BE1 A;  1WX6 A;  2JUF A;  2X35 A;  1FMW A;  1H25 B;  2DXT A;  4M75 B;  2DLP A;  4YOO A;  4HCZ A;  1N9R A;  4QVZ A;  3M56 A;  2W96 A;  2DEU A;  4QSH A;  1VQ9 T;  3OYA A;  2E41 A;  4OB2 B;  5FRN A;  2GFU A;  2AK5 A;  4HVV A;  3URG A;  1YWO A;  2NLU A;  5FU7 B;  1SRM A;  2G9X B;  1PSE A;  2A37 A;  3EGD B;  1K0S A;  2J6F A;  2LT4 A;  2QQR A;  3I56 T;  3DTO A;  4ANJ A;  2NUT A;  3OMG A;  1Q82 R;  2CP7 A;  5A0D A;  2SEM A;  2DM1 A;  2EIF A;  2RN8 A;  4JJB A;  4ZNX A;  4FL6 A;  2KRS A;  3JCM g;  1N27 A;  3VRY A;  2ED0 A;  4PL6 A;  1QQJ A;  4EC9 B;  1ARK A;  3HL8 A;  2A36 A;  5IF1 B;  4M75 C;  1TFB A;  5I2M A;  4NS5 A;  4ORZ A;  1RUW A;  2RHY A;  2FPE A;  2RO0 A;  2RHX A;  4DQ2 A;  5IH2 A;  4ROD A;  4XK8 E;  3FJP A;  1KSW A;  5EC7 A;  3QBY A;  3RMS A;  2AZV A;  3RGF B;  1OU8 A;  2VAS A;  2RJF A;  4M7D B;  2YLB A;  5GAM e;  1AEY A;  3M4Y A;  4FSS A;  1TTH B;  4F7N B;  1VOM A;  5FRO A;  5GAN 5;  4PKC C;  1T3S A;  2NUP B;  3G71 Q;  2QAZ A;  3X24 B;  2HZY A;  3VKH A;  1S72 Q;  3HHT B;  2PJQ A;  1BU1 A;  2LCS A;  5GAN 3;  1RAI B;  1XJW B;  4KUL A;  1W6X A;  3BE3 A;  2DIL A;  2DZ9 A;  4J6W A;  2LX7 A;  2E5Q A;  3NMZ C;  2NUZ A;  4BUG A;  2DNU A;  2W9F A;  1VIF A;  3CME Q;  3FJ5 A;  2ESW A;  2JS2 A;  2JW4 A;  1JU5 C;  3A1P A;  3CD6 A;  3KUF A;  3GF5 A;  2I53 A;  3UDC A;  1M2V B;  1YCY A;  1BCO A;  1Z9Z A;  2CUD A;  3C0C A;  1D09 B;  4JJD A;  4BY1 X;  5FU7 C;  2C4G B;  1NG2 A;  3PT9 A;  5CEI B;  1VA7 A;  4JRP A;  2UZE B;  1MMA A;  4M7D G;  1O9K A;  3BG5 A;  2HSE B;  4N4I A;  4MDX A;  4OGC A;  2DL4 A;  1X2Q A;  3M03 A;  2CZ7 B;  1RLQ C;  1Y96 B;  4EDU A;  1ZHI A;  3NFC A;  4LN2 A;  1GXI E;  5LJ3 g;  2ZZD A;  2WIH B;  2P84 A;  3K7A M;  1N9S A;  2WMB B;  4C0F A;  2O01 E;  2V1Q A;  4RTX A;  1R0C B;  1I07 A;  2EGE A;  3MP6 A;  1YIT A;  3VS5 A;  3OSS C;  2KBT A;  3UWN A;  1RAD B;  5DLO A;  4PFO A;  1K73 R;  2GGR A;  3KFV A;  1CSK A;  1J3T A;  1UEC A;  1VQ9 A;  1K4U S;  3NDQ A;  2NWM A;  3CMA T;  2RQV A;  4DEY A;  3OYN A;  5FGK B;  2KVQ G;  4EMK A;  5GAN e;  3CMA Q;  2QDY B;  4C92 B;  2AHJ B;  2MIO A;  4FYV B;  4MMK A;  4R55 A;  2C5V B;  1YNZ A;  3JCM J;  2R58 A;  4BY6 C;  3LH5 A;  2EYX A;  2RK1 A;  3JB9 D;  5L2W B;  1PCX A;  1YJW Q;  2FZC B;  2EBP A;  1LOJ A;  1IXD A;  5IXB A;  4OGE A;  5GAO p;  3IQL A;  4CC3 A;  1UG1 A;  1QCN A;  4RCB A;  3RKX A;  1VQM T;  1VQK A;  2UZB B;  1VQM Q;  4E7I A;  2FPF A;  4PJO G;  3LWI A;  4C0G A;  2F5K A;  4EOO B;  2RA2 A;  3HRU A;  2CH4 A;  2K3B A;  2Z0W A;  3QWL A;  1QVP A;  2LNV A;  3X20 B;  1ABQ A;  1QMC A;  2L3R A;  2KDS A;  2CT4 A;  2RHU A;  1WXU A;  2O9V A;  