3WVDB

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 50 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
molecule tags Lyase
source organism Rhodococcus erythropolis
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3wvdB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3wvdB02
1QP3A 3QZ9B 3X25B 1GXIE 2QDYB 4OB1B 2ZPBB 3QXEB 3A8MB 1UGQB 2ZPEB 2O01E 4L6V5 3VYHB 2DD5A 2ZCFB 2DD5B 4ZGDB 2DXCA 3X26B 4XK8E 2CZ1B 2PUOB 3A8HB 2PVOB 2D0QB 4OB3B 2DPPB 2DXBB 2WSCE 2PUKB 4OB2B 2ZZDA 3X24B 1AHJB 2ZZDB 1IREB 2ZPHB 2WSEE 3QYGB 2DD4A 3LW5E 1JB0E 2PU9B 1PSEA 2CYZB 3VYGB 3VYGA 4FM4B 1PSFA 2CZ7B 4RKUE 3X20B 5L8RE 2ZPFB 1DJ7B 3HHTB 4ZGEB 4ZGJB 3X28B 2WSFE 1UGPB 2CZ6B 2PVDB 1QP2A 1UGRB 4KT0E 2AHJB 2CZ0B 4OB0B 3A8OB 3A8LB 2ZPGB 3QYHB 3QZ5B 1V29B 1UGSB 2DXBA 4Y28E 3A8GB 2DD4B 2DXCB 2ZPIB 2PVGB 3WVEB 3WVDB
chains in the Genus database with same CATH superfamily
2LP5A 1B34B 2V22B 3DJBA 3CCST 1KQSP 4BCNB 3VRYA 4JRQA 2PTKA 3RKWA 1E7OA 1K4US 1OPLA 2GTOA 2X4XA 2DTHA 1SF9A 3QXEB 1MUZA 1UJYA 2L3RA 1W2BA 4EOMB 3KBGA 3BDUA 4IUTA 3JCMe 1VQ8Q 4XU0A 2FPDA 4OMMA 3CMET 3G4ST 1KD1R 3KHIA 4A4GA 4HVWA 1TXQA 2PVOB 5IHKA 4YOSA 4HA8A 2JMCA 2LNVA 3CCSQ 2DPPB 3RUXA 4OB2B 2JW4A 1MHNA 5LJ5j 1ZSZC 1LOJA 1Y7XA 4PJJA 1SG5A 5GAMg 4WF2A 1RABB 4KGVB 4F7SB 2PU9B 4J9BA 4BBRM 4BCIB 4CC7A 2DO3A 2MMPA 2CZ7B 4RKUE 3CPWA 2LQKA 3RR6A 5GAN2 4M7DB 4KBMB 2HQXA 3CCRA 5GAMd 1WJQA 2YDLA 2JJ9A 1DJ7B 4HCKA 3CCRT 2QGFB 2C06A 3PFSA 2FZGB 4AKGA 4IUQA 4TVRA 4E7LA 1JKWA 1ARKA 2C0TA 2WACA 1QP2A 4EOQB 4M7AF 4E2FB 1WFWA 3I5RA 4M78B 2NWMA 2VUBA 1UE9A 3G4SQ 2ZPGB 1YIJT 5HK0A 1UGSB 2XDDA 3IQLA 3CCUT 3A1PA 2Z0WA 4IIMA 3JB9G 2YSQA 1RAGB 1MMNA 1NEGA 2JN0A 4I3ZB 2F1LA 1W70A 4GLKA 2FO0A 2LCSA 2PVGB 4CFMB 3SWNA 2RJDA 4HNUA 4BCND 5ECAA 2KGTA 3M0RA 2KK4A 4AKHA 1VIEA 3NTHA 2LJ0A 2QDYB 4OB1B 3S3NA 2EQKA 3U23A 3JB9I 2RHZA 2IN3A 2JTEA 1BB9A 3OW2P 1NJIR 2XDBA 1XJWB 3OYKA 3VUBA 3PNWC 2DD5A 1WJSA 3GNGA 5CR2A 4C8QG 3EG2A 3RMQA 4XK8E 4RTWA 1GY3B 3CD6T 2JUFA 2CP7A 2DE0X 2IIMA 1KFZA 2K57A 3E19A 3REAB 4EOPB 2DL4A 1ZBXA 2QQAA 1YHQA 3G71Q 1G2BA 1TWBA 3VRZA 3CCUQ 2QGGA 1VQOA 1M2OA 2EGEA 2EVRA 3FRNA 4C92C 5GANe 2DL5A 3C94A 4HVUA 4IIOA 4AFSC 1YHQT 3VS2A 3HO8A 4DA4A 1RACB 4FM4B 4C8QB 1SRMA 5J26A 4PJOE 5IH2A 4OMNA 5HY6A 2QQSA 4DBFA 1OI1A 2JM9A 1K8AR 1D1BA 4IUUA 3EAEA 3EG3A 2K2MA 5LJ3d 4BB7A 2R58A 1VQMQ 2P84A 3UA6A 2AZVA 2XK0A 3QO3A 2HZYA 4JJNK 4JX4A 3TEEA 3JB9F 3MI9B 3I56Q 4A63B 1VQ6T 3BY7A 2V1RA 3FEOA 4F14A 3MP1A 4OB0B 2VWFA 2EW3A 2DX1A 2A3LA 4ELLA 2LC4A 3LGLA 3O0GD 1Y07A 4ZN3A 2COYA 3GP8A 3JSCA 4Y28E 4HCZA 1I1JA 4CFXB 3CPWS 2BZYA 1WA7A 2W10A 1OKWB 3CBPA 1Q82C 2EJ9A 5M9OA 2C5OB 1IB8A 4FCYA 1PM3A 1QP3A 3VUZA 2DXTA 2ENMA 3CBOA 5CKFA 2JTMA 3A5ZB 2KI7A 2C4GB 1PKDB 5AT1B 4WTOB 1H4LD 3BDLA 2EWNA 4JLGA 2MCNA 2ZPEB 4L6V5 1NZ9A 1I07A 2O4XA 5HBHB 1VQ4Q 2CP2A 2J6KA 4ZTJA 4XTZA 1OYXA 5D6XA 2ZGWA 1GUXB 4ZGDB 4CFVB 1NE8A 5CKDA 4HLQA 4J9FA 3EHQA 2YUPA 5CKEA 4M7AE 4X9CA 5BNJB 1JBMA 5L23A 5KYXA 3OYEA 2UZLB 2DJZA 2P4RA 1QVFS 2CP5A 1V76A 2NUTB 4D6WA 1Q81R 1AHJB 2ZZDB 1HYOA 3M4YA 2KAFA 1KD1U 5LJ3g 2NUZA 1BKBA 2WPAB 1W2BS 2M02A 3OA6A 3OW2A 3POMA 1PSEA 4HL4A 2FVUA 1YWPA 2MAMA 3MO8A 3K7AM 4PFOA 1B07A 4JRIA 1GL5A 2Y90A 2AK5A 1M8VA 4HT8A 2XI9A 4R56A 2CT3A 3FDRA 4JX6A 2W96A 2DKGA 2KY9A 3NHNA 4ELYC 3HPWA 1IHWA 3OSVA 2M9UA 1T3SA 4FSSA 4ZN1A 3SD4A 3L2WA 4CRLB 3CCSA 2E64A 2O9SA 1KHCA 4PJOG 1AVZC 4EPCA 1WIEA 2XMFA 5FROA 2B8AA 3AT1B 1ZQ1A 1FINB 4OMLA 1YHQQ 2DM1A 2DYIA 5A0LA 3M0QA 2D6FA 4JUVA 4KH0B 1WZOA 4EMGA 2DRMA 4LDVA 1K73U 2LQWA 4C8QF 3QYBA 2JOYA 1IRXA 1YITA 3HRTA 2DBMA 1R77A 1KHIA 4C92B 5GMKi 2M1HA 3EH1A 4HNTA 2MWPA 2BE9B 4C92F 5FLXE 2RHYA 1H1SB 1WXTA 3VYHB 1FVVB 4KRCB 3QWXX 3URGA 3CC4A 1M1FA 2RI3A 2RK1A 3V8LA 2UUEB 1Q82U 3KFVA 2CCHB 2DBKA 4CXAB 1VQ6Q 3GF5A 4Y72B 5GAN3 1H28B 1JJ2A 2NYSA 4M77F 2DXBB 2K6DA 3NDQA 4OGRB 1AWJA 1H1RB 1YI2Q 3ULRB 4LDUA 3META 1WI7A 4DEXA 2D9TA 2RHXA 2RQUA 4JRKA 2ECZA 3OQ5A 4BY1X 1NYGA 3VS4A 1K0SA 3VS3A 2AKLA 4LD9K 3CXCS 3HRUA 2R5AA 2QTXA 3H9NA 4BE0A 4O5VA 4M77E 1IZ6A 4C5GA 3DLMA 3S3OA 3NTKA 3V7CA 1YN8A 3OYGA 2Y4YA 3RESA 1AISB 2BZXA 1Q86C 1VQ4T 4OR5B 1UGRB 1IHVA 1R0CB 5GMKm 5I5ZB 2PNIA 1ZP2A 2L3SA 4J9DA 2CZ0B 5CAIA 2E12A 1M30A 3OYDA 1FMVA 1BU2A 1YCYA 5KYYA 1M2VA 2OTLT 1K76A 2LW4A 3M0UA 5GJVB 2DZ9A 5KYXB 1VYUA 3JV3A 4CFWB 1TSFA 4LDYA 3G4SA 3DDQB 4C92D 1VQPA 4M7DC 5DLQE 3P8DA 2YRDA 2KXDA 1OOTA 3LX7A 1K8AU 1PKTA 2DMOA 1X6GA 1HD3A 4JJBA 3MY5B 3RGFB 4C0DC 4XU1A 4RTUA 4HKEA 3BHUB 2LT4A 2ZPBB 2X51A 1UGQB 3I55T 5IDPB 1U5SA 5I2SA 2KYBA 1ZSZB 2QEXT 4M7DE 1UNHD 2VKNA 4ELJA 3MY1B 2F5KA 2ROTA 1D0XA 2K3BA 4MMLA 1H27B 1VQNQ 4OP0A 1Q7YC 1K1ZA 1SKUB 4FX3B 4UN0A 4RUGA 4YOOA 5CIUA 1VINA 5CYIB 1PNJA 5GJWB 3VV0A 1M3AA 3M55A 2DLPA 1O9KA 1VQ5A 1QQJA 3QHRB 4BCPB 1UG1A 1V1CA 1N6AA 5GMKj 3L2QA 1RAAB 2FZKB 4LOCA 1YJNA 1VQKQ 1RI0A 1S1NA 1W98B 2CJMB 2IG0A 3HKSA 1UHCA 3LH5A 4M78G 3CCEA 2V26A 3AHUA 4C0DB 4F70B 4KGZB 3B57A 3CC7T 2YHTA 3SB2A 4J6WA 1F5QB 3MIAB 4QVZA 3VS7A 4M7AD 1VUBA 3H0FA 5J39A 3I55A 1PHTA 3PMTA 1NBEB 1X6BA 2OTJT 1D3BB 4MMKA 5GAMh 3UPUA 2KROA 4Z88A 4E7JA 1YNZA 1WHJA 2DYBA 4F7LB 1ZHIA 3L1AA 3PE0A 1SPKA 2D0NA 4M75A 3JB9H 1YJ9Q 4LDWA 3CCQT 4VUBA 2HNIA 1KD1C 4XTUA 1N8RU 3OYNA 4BCMB 4EMHA 1X01A 1QVGA 4C8QE 3TVTA 3JCMV 1UJ0A 1N9SA 1Y96B 2L2PA 1I81A 2EQIA 2E70A 1Q86R 1NG2A 5I22A 2PHGA 1M1KC 4J9GA 4M75F 3RNJA 2ABLA 1VOMA 3LLRA 4GBQA 4M75B 3VS6A 1VQMA 2L89A 4YTLA 2KRMA 4E6RA 3JCMQ 3HL8A 2FHDA 5HNBB 1RL2A 5DY9A 2WMAB 2HEQA 5LMKB 1QLYA 4BI4A 1JJ2P 3KUFA 2XG8D 1H1QB 1YJWT 4Q5WA 4EONB 1TH7A 2HDAA 3C4SA 1XQHA 1VQOQ 5KYUB 4DEYA 1JEGA 2M0YA 2YWWA 2YRVA 2JGZB 1AZGB 4F7UF 1VQ7A 4IUVA 2W2HA 4II1A 4OF1A 3G71A 3DDPB 1QCOA 2QYZA 1VQLT 1QW1A 2BPMB 4KGXB 2R57A 1VQ9A 5GAMj 5HQ0B 4EORB 1IREB 2OAUA 3CC7Q 3PO3S 3OYHA 4M75E 3TN8B 1ZUKA 3HTRA 4NOYA 4B9XA 4DOWA 3INZA 2EGCA 2UZBB 2HSEB 1NM7A 2RQWA 3LQ5B 2EYWA 3CMAQ 4ATOA 3VYGB 1GCQC 2QGSA 3JAME 1NEBA 4F7UB 4HNVA 4J9CA 3HSBA 2DF6A 1H26B 1UUEA 2V8JA 1U1SA 4QKUA 2K7AA 5GAOq 1I5OB 1AT1B 4ZGEB 3OS5A 3JCMh 2EKHA 4A4EA 4F16A 3L2VA 1KSWA 4IKFA 4DOVA 1AD6A 1H92A 4AFZC 2CREA 2XDPA 5HKCA 1VQKA 2G9XB 2LZ6B 4PKCC 4XTWA 2K4YA 3M58A 1S72A 3OYJA 3JCMW 4FU6A 3CC2Q 3H0HA 2KR3A 3EG9B 1U3OA 2WIHB 1JXMA 2HAXA 1OQKA 1WLPB 5GAN7 5ACBA 2HL3A 3EG0A 4PL6A 5LJ3e 3CCMT 4AMCA 3ER0A 2MF2A 2QA4T 5FU7B 4BACA 1C0MA 2EYYA 2EQUA 3BW1A 3BFMA 1AWWA 5IHIA 3QSUA 2JS0A 4MZTA 2I0NA 2PK2A 1GUXA 3EG1A 1XNIA 3TCJA 3UDCA 2E6ZA 1OIYB 4C5HA 2G77A 2CZ1B 1KC8R 4N4GA 3BHTB 2OX7A 4ESRA 5FU6C 1VQPQ 2AT1B 4C92A 3J7AF 2H8HA 1QLBA 4GY5A 1YJ9T 3X24B 2L5QA 3R6NA 2E6NA 1LJOA 2QK0A 3QYGB 1BI2A 2DJQA 3DKMA 2KNBB 3MEWA 2H3JA 1E6HA 2D8JA 2YUOA 2L8DA 1YI2T 3OYMA 2KMTA 2D1XA 5I2MA 1K9MU 2BS4A 2X4YA 3C12A 5L8RE 2DXUA 4TTHA 2ZPFB 4D8KA 3KXTA 4OMQA 2VV5A 2E4HA 3V7RA 4EIKA 3F5XB 2EPDA 4N4IA 2RH2A 4CC3A 1PCXA 1UGPB 2VB6A 5FU7C 6AT1B 1MMGA 1I5LA 3A98A 2K5LA 2K5FA 4NC6A 1U1TA 2CDTA 2V8KA 4QQGA 3TQ7P 3CXCP 1W1FA 2HL5C 1K73R 3QJYA 2X3WD 1N9RA 4C8QA 5HBJB 