2JJ9 A;  1WPY A;  3UAT A;  1TUG B;  2KE9 A;  4QQD A;  3CEY A;  4WCI A;  3CCM Q;  1HD3 A;  3G1J A;  1HJD A;  2O88 A;  1GBR A;  2R7G A;  4GLK A;  2DD4 A;  2P0P A;  2EKH A;  4BBR M;  3J81 E;  2JTE A;  3JCM d;  3QWY A;  4LUE A;  5LJ5 d;  4LXC A;  3X26 B;  2KRN A;  3OBW A;  1NEG A;  4X1V A;  3GP8 A;  2AKL A;  4Z6Y A;  4BY7 X;  4II5 B;  1H24 B;  3CCE T;  2P0Q A;  3T9N A;  3HRT A;  1UGQ B;  3DOG B;  4YC3 B;  4RCC A;  1XQH A;  3HFO A;  2KGT A;  3E2U A;  3PMT A;  3ME9 A;  1OL2 B;  3VYG A;  4ROE A;  4GLM A;  3RKW A;  5ICP B;  4BDY A;  1O9K B;  1UE9 A;  3QHW B;  1F1B B;  2YDL A;  1RAA B;  3G71 A;  1D3B B;  3I55 T;  1F5Q B;  1AWX A;  2F69 A;  4F7U G;  1VQ7 A;  2CP6 A;  4BCG B;  2K2M A;  2K2V A;  2YLC A;  2L8D A;  2HQX A;  3I55 A;  1KHC A;  3M58 A;  3VS7 A;  1VQ6 A;  2HQE A;  4FYW B;  5CKD A;  5KYY A;  3I56 A;  2LNH B;  3BHV B;  2ENM A;  4Z88 A;  4C92 G;  2CT3 A;  4CRL B;  4M78 C;  4OMP A;  4RTV A;  4YTL A;  1R0B G;  2K9G A;  1H3Z A;  3REA B;  5KYX A;  1VQ5 A;  1NLP C;  2DRK A;  3DB4 A;  1WJQ A;  4M7A G;  1NJI U;  1I81 A;  4M7D F;  2F2V A;  1FMK A;  3GNF B;  3EOC B;  1QVF P;  3VUB A;  1G3N C;  1PRM C;  1U06 A;  2LP5 A;  1RAE B;  3HP9 A;  2LJ3 A;  1KQS A;  1YJN T;  1UHF A;  3CCQ A;  4XU2 A;  2E6Z A;  1WQ7 A;  2OJ2 A;  2DAQ A;  2JM9 A;  5DY9 A;  1UGS B;  3EFS A;  3CCJ A;  2ZCF B;  3RNJ A;  1G83 A;  4OVA A;  2M0Y A;  2RI3 A;  4BCM B;  1WQW A;  2JVV A;  2HMA A;  2DYB A;  5HQ0 B;  1VIN A;  2HDA A;  4AKG A;  4C8Q C;  2E12 A;  4JRI A;  2KXD A;  3Q1J A;  4UC4 A;  3SWN B;  1M8M A;  3EG0 A;  1IRX A;  2RB6 A;  1JB0 E;  3LGF A;  1VQO A;  1OL1 B;  1PSF A;  2VGM A;  3JV3 A;  3DB3 A;  2L0A A;  5C6S A;  5CYI B;  4TVR A;  1R77 A;  2IW6 B;  2RQW A;  4PNO A;  4CC7 A;  5LJ5 g;  3QWX X;  4DBR A;  1ENW A;  3E19 A;  1VQO T;  1FIN B;  5GAO m;  1RI0 A;  4JX5 A;  1T0J A;  2XDP A;  3FRN A;  2A0F B;  2NUP A;  1P5E B;  3CCM A;  4JRQ A;  4R56 A;  5IHY A;  3V7R A;  1UNG D;  2F5T X;  1N6A A;  2W10 A;  1H4L D;  2ATC B;  2LTO A;  4XTV A;  3RR6 A;  1LVK A;  2Y4X A;  1WLP B;  3R6O A;  2QQB A;  1UTI A;  2QYZ A;  3PFS A;  3HFN A;  4EIK A;  1U3O A;  2QQA A;  3OBY A;  4GY5 A;  4EOJ B;  2MMP A;  1GL5 A;  2CGH A;  3FB9 A;  2EQM A;  3H0F A;  3QXE B;  1VQ8 Q;  4XU0 A;  2ROT A;  3A8L B;  1O9S A;  4F6S B;  1GCP A;  3PO3 S;  2EGC A;  4IUT A;  4MZT A;  4JZ4 A;  4BCF B;  2E3H A;  2IN3 A;  1XNI A;  1NJI C;  4EPC A;  2JT4 A;  1Q81 R;  3R6N A;  3JCM f;  1H1R B;  4RTU A;  1QVF S;  2AT1 B;  3A8G B;  4HCC A;  1OI9 B;  3TN8 B;  1K1Z A;  2KR6 A;  2I2L A;  5LJ3 e;  1KIK A;  2HCK A;  3CC4 T;  4EMG A;  2VB6 A;  1E6G A;  4B6M A;  2VKN A;  4ZN3 A;  3CBO A;  4M78 D;  3JCM c;  5EG2 A;  2DIQ A;  1EX4 A;  1H8K A;  1UFF A;  1SRL A;  3M4G A;  3KXT A;  5IDN B;  4BCO B;  4CFM B;  4E7H A;  2FRW A;  4I3Z B;  2QGF B;  3QSU A;  4HCB A;  1PRL C;  2PUK B;  2J06 A;  3MP1 A;  2WSF E;  4FX3 B;  5GAM g;  5LJ5 j;  2W2H A;  4EON B;  4L6V 5;  2F2W A;  1U1T A;  2LQW A;  2CH4 W;  4C0D C;  1QLY A;  4L5G A;  4XQ3 A;  3C12 A;  2DXB B;  1YWP A;  2DL7 A;  4F7U F;  1IGQ A;  1B34 B;  4AFZ C;  2KAF A;  3JB9 J;  4EOQ B;  2EFI A;  3H0I A;  4BCM D;  1D0Z A;  2B86 A;  4E47 A;  2VGN A;  3HBL A;  1Q82 C;  1OKW B;  2C5X B;  1Q95 G;  1X75 C;  1H64 1;  2XI9 A;  5FWC A;  3HPW A;  4YOS A;  2C5O B;  2V26 A;  1YIT T;  1Y7X A;  2D8J A;  2KR3 A;  3S3N A;  5LJ5 e;  1N5Z A;  2WSC E;  4KH0 B;  1MMG A;  5I5Z B;  4J9F A;  1NJI R;  1JXM A;  1OZ3 A;  2JZ2 A;  1JST B;  3CCE Q;  3WXM B;  1ZLM A;  3CMA A;  3OMC A;  4C5H A;  5D6Y A;  2QXF A;  1VQ4 Q;  5HK3 A;  4VUB A;  2RQR A;  3MJX A;  4F16 A;  1GCQ C;  5LJ3 d;  2DMO A;  1WA7 A;  2RJC A;  3VS1 A;  2MI6 A;  1HYO A;  3CC7 A;  2QQ9 A;  4C5I A;  2DTI A;  4C8Q G;  3GLX A;  5CKE A;  3FC3 A;  2KYB A;  2BKD N;  2FPD A;  4BDZ A;  2K3Y A;  5GAM d;  1G8X A;  3MEA A;  1BKB A;  1M3C A;  1H1Q B;  1X6O A;  5HY6 A;  2OTL T;  1H1P B;  4PJO C;  2LX9 A;  4J9B A;  3CCJ Q;  4II1 A;  4BCN B;  3A5Z B;  3E1S A;  3G4S Q;  2VUB A;  2CP0 A;  1QP3 A;  1HXD A;  1IB8 A;  3UPU A;  4CFU D;  4K11 A;  2BS3 A;  1WDX A;  3QO3 A;  5L23 A;  4OML A;  4HA8 A;  3RKY A;  5HNB B;  2WIP B;  2FYK A;  2BE7 D;  3MO8 A;  2WJ9 A;  2F2X A;  2DZC A;  1Y57 A;  2VXF A;  5HVY B;  1R8O B;  1K0X A;  3PMI A;  2LZ6 B;  4F17 A;  2X3W D;  4A4H A;  2HD0 A;  1QKW A;  1MMN A;  3O8V A;  4ZGJ B;  4BE2 A;  3JCM e;  3TSZ A;  2VVK A;  1M2V A;  5D6X A;  2GBQ A;  1M30 A;  4PK4 A;  1VYV A;  2PVG B;  2DKG A;  4J9C A;  1IO6 A;  3BHT B;  4M7A B;  1YJ9 A;  1ZX6 A;  3PGG A;  4N4H A;  3BLH B;  1D1A A;  1JEG A;  3BHU B;  2LC4 A;  3BDU A;  2WPA B;  2V8J A;  3PIP A;  5C0M A;  1JXO A;  4C92 C;  1C0M A;  1WHL A;  4N0A A;  1CKB A;  3BG3 A;  4B9W A;  3DJB A;  4BCH B;  1M1F A;  1TOV A;  1Q7Y R;  2COZ A;  4HNT A;  3VS0 A;  3VUZ A;  1D3U B;  3KBG A;  1OPK A;  2DME A;  3JCM V;  4F6U B;  1KC8 C;  2C6T B;  3SD4 A;  2DD5 A;  2XMF A;  1D0X A;  1KD1 U;  4BCK B;  3OA6 A;  2KT8 A;  3M54 A;  4EMK C;  5AYF A;  2PZ1 A;  2BZX A;  4M77 A;  3BY7 A;  1VQP T;  5EFQ B;  2PUO B;  2O4X A;  3NGP A;  1KQ2 A;  3ZBD A;  4ZN1 A;  3AT1 B;  1E7P A;  5GMK e;  3JCM Q;  5GJW B;  5CIU A;  4M75 E;  4A4K A;  1SEM A;  2XK0 A;  4M75 A;  4HVW A;  2QGG A;  4XTX A;  4BCP B;  2RJE A;  3REB B;  1AZE A;  1NYF A;  1JJ2 S;  1WJR A;  2EAY A;  2DXC A;  4KGX