4M7DF 1HK9A 3O5ZA 3MEUA 2OTJQ 3EGDA 3RBBB 1OIUB 4FYWB 1Q82R 4LE9A 2YXYA 4M7AA 3TNIB 9ATCB 2DD4B 5KYYB 1WQWA 1ZUUA 3I9QA 2EBPA 3S6WA 1URCB 1VQ6A 2QA4Q 1R8OB 1CSKA 3GTMS 5C0MA 4RMOA 2SEMA 5FGKB 3V8JA 3CC4Q 1VYTA 3TNHB 3GLXA 3M53A 4J9HA 2Y4XA 3HRSA 4BCHB 4Z89A 1Q7YR 3MP8A 1TD6A 1QWEA 2F69A 1JRIA 4LN2A 3CC4T 2J6FA 1M9SA 3SDZA 3QWYA 3ZFJA 5GAN4 1YBYA 5LJ5g 2WIPB 3NMZC 3I35A 1PD0A 5CKHA 2DXCA 1ACMB 2DMEA 1WJRA 4XU2A 4M77C 2IPOB 1GBQA 2J6OA 2LJ3A 3A8HB 3CEYA 2QEXQ 3OMCA 4A54A 4OB3B 2FZCB 3MKDA 4JZ3A 3CC7A 1B34A 2A0FB 1UNGD 5LJ3f 1WDXA 1U8RA 3FIFA 1N8RR 2ZPHB 5FWBA 4BCQD 2QDLA 5HVYB 4MFEA 4Z6YA 5A0DA 1VQMT 2VGNA 2K79A 4BCFB 1WX6A 1FMWA 1NJIC 2FPFA 2GCXA 3X20B 5EFQB 2P0KA 4OVAA 3SHWA 1WYXA 4N0AC 2RK2A 4OGEA 4BUGA 1WGSA 1SHGA 1X2QA 2VASA 4C8QD 1OU8A 1FXXA 1TUGB 4F7NB 2CH4A 2PVDB 1C9BA 4HT9A 4KT0E 3QIIA 2EUFA 2OJ2A 4KRDB 1T0JA 1G8XA 1G3TA 1OULA 4DBHA 4E7HA 4BY7X 3G6EA 1D1CA 3CMEA 4E7IA 3EHRA 2L0AA 2RQRA 4C92E 2JXBA 3PVLA 2COWA 2OTJA 2YT6A 1UB4A 2CP6A 2KRSA 2DVJA 3M56A 2F2CA 1VOLA 2QTVA 2MI6A 1MNEA 2M0OA 1M90C 1M8MA 3WVDB 1LPLA 1VQNA 2MK5A 3TSWA 2X3XD 5GANj 1G3SA 1GFDA 4RTXA 2FRWA 2MIOA 4DBQA 1BI3A 4M77B 4RG2A 2K9GA 3GOXA 1GXIE 4KH1B 4OGCA 1VQ4A 1X75C 4M6VA 2GTJA 2EQMA 2CUDA 4EOJB 2A36A 1D0ZA 3PTAA 2GF7A 4YC3B 2GBQA 3I5SA 2C0IA 4DQ2A 1D09B 5GAOl 2I2LA 4QVCA 2M16A 1YJNQ 1RUWA 1MV0B 2LJ1A 4FYXB 3FB9A 4V2SA 4PJOA 1GCPA 2PK9B 2WSEE 2I40B 2CT4A 4C0ZA 1B3QA 2HBWA 3FLGA 4M78D 4MZPA 5GMKe 1KIKA 4F7UG 1QVFA 4F6WB 2DEQA 5CK9A 3GPLA 4M7AB 1G83A 2NLUA 2X1NB 1WQ7A 3VYGA 1PRMC 3E9FA 5IXFA 1PD1A 1TG0A 4M4ZA 4B9WA 2DAQA 2ED1A 2A28A 3LWIA 3FJ5A 4FIBA 5GAN8 4NL3A 2WXVB 2W9FA 2KRNA 4M77D 1VYVA 3QYEA 2FPEA 1TS9A 3M9QA 2KBTA 1QKXA 4B6MA 4JS4A 4NSTB 3X28B 2EQJA 4FSXA 1M4ZA 1AWXA 4EOLB 1YIJA 2AHJB 3OS1A 3EFOB 3EGUA 3QDFA 2A37A 3QDRB 1KQSS 2W0ZA 1MGQA 4FT4A 1VQ7T 4E7ZA 2P4TA 3HP9A 1FMKA 2K2VA 3N5BB 4XAXB 2O2OA 3DB3A 4K11A 2LT1A 2QQBA 2LVMA 5DM7R 3CCMQ 3M0SA 1D0YA 2DXCB 4JRPA 4FW2A 2HBPA 4IURA 2NUPB 1KK7A 2RI2A 4J5YA 3J80E 4X34A 3GNFB 3QZ9B 2IW9B 4EMKA 2DTOA 2J7IA 1LCKA 4N4HA 2KE9A 3EGXA 3CCLA 1UFFA 2XHCA 2DETA 3CC2T 1H3HA 3E1SA 3H0IA 1J3TA 3M54A 2RJCA 5CO7A 4EC9B 2KR6A 3EG9A 2C5VB 3OBYA 4PJOB 3CMAA 4GLMA 1ZLMA 2CSQA 3JCMX 2EAYA 1IGQA 2CUBA 2LMJA 1OX9A 1I0CA 1MNDA 2CH4W 4M75D 3D7SB 2JM8A 5IN1A 5KE2A 1FX7A 4O6JA 1R0BG 3QHSA 3TREA 2FB7A 3I56A 2J05A 4NL2A 1VQ7Q 5IXBA 4J8OA 4PJNA 4MIMA 4PJOF 1M5Q1 1PWTA 1JJ2S 3UA7A 4JLIA 2BS3A 3CXCA 2A7YA 2OTLA 1QMZB 5EG2A 2FG0A 3CMAT 1NLPC 1QCNA 2E3IA 1ZX6A 2QQ9A 2R7GA 4MDXA 1RAEB 2COZA 5LQFB 1NLOC 3V7SA 2CS7A 1ZA2B 4HCBA 3OYBA 5EJCA 1QVFP 2RD1A 2VXFA 1O9KB 1UECA 2F2WA 2E5KA 1OZ3A 1C1AA 4M78E 1KC8C 2KT1A 4BCKB 1S72T 1EZZB 4PK4A 1QMCA 4CRIA 4BCMD 3JCMd 4QT7A 1WNLA 2BS2A 2RQTA 1M3BA 1Y0MA 4C8QC 2H3EB 3OBWA 1QVGP 3GIBA 1RADB 4E47A 3BG9A 4EC8B 1ABOA 1O75A 1BIAA 2RQVA 2K3XA 2CP0A 1E7PA 4IMYB 4FL6A 1XO2A 1K9MC 5LJ5f 4EOIB 4LNPA 1VA7A 4FYYB 5GANh 2HSPA 5CVIA 3UF4A 3QHWB 1KJWA 1D1AA 3CCLQ 3SWNC 4M7DA 3DB4A 3M59A 4M78A 5CKBA 1VQ8T 3NTIA 2RN8A 3HB9A 1T3LA 3I55Q 5D7UA 4BD3A 3GBQA 4M7DD 4A4FA 1VQ8A 4M7AG 2KT8A 4J83A 1AZEA 1AD5A 5KYUA 2IW8B 1VQ9T 3CCEQ 2W99A 1TUDA 1EFNA 2WHBB 3VS0A 4M78F 4R55A 3HFNA 2RF0A 3EFSA 4PJMA 5DQWA 2FYKA 3VKIA 2KVQG 1WXUA 4L5GA 3E2UA 2WSCE 2PUKB 4XTXA 3DL1A 1YIJQ 5HK3A 5IAYA 4X1VA 2XD0A 4J7FA 2DD4A 4LD6A 1X2KA 2A08A 2C6TB 4J6YA 4R0KA 3ASKA 2FEIA 5CCAA 4BY6C 1Y96A 4KULA 5FU6B 3CCRQ 2HKQB 4EOKB 4PLIA 2RPNA 4A53A 3CD6A 4QQDA 3M0TA 1MMAA 4OMPA 3C0CA 2NUTA 3PGGA 1EX4A 1MMDA 1WPYA 4X9DA 4CFUB 3JCMg 2V8IA 2L3PA 5HBEB 1E6GA 1S72Q 1UGVA 2HQHA 1YJWQ 2F2VA 2CCIB 2IVWA 1VQNT 5IHYA 2NUPA 2C5XB 2RHUA 3VKGA 4FYVB 3CCJT 5KE3A 1VIFA 3A8LB 3QBYA 1LVKA 1K9AA 1V29B 2EJGA 1O9SA 4AFQC 1BCMA 2ZAEA 2AKKA 5GAMf 2XKOC 1SSHA 3A8GB 1AEYA 3UWNA 5GMKh 4HVVA 2RMOA 5KYWB 1CKBA 2MYSA 4F17A 2JVVA 3L42A 1BBZA 2XU8A 5ICPB 4D8DA 2C0OA 1N4MA 2FL7A 1W6XA 3CC2A 4PJOD 1K0XA 3OYIA 2X4JA 3PIPA 1NPPA 1K9MR 3A8MB 4XTVA 5EC7A 3CCJQ 4LXCA 3PMIA 5LJ5e 1KXUA 3RERA 1WHGA 3JCMc 5I11A 4BI8B 3J81E 2OTLQ 1VQ5T 4J7IA 2ATCB 3CMEQ 1UEBA 3CQTA 1C6VX 1RLPC 5FW9A 5GAN6 2D0QB 2HMAA 1N8RC 1ZA1B 1AOJA 1Q81U 2GFAA 1M1KU 4PJOC 3OSSC 2ZZDA 1M1KR 1T0HA 2ED0A 1SSFA 1M1GA 4JPBW 1JB0E 2DEUA 3TSZA 2F2XA 4MZMA 4IUPA 2KQWA 3MEAA 1PC0A 1NPRA 4EOSB 2RI5A 4HXJA 2DERA 1PSFA 3M4GA 2D8HA 3RKYA 3MCAB 3CCQQ 2O4XB 1Q81C 2SRCA 3OS0A 4M75G 3VJPA 1X69A 4WCIA 4RTVA 1BI1A 4BCJB 5IDNB 1TUCA 4LUDA 4OMOA 4PFPA 3Q1JA 1YITQ 3DTOA 3JB9J 3OYAA 1VQ9Q 1OZ2A 4BCGB 2E41A 1BU1A 2BUDA 2XICA 2YLCA 3SFMA 3QYHB 1VQLQ 4M75C 1NYFA 4RCBA 3M5AA 3EJ1B 1TTHB 5IF1B 4CC4B 3VU3C 2DXBA 2WJ9A 3BG3A 2O31A 3JCMf 7AT1B 3EH2A 3OMGA 5DLOA 1VQOT 3QJ6A 1K73C 4XTYA 3CCVT 4QQ6A 2EIFA 2BIVA 2QQ8A 2ZPIB 2CGHA 2KEAA 4F7JB 1RAIB 2DIQA 1YJWA 1SRLA 3SWNB 4M7AC 4AG2C 3QG1A 2RJFA 1WHHA 2HKNA 1M3CA 3M03A 1PRLC 5GAOm 2EYQA 5FRNA 1H24B 4N0AA 4AI6A 5D6YA 1GCQA 1QWFA 5GAMe 2E1HA 1P5EB 2KMGA 4F7UE 3L2ZA 3DLLA 4Z8AA 1H641 2ZCFB 2K5IA 3ZL7C 3X26B 2HQEA 5D6WA 4A4HA 4E7SA 5DQVA 1TU0B 2RA2A 2KXCA 3OW2S 4ROCA 5GAOn 1D3UB 2LX9A 3UT1A 1JU5C 2UZEB 4II5B 1OX8A 4JX5A 1ZUYA 1ZSZA 3THKA 4ZNXA 3EIDB 3H8ZA 1KC8U 2EJFA 3BLRB 3JCMb 2AIRB 2J06A 3R6OA 5KYNA 2I53A 1M27C 2JS2A 4ROEA 4BXXX 4EOOB 4MDWA 3H4CA 1OL1B 2EFIA 5KCHA 2PZ1A 3BLQB 2CKKA 3HZJA 5KYWA 2EYZA 4CC2A 4ZTFA 4ZGJB 3RKXA 4Y92A 3BLHB 1VQKT 4KUIA 2O88A 1Q86U 1OU9A 4DBRA 1JOWA 3H41A 3MHXA 4PLLA 4JJDA 1W4SA 3L2RA 3L2UA 4F6SB 2G3RA 3OYCA 3RDVA 4OMFB 2JMAA 2DZCA 1M90R 2XIDA 1PKSA 3HBLA 1D3BA 2WMBB 8ATCB 2GNCA 2E65A 1KQ2A 3CBMA 5A0GA 1BK2A 2LQ8A 4C5IA 2IW6B 2JZ2A 3LYIA 3WVEB 2QEXA 3TW7A 2CP3A 3OY9A 3QKJA 2BTTA 4BE2A 2LRQA 1OV3A 1X43A 1OEBA 1ABQA 4EDUA 2MWOA 5I21A 4BBSM 2KDSA 1UDLA 1VYWB 3EGXB 3RIRA 2DRKA 1H8KA 3ME9A 5C6SA 1BI0A 1JQQA 3MJXA 3CCVQ 1TOVA 1U06A 4PNOA 1YWOA 2DD5B 5GAOr 4E7KA 1KG1A 3G33B 3OB9A 1M90U 2ESWA 4QVDA 2LQNA 1QKWA 1F1BB 4L59A 1VQLA 4BCQB 3TW6A 3P8BB 1Z9QA 3CCUA 2QQRA 4JJCA 2C5NB 4Z02A 4Y91A 2BE7D 1Y57A 4J9IA 3OS2A 2V1QA 5FRMA 1AWOA 3LW5E 1MV3A 4F04B 2LCCA 3PT9A 4ME7A 2JT4A 3QPHA 4YOZA 1ZSGA 1TFBA 3P8HA 2CYZB 2VGMA 4EMKC 2DVEA 5L2WB 1Q7YU 1QCFA 1OL2B 4JDSA 1JSUB 2QF7A 5LJ3h 3S3MA 5CQYA 4ELZC 1SHFA 1H25B 1YCSB 3HHTB 1WXBA 4LUEA 1BYMA 3MP6A 3LWHA 4AT1B 1EIFA 2UZDB 1FKMA 5LJ5h 2WSFE 1I4K1 4HCCA 3JCMP 4CFUD 3CPFA 1YI2A 2P0PA 2OAWA 2E5QA 2QXFA 1OPKA 5GANf 1YP5A 2WEVB 4A4KA 3BHVB 5GANg 3A8OB 4PFZA 3QZ5B 2GQVA 1IGUA 3ZBDA 3JCMJ 2QFZA 5KH6A 1Q95G 4BDZA 1IXDA 2KYMA 1JO8A 3JB9D 1A0NB 1BIBA 4RTZA 1G3YA 2F5TX 2PJQA 4UC4A 1X6OA 3REBB 2GFUA 1ENWA 2MOXA 3CCJA 4XU3A 1KQ1A 1FYNA 2JTFA 2BZ8A 3E9GA 8AT1B 5IHNA 4AG1C 4J9EA 2BKDN 3RMSA 1X27A 2EYXA 1H1PB 4RODA 3FC3A 1P92A 3X25B 2GGRA 3CCET 4BY6B 1WHMA 2RJEA 1YJNT 3CPWP 2YUQA 4LDXA 2O01E 3H6ZA 4QW2A 1RAFB 2G6FX 2LTOA 2GQIA 1HSQA 2LNHB 2LX7A 3CCLT 1W2BP 3LGFA 1OI9B 4JS5A 1FWZA 2CSIA 2PUOB 3HFOA 1OGUB 1G3NC 4CFNB 2HD0A 4BDYA 2DNUA 3OYFA 2DL3A 3MEVA 2BKZB 3C95A 4RTYA 2X35A 2ROLA 1N27A 3TNWB 2KSSA 2RO0A 5J3BA 4BE1A 2B9RA 3BE3A 4JZ4A 2DL7A 4M78C 2O9VA 3TU4K 5FWCA 3EFOA 3M57A 5A2QE 1NJIU 2LDMA 3UATA 1QVGS 4CI0C 5GANd 2YLBA 3I56T 2DA9A 5GAN5 2EGAA 3G7ZA 1VQPT 2CZ6B 3M0PA 1JSTB 3F70A 2WFYB 2OI3A 5LJ5d 2JNGA 1B7TA 1QVPA 3FJPA 1UNLD 3MPUB 2EKOA 4FW1A 2DIGA 2FRYA 4C5EA 3G6EQ 1GRIA 4AKIA 1XOVA 5GAOp 2DL8A 1I8FA 2R5MA 4M77G 1GH6B 1KQSA 1WHKA 1N5ZA 1LNXA 4RTTA 2PMIB 2VC8A 4AFUC 3OYLA 3SEMA 4PJLA 1BCOA 1GFCA 3G71T 4G6LB 1RAHB 1WHLA 1G5VA 3PIOA 5LJ3j 2AZSA 5CQXA 4FT2A 1SEMA 5IT9E 2HCKA 3CCVA 2L3QA 1Y71A 1UHFA 1IO6A 4C0GA 2DILA 2RB6A 2QI2A 5HCKA 3O8VA 2W9ZA 3NPFA 4XQ3A 2IVXA 2YUNA 4P5NA 5KCOA 2X9HA 4F7UA 2QDJA 4M77A 2VXEA 4EMKB 4J6XA 1OKVB 3EFRA 2VVKA 3QWLA 4BCOB 2RM4A 3EGDB 3V8KA 2PQWA 2E3HA 3WXMB 3G6ET 2X4WA 4MFDA 4F6UB 2B86A 3VS5A 4C0FA 1H3ZA 1RLQC 3OYYA 1ZBJA 1YJ9A 4BI3A 1XTDA 4C92G 5LL6S 3CCQA 1E9HB 1CKAA 3LH0A 4M7DG 3G1JA 3PVQA 2MPXC 4RCCA 2DFUA 3T9NA 4NS5A 2QAZA 3ZEHA 2LCLA 4RG8A 3BG5A 1PG5B 3JRZA 2M51A 2E10A 1UTIA 4KRTA 3NFCA 3CD6Q 2QASA 2QA4A 1G3WA 3CCMA 3VKHA 3EOCB 2K3YA 1JXOA 2DK3A 2DTIA 2RNAA 1YITT 4ANJA 1K8AC 1Z9ZA 2VYTA 3QUIA 1RI9A 1VQ5Q 4QSHA 5GMKl 2YRCA 1GBRA 1HXDA 2QG9B 4ORZA 1HJDA 2RHIA 5AYFA 3DOGB 1M2VB 4KUDK 3VS1A 3NGPA 5CEIB 1YFNA 2P0QA
chains in the Genus database with same CATH topology
1B34B 3LX7A 1K8AU 1YJWA 5GANj 1G3SA 3SWNB 3CCST 1BI3A 4M77B 4M7AC 4C0DC 4RG2A 3GOXA 3QG1A 4XU1A 4JRQA 2RJFA 3RKWA 1GXIE 4OGCA 4HKEA 1VQ4A 1X75C 2X4XA 4M6VA 2EYQA 5GAOm 2DTHA 5FRNA 2LT4A 2ZPBB 3QXEB 4AI6A 2EQMA 4N0AA 1UGQB 5D6YA 2L3RA 3I55T 1W2BA 3KBGA 4IUTA 3BDUA 5I2SA 3JCMe 3PTAA 5GAMe 2GF7A 2E1HA 2QEXT 4M7DE 2KMGA 4F7UE 3L2ZA 4XU0A 3DLLA 1H641 2ZCFB 4ELJA 2K5IA 4DQ2A 3G4ST 3CMET 3KHIA 2F5KA 3X26B 2HQEA 5GAOl 4MMLA 5D6WA 2I2LA 4A4GA 4QVCA 4A4HA 2M16A 4OP0A 2PVOB 1Q7YC 2RA2A 4HA8A 2LNVA 2DPPB 3RUXA 3OW2S 5CIUA 3FB9A 5GAOn 4OB2B 3VV0A 2LX9A 3M55A 4V2SA 3UT1A 4PJOA 1MHNA 5LJ5j 1LOJA 1VQ5A 4JX5A 2WSEE 1N6AA 5GMKj 1Y7XA 3L2QA 4C0ZA 4LOCA 3H8ZA 4M78D 3FLGA 4WF2A 4MZPA 1RI0A 5GMKe 5GAMg 4F7UG 1YJNA 2IG0A 3HKSA 1QVFA 2PU9B 4M78G 3CCEA 3AHUA 2DEQA 4C0DB 5CK9A 1KC8U 3GPLA 4M7AB 2EJFA 4BBRM 2NLUA 3CC7T 2YHTA 3SB2A 1WQ7A 3JCMb 3VYGA 4J6WA 3E9FA 3R6OA 2DO3A 2MMPA 4QVZA 2CZ7B 4B9WA 2DAQA 4M7AD 4RKUE 1VUBA 3CPWA 4MDWA 5J39A 2LQKA 3H4CA 4FIBA 5GAN8 5GAN2 4NL3A 4KBMB 2HQXA 3I55A 2EFIA 3CCRA 4M7DB 5GAMd 5KCHA 1WJQA 3PMTA 4M77D 3QYEA 1DJ7B 3CCRT 2OTJT 2CKKA 3HZJA 1D3BB 3M9QA 4MMKA 5GAMh 2C06A 3UPUA 3PFSA 4ZTFA 4AKGA 4ZGJB 3RKXA 4IUQA 4TVRA 3X28B 4JS4A 4E7LA 2EQJA 4E7JA 4FSXA 1VQKT 4KUIA 1Q86U 1M4ZA 2WACA 1QP2A 4M7AF 1YIJA 2AHJB 1ZHIA 3L1AA 3MHXA 4M78B 3OS1A 2VUBA 4M75A 4PLLA 3QDRB 3JB9H 2ZPGB 1YIJT 1KQSS 4LDWA 5HK0A 3CCQT 4VUBA 4PJOD 1UGSB 1W4SA 3L2RA 2XDDA 1MGQA 2HNIA 3L2UA 4XTUA 4FT4A 3OYNA 3CCUT 2G3RA 3OYCA 1N8RU 4EMHA 1VQ7T 2P4TA 1X01A 3HP9A 2K2VA 3N5BB 4XAXB 3JB9G 4OMFB 2DZCA 3DB3A 2XIDA 2LT1A 1QVGA 2QQBA 2JN0A 3HBLA 4C8QE 1D3BA 2LVMA 5DM7R 3JCMV 1N9SA 1Y96B 2E65A 4GLKA 3CBMA 1I81A 5A0GA 1KQ2A 2E70A 2LQ8A 4C5IA 2DXCB 2JZ2A 2PVGB 3WVEB 3LYIA 4JRPA 1M1KC 2QEXA 4M75F 3TW7A 3SWNA 3OY9A 2HBPA 4IURA 3QKJA 2RI2A 2RJDA 4HNUA 3LLRA 4J5YA 3J80E 4X34A 3GNFB 4M75B 4BE2A 3QZ9B 2LRQA 4EMKA 2DTOA 4EDUA 4N4HA 2KK4A 2MWOA 1VQMA 2L89A 4AKHA 4YTLA 1VIEA 5I21A 3NTHA 4BBSM 2KDSA 2QDYB 4OB1B 3JCMQ 3S3NA 2EQKA 3HL8A 3RIRA 3CCLA 2FHDA 2XHCA 3JB9I 2RHZA 3CC2T 1RL2A 3E1SA 5DY9A 3ME9A 4BI4A 5C6SA 2XDBA 3M54A 1BI0A 2RJCA 5CO7A 3OYKA 2KR6A 3VUBA 3KUFA 3PNWC 2XG8D 3OBYA 4PJOB 4PNOA 2DD5A 1YJWT 1WJSA 1TH7A 4Q5WA 2DD5B 5GAOr 3GNGA 3C4SA 3CMAA 4E7KA 1XQHA 1KG1A 3OB9A 5CR2A 1M90U 4C8QG 3RMQA 4XK8E 4QVDA 3JCMX 2EAYA 3CD6T 2JUFA 2YRVA 4L59A 4F7UF 1VQLA 3TW6A 4M75D 3P8BB 3CCUA 1VQ7A 2QQRA 4IUVA 4Z02A 2K57A 3E19A 5IN1A 4II1A 4Y91A 4OF1A 3G71A 5KE2A 1FX7A 1ZBXA 2QQAA 1QW1A 3OS2A 4O6JA 1VQLT 3QHSA 1YHQA 2R57A 1VQ9A 5GAMj 5FRMA 3TREA 2FB7A 3I56A 1IREB 2OAUA 4NL2A 3OYHA 4M75E 4J8OA 3LW5E 1VQOA 4MIMA 4PJOF 1M5Q1 2LCCA 3PT9A 4ME7A 4NOYA 4B9XA 4JLIA 1JJ2S 4DOWA 2BS3A 3INZA 3FRNA 4C92C 2A7YA 3QPHA 5GANe 3CXCA 3C94A 1YHQT 2OTLA 3P8HA 2CYZB 3HO8A 5EG2A 4DA4A 3CMAT 3VYGB 4ATOA 2VGMA 4EMKC 4FM4B 3JAME 2DVEA 4F7UB 4HNVA 4C8QB 1Q7YU 4JDSA 2QQ9A 5J26A 2QF7A 4MDXA 4PJOE 5HY6A 2QQSA 1OI1A 3HSBA 5LJ3h 3V7SA 2CS7A 3S3MA 3LWIA 5CQYA 4ELZC 4HCBA 2V8JA 1U1SA 3OYBA 5EJCA 4IUUA 2RD1A 2VXFA 3EAEA 3HHTB 5LJ3d 4BB7A 1BYMA 5GAOq 2R58A 3MP6A 1OZ3A 4ZGEB 3OS5A 3JCMh 3LWHA 1EIFA 4M78E 1KC8C 1FKMA 2XK0A 3QO3A 4A4EA 4JJNK 4JX4A 3TEEA 2WSFE 5LJ5h 1S72T 4CRIA 1I4K1 4HCCA 3JB9F 3L2VA 3JCMP 3CPFA 1YI2A 2P0PA 3JCMd 1WNLA 1VQ6T 2BS2A 4IKFA 3BY7A 2E5QA 2QXFA 4DOVA 5GANf 3FEOA 3MP1A 4OB0B 4A4KA 5GANg 3A8OB 4C8QC 3OBWA 3QZ5B 2GQVA 3GIBA 2XDPA 3ZBDA 2A3LA 2LC4A 5HKCA 3JCMJ 4E47A 2QFZA 1VQKA 3BG9A 3LGLA 5KH6A 4BDZA 1O75A 1BIAA 1Y07A 2K3XA 4ZN3A 3JB9D 1BIBA 1E7PA 3GP8A 1G3YA 2F5TX 3JSCA 4PKCC 4UC4A 1X6OA 4FL6A 4Y28E 1K9MC 4HCZA 4XTWA 5LJ5f 2GFUA 3CPWS 2K4YA 3M58A 1S72A 5GANh 4XU3A 1KQ1A 3CCJA 3OYJA 3JCMW 5CVIA 3CBPA 1Q82C 2EJ9A 2JTFA 4FU6A 5M9OA 3SWNC 3E9GA 4M7DA 3DB4A 1QP3A 3VUZA 3M59A 2BKDN 2DXTA 4M78A 3RMSA 5CKBA 3CBOA 5CKFA 2JTMA 2HAXA 1VQ8T 3NTIA 3A5ZB 3HB9A 3FC3A 1P92A 3X25B 5GAN7 3CCET 4BY6B 4BD3A 4PL6A 5LJ3e 2RJEA 3CCMT 4A4FA 1YJNT 4M7DD 1VQ8A 4M7AG 3ER0A 3BDLA 4J83A 2MF2A 2EWNA 5FU7B 4JLGA 2QA4T 4BACA 3BW1A 2EQUA 4LDXA 2O01E 2ZPEB 4L6V5 1NZ9A 3H6ZA 3BFMA 2O4XA 4QW2A 1VQ9T 3QSUA 4MZTA 4ZTJA 4XTZA 2LTOA 1OYXA 5D6XA 2ZGWA 4ZGDB 1XNIA 4M78F 5CKDA 1NE8A 3TCJA 4HLQA 3UDCA 3CCLT 4R55A 2E6ZA 3HFNA 1VQNA 3EFSA 5CKEA 4M7AE 4C5HA 4X9CA 2G77A 3LGFA 2CZ1B 4JS5A 1FWZA 2PUOB 3HFOA 4N4GA 2FYKA 3OYEA 1JBMA 5FU6C 3VKIA 2KVQG 4C92A 2HD0A 4L5GA 4BDYA 2WSCE 3J7AF 2PUKB 3OYFA 2DJZA 1QVFS 1QLBA 4GY5A 3DL1A 4XTXA 4D6WA 1YJ9T 3X24B 2L5QA 1AHJB 2ZZDB 5HK3A 5IAYA 3M4YA 2KAFA 2E6NA 3MEVA 1LJOA 5LJ3g 1KD1U 1BKBA 2XD0A 3QYGB 1BI2A 3C95A 4J7FA 2DD4A 4LD6A 1W2BS 2X35A 3OA6A 3DKMA 3OW2A 4J6YA 3MEWA 2H3JA 1N27A 3ASKA 5CCAA 1PSEA 4BY6C 4HL4A 2FVUA 2MAMA 3MO8A 1Y96A 4KULA 2KSSA 2L8DA 2RO0A 1YI2T 4JRIA 5FU6B 5J3BA 3OYMA 4BE1A 2KMTA 4PLIA 5I2MA 1K9MU 2Y90A 1M8VA 2BS4A 4A53A 4HT8A 4M78C 2X4YA 3C12A 4QQDA 3TU4K 3CD6A 5L8RE 2DXUA 2XI9A 4R56A 2ZPFB 3KXTA 2VV5A 3PGGA 3V7RA 3M57A 5A2QE 1NJIU 1WPYA 3FDRA 2LDMA 4X9DA 3JCMg 1QVGS 4JX6A 2DKGA 2V8IA 4CI0C 5GANd 2KY9A 2YLBA 4ELYC 3I56T 3HPWA 5GAN5 4N4IA 3OSVA 2M9UA 3G7ZA 2RH2A 1VQPT 4ZN1A 3SD4A 1UGPB 5FU7C 3L2WA 2CZ6B 2IVWA 3F70A 1I5LA 2K5LA 2K5FA 4NC6A 1U1TA 2V8KA 4QQGA 1VQNT 2RHUA 1KD1C 3VKGA 5LJ5d 3CCJT 2JNGA 5KE3A 1VIFA 3CCSA 1QVPA 3A8LB 3FJPA 2E64A 3QJYA 3QBYA 2EKOA 1N9RA 4C8QA 1KHCA 1V29B 2DIGA 1HK9A 4PJOG 4M7DF 4C5EA 4EPCA 3MEUA 4AKIA 2EJGA 1XOVA 5GAOp 1O9SA 1I8FA 2R5MA 4M77G 5FROA 2B8AA 5GAMf 2XKOC 1ZQ1A 1KQSA 4M7AA 5A0LA 2D6FA 3A8GB 4JUVA 2DD4B 1LNXA 3UWNA 5GMKh 1WQWA 2VC8A 3OYLA 3S6WA 4EMGA 4LDVA 1K73U 4C8QF 3G71T 1VQ6A 3QYBA 1R8OB 2JVVA 2JOYA 3L42A 1G5VA 3PIOA 2XU8A 5LJ3j 1YITA 5C0MA 4RMOA 3HRTA 5CQXA 4FT2A 5IT9E 1KHIA 3V8JA 4C92B 5GMKi 2M1HA 3CCVA 2FL7A 4HNTA 3GLXA 3M53A 3CC2A 1Y71A 2MWPA 2Y4XA 2X4JA 3HRSA 3PIPA 3OYIA 4C0GA 1NPPA 