B;  5A0G A;  1NZ9 A;  2BUD A;  3BDL A;  3UA6 A;  2ZPI B;  2C0I A;  3CPW S;  2WHB B;  3CCV Q;  3V8J A;  2J7I A;  2LQN A;  3S6W A;  1W98 B;  4GBQ A;  3OS0 A;  5HBH B;  5DLQ E;  2CZ1 B;  2EGA A;  3CCL Q;  1YIJ A;  1OI1 A;  3L42 A;  1GH6 B;  4M4Z A;  2GF7 A;  1S72 T;  3GPL A;  3EH1 A;  1ZSG A;  5GAO r;  2PNI A;  1AWJ A;  2C06 A;  4ME7 A;  1LCK A;  4OGR B;  1AIS B;  1PKT A;  5DQV A;  1Y07 A;  1RAF B;  2DBM A;  1M1K C;  4C0Z A;  1V29 B;  1ZA2 B;  2DE0 X;  2JTM A;  3N5B B;  4ESR A;  3P8D A;  5GAN f;  4V2S A;  1NM7 A;  4M77 C;  4WF2 A;  2WMA B;  1BU2 A;  4BI3 A;  5J26 A;  4F7U A;  2L3P A;  1UUE A;  2RH2 A;  2PU9 B;  1RAB B;  2FVU A;  1VQN T;  2Y90 A;  1OYX A;  7AT1 B;  5GAN g;  5ACB A;  1BI2 A;  1U1S A;  3MHX A;  2BKZ B;  3H6Z A;  1VYW B;  4IUR A;  2XDD A;  1M1G A;  3BFM A;  2JS0 A;  3ZFJ A;  1FKM A;  5M9O A;  5GMK i;  3EH2 A;  4F7U B;  2QQS A;  1VQ7 Q;  4EOK B;  3A8O B;  4OB3 B;  4L59 A;  3SB2 A;  2YSQ A;  1RAH B;  4OR5 B;  1BI3 A;  2RM4 A;  3OYD A;  1D3B A;  3M0T A;  1G3Y A;  1BK2 A;  1OX8 A;  4NL2 A;  4KUD K;  5CQX A;  1Q81 C;  1ZBJ A;  2KY9 A;  3CPF A;  3LYI A;  5ECA A;  4PJN A;  4LE9 A;  2DJZ A;  1ABO A;  1YJN Q;  5CO7 A;  2HSP A;  1VQ4 A;  3PE0 A;  3OYE A;  4F7J B;  2BE9 B;  3I35 A;  1ACM B;  2DJQ A;  4DOV A;  1I5O B;  1JRI A;  1YI2 T;  5GAO q;  4CFU B;  3I9Q A;  4KT0 E;  4IKF A;  1YJW A;  4ELL A;  4OMQ A;  5DM7 R;  1BB9 A;  2XG8 D;  1YHQ Q;  5LJ5 f;  5KE2 A;  2L89 A;  1EFN A;  3EG3 A;  3CCS T;  1NYG A;  3MY5 B;  4A4G A;  3JCM P;  2YT6 A;  5KYU A;  5IN1 A;  4RG2 A;  4PJO D;  2DTO A;  3MKD A;  4Q5W A;  3QHR B;  3CCU A;  1OIU B;  1AT1 B;  1SSF A;  1KK7 A;  2PK2 A;  5GMK h;  1QP2 A;  3TW7 A;  3EHR A;  1YHQ A;  1PKD B;  2ZPF B;  2RPN A;  2KEA A;  4JRK A;  2E65 A;  3MPU B;  4FT4 A;  3OYB A;  3CCR T;  2FZG B;  1B7T A;  3OYY A;  2K57 A;  1BIB A;  4J7I A;  4LDV A;  1SPK A;  5GAN h;  2COW A;  1VQ8 T;  4J9G A;  3JCM W;  1VQP Q;  3CBP A;  2D0Q B;  3VS2 A;  4IUU A;  3EG9 B;  1VOL A;  4AG1 C;  1OX9 A;  2JMA A;  1TS9 A;  3H4C A;  4C92 E;  5GAO l;  1LPL A;  4C92 A;  2LCL A;  4J7F A;  1W2B A;  1VQL T;  1OUL A;  4ZTF A;  9ATC B;  4BCN D;  1K9M U;  3NTI A; 
#chains in the Genus database with same CATH homology
 3SWN A;  3OBY A;  4GY5 A;  2M1H A;  2MMP A;  4LDY A;  1N8R C;  1QW1 A;  2MF2 A;  2CGH A;  3JRZ A;  4PJO F;  3CCU T;  1VQL A;  3FB9 A;  2EQM A;  5GAM f;  2IG0 A;  2L5Q A;  4MFD A;  4M7A C;  3LLR A;  2LDM A;  1ZQ1 A;  5HKC A;  3QXE B;  4XU0 A;  2X4X A;  2IVW A;  3JAM E;  3A8L B;  4KUI A;  1VQP A;  3CD6 T;  1O9S A;  5J3B A;  5GAN 2;  3CCS A;  4JX6 A;  2B8A A;  2R5M A;  4JLG A;  1W4S A;  