4C92F 3MP8A 3A8MB 2F69A 2QI2A 1JRIA 2RB6A 4XTVA 2RHYA 3SDZA 1M9SA 5FLXE 3CC4T 3ZFJA 5GAN4 1YBYA 3O8VA 3PMIA 3VYHB 3URGA 5LJ5g 5LJ5e 3CC4A 5CKHA 1M1FA 2RI3A 2RK1A 4XQ3A 3V8LA 3RERA 2DXCA 4P5NA 3JCMc 1Q82U 1WJRA 5KCOA 4BI8B 3J81E 4XU2A 4M77C 4F7UA 4J7IA 1VQ5T 3GF5A 1UEBA 5GAN3 2QDJA 3A8HB 3CEYA 4M77A 5GAN6 2D0QB 2VXEA 3OMCA 4A54A 4EMKB 4OB3B 4J6XA 1N8RC 3EFRA 4M77F 3CC7A 3QWLA 2RM4A 1JJ2A 2DXBB 1B34A 1Q81U 2GFAA 1M1KU 4PJOC 3OSSC 2ZZDA 5LJ3f 3V8KA 2PQWA 1U8RA 3FIFA 3WXMB 2ZPHB 1SSFA 3G6ET 2X4WA 4LDUA 4MFDA 1M1GA 1JB0E 3META 4MFEA 2D9TA 4Z6YA 2RHXA 4C0FA 1H3ZA 5A0DA 4MZMA 1VQMT 4IUPA 2KQWA 3OYYA 3MEAA 1YJ9A 2VGNA 4BI3A 1NPRA 1XTDA 2RI5A 4JRKA 3OQ5A 4C92G 5LL6S 1PSFA 3CCQA 3M4GA 3RKYA 3LH0A 1NJIC 2GCXA 3MCAB 4LD9K 3X20B 4M7DG 4RCCA 3CXCS 2O4XB 2P0KA 4OVAA 1Q81C 3HRUA 3T9NA 4N0AC 4M75G 2RK2A 3VJPA 4NS5A 4OGEA 3OS0A 2R5AA 2QTXA 3ZEHA 2LCLA 4RG8A 4BUGA 3BG5A 4BE0A 1BI1A 1WGSA 3JRZA 4O5VA 2E10A 4M77E 1IZ6A 4C5GA 3DLMA 4C8QD 3NTKA 3S3OA 3Q1JA 1FXXA 3NFCA 3V7CA 3OYGA 2QA4A 2PVDB 2Y4YA 3RESA 3OYAA 3JB9J 1Q86C 1VQ4T 1G3WA 1UGRB 1OZ2A 4HT9A 4KT0E 3CCMA 5GMKm 3QIIA 3VKHA 2E41A 2K3YA 2BUDA 2DK3A 2CZ0B 2XICA 5CAIA 2DTIA 2YLCA 2E12A 1G3TA 4E7HA 1YITT 3SFMA 3QYHB 4M75C 4RCBA 3OYDA 3M5AA 1K8AC 3G6EA 3CMEA 4E7IA 1YCYA 3VU3C 2DXBA 4C92E 2VYTA 2WJ9A 2OTLT 3BG3A 2DZ9A 3QUIA 3JCMf 4QSHA 5GMKl 2OTJA 3OMGA 1UB4A 1HXDA 3M56A 4LDYA 3QJ6A 5DLOA 1VQOT 2RHIA 5AYFA 1K73C 3G4SA 4XTYA 3CCVT 4QQ6A 2EIFA 2BIVA 2QQ8A 2ZPIB 2CGHA 4C92D 1VQPA 2MI6A 4M7DC 2M0OA 4KUDK 5DLQE 1M90C 3P8DA 2P0QA 3WVDB 2DIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QP3 A;  3QZ9 B;  3X25 B;  1GXI E;  2QDY B;  4OB1 B;  2ZPB B;  3QXE B;  3A8M B;  1UGQ B;  2ZPE B;  2O01 E;  4L6V 5;  3VYH B;  2DD5 A;  2ZCF B;  2DD5 B;  4ZGD B;  2DXC A;  3X26 B;  4XK8 E;  2CZ1 B;  2PUO B;  3A8H B;  2PVO B;  2D0Q B;  4OB3 B;  2DPP B;  2DXB B;  2WSC E;  2PUK B;  4OB2 B;  2ZZD A;  3X24 B;  1AHJ B;  2ZZD B;  1IRE B;  2ZPH B;  2WSE E;  3QYG B;  2DD4 A;  3LW5 E;  1JB0 E;  2PU9 B;  1PSE A;  2CYZ B;  3VYG B;  3VYG A;  4FM4 B;  1PSF A;  2CZ7 B;  4RKU E;  3X20 B;  5L8R E;  2ZPF B;  1DJ7 B;  3HHT B;  4ZGE B;  4ZGJ B;  3X28 B;  2WSF E;  1UGP B;  2CZ6 B;  2PVD B;  1QP2 A;  1UGR B;  4KT0 E;  2AHJ B;  2CZ0 B;  4OB0 B;  3A8O B;  3A8L B;  2ZPG B;  3QYH B;  3QZ5 B;  1V29 B;  1UGS B;  2DXB A;  4Y28 E;  3A8G B;  2DD4 B;  2DXC B;  2ZPI B;  2PVG B;  3WVE B;  3WVD B; 
#chains in the Genus database with same CATH topology
 2LP5 A;  1B34 B;  2V22 B;  3DJB A;  3CCS T;  1KQS P;  4BCN B;  3VRY A;  4JRQ A;  2PTK A;  3RKW A;  1E7O A;  1K4U S;  1OPL A;  2GTO A;  2X4X A;  2DTH A;  1SF9 A;  3QXE B;  1MUZ A;  1UJY A;  2L3R A;  1W2B A;  4EOM B;  3KBG A;  3BDU A;  4IUT A;  3JCM e;  1VQ8 Q;  4XU0 A;  2FPD A;  4OMM A;  3CME T;  3G4S T;  1KD1 R;  3KHI A;  4A4G A;  4HVW A;  1TXQ A;  2PVO B;  5IHK A;  4YOS A;  4HA8 A;  2JMC A;  2LNV A;  3CCS Q;  2DPP B;  3RUX A;  4OB2 B;  2JW4 A;  1MHN A;  5LJ5 j;  1ZSZ C;  1LOJ A;  1Y7X A;  4PJJ A;  1SG5 A;  5GAM g;  4WF2 A;  1RAB B;  4KGV B;  4F7S B;  2PU9 B;  4J9B A;  4BBR M;  4BCI B;  4CC7 A;  2DO3 A;  2MMP A;  2CZ7 B;  4RKU E;  3CPW A;  2LQK A;  3RR6 A;  5GAN 2;  4M7D B;  4KBM B;  2HQX A;  3CCR A;  5GAM d;  1WJQ A;  2YDL A;  2JJ9 A;  1DJ7 B;  4HCK A;  3CCR T;  2QGF B;  2C06 A;  3PFS A;  2FZG B;  4AKG A;  4IUQ A;  4TVR A;  4E7L A;  1JKW A;  1ARK A;  2C0T A;  2WAC A;  1QP2 A;  4EOQ B;  4M7A F;  4E2F B;  1WFW A;  3I5R A;  4M78 B;  2NWM A;  2VUB A;  1UE9 A;  3G4S Q;  2ZPG B;  1YIJ T;  5HK0 A;  1UGS B;  2XDD A;  3IQL A;  3CCU T;  3A1P A;  2Z0W A;  4IIM A;  3JB9 G;  2YSQ A;  1RAG B;  1MMN A;  1NEG A;  2JN0 A;  4I3Z B;  2F1L A;  1W70 A;  4GLK A;  2FO0 A;  2LCS A;  2PVG B;  4CFM B;  3SWN A;  2RJD A;  4HNU A;  4BCN D;  5ECA A;  2KGT A;  3M0R A;  2KK4 A;  4AKH A;  1VIE A;  3NTH A;  2LJ0 A;  2QDY B;  4OB1 B;  3S3N A;  2EQK A;  3U23 A;  3JB9 I;  2RHZ A;  2IN3 A;  2JTE A;  1BB9 A;  3OW2 P;  1NJI R;  2XDB A;  1XJW B;  3OYK A;  3VUB A;  3PNW C;  2DD5 A;  1WJS A;  3GNG A;  5CR2 A;  4C8Q G;  3EG2 A;  3RMQ A;  4XK8 E;  4RTW A;  1GY3 B;  3CD6 T;  2JUF A;  2CP7 A;  2DE0 X;  2IIM A;  1KFZ A;  2K57 A;  3E19 A;  3REA B;  4EOP B;  2DL4 A;  1ZBX A;  2QQA A;  1YHQ A;  3G71 Q;  1G2B A;  1TWB A;  3VRZ A;  3CCU Q;  2QGG A;  1VQO A;  1M2O A;  2EGE A;  2EVR A;  3FRN A;  4C92 C;  5GAN e;  2DL5 A;  3C94 A;  4HVU A;  4IIO A;  4AFS C;  1YHQ T;  3VS2 A;  3HO8 A;  4DA4 A;  1RAC B;  4FM4 B;  4C8Q B;  1SRM A;  5J26 A;  4PJO E;  5IH2 A;  4OMN A;  5HY6 A;  2QQS A;  4DBF A;  1OI1 A;  2JM9 A;  1K8A R;  1D1B A;  4IUU A;  3EAE A;  3EG3 A;  2K2M A;  5LJ3 d;  4BB7 A;  2R58 A;  1VQM Q;  2P84 A;  3UA6 A;  2AZV A;  2XK0 A;  3QO3 A;  2HZY A;  4JJN K;  4JX4 A;  3TEE A;  3JB9 F;  3MI9 B;  3I56 Q;  4A63 B;  1VQ6 T;  3BY7 A;  2V1R A;  3FEO A;  4F14 A;  3MP1 A;  4OB0 B;  2VWF A;  2EW3 A;  2DX1 A;  2A3L A;  4ELL A;  2LC4 A;  3LGL A;  3O0G D;  1Y07 A;  4ZN3 A;  2COY A;  3GP8 A;  3JSC A;  4Y28 E;  4HCZ A;  1I1J A;  4CFX B;  3CPW S;  2BZY A;  1WA7 A;  2W10 A;  1OKW B;  3CBP A;  1Q82 C;  2EJ9 A;  5M9O A;  2C5O B;  1IB8 A;  4FCY A;  1PM3 A;  1QP3 A;  3VUZ A;  2DXT A;  2ENM A;  3CBO A;  5CKF A;  2JTM A;  3A5Z B;  2KI7 A;  2C4G B;  1PKD B;  5AT1 B;  4WTO B;  1H4L D;  3BDL A;  2EWN A;  4JLG A;  2MCN A;  2ZPE B;  4L6V 5;  1NZ9 A;  1I07 A;  2O4X A;  5HBH B;  1VQ4 Q;  2CP2 A;  2J6K A;  4ZTJ A;  4XTZ A;  1OYX A;  5D6X A;  2ZGW A;  1GUX B;  4ZGD B;  4CFV B;  1NE8 A;  5CKD A;  4HLQ A;  4J9F A;  3EHQ A;  2YUP A;  5CKE A;  4M7A E;  4X9C A;  5BNJ B;  1JBM A;  5L23 A;  5KYX A;  3OYE A;  2UZL B;  2DJZ A;  2P4R A;  1QVF S;  2CP5 A;  1V76 A;  2NUT B;  4D6W A;  1Q81 R;  1AHJ B;  2ZZD B;  1HYO A;  3M4Y A;  2KAF A;  1KD1 U;  5LJ3 g;  2NUZ A;  1BKB A;  2WPA B;  1W2B S;  2M02 A;  3OA6 A;  3OW2 A;  3POM A;  1PSE A;  4HL4 A;  2FVU A;  1YWP A;  2MAM A;  3MO8 A;  3K7A M;  4PFO A;  1B07 A;  4JRI A;  1GL5 A;  2Y90 A;  2AK5 A;  1M8V A;  4HT8 A;  2XI9 A;  4R56 A;  2CT3 A;  3FDR A;  4JX6 A;  2W96 A;  2DKG A;  2KY9 A;  3NHN A;  4ELY C;  3HPW A;  1IHW A;  3OSV A;  2M9U A;  1T3S A;  4FSS A;  4ZN1 A;  3SD4 A;  3L2W A;  4CRL B;  3CCS A;  2E64 A;  2O9S A;  1KHC A;  4PJO G;  1AVZ C;  4EPC A;  1WIE A;  2XMF A;  5FRO A;  2B8A A;  3AT1 B;  1ZQ1 A;  1FIN B;  4OML A;  1YHQ Q;  2DM1 A;  2DYI A;  5A0L A;  3M0Q A;  2D6F A;  4JUV A;  4KH0 B;  1WZO A;  4EMG A;  2DRM A;  4LDV A;  1K73 U;  2LQW A;  4C8Q F;  3QYB A;  2JOY A;  1IRX A;  1YIT A;  3HRT A;  2DBM A;  1R77 A;  1KHI A;  4C92 B;  5GMK i;  2M1H A;  3EH1 A;  4HNT A;  2MWP A;  2BE9 B;  4C92 F;  5FLX E;  2RHY A;  1H1S B;  1WXT A;  3VYH B;  1FVV B;  4KRC B;  3QWX X;  3URG A;  3CC4 A;  1M1F A;  2RI3 A;  2RK1 A;  3V8L A;  2UUE B;  1Q82 U;  3KFV A;  2CCH B;  2DBK A;  4CXA B;  1VQ6 Q;  3GF5 A;  4Y72 B;  5GAN 3;  1H28 B;  1JJ2 A;  2NYS A;  4M77 F;  2DXB B;  2K6D A;  3NDQ A;  4OGR B;  1AWJ A;  1H1R B;  1YI2 Q;  3ULR B;  4LDU A;  3MET A;  1WI7 