2X4Y A;  2G77 A;  4HT8 A;  4IUT A;  2K5I A;  4MZT A;  5CQY A;  4RKU E;  4PJO E;  4J8O A;  3VV0 A;  4A53 A;  4Z02 A;  1XTD A;  3FEO A;  5LJ5 h;  1KD1 C;  1XNI A;  2M0O A;  1NJI C;  3FLG A;  4XTZ A;  4XTW A;  4EPC A;  3PIO A;  3MET A;  3NTH A;  3JCM f;  3CCJ T;  5FRM A;  2KQW A;  3HRS A;  1VQ6 T;  1QVF S;  3VKI A;  3A8G B;  4O6J A;  1Q81 U;  1K73 U;  1FWZ A;  1M90 U;  4HCC A;  1Q7Y U;  2E6N A;  4A4F A;  1K73 C;  2KR6 A;  3CCR A;  2I2L A;  5LJ3 e;  1NPP A;  1UGP B;  2LQK A;  1VQN A;  2Y4Y A;  3G4S T;  4HNV A;  2RK2 A;  4X34 A;  3CC4 T;  1U8R A;  4EMG A;  3CPW A;  2HAX A;  4BE1 A;  3L2V A;  2JUF A;  3X28 B;  1MGQ A;  2X35 A;  5A0L A;  4PLI A;  4ZN3 A;  3CBO A;  4M78 D;  2DXT A;  4M75 B;  3JCM c;  2RI2 A;  5EG2 A;  3L2R A;  2DIQ A;  4HCZ A;  1N9R A;  4QVZ A;  3M56 A;  3WVD B;  3ZEH A;  3JB9 I;  4QSH A;  4CI0 C;  1VQ9 T;  3OYA A;  3M4G A;  2E41 A;  4OB2 B;  1G3W A;  2GFU A;  2JTF A;  1Q7Y C;  3URG A;  5FRN A;  3JCM b;  2NLU A;  5LL6 S;  5A2Q E;  3KXT A;  5FU7 B;  3OW2 S;  2QF7 A;  3M55 A;  4M7D A;  4FT2 A;  1PSE A;  2LQ8 A;  3MEW A;  2GCX A;  4O5V A;  1Y71 A;  5L8R E;  3OY9 A;  4E7H A;  2LT4 A;  2QQR A;  4LD6 A;  3I56 T;  4JUV A;  3QSU A;  4HCB A;  3JB9 H;  2CYZ B;  2PUK B;  5FU6 B;  3OMG A;  4HNU A;  2HBP A;  5KCH A;  5A0D A;  4NL3 A;  1QLB A;  2DIG A;  3MP1 A;  2XDB A;  2WSF E;  2ZZD B;  4DOW A;  1ZBX A;  2EIF A;  5GAM g;  4FL6 A;  5LJ5 j;  4JS5 A;  2GQV A;  3JCM g;  4L6V 5;  1N27 A;  2BS4 A;  3QZ5 B;  1U1T A;  3P8H A;  3L2Q A;  4C0D C;  4PL6 A;  5KCO A;  3CCL A;  3HL8 A;  4L5G A;  4XQ3 A;  3C12 A;  4M75 C;  2DXB B;  5I2M A;  4NS5 A;  1K9M C;  3OYF A;  4F7U F;  1B34 B;  3JB9 J;  2KAF A;  2LCC A;  2RHY A;  3E9G A;  2EFI A;  5GAO n;  2X4J A;  2RO0 A;  1VQ4 T;  2RHX A;  4DQ2 A;  2WSE E;  4E47 A;  4XK8 E;  2VGN A;  2XIC A;  3FJP A;  3HBL A;  1Q82 C;  4LDU A;  3PNW C;  2XI9 A;  1X75 C;  1H64 1;  3QBY A;  1G3S A;  1I4K 1;  4IUP A;  4J5Y A;  3ASK A;  3RMS A;  1O75 A;  3HPW A;  4X9C A;  2RJF A;  2OTJ A;  4M7D B;  4RG8 A;  2YLB A;  1YIT T;  1Y7X A;  3QII A;  5GAM e;  1UGR B;  2GFA A;  3M4Y A;  3S3N A;  5LJ5 e;  2WSC E;  5FRO A;  3J80 E;  3CC2 A;  4XU3 A;  5GAN 5;  4PKC C;  1BI0 A;  2VXE A;  4M77 B;  1OZ3 A;  3X24 B;  1YIJ T;  2JZ2 A;  3BG9 A;  5GAN 4;  4C5G A;  3HSB A;  3VKH A;  5EJC A;  3QDR B;  3HHT B;  4M77 F;  3CC4 A;  3WXM B;  4BI4 A;  3CMA A;  4JX4 A;  3OMC A;  2E10 A;  5GAN 3;  2QA4 A;  2VC8 A;  1Y96 A;  4C5H A;  5FLX E;  5D6Y A;  4KUL A;  2QXF A;  5GAN d;  2EJF A;  5IAY A;  5GAM j;  2DZ9 A;  4J6W A;  2E5Q A;  2VYT A;  4ZTJ A;  4FM4 B;  5HK3 A;  4VUB A;  4BUG A;  3RUX A;  2DD5 B;  1B34 