A;  4DEX A;  2D9T A;  2RHX A;  2RQU A;  4JRK A;  2ECZ A;  3OQ5 A;  4BY1 X;  1NYG A;  3VS4 A;  1K0S A;  3VS3 A;  2AKL A;  4LD9 K;  3CXC S;  3HRU A;  2R5A A;  2QTX A;  3H9N A;  4BE0 A;  4O5V A;  4M77 E;  1IZ6 A;  4C5G A;  3DLM A;  3S3O A;  3NTK A;  3V7C A;  1YN8 A;  3OYG A;  2Y4Y A;  3RES A;  1AIS B;  2BZX A;  1Q86 C;  1VQ4 T;  4OR5 B;  1UGR B;  1IHV A;  1R0C B;  5GMK m;  5I5Z B;  2PNI A;  1ZP2 A;  2L3S A;  4J9D A;  2CZ0 B;  5CAI A;  2E12 A;  1M30 A;  3OYD A;  1FMV A;  1BU2 A;  1YCY A;  5KYY A;  1M2V A;  2OTL T;  1K76 A;  2LW4 A;  3M0U A;  5GJV B;  2DZ9 A;  5KYX B;  1VYU A;  3JV3 A;  4CFW B;  1TSF A;  4LDY A;  3G4S A;  3DDQ B;  4C92 D;  1VQP A;  4M7D C;  5DLQ E;  3P8D A;  2YRD A;  2KXD A;  1OOT A;  3LX7 A;  1K8A U;  1PKT A;  2DMO A;  1X6G A;  1HD3 A;  4JJB A;  3MY5 B;  3RGF B;  4C0D C;  4XU1 A;  4RTU A;  4HKE A;  3BHU B;  2LT4 A;  2ZPB B;  2X51 A;  1UGQ B;  3I55 T;  5IDP B;  1U5S A;  5I2S A;  2KYB A;  1ZSZ B;  2QEX T;  4M7D E;  1UNH D;  2VKN A;  4ELJ A;  3MY1 B;  2F5K A;  2ROT A;  1D0X A;  2K3B A;  4MML A;  1H27 B;  1VQN Q;  4OP0 A;  1Q7Y C;  1K1Z A;  1SKU B;  4FX3 B;  4UN0 A;  4RUG A;  4YOO A;  5CIU A;  1VIN A;  5CYI B;  1PNJ A;  5GJW B;  3VV0 A;  1M3A A;  3M55 A;  2DLP A;  1O9K A;  1VQ5 A;  1QQJ A;  3QHR B;  4BCP B;  1UG1 A;  1V1C A;  1N6A A;  5GMK j;  3L2Q A;  1RAA B;  2FZK B;  4LOC A;  1YJN A;  1VQK Q;  1RI0 A;  1S1N A;  1W98 B;  2CJM B;  2IG0 A;  3HKS A;  1UHC A;  3LH5 A;  4M78 G;  3CCE A;  2V26 A;  3AHU A;  4C0D B;  4F70 B;  4KGZ B;  3B57 A;  3CC7 T;  2YHT A;  3SB2 A;  4J6W A;  1F5Q B;  3MIA B;  4QVZ A;  3VS7 A;  4M7A D;  1VUB A;  3H0F A;  5J39 A;  3I55 A;  1PHT A;  3PMT A;  1NBE B;  1X6B A;  2OTJ T;  1D3B B;  4MMK A;  5GAM h;  3UPU A;  2KRO A;  4Z88 A;  4E7J A;  1YNZ A;  1WHJ A;  2DYB A;  4F7L B;  1ZHI A;  3L1A A;  3PE0 A;  1SPK A;  2D0N A;  4M75 A;  3JB9 H;  1YJ9 Q;  4LDW A;  3CCQ T;  4VUB A;  2HNI A;  1KD1 C;  4XTU A;  1N8R U;  3OYN A;  4BCM B;  4EMH A;  1X01 A;  1QVG A;  4C8Q E;  3TVT A;  3JCM V;  1UJ0 A;  1N9S A;  1Y96 B;  2L2P A;  1I81 A;  2EQI A;  2E70 A;  1Q86 R;  1NG2 A;  5I22 A;  2PHG A;  1M1K C;  4J9G A;  4M75 F;  3RNJ A;  2ABL A;  1VOM A;  3LLR A;  4GBQ A;  4M75 B;  3VS6 A;  1VQM A;  2L89 A;  4YTL A;  2KRM A;  4E6R A;  3JCM Q;  3HL8 A;  2FHD A;  5HNB B;  1RL2 A;  5DY9 A;  2WMA B;  2HEQ A;  5LMK B;  1QLY A;  4BI4 A;  1JJ2 P;  3KUF A;  2XG8 D;  1H1Q B;  1YJW T;  4Q5W A;  4EON B;  1TH7 A;  2HDA A;  3C4S A;  1XQH A;  1VQO Q;  5KYU B;  4DEY A;  1JEG A;  2M0Y A;  2YWW A;  2YRV A;  2JGZ B;  1AZG B;  4F7U F;  1VQ7 A;  4IUV A;  2W2H A;  4II1 A;  4OF1 A;  3G71 A;  3DDP B;  1QCO A;  2QYZ A;  1VQL T;  1QW1 A;  2BPM B;  4KGX B;  2R57 A;  1VQ9 A;  5GAM j;  5HQ0 B;  4EOR B;  1IRE B;  2OAU A;  3CC7 Q;  3PO3 S;  3OYH A;  4M75 E;  3TN8 B;  1ZUK A;  3HTR A;  4NOY A;  4B9X A;  4DOW A;  3INZ A;  2EGC A;  2UZB B;  2HSE B;  1NM7 A;  2RQW A;  3LQ5 B;  2EYW A;  3CMA Q;  4ATO A;  3VYG B;  1GCQ C;  2QGS A;  3JAM E;  1NEB A;  4F7U B;  4HNV A;  4J9C A;  3HSB A;  2DF6 A;  1H26 B;  1UUE A;  2V8J A;  1U1S A;  4QKU A;  2K7A A;  5GAO q;  1I5O B;  1AT1 B;  4ZGE B;  3OS5 A;  3JCM h;  2EKH A;  4A4E A;  4F16 A;  3L2V A;  1KSW A;  4IKF A;  4DOV A;  1AD6 A;  1H92 A;  4AFZ C;  2CRE A;  2XDP A;  5HKC A;  1VQK A;  2G9X B;  2LZ6 B;  4PKC C;  4XTW A;  2K4Y A;  3M58 A;  1S72 A;  3OYJ A;  3JCM W;  4FU6 A;  3CC2 Q;  3H0H A;  2KR3 A;  3EG9 B;  1U3O A;  2WIH B;  1JXM A;  2HAX A;  1OQK A;  1WLP B;  5GAN 7;  5ACB A;  2HL3 A;  3EG0 A;  4PL6 A;  5LJ3 e;  3CCM T;  4AMC A;  3ER0 A;  2MF2 A;  2QA4 T;  5FU7 B;  4BAC A;  1C0M A;  2EYY A;  2EQU A;  3BW1 A;  3BFM A;  1AWW A;  5IHI A;  3QSU A;  2JS0 A;  4MZT A;  2I0N A;  2PK2 A;  1GUX A;  3EG1 A;  1XNI A;  3TCJ A;  3UDC A;  2E6Z A;  1OIY B;  4C5H A;  2G77 A;  2CZ1 B;  1KC8 R;  4N4G A;  3BHT B;  2OX7 A;  4ESR A;  5FU6 C;  1VQP Q;  2AT1 B;  4C92 A;  3J7A F;  2H8H A;  1QLB A;  4GY5 A;  1YJ9 T;  3X24 B;  2L5Q A;  3R6N A;  2E6N A;  1LJO A;  2QK0 A;  3QYG B;  1BI2 A;  2DJQ A;  3DKM A;  2KNB B;  3MEW A;  2H3J A;  1E6H A;  2D8J A;  2YUO A;  2L8D A;  1YI2 T;  3OYM A;  2KMT A;  2D1X A;  5I2M A;  1K9M U;  2BS4 A;  2X4Y A;  3C12 A;  5L8R E;  2DXU A;  4TTH A;  2ZPF B;  4D8K A;  3KXT A;  4OMQ A;  2VV5 A;  2E4H A;  3V7R A;  4EIK A;  3F5X B;  2EPD A;  4N4I A;  2RH2 A;  4CC3 A;  1PCX A;  1UGP B;  2VB6 A;  5FU7 C;  6AT1 B;  1MMG A;  1I5L A;  3A98 A;  2K5L A;  2K5F A;  4NC6 A;  1U1T A;  2CDT A;  2V8K A;  4QQG A;  3TQ7 P;  3CXC P;  1W1F A;  2HL5 C;  1K73 R;  3QJY A;  2X3W D;  1N9R A;  4C8Q A;  5HBJ B;  4M7D F;  1HK9 A;  3O5Z A;  3MEU A;  2OTJ Q;  3EGD A;  3RBB B;  1OIU B;  4FYW B;  1Q82 R;  4LE9 A;  2YXY A;  4M7A A;  3TNI B;  9ATC B;  2DD4 B;  5KYY B;  1WQW A;  1ZUU A;  3I9Q A;  2EBP A;  3S6W A;  1URC B;  1VQ6 A;  2QA4 Q;  1R8O B;  1CSK A;  3GTM S;  5C0M A;  4RMO A;  2SEM A;  5FGK B;  3V8J A;  3CC4 Q;  1VYT A;  3TNH B;  3GLX A;  3M53 A;  4J9H A;  2Y4X A;  3HRS A;  4BCH B;  4Z89 A;  1Q7Y R;  3MP8 A;  1TD6 A;  1QWE A;  2F69 A;  1JRI A;  4LN2 A;  3CC4 T;  2J6F A;  1M9S A;  3SDZ A;  3QWY A;  3ZFJ A;  5GAN 4;  1YBY A;  5LJ5 g;  2WIP B;  3NMZ C;  3I35 A;  1PD0 A;  5CKH A;  2DXC A;  1ACM B;  2DME A;  1WJR A;  4XU2 A;  4M77 C;  2IPO B;  1GBQ A;  2J6O A;  2LJ3 A;  3A8H B;  3CEY A;  2QEX Q;  3OMC A;  4A54 A;  4OB3 B;  2FZC B;  3MKD A;  4JZ3 A;  3CC7 A;  1B34 A;  2A0F B;  1UNG D;  5LJ3 f;  1WDX A;  1U8R A;  3FIF A;  1N8R R;  2ZPH B;  5FWB A;  4BCQ D;  2QDL A;  5HVY B;  4MFE A;  4Z6Y A;  5A0D A;  1VQM T;  2VGN A;  2K79 A;  4BCF B;  1WX6 A;  1FMW A;  1NJI C;  2FPF A;  2GCX A;  3X20 B;  5EFQ B;  2P0K A;  4OVA A;  3SHW A;  1WYX A;  4N0A C;  2RK2 A;  4OGE A;  4BUG A;  1WGS A;  1SHG A;  1X2Q A;  2VAS A;  4C8Q D;  1OU8 A;  1FXX A;  1TUG B;  4F7N B;  2CH4 A;  2PVD B;  1C9B A;  4HT9 A;  4KT0 E;  3QII A;  2EUF A;  2OJ2 A;  4KRD B;  1T0J A;  1G8X A;  1G3T A;  1OUL A;  4DBH A;  4E7H A;  4BY7 X;  3G6E A;  1D1C A;  3CME A;  4E7I A;  3EHR A;  2L0A A;  2RQR A;  4C92 E;  2JXB A;  3PVL A;  2COW A;  2OTJ A;  2YT6 A;  1UB4 A;  2CP6 A;  2KRS A;  2DVJ A;  3M56 A;  2F2C A;  1VOL A;  2QTV A;  2MI6 A;  1MNE A;  2M0O A;  1M90 C;  1M8M A;  3WVD B;  1LPL A;  1VQN A;  2MK5 A;  3TSW A;  2X3X D;  5GAN j;  1G3S A;  1GFD A;  4RTX A;  2FRW A;  2MIO A;  4DBQ A;  1BI3 A;  4M77 B;  4RG2 A;  2K9G A;  3GOX A;  1GXI E;  4KH1 B;  4OGC A;  1VQ4 A;  1X75 C;  4M6V A;  2GTJ A;  2EQM A;  2CUD A;  4EOJ B;  2A36 A;  1D0Z A;  3PTA A;  2GF7 A;  4YC3 B;  2GBQ A;  3I5S A;  2C0I A;  4DQ2 A;  1D09 B;  5GAO l;  2I2L A;  4QVC A;  2M16 A;  1YJN Q;  1RUW A;  1MV0 B;  2LJ1 A;  4FYX B;  3FB9 A;  4V2S A;  4PJO A;  1GCP A;  2PK9 B;  2WSE E;  2I40 B;  2CT4 A;  4C0Z A;  1B3Q A;  2HBW A;  3FLG A;  4M78 D;  4MZP A;  5GMK e;  1KIK A;  4F7U G;  1QVF A;  4F6W B;  2DEQ A;  5CK9 A;  3GPL A;  4M7A B;  1G83 A;  2NLU A;  2X1N B;  1WQ7 A;  3VYG A;  1PRM C;  3E9F A;  5IXF A;  1PD1 A;  1TG0 A;  4M4Z A;  4B9W A;  2DAQ A;  2ED1 A;  2A28 A;  3LWI A;  3FJ5 A;  4FIB A;  5GAN 8;  4NL3 A;  2WXV B;  2W9F A;  2KRN A;  4M77 D;  1VYV A;  3QYE A;  2FPE A;  1TS9 A;  3M9Q A;  2KBT A;  1QKX A;  4B6M A;  4JS4 A;  4NST B;  3X28 B;  2EQJ A;  4FSX A;  1M4Z A;  1AWX A;  4EOL B;  1YIJ A;  2AHJ B;  3OS1 A;  3EFO B;  3EGU A;  3QDF A;  2A37 A;  3QDR B;  1KQS S;  2W0Z A;  1MGQ A;  4FT4 A;  1VQ7 T;  4E7Z A;  2P4T A;  3HP9 A;  1FMK A;  2K2V A;  3N5B B;  4XAX B;  2O2O A;  3DB3 A;  4K11 A;  2LT1 A;  2QQB A;  2LVM A;  5DM7 R;  3CCM Q;  3M0S A;  1D0Y A;  2DXC B;  4JRP A;  4FW2 A;  2HBP A;  4IUR A;  2NUP B;  1KK7 A;  2RI2 A;  4J5Y A;  3J80 E;  4X34 A;  3GNF B;  3QZ9 B;  2IW9 B;  4EMK A;  2DTO A;  2J7I A;  1LCK A;  4N4H A;  2KE9 A;  3EGX A;  3CCL A;  1UFF A;  2XHC A;  2DET A;  3CC2 T;  1H3H A;  3E1S A;  3H0I A;  1J3T A;  3M54 A;  2RJC A;  5CO7 A;  4EC9 B;  2KR6 A;  3EG9 A;  2C5V B;  3OBY A;  4PJO B;  3CMA A;  4GLM A;  1ZLM A;  2CSQ A;  3JCM X;  2EAY A;  1IGQ A;  2CUB A;  2LMJ A;  1OX9 A;  1I0C A;  1MND A;  2CH4 W;  4M75 D;  3D7S B;  2JM8 A;  5IN1 A;  5KE2 A;  1FX7 A;  4O6J A;  1R0B G;  3QHS A;  3TRE A;  2FB7 A;  3I56 A;  2J05 A;  4NL2 A;  1VQ7 Q;  5IXB A;  4J8O A;  4PJN A;  4MIM A;  4PJO F;  1M5Q 1;  1PWT A;  1JJ2 S;  3UA7 A;  4JLI A;  2BS3 A;  3CXC A;  2A7Y A;  2OTL A;  1QMZ B;  5EG2 A;  2FG0 A;  3CMA T;  1NLP C;  1QCN A;  2E3I A;  1ZX6 A;  2QQ9 A;  2R7G A;  4MDX A;  1RAE B;  2COZ A;  5LQF B;  1NLO C;  3V7S A;  2CS7 A;  1ZA2 B;  4HCB A;  3OYB A;  5EJC A;  1QVF P;  2RD1 A;  2VXF A;  1O9K B;  1UEC A;  2F2W A;  2E5K A;  1OZ3 A;  1C1A A;  4M78 E;  1KC8 C;  2KT1 A;  4BCK B;  1S72 T;  1EZZ B;  4PK4 A;  1QMC A;  4CRI A;  4BCM D;  3JCM d;  4QT7 A;  1WNL A;  2BS2 A;  2RQT A;  1M3B A;  1Y0M A;  4C8Q C;  2H3E B;  3OBW A;  1QVG P;  3GIB A;  1RAD B;  4E47 A;  3BG9 A;  4EC8 B;  1ABO A;  1O75 A;  1BIA A;  2RQV A;  2K3X A;  2CP0 A;  1E7P A;  4IMY B;  4FL6 A;  1XO2 A;  1K9M C;  5LJ5 f;  4EOI B;  4LNP A;  1VA7 A;  4FYY B;  5GAN h;  2HSP A;  5CVI A;  3UF4 A;  3QHW B;  1KJW A;  1D1A A;  3CCL Q;  3SWN C;  4M7D A;  3DB4 A;  3M59 A;  4M78 A;  5CKB A;  1VQ8 T;  3NTI A;  2RN8 A;  3HB9 A;  1T3L A;  3I55 Q;  5D7U A;  4BD3 A;  3GBQ A;  4M7D D;  4A4F A;  1VQ8 A;  4M7A G;  2KT8 A;  4J83 A;  1AZE A;  1AD5 A;  5KYU A;  2IW8 B;  1VQ9 T;  3CCE Q;  2W99 A;  1TUD A;  1EFN A;  2WHB B;  3VS0 A;  4M78 F;  4R55 A;  3HFN A;  2RF0 A;  3EFS A;  4PJM A;  5DQW A;  2FYK A;  3VKI A;  2KVQ G;  1WXU A;  4L5G A;  3E2U A;  2WSC E;  2PUK B;  4XTX A;  3DL1 A;  1YIJ Q;  5HK3 A;  5IAY A;  4X1V A;  2XD0 A;  4J7F A;  2DD4 A;  4LD6 A;  1X2K A;  2A08 A;  2C6T B;  4J6Y A;  4R0K A;  3ASK A;  2FEI A;  5CCA A;  4BY6 C;  1Y96 A;  4KUL A;  5FU6 B;  3CCR Q;  2HKQ B;  4EOK B;  4PLI A;  2RPN A;  4A53 A;  3CD6 A;  4QQD A;  3M0T A;  1MMA A;  4OMP A;  3C0C A;  2NUT A;  3PGG A;  1EX4 A;  1MMD A;  1WPY A;  4X9D A;  4CFU B;  3JCM g;  2V8I A;  2L3P A;  5HBE B;  1E6G A;  1S72 Q;  1UGV A;  2HQH A;  1YJW Q;  2F2V A;  2CCI B;  2IVW A;  1VQN T;  5IHY A;  2NUP A;  2C5X B;  2RHU A;  3VKG A;  4FYV B;  3CCJ T;  5KE3 A;  1VIF A;  3A8L B;  3QBY A;  1LVK A;  1K9A A;  1V29 B;  2EJG A;  1O9S A;  4AFQ C;  1BCM A;  2ZAE A;  2AKK A;  5GAM f;  2XKO C;  1SSH A;  3A8G B;  1AEY A;  3UWN A;  5GMK h;  4HVV A;  2RMO A;  5KYW B;  1CKB A;  2MYS A;  4F17 A;  2JVV A;  3L42 A;  1BBZ A;  2XU8 A;  5ICP B;  4D8D A;  2C0O A;  1N4M A;  2FL7 A;  1W6X A;  3CC2 A;  4PJO D;  1K0X A;  3OYI A;  2X4J A;  3PIP A;  1NPP A;  1K9M R;  3A8M B;  4XTV A;  5EC7 A;  3CCJ Q;  4LXC A;  3PMI A;  5LJ5 e;  1KXU A;  3RER A;  1WHG A;  3JCM c;  5I11 A;  4BI8 B;  3J81 E;  2OTL Q;  1VQ5 T;  4J7I A;  2ATC B;  3CME Q;  1UEB A;  3CQT A;  1C6V X;  1RLP C;  5FW9 A;  5GAN 6;  2D0Q B;  2HMA A;  1N8R C;  1ZA1 B;  1AOJ A;  1Q81 U;  2GFA A;  1M1K U;  4PJO C;  3OSS C;  2ZZD A;  1M1K R;  1T0H A;  2ED0 A;  1SSF A;  1M1G A;  4JPB W;  1JB0 E;  2DEU A;  3TSZ A;  2F2X A;  4MZM A;  4IUP A;  2KQW A;  3MEA A;  1PC0 A;  1NPR A;  4EOS B;  2RI5 A;  4HXJ A;  2DER A;  1PSF A;  3M4G A;  2D8H A;  3RKY A;  3MCA B;  3CCQ Q;  2O4X B;  1Q81 C;  2SRC A;  3OS0 A;  4M75 G;  3VJP A;  1X69 A;  4WCI A;  4RTV A;  1BI1 A;  4BCJ B;  5IDN B;  1TUC A;  4LUD A;  4OMO A;  4PFP A;  3Q1J A;  1YIT Q;  3DTO A;  3JB9 J;  3OYA A;  1VQ9 Q;  1OZ2 A;  4BCG B;  2E41 A;  1BU1 A;  2BUD A;  2XIC A;  2YLC A;  3SFM A;  3QYH B;  1VQL Q;  4M75 C;  1NYF A;  4RCB A;  3M5A A;  3EJ1 B;  1TTH B;  5IF1 B;  4CC4 B;  3VU3 C;  2DXB A;  2WJ9 A;  3BG3 A;  2O31 A;  3JCM f;  7AT1 B;  3EH2 A;  3OMG A;  5DLO A;  1VQO T;  3QJ6 A;  1K73 C;  4XTY A;  3CCV T;  4QQ6 A;  2EIF A;  2BIV A;  2QQ8 A;  2ZPI B;  2CGH A;  2KEA A;  4F7J B;  1RAI B;  2DIQ A;  1YJW A;  1SRL A;  3SWN B;  4M7A C;  4AG2 C;  3QG1 A;  2RJF A;  1WHH A;  2HKN A;  1M3C A;  3M03 A;  1PRL C;  5GAO m;  2EYQ A;  5FRN A;  1H24 B;  4N0A A;  4AI6 A;  5D6Y A;  1GCQ A;  1QWF A;  5GAM e;  2E1H A;  1P5E B;  2KMG A;  4F7U E;  3L2Z A;  3DLL A;  4Z8A A;  1H64 1;  2ZCF B;  2K5I A;  3ZL7 C;  3X26 B;  2HQE A;  5D6W A;  4A4H A;  4E7S A;  5DQV A;  1TU0 B;  2RA2 A;  2KXC A;  3OW2 S;  4ROC A;  5GAO n;  1D3U B;  2LX9 A;  3UT1 A;  1JU5 C;  2UZE B;  4II5 B;  1OX8 A;  4JX5 A;  1ZUY A;  1ZSZ A;  3THK A;  4ZNX A;  3EID B;  3H8Z A;  1KC8 U;  2EJF A;  3BLR B;  3JCM b;  2AIR B;  2J06 A;  3R6O A;  5KYN A;  2I53 A;  1M27 C;  2JS2 A;  4ROE A;  4BXX X;  4EOO B;  4MDW A;  3H4C A;  1OL1 B;  2EFI A;  5KCH A;  2PZ1 A;  3BLQ B;  2CKK A;  3HZJ A;  5KYW A;  2EYZ A;  4CC2 A;  4ZTF A;  4ZGJ B;  3RKX A;  4Y92 A;  3BLH B;  1VQK T;  4KUI A;  2O88 A;  1Q86 U;  1OU9 A;  4DBR A;  1JOW A;  3H41 A;  3MHX A;  4PLL A;  4JJD A;  1W4S A;  3L2R A;  3L2U A;  4F6S B;  2G3R A;  3OYC A;  3RDV A;  4OMF B;  2JMA A;  2DZC A;  1M90 R;  2XID A;  1PKS A;  3HBL A;  1D3B A;  2WMB B;  8ATC B;  2GNC A;  2E65 A;  1KQ2 A;  3CBM A;  5A0G A;  1BK2 A;  2LQ8 A;  4C5I A;  2IW6 B;  2JZ2 A;  3LYI A;  3WVE B;  2QEX A;  3TW7 A;  2CP3 A;  3OY9 A;  3QKJ A;  2BTT A;  4BE2 A;  2LRQ A;  1OV3 A;  1X43 A;  1OEB A;  1ABQ A;  4EDU A;  2MWO A;  5I21 A;  4BBS M;  2KDS A;  1UDL A;  1VYW B;  3EGX B;  3RIR A;  2DRK A;  1H8K A;  3ME9 A;  5C6S A;  1BI0 A;  1JQQ A;  3MJX A;  3CCV Q;  1TOV A;  1U06 A;  4PNO A;  1YWO A;  2DD5 B;  5GAO r;  4E7K A;  1KG1 A;  3G33 B;  3OB9 A;  1M90 U;  2ESW A;  4QVD A;  2LQN A;  1QKW A;  1F1B B;  4L59 A;  1VQL A;  4BCQ B;  3TW6 A;  3P8B B;  1Z9Q A;  3CCU A;  2QQR A;  4JJC A;  2C5N B;  4Z02 A;  4Y91 A;  2BE7 D;  1Y57 A;  4J9I A;  3OS2 A;  2V1Q A;  5FRM A;  1AWO A;  3LW5 E;  1MV3 A;  4F04 B;  2LCC A;  3PT9 A;  4ME7 A;  2JT4 A;  3QPH A;  4YOZ A;  1ZSG A;  1TFB A;  3P8H A;  2CYZ B;  2VGM A;  4EMK C;  2DVE A;  5L2W B;  1Q7Y U;  1QCF A;  1OL2 B;  4JDS A;  1JSU B;  2QF7 A;  5LJ3 h;  3S3M A;  5CQY A;  4ELZ C;  1SHF A;  1H25 B;  1YCS B;  3HHT B;  1WXB A;  4LUE A;  1BYM A;  3MP6 A;  3LWH A;  4AT1 B;  1EIF A;  2UZD B;  1FKM A;  5LJ5 h;  2WSF E;  1I4K 1;  