A;  3CCQ T;  1VIF A;  2WAC A;  5LJ3 d;  5KH6 A;  2R57 A;  4IUQ A;  2VV5 A;  5IT9 E;  2RJC A;  2QQ8 A;  3FIF A;  2MI6 A;  5CVI A;  3CC7 A;  2QQ9 A;  4C5I A;  1G5V A;  2DTI A;  5GAN 6;  4MDW A;  3GLX A;  5CKE A;  4C8Q G;  3A8M B;  5CKF A;  2BKD N;  3FC3 A;  3CME T;  1I5L A;  2M16 A;  4BDZ A;  5GMK j;  2K3Y A;  2QTX A;  3KUF A;  5GAM d;  4ELJ A;  1NE8 A;  3GF5 A;  3MEA A;  1BKB A;  3UDC A;  5J39 A;  1X6O A;  5HY6 A;  2OTL T;  1YCY A;  3QJY A;  4PJO C;  2LX9 A;  5FU7 C;  4JS4 A;  3CC7 T;  4P5N A;  5CCA A;  3AHU A;  2OTJ T;  4II1 A;  3PT9 A;  1XOV A;  3A5Z B;  2PVO B;  4JRP A;  3V7S A;  4QVC A;  3E1S A;  3CBM A;  4M7D G;  3BG5 A;  2D9T A;  2VUB A;  3DKM A;  4BI8 B;  2CZ0 B;  1QP3 A;  2FB7 A;  2V8K A;  4N4I A;  4OGC A;  3LH0 A;  4ELY C;  3TU4 K;  3QYE A;  4MDX A;  1TH7 A;  1HXD A;  4M78 B;  1VQ7 T;  2CZ7 B;  2OAU A;  1Y96 B;  4JLI A;  2KSS A;  4EDU A;  3UPU A;  3A8H B;  2BS3 A;  2E64 A;  1ZHI A;  3NFC A;  1GXI E;  3GIB A;  3QO3 A;  4QQG A;  2EQJ A;  2KMG A;  5LJ3 g;  4HA8 A;  2ZZD A;  3RKY A;  1OZ2 A;  4C92 D;  4PJO A;  1N9S A;  2FYK A;  4N4G A;  4C0F A;  3MO8 A;  2O01 E;  2WJ9 A;  2DZC A;  2MWP A;  5GAM h;  2VXF A;  1R8O B;  2EJG A;  2CKK A;  2XID A;  3MP6 A;  3PMI A;  2KMT A;  1YIT A;  4A4H A;  2HD0 A;  3O8V A;  4ZGJ B;  4BE2 A;  4DA4 A;  3JCM e;  4NC6 A;  3OSS C;  3UWN A;  2EKO A;  2K3X A;  5D6X A;  5DLO A;  4FSX A;  3QYB A;  1LNX A;  3G4S A;  4BY6 B;  2PVG B;  2DKG A;  1VQ9 A;  4M7A B;  2LRQ A;  3QPH A;  1YJ9 A;  3CMA T;  3UT1 A;  3G7Z A;  3PGG A;  4N4H A;  3OYN A;  4F7U E;  4M75 G;  4OF1 A;  3L2U A;  4M7A D;  2KVQ G;  2LC4 A;  4EMK A;  5GAN e;  3QG1 A;  4C0D B;  4C8Q B;  3BDU A;  2V8J A;  3VKG A;  3PIP A;  5C0M A;  2QDY B;  4MIM A;  2AHJ B;  4OB0 B;  4C92 B;  4C92 C;  4MMK A;  3JCM X;  1VQ5 T;  4C8Q F;  2FHD A;  4N0A A;  4CRI A;  5GAN j;  4A4E A;  4C8Q D;  4C92 F;  4R55 A;  3BG3 A;  4B9W A;  2PVD B;  4M77 G;  4E7J A;  3JCM J;  5CKH A;  3L1A A;  5GMK m;  1M1F A;  2R58 A;  1QVG S;  3J7A F;  4BY6 C;  2DD4 B;  4HNT A;  1LJO A;  2QFZ A;  2RK1 A;  3VUZ A;  3CME A;  1M9S A;  4EMH A;  3KBG A;  3JB9 D;  4PJO B;  3LX7 A;  3JCM V;  1JBM A;  1LOJ A;  1KC8 U;  3KHI A;  4M7D E;  4OGE A;  1KC8 C;  5GAO p;  3SD4 A;  3RKX A;  4RCB A;  1VQM T;  2DD5 A;  3RIR A;  4BBS M;  4BE0 A;  1KD1 U;  1VQK A;  1K8A C;  3QYG B;  3VYG B;  3OA6 A;  4BD3 A;  3M54 A;  2G3R A;  4NOY A;  5AYF A;  4EMK C;  5CAI A;  2LVM A;  3TW6 A;  4M77 E;  2DVE A;  3G71 T;  4E7I A;  4ATO A;  4M77 A;  3BY7 A;  1VQP T;  4PJO G;  3LWI A;  1VQ8 A;  3OYH A;  4C0G A;  2F5K A;  2PUO B;  2O4X A;  2RA2 A;  1I8F A;  3ZBD A;  3HRU A;  2DPP