4HCC A;  3JCM P;  4CFU D;  3CPF A;  1YI2 A;  2P0P A;  2OAW A;  2E5Q A;  2QXF A;  1OPK A;  5GAN f;  1YP5 A;  2WEV B;  4A4K A;  3BHV B;  5GAN g;  3A8O B;  4PFZ A;  3QZ5 B;  2GQV A;  1IGU A;  3ZBD A;  3JCM J;  2QFZ A;  5KH6 A;  1Q95 G;  4BDZ A;  1IXD A;  2KYM A;  1JO8 A;  3JB9 D;  1A0N B;  1BIB A;  4RTZ A;  1G3Y A;  2F5T X;  2PJQ A;  4UC4 A;  1X6O A;  3REB B;  2GFU A;  1ENW A;  2MOX A;  3CCJ A;  4XU3 A;  1KQ1 A;  1FYN A;  2JTF A;  2BZ8 A;  3E9G A;  8AT1 B;  5IHN A;  4AG1 C;  4J9E A;  2BKD N;  3RMS A;  1X27 A;  2EYX A;  1H1P B;  4ROD A;  3FC3 A;  1P92 A;  3X25 B;  2GGR A;  3CCE T;  4BY6 B;  1WHM A;  2RJE A;  1YJN T;  3CPW P;  2YUQ A;  4LDX A;  2O01 E;  3H6Z A;  4QW2 A;  1RAF B;  2G6F X;  2LTO A;  2GQI A;  1HSQ A;  2LNH B;  2LX7 A;  3CCL T;  1W2B P;  3LGF A;  1OI9 B;  4JS5 A;  1FWZ A;  2CSI A;  2PUO B;  3HFO A;  1OGU B;  1G3N C;  4CFN B;  2HD0 A;  4BDY A;  2DNU A;  3OYF A;  2DL3 A;  3MEV A;  2BKZ B;  3C95 A;  4RTY A;  2X35 A;  2ROL A;  1N27 A;  3TNW B;  2KSS A;  2RO0 A;  5J3B A;  4BE1 A;  2B9R A;  3BE3 A;  4JZ4 A;  2DL7 A;  4M78 C;  2O9V A;  3TU4 K;  5FWC A;  3EFO A;  3M57 A;  5A2Q E;  1NJI U;  2LDM A;  3UAT A;  1QVG S;  4CI0 C;  5GAN d;  2YLB A;  3I56 T;  2DA9 A;  5GAN 5;  2EGA A;  3G7Z A;  1VQP T;  2CZ6 B;  3M0P A;  1JST B;  3F70 A;  2WFY B;  2OI3 A;  5LJ5 d;  2JNG A;  1B7T A;  1QVP A;  3FJP A;  1UNL D;  3MPU B;  2EKO A;  4FW1 A;  2DIG A;  2FRY A;  4C5E A;  3G6E Q;  1GRI A;  4AKI A;  1XOV A;  5GAO p;  2DL8 A;  1I8F A;  2R5M A;  4M77 G;  1GH6 B;  1KQS A;  1WHK A;  1N5Z A;  1LNX A;  4RTT A;  2PMI B;  2VC8 A;  4AFU C;  3OYL A;  3SEM A;  4PJL A;  1BCO A;  1GFC A;  3G71 T;  4G6L B;  1RAH B;  1WHL A;  1G5V A;  3PIO A;  5LJ3 j;  2AZS A;  5CQX A;  4FT2 A;  1SEM A;  5IT9 E;  2HCK A;  3CCV A;  2L3Q A;  1Y71 A;  1UHF A;  1IO6 A;  4C0G A;  2DIL A;  2RB6 A;  2QI2 A;  5HCK A;  3O8V A;  2W9Z A;  3NPF A;  4XQ3 A;  2IVX A;  2YUN A;  4P5N A;  5KCO A;  2X9H A;  4F7U A;  2QDJ A;  4M77 A;  2VXE A;  4EMK B;  4J6X A;  1OKV B;  3EFR A;  2VVK A;  3QWL A;  4BCO B;  2RM4 A;  3EGD B;  3V8K A;  2PQW A;  2E3H A;  3WXM B;  3G6E T;  2X4W A;  4MFD A;  4F6U B;  2B86 A;  3VS5 A;  4C0F A;  1H3Z A;  1RLQ C;  3OYY A;  1ZBJ A;  1YJ9 A;  4BI3 A;  1XTD A;  4C92 G;  5LL6 S;  3CCQ A;  1E9H B;  1CKA A;  3LH0 A;  4M7D G;  3G1J A;  3PVQ A;  2MPX C;  4RCC A;  2DFU A;  3T9N A;  4NS5 A;  2QAZ A;  3ZEH A;  2LCL A;  4RG8 A;  3BG5 A;  1PG5 B;  3JRZ A;  2M51 A;  2E10 A;  1UTI A;  4KRT A;  3NFC A;  3CD6 Q;  2QAS A;  2QA4 A;  1G3W A;  3CCM A;  3VKH A;  3EOC B;  2K3Y A;  1JXO A;  2DK3 A;  2DTI A;  2RNA A;  1YIT T;  4ANJ A;  1K8A C;  1Z9Z A;  2VYT A;  3QUI A;  1RI9 A;  1VQ5 Q;  4QSH A;  5GMK l;  2YRC A;  1GBR A;  1HXD A;  2QG9 B;  4ORZ A;  1HJD A;  2RHI A;  5AYF A;  3DOG B;  1M2V B;  4KUD K;  3VS1 A;  3NGP A;  5CEI B;  1YFN A;  2P0Q A; 
#chains in the Genus database with same CATH homology
 1B34 B;  3LX7 A;  1K8A U;  1YJW A;  5GAN j;  1G3S A;  3SWN B;  3CCS T;  1BI3 A;  4M77 B;  4M7A C;  4C0D C;  4RG2 A;  3GOX A;  3QG1 A;  4XU1 A;  4JRQ A;  2RJF A;  3RKW A;  1GXI E;  4OGC A;  4HKE A;  1VQ4 A;  1X75 C;  2X4X A;  4M6V A;  2EYQ A;  5GAO m;  2DTH A;  5FRN A;  2LT4 A;  2ZPB B;  3QXE B;  4AI6 A;  2EQM A;  4N0A A;  1UGQ B;  5D6Y A;  2L3R A;  3I55 T;  1W2B A;  3KBG A;  4IUT A;  3BDU A;  5I2S A;  3JCM e;  3PTA A;  5GAM e;  2GF7 A;  2E1H A;  2QEX T;  4M7D E;  2KMG A;  4F7U E;  3L2Z A;  4XU0 A;  3DLL A;  1H64 1;  2ZCF B;  4ELJ A;  2K5I A;  4DQ2 A;  3G4S T;  3CME T;  3KHI A;  2F5K A;  3X26 B;  2HQE A;  5GAO l;  4MML A;  5D6W A;  2I2L A;  4A4G A;  4QVC A;  4A4H A;  2M16 A;  4OP0 A;  2PVO B;  1Q7Y C;  2RA2 A;  4HA8 A;  2LNV A;  2DPP B;  3RUX A;  3OW2 S;  5CIU A;  3FB9 A;  5GAO n;  4OB2 B;  3VV0 A;  2LX9 A;  3M55 A;  4V2S A;  3UT1 A;  4PJO A;  1MHN A;  5LJ5 j;  1LOJ A;  1VQ5 A;  4JX5 A;  2WSE E;  1N6A A;  5GMK j;  1Y7X A;  3L2Q A;  4C0Z A;  4LOC A;  3H8Z A;  4M78 D;  3FLG A;  4WF2 A;  4MZP A;  1RI0 A;  5GMK e;  5GAM g;  4F7U G;  1YJN A;  2IG0 A;  3HKS A;  1QVF A;  2PU9 B;  4M78 G;  3CCE A;  3AHU A;  2DEQ A;  4C0D B;  5CK9 A;  1KC8 U;  3GPL A;  4M7A B;  2EJF A;  4BBR M;  2NLU A;  3CC7 T;  2YHT A;  3SB2 A;  1WQ7 A;  3JCM b;  3VYG A;  4J6W A;  3E9F A;  3R6O A;  2DO3 A;  2MMP A;  4QVZ A;  2CZ7 B;  4B9W A;  2DAQ A;  4M7A D;  4RKU E;  1VUB A;  3CPW A;  4MDW A;  5J39 A;  2LQK A;  3H4C A;  4FIB A;  5GAN 8;  5GAN 2;  4NL3 A;  4KBM B;  2HQX A;  3I55 A;  2EFI A;  3CCR A;  4M7D B;  5GAM d;  5KCH A;  1WJQ A;  3PMT A;  4M77 D;  3QYE A;  1DJ7 B;  3CCR T;  2OTJ T;  2CKK A;  3HZJ A;  1D3B B;  3M9Q A;  4MMK A;  5GAM h;  2C06 A;  3UPU A;  3PFS A;  4ZTF A;  4AKG A;  4ZGJ B;  3RKX A;  4IUQ A;  4TVR A;  3X28 B;  4JS4 A;  4E7L A;  2EQJ A;  4E7J A;  4FSX A;  1VQK T;  4KUI A;  1Q86 U;  1M4Z A;  2WAC A;  1QP2 A;  4M7A F;  1YIJ A;  2AHJ B;  1ZHI A;  3L1A A;  3MHX A;  4M78 B;  3OS1 A;  2VUB A;  4M75 A;  4PLL A;  3QDR B;  3JB9 H;  2ZPG B;  1YIJ T;  1KQS S;  4LDW A;  5HK0 A;  3CCQ T;  4VUB A;  4PJO D;  1UGS B;  1W4S A;  3L2R A;  2XDD A;  1MGQ A;  2HNI A;  3L2U A;  4XTU A;  4FT4 A;  3OYN A;  3CCU T;  2G3R A;  3OYC A;  1N8R U;  4EMH A;  1VQ7 T;  2P4T A;  1X01 A;  3HP9 A;  2K2V A;  3N5B B;  4XAX B;  3JB9 G;  4OMF B;  2DZC A;  3DB3 A;  2XID A;  2LT1 A;  1QVG A;  2QQB A;  2JN0 A;  3HBL A;  4C8Q E;  1D3B A;  2LVM A;  5DM7 R;  3JCM V;  1N9S A;  1Y96 B;  2E65 A;  4GLK A;  3CBM A;  1I81 A;  5A0G A;  1KQ2 A;  2E70 A;  2LQ8 A;  4C5I A;  2DXC B;  2JZ2 A;  2PVG B;  3WVE B;  3LYI A;  4JRP A;  1M1K C;  2QEX A;  4M75 F;  3TW7 A;  3SWN A;  3OY9 A;  2HBP A;  4IUR A;  3QKJ A;  2RI2 A;  2RJD A;  4HNU A;  3LLR A;  4J5Y A;  3J80 E;  4X34 A;  3GNF B;  4M75 B;  4BE2 A;  3QZ9 B;  2LRQ A;  4EMK A;  2DTO A;  4EDU A;  4N4H A;  2KK4 A;  2MWO A;  1VQM A;  2L89 A;  4AKH A;  4YTL A;  1VIE A;  5I21 A;  3NTH A;  4BBS M;  2KDS A;  2QDY B;  4OB1 B;  3JCM Q;  3S3N A;  2EQK A;  3HL8 A;  3RIR A;  3CCL A;  2FHD A;  2XHC A;  3JB9 I;  2RHZ A;  3CC2 T;  1RL2 A;  3E1S A;  5DY9 A;  3ME9 A;  4BI4 A;  5C6S A;  2XDB A;  3M54 A;  1BI0 A;  2RJC A;  5CO7 A;  3OYK A;  2KR6 A;  3VUB A;  3KUF A;  3PNW C;  2XG8 D;  3OBY A;  4PJO B;  4PNO A;  2DD5 A;  1YJW T;  1WJS A;  1TH7 A;  4Q5W A;  2DD5 B;  5GAO r;  3GNG A;  3C4S A;  3CMA A;  4E7K A;  1XQH A;  1KG1 A;  3OB9 A;  5CR2 A;  1M90 U;  4C8Q G;  3RMQ A;  4XK8 E;  4QVD A;  3JCM X;  2EAY A;  3CD6 T;  2JUF A;  2YRV A;  4L59 A;  4F7U F;  1VQL A;  3TW6 A;  4M75 D;  3P8B B;  3CCU A;  1VQ7 A;  2QQR A;  4IUV A;  4Z02 A;  2K57 A;  3E19 A;  5IN1 A;  4II1 A;  4Y91 A;  4OF1 A;  3G71 A;  5KE2 A;  1FX7 A;  1ZBX A;  2QQA A;  1QW1 A;  3OS2 A;  4O6J A;  1VQL T;  3QHS A;  1YHQ A;  2R57 A;  1VQ9 A;  5GAM j;  5FRM A;  3TRE A;  2FB7 A;  3I56 A;  1IRE B;  2OAU A;  4NL2 A;  3OYH A;  4M75 E;  4J8O A;  3LW5 E;  1VQO A;  4MIM A;  4PJO F;  1M5Q 1;  2LCC A;  3PT9 A;  4ME7 A;  4NOY A;  4B9X A;  4JLI A;  1JJ2 S;  4DOW A;  2BS3 A;  3INZ A;  3FRN