B;  3QHS A;  1KQ2 A;  4ZN1 A;  3JSC A;  3M5A A;  1E7P A;  5GMK e;  3JCM Q;  5CIU A;  1VQM A;  3QWL A;  1QVP A;  2FL7 A;  2LT1 A;  2XK0 A;  4M75 E;  2LNV A;  3LW5 E;  4M75 A;  4A4K A;  3G6E A;  4XTX A;  1VQK T;  5I21 A;  5HK0 A;  2RJE A;  3X20 B;  4J6X A;  3OYL A;  1YJ9 T;  3VJP A;  4M78 F;  1JJ2 S;  1WJR A;  2QEX T;  3CD6 A;  2CS7 A;  2DXC A;  2EAY A;  3SFM A;  2EJ9 A;  2L3R A;  2KDS A;  4J83 A;  5A0G A;  2RHU A;  3CCV A;  1NZ9 A;  1KHI A;  1WPY A;  2BIV A;  2EQK A;  2CZ6 B;  3OW2 A;  2BUD A;  3BDL A;  2ZGW A;  3CEY A;  4QQD A;  2ZPI B;  3CPW S;  3G6E T;  5KE3 A;  3V8J A;  2ZPB B;  2K5F A;  3S6W A;  3CCM T;  4GLK A;  2DD4 A;  2P0P A;  4EMK B;  4IUV A;  5CK9 A;  3OS0 A;  4HT9 A;  1P92 A;  5FU6 C;  4A54 A;  3GNG A;  4BBR M;  5DLQ E;  3J81 E;  3JCM d;  5LJ5 d;  3E9F A;  4E7K A;  2CZ1 B;  4AI6 A;  3JCM h;  3X26 B;  5CKB A;  4BAC A;  2RJD A;  3OBW A;  3GP8 A;  1YIJ A;  4QW2 A;  4B9X A;  2JN0 A;  1MHN A;  1OI1 A;  3L42 A;  4Z6Y A;  3CCL T;  2E1H A;  2QDJ A;  1FXX A;  2GF7 A;  1S72 T;  3GPL A;  3CCE T;  2P0Q A;  1YBY A;  3EAE A;  3T9N A;  2YHT A;  1UGQ B;  2RI5 A;  3HRT A;  5I2S A;  1BIA A;  4RCC A;  5GAO r;  1XQH A;  2EQU A;  3X25 B;  2C06 A;  3HFO A;  4ME7 A;  4XTU A;  1Q86 C;  3PMT A;  3INZ A;  1Y07 A;  3ME9 A;  3MEV A;  4OP0 A;  1YJN A;  3VYG A;  1M1K C;  4MML A;  3RKW A;  1HK9 A;  2JOY A;  3M59 A;  4C0Z A;  2P4T A;  4BDY A;  2DXU A;  2JNG A;  1V29 B;  4PLL A;  2KK4 A;  1WNL A;  2JTM A;  2O4X B;  1QVF A;  1BYM A;  2R5A A;  1D3B B;  2XU8 A;  5GAN 8;  3N5B B;  3MP8 A;  3G71 A;  2RHZ A;  1UEB A;  3P8D A;  4C5E A;  5GAN f;  3I55 T;  4LD9 K;  4V2S A;  4M77 C;  1M8V A;  4WF2 A;  3QZ9 B;  2V8I A;  4E7L A;  1VUB A;  2RHI A;  4M78 A;  4BI3 A;  1KG1 A;  2F69 A;  2DTH A;  2K5L A;  5J26 A;  4F7U A;  4M78 G;  2MAM A;  3TEE A;  4RMO A;  5GMK l;  2RH2 A;  2PU9 B;  3C95 A;  2FVU A;  4FU6 A;  3HB9 A;  1UB4 A;  4D6W A;  4F7U G;  1VQN T;  3F70 A;  2Y90 A;  5D6W A;  1VQ7 A;  4M6V A;  2DXC B;  1OYX A;  2YRV A;  3OB9 A;  5GAN g;  4OB1 B;  2M9U A;  1M1K U;  2K2V A;  1BI2 A;  1U1S A;  2YLC A;  4LOC A;  2HQX A;  2L8D A;  3OYM A;  3QUI A;  1KHC A;  4HL4 A;  3MHX A;  3P8B B;  3I55 A;  3H6Z A;  3BW1 A;  3M58 A;  2MWO A;  1VQ6 A;  4IUR A;  2HQE A;  2XDD A;  5CKD A;  1M1G A;  3BFM A;  1N8R U;  3ZFJ A;  1FKM A;  2QI2 A;  5M9O A;  5GMK i;  1WGS A;  3I56 A;  4MZM A;  1NPR A;  4F7U B;  3EFR A;  2QQS A;  3QYH B;  1EIF A;  3OYG A;  4Y28 E;  3PTA A;  3NTK A;  3A8O B;  4C92 G;  4OB3 B;  3M53 A;  4J6Y A;  4L59 A;  3MEU A;  3SB2 A;  1YHQ T;  4M78 C;  1BI3 A;  2DEQ A;  3HO8 A;  1D3B A;  2DK3 A;  2RM4 A;  4OMF B;  4YTL