A;  4C92 C;  2A7Y A;  3QPH A;  5GAN e;  3CXC A;  3C94 A;  1YHQ T;  2OTL A;  3P8H A;  2CYZ B;  3HO8 A;  5EG2 A;  4DA4 A;  3CMA T;  3VYG B;  4ATO A;  2VGM A;  4EMK C;  4FM4 B;  3JAM E;  2DVE A;  4F7U B;  4HNV A;  4C8Q B;  1Q7Y U;  4JDS A;  2QQ9 A;  5J26 A;  2QF7 A;  4MDX A;  4PJO E;  5HY6 A;  2QQS A;  1OI1 A;  3HSB A;  5LJ3 h;  3V7S A;  2CS7 A;  3S3M A;  3LWI A;  5CQY A;  4ELZ C;  4HCB A;  2V8J A;  1U1S A;  3OYB A;  5EJC A;  4IUU A;  2RD1 A;  2VXF A;  3EAE A;  3HHT B;  5LJ3 d;  4BB7 A;  1BYM A;  5GAO q;  2R58 A;  3MP6 A;  1OZ3 A;  4ZGE B;  3OS5 A;  3JCM h;  3LWH A;  1EIF A;  4M78 E;  1KC8 C;  1FKM A;  2XK0 A;  3QO3 A;  4A4E A;  4JJN K;  4JX4 A;  3TEE A;  2WSF E;  5LJ5 h;  1S72 T;  4CRI A;  1I4K 1;  4HCC A;  3JB9 F;  3L2V A;  3JCM P;  3CPF A;  1YI2 A;  2P0P A;  3JCM d;  1WNL A;  1VQ6 T;  2BS2 A;  4IKF A;  3BY7 A;  2E5Q A;  2QXF A;  4DOV A;  5GAN f;  3FEO A;  3MP1 A;  4OB0 B;  4A4K A;  5GAN g;  3A8O B;  4C8Q C;  3OBW A;  3QZ5 B;  2GQV A;  3GIB A;  2XDP A;  3ZBD A;  2A3L A;  2LC4 A;  5HKC A;  3JCM J;  4E47 A;  2QFZ A;  1VQK A;  3BG9 A;  3LGL A;  5KH6 A;  4BDZ A;  1O75 A;  1BIA A;  1Y07 A;  2K3X A;  4ZN3 A;  3JB9 D;  1BIB A;  1E7P A;  3GP8 A;  1G3Y A;  2F5T X;  3JSC A;  4PKC C;  4UC4 A;  1X6O A;  4FL6 A;  4Y28 E;  1K9M C;  4HCZ A;  4XTW A;  5LJ5 f;  2GFU A;  3CPW S;  2K4Y A;  3M58 A;  1S72 A;  5GAN h;  4XU3 A;  1KQ1 A;  3CCJ A;  3OYJ A;  3JCM W;  5CVI A;  3CBP A;  1Q82 C;  2EJ9 A;  2JTF A;  4FU6 A;  5M9O A;  3SWN C;  3E9G A;  4M7D A;  3DB4 A;  1QP3 A;  3VUZ A;  3M59 A;  2BKD N;  2DXT A;  4M78 A;  3RMS A;  5CKB A;  3CBO A;  5CKF A;  2JTM A;  2HAX A;  1VQ8 T;  3NTI A;  3A5Z B;  3HB9 A;  3FC3 A;  1P92 A;  3X25 B;  5GAN 7;  3CCE T;  4BY6 B;  4BD3 A;  4PL6 A;  5LJ3 e;  2RJE A;  3CCM T;  4A4F A;  1YJN T;  4M7D D;  1VQ8 A;  4M7A G;  3ER0 A;  3BDL A;  4J83 A;  2MF2 A;  2EWN A;  5FU7 B;  4JLG A;  2QA4 T;  4BAC A;  3BW1 A;  2EQU A;  4LDX A;  2O01 E;  2ZPE B;  4L6V 5;  1NZ9 A;  3H6Z A;  3BFM A;  2O4X A;  4QW2 A;  1VQ9 T;  3QSU A;  4MZT A;  4ZTJ A;  4XTZ A;  2LTO A;  1OYX A;  5D6X A;  2ZGW A;  4ZGD B;  1XNI A;  4M78 F;  5CKD A;  1NE8 A;  3TCJ A;  4HLQ A;  3UDC A;  3CCL T;  4R55 A;  2E6Z A;  3HFN A;  1VQN A;  3EFS A;  5CKE A;  4M7A E;  4C5H A;  4X9C A;  2G77 A;  3LGF A;  2CZ1 B;  4JS5 A;  1FWZ A;  2PUO B;  3HFO A;  4N4G A;  2FYK A;  3OYE A;  1JBM A;  5FU6 C;  3VKI A;  2KVQ G;  4C92 A;  2HD0 A;  4L5G A;  4BDY A;  2WSC E;  3J7A F;  2PUK B;  3OYF A;  2DJZ A;  1QVF S;  1QLB A;  4GY5 A;  3DL1 A;  4XTX A;  4D6W A;  1YJ9 T;  3X24 B;  2L5Q A;  1AHJ B;  2ZZD B;  5HK3 A;  5IAY A;  3M4Y A;  2KAF A;  2E6N A;  3MEV A;  1LJO A;  5LJ3 g;  1KD1 U;  1BKB A;  2XD0 A;  3QYG B;  1BI2 A;  3C95 A;  4J7F A;  2DD4 A;  4LD6 A;  1W2B S;  2X35 A;  3OA6 A;  3DKM A;  3OW2 A;  4J6Y A;  3MEW A;  2H3J A;  1N27 A;  3ASK A;  5CCA A;  1PSE A;  4BY6 C;  4HL4 A;  2FVU A;  2MAM A;  3MO8 A;  1Y96 A;  4KUL A;  2KSS A;  2L8D A;  2RO0 A;  1YI2 T;  4JRI A;  5FU6 B;  5J3B A;  3OYM A;  4BE1 A;  2KMT A;  4PLI A;  5I2M A;  1K9M U;  2Y90 A;  1M8V A;  2BS4 A;  4A53 A;  4HT8 A;  4M78 C;  2X4Y A;  3C12 A;  4QQD A;  3TU4 K;  3CD6 A;  5L8R E;  2DXU A;  2XI9 A;  4R56 A;  2ZPF B;  3KXT A;  2VV5 A;  3PGG A;  3V7R A;  3M57 A;  5A2Q E;  1NJI U;  1WPY A;  3FDR A;  2LDM A;  4X9D A;  3JCM g;  1QVG S;  4JX6 A;  2DKG A;  2V8I A;  4CI0 C;  5GAN d;  2KY9 A;  2YLB A;  4ELY C;  3I56 T;  3HPW A;  5GAN 5;  4N4I A;  3OSV A;  2M9U A;  3G7Z A;  2RH2 A;  1VQP T;  4ZN1 A;  3SD4 A;  1UGP B;  5FU7 C;  3L2W A;  2CZ6 B;  2IVW A;  3F70 A;  1I5L A;  2K5L A;  2K5F A;  4NC6 A;  1U1T A;  2V8K A;  4QQG A;  1VQN T;  2RHU A;  1KD1 C;  3VKG A;  5LJ5 d;  3CCJ T;  2JNG A;  5KE3 A;  1VIF A;  3CCS A;  1QVP A;  3A8L B;  3FJP A;  2E64 A;  3QJY A;  3QBY A;  2EKO A;  1N9R A;  4C8Q A;  1KHC A;  1V29 B;  2DIG A;  1HK9 A;  4PJO G;  4M7D F;  4C5E A;  4EPC A;  3MEU A;  4AKI A;  2EJG A;  1XOV A;  5GAO p;  1O9S A;  1I8F A;  2R5M A;  4M77 G;  5FRO A;  2B8A A;  5GAM f;  2XKO C;  1ZQ1 A;  1KQS A;  4M7A A;  5A0L A;  2D6F A;  3A8G B;  4JUV A;  2DD4 B;  1LNX A;  3UWN A;  5GMK h;  1WQW A;  2VC8 A;  3OYL A;  3S6W A;  4EMG A;  4LDV A;  1K73 U;  4C8Q F;  3G71 T;  1VQ6 A;  3QYB A;  1R8O B;  2JVV A;  2JOY A;  3L42 A;  1G5V A;  3PIO A;  2XU8 A;  5LJ3 j;  1YIT A;  5C0M A;  4RMO A;  3HRT A;  5CQX A;  4FT2 A;  5IT9 E;  1KHI A;  3V8J A;  4C92 B;  5GMK i;  2M1H A;  3CCV A;  2FL7 A;  4HNT A;  3GLX A;  3M53 A;  3CC2 A;  1Y71 A;  2MWP A;  2Y4X A;  2X4J A;  3HRS A;  3PIP A;  3OYI A;  4C0G A;  1NPP A;  4C92 F;  3MP8 A;  3A8M B;  2F69 A;  2QI2 A;  1JRI A;  2RB6 A;  4XTV A;  2RHY A;  3SDZ A;  1M9S A;  5FLX E;  3CC4 T;  3ZFJ A;  5GAN 4;  1YBY A;  3O8V A;  3PMI A;  3VYH B;  3URG A;  5LJ5 g;  5LJ5 e;  3CC4 A;  5CKH A;  1M1F A;  2RI3 A;  2RK1 A;  4XQ3 A;  3V8L A;  3RER A;  2DXC A;  4P5N A;  3JCM c;  1Q82 U;  1WJR A;  5KCO A;  4BI8 B;  3J81 E;  4XU2 A;  4M77 C;  4F7U A;  4J7I A;  1VQ5 T;  3GF5 A;  1UEB A;  5GAN 3;  2QDJ A;  3A8H B;  3CEY A;  4M77 A;  5GAN 6;  2D0Q B;  2VXE A;  3OMC A;  4A54 A;  4EMK B;  4OB3 B;  4J6X A;  1N8R C;  3EFR A;  4M77 F;  3CC7 A;  3QWL A;  2RM4 A;  1JJ2 A;  2DXB B;  1B34 A;  1Q81 U;  2GFA A;  1M1K U;  4PJO C;  3OSS C;  2ZZD A;  5LJ3 f;  3V8K A;  2PQW A;  1U8R A;  3FIF A;  3WXM B;  2ZPH B;  1SSF A;  3G6E T;  2X4W A;  4LDU A;  4MFD A;  1M1G A;  1JB0 E;  3MET A;  4MFE A;  2D9T A;  4Z6Y A;  2RHX A;  4C0F A;  1H3Z A;  5A0D A;  4MZM A;  1VQM T;  4IUP A;  2KQW A;  3OYY A;  3MEA A;  1YJ9 A;  2VGN A;  4BI3 A;  1NPR A;  1XTD A;  2RI5 A;  4JRK A;  3OQ5 A;  4C92 G;  5LL6 S;  1PSF A;  3CCQ A;  3M4G A;  3RKY A;  3LH0 A;  1NJI C;  2GCX A;  3MCA B;  4LD9 K;  3X20 B;  4M7D G;  4RCC A;  3CXC S;  2O4X B;  2P0K A;  4OVA A;  1Q81 C;  3HRU A;  3T9N A;  4N0A C;  4M75 G;  2RK2 A;  3VJP A;  4NS5 A;  4OGE A;  3OS0 A;  2R5A A;  2QTX A;  3ZEH A;  2LCL A;  4RG8 A;  4BUG A;  3BG5 A;  4BE0 A;  1BI1 A;  1WGS A;  3JRZ A;  4O5V A;  2E10 A;  4M77 E;  1IZ6 A;  4C5G A;  3DLM A;  4C8Q D;  3NTK A;  3S3O A;  3Q1J A;  1FXX A;  3NFC A;  3V7C A;  3OYG A;  2QA4 A;  2PVD B;  2Y4Y A;  3RES A;  3OYA A;  3JB9 J;  1Q86 C;  1VQ4 T;  1G3W A;  1UGR B;  1OZ2 A;  4HT9 A;  4KT0 E;  3CCM A;  5GMK m;  3QII A;  3VKH A;  2E41 A;  2K3Y A;  2BUD A;  2DK3 A;  2CZ0 B;  2XIC A;  5CAI A;  2DTI A;  2YLC A;  2E12 A;  1G3T A;  4E7H A;  1YIT T;  3SFM A;  3QYH B;  4M75 C;  4RCB A;  3OYD A;  3M5A A;  1K8A C;  3G6E A;  3CME A;  4E7I A;  1YCY A;  3VU3 C;  2DXB A;  4C92 E;  2VYT A;  2WJ9 A;  2OTL T;  3BG3 A;  2DZ9 A;  3QUI A;  3JCM f;  4QSH A;  5GMK l;  2OTJ A;  3OMG A;  1UB4 A;  1HXD A;  3M56 A;  4LDY A;  3QJ6 A;  5DLO A;  1VQO T;  2RHI A;  5AYF A;  1K73 C;  3G4S A;  4XTY A;  3CCV T;  4QQ6 A;  2EIF A;  2BIV A;  2QQ8 A;  2ZPI B;  2CGH A;  4C92 D;  1VQP A;  2MI6 A;  4M7D C;  2M0O A;  4KUD K;  5DLQ E;  1M90 C;  3P8D A;  2P0Q A;  3WVD B;  2DIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...