A;  3OYD A;  4LDX A;  4LDW A;  3OS2 A;  1BI1 A;  4QQ6 A;  2X4W A;  3TRE A;  1VQ5 A;  1G3Y A;  4M75 F;  3RER A;  1H3Z A;  1WJQ A;  3DB4 A;  2EYQ A;  4NL2 A;  4M75 D;  1WJS A;  3V7C A;  4X9D A;  2XKO C;  1K8A U;  1NJI U;  1I81 A;  4KUD K;  4M7A G;  1KQ1 A;  5CQX A;  3OYJ A;  2OTL A;  1KQS S;  1Q81 C;  1M90 C;  4M7D F;  1IZ6 A;  2KY9 A;  4C8Q A;  1VIE A;  3CPF A;  3LYI A;  4XAX B;  1G3T A;  2EWN A;  3OQ5 A;  3M9Q A;  3GNF B;  1YJW T;  3RES A;  1W2B S;  2DJZ A;  3VUB A;  3S3O A;  3HKS A;  5CO7 A;  2K4Y A;  1VQ4 A;  1RL2 A;  3OYE A;  3HP9 A;  5LJ3 j;  1KQS A;  3OSV A;  1YJN T;  4DOV A;  1JRI A;  5LJ3 f;  3CCQ A;  1YI2 T;  3QJ6 A;  4FIB A;  4MZP A;  3HZJ A;  4XU2 A;  2E6Z A;  3TCJ A;  5GAO q;  3L2W A;  3CXC S;  2E70 A;  1WQ7 A;  2DO3 A;  4KT0 E;  4IKF A;  4XTY A;  1YJW A;  4MFE A;  3CCE A;  2DAQ A;  5DY9 A;  1S72 A;  1IRE B;  3SDZ A;  5DM7 R;  3LWH A;  1UGS B;  2XG8 D;  3EFS A;  3V8L A;  5LJ5 f;  3CCJ A;  3WVE B;  2ZCF B;  1FX7 A;  2L89 A;  3VYH B;  3M57 A;  5KE2 A;  4OVA A;  3OS1 A;  4M78 E;  4M77 D;  3CC2 T;  3CCS T;  2RI3 A;  4A4G A;  3JCM P;  4AKI A;  5GAN 7;  5IN1 A;  1WQW A;  2JVV A;  1AHJ B;  4RG2 A;  2DTO A;  4C8Q C;  2D6F A;  4HKE A;  4AKG A;  4N0A C;  2E12 A;  4PJO D;  4JRI A;  4Q5W A;  3OYC A;  3LGL A;  3JB9 G;  3OYI A;  3CCU A;  1SSF A;  3Q1J A;  4UC4 A;  3GOX A;  3SWN B;  3S3M A;  3DLL A;  5GMK h;  4JDS A;  3H8Z A;  5LJ3 h;  2RB6 A;  1QP2 A;  1M4Z A;  4ELZ C;  3TW7 A;  1DJ7 B;  1JB0 E;  1YHQ A;  2BS2 A;  1X01 A;  3LGF A;  1VQO A;  2ZPF B;  3CCV T;  1PSF A;  4JRK A;  2E65 A;  2A3L A;  3MCA B;  4FT4 A;  3RMQ A;  3OYB A;  3CCR T;  4ZGD B;  2VGM A;  2XD0 A;  3DB3 A;  2PQW A;  3OYY A;  4KBM B;  5C6S A;  2K57 A;  4TVR A;  3ER0 A;  3JB9 F;  1BIB A;  4J7I A;  4LDV A;  4PNO A;  4QVD A;  5LJ5 g;  4M7D C;  5GAN h;  4JRQ A;  4ZGE B;  2QA4 T;  3QKJ A;  3E19 A;  4Y91 A;  4AKH A;  1VQO T;  1Q86 U;  1VQ8 T;  2ZPH B;  3JCM W;  3CBP A;  3DL1 A;  4M7A E;  5GAO m;  1QVG A;  4M7A A;  1JJ2 A;  2D0Q B;  3VU3 C;  1RI0 A;  4JX5 A;  4XU1 A;  3CXC A;  4IUU A;  3DLM A;  2XDP A;  4JJN K;  3FRN A;  2DXB A;  1YI2 A;  3FDR A;  1M5Q 1;  4C8Q E;  1Q82 U;  3H4C A;  3CCM A;  3OS5 A;  4C92 E;  5CR2 A;  5GAO l;  4R56 A;  2HNI A;  2ZPE B;  3V7R A;  4C92 A;  3SWN C;  2QEX A;  4M7A F;  2F5T X;  1N6A A;  2LCL A;  2XHC A;  2H3J A;  4J7F A;  4BB7 A;  1W2B A;  2P0K A;  1VQL T;  2A7Y A;  3L2Z A;  2ZPG B;  4HLQ A;  2LTO A;  4XTV A;  3V8K A;  3OYK A;  2Y4X A;  4ZTF A;  3R6O A;  3C4S A;  2RD1 A;  3C94 A;  2QQB A;  3PFS A;  3HFN A;  2QQA A;  1K9M U;  4M7D D;  3NTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...