3WVEB

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, before photo-activation
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3wveB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3wveB02
2CZ1B 3LW5E 3A8LB 2DD5B 1QP2A 1AHJB 2ZPFB 2CZ0B 4XK8E 2DD4A 2CZ6B 4OB0B 2DPPB 3VYGA 2WSCE 2ZZDA 1GXIE 1UGSB 2PUOB 2WSFE 2PVGB 4ZGEB 2QDYB 4ZGJB 1UGPB 3QZ9B 2ZPHB 2ZPGB 3X28B 2DXBB 3A8OB 3QYHB 2ZPEB 4ZGDB 2DD4B 1UGRB 4OB1B 3A8HB 2DXCA 3HHTB 3QZ5B 3WVEB 3WVDB 3VYHB 1QP3A 2DD5A 2ZPIB 4L6V5 2PVOB 5L8RE 2D0QB 3X24B 3X25B 4Y28E 2AHJB 1DJ7B 2ZPBB 4KT0E 3A8GB 4FM4B 3VYGB 1PSEA 2ZZDB 3A8MB 3X20B 2PVDB 3QYGB 2CZ7B 1JB0E 2PU9B 2O01E 2PUKB 1PSFA 2DXBA 1V29B 4RKUE 1IREB 3QXEB 2CYZB 1UGQB 2ZCFB 4OB2B 2WSEE 2DXCB 3X26B 4OB3B
chains in the Genus database with same CATH superfamily
4PJNA 3LW5E 4QVCA 2JTMA 2LQKA 3MEWA 1H4LD 3VS1A 2EAYA 3OBYA 2QEXA 1QKXA 4CFVB 5I2SA 2RJEA 1ZQ1A 2LW4A 3HRTA 4XK8E 4YC3B 3SWNC 4JLIA 2H3JA 3QG1A 4HL4A 1XJWB 1OU9A 4NL3A 4BY7X 5A0DA 3CCMA 2MWPA 2O9VA 3VUZA 2WSFE 4BCQB 4A63B 5KYUB 5DLOA 1MMDA 2QDYB 1JEGA 1QQJA 3QZ9B 3MY5B 3PNWC 2QG9B 1NPRA 3CMET 3CMEQ 1WGSA 3I9QA 4PJOC 3S6WA 4OVAA 1T3LA 1X75C 1H8KA 4R0KA 3CCUA 3UWNA 4NC6A 1M2VA 4ORZA 4BCMB 1UEBA 1I5LA 1VQ4T 1VQ4Q 2AT1B 1D0XA 3H41A 1QVGS 4BE0A 2C0IA 3BG3A 4XTXA 5IT9E 2QFZA 1BYMA 2NUPA 3Q1JA 5IDPB 4TVRA 2CKKA 3WVDB 4C92E 1OZ3A 2RHIA 2KR6A 2C0TA 4FSSA 5FW9A 2HAXA 3EJ1B 1I1JA 4RCBA 4E7KA 2G77A 2XDPA 1AWXA 2PZ1A 1KQSS 5GMKh 2QI2A 1UHFA 4C92C 3GBQA 1WJRA 2XKOC 1KHIA 5KYUA 3QYGB 2IPOB 5CVIA 1JXMA 2RN8A 2GBQA 5IXFA 2ECZA 4XQ3A 1JB0E 2LC4A 2KNBB 3RMSA 3M55A 2QEXQ 2X4YA 1V29B 3JV3A 3TSWA 2CJMB 1W2BS 2UZEB 2QAZA 4OB2B 3QSUA 1JJ2S 4C8QB 2M0YA 1YJWA 2QF7A 1M90C 3M56A 2RI5A 3OYCA 2VVKA 1KC8R 5GMKj 2LRQA 2C5NB 1KG1A 1R77A 5KYYA 1D1BA 5HK0A 7AT1B 1GL5A 2MCNA 3A8LB 1KSWA 1QVGP 2DIGA 3FC3A 4F7UE 3QHSA 4XU0A 1M90U 3CCUQ 2BUDA 1FX7A 4D6WA 2EWNA 4OMQA 4Y92A 4RTZA 4C0DB 2EQUA 5FROA 1TUCA 1H1RB 2MI6A 2K9GA 5GANh 4V2SA 3DDQB 3QWLA 1W6XA 2JS2A 1KQSP 2O2OA 4GLMA 1QLBA 4HNUA 5GAMh 4C8QA 1IGUA 4ATOA 4RTXA 3PGGA 3A8HB 4CC4B 2F1LA 5KCHA 1OI1A 2I40B 2MIOA 1Y0MA 2CH4A 1PKTA 3OMGA 3BHUB 5AYFA 1UFFA 1V76A 4RTUA 1QVFS 1W2BP 2EYZA 3INZA 3MEAA 4X9DA 1NE8A 3MY1B 1JJ2P 3TW7A 1IXDA 2RO0A 4QQGA 2DXUA 4CRLB 2ZZDB 2M16A 1YJWT 4B6MA 1YJWQ 4J9CA 2UUEB 2JJ9A 1MHNA 4M78C 5GAMj 4M75E 4ZN1A 1BIBA 2FZKB 2BTTA 2JMAA 2BS3A 1JJ2A 4PJOD 5C6SA 3U23A 2LZ6B 1OU8A 2A08A 4BCNB 5FU6C 1GCPA 1MV0B 4C0ZA 4MFDA 2E4HA 4M75C 2BE9B 1LJOA 4XTWA 4GBQA 5CKDA 3GF5A 3H0HA 1WHJA 1C1AA 3BE3A 5GAMd 2RHXA 4FYXB 2L5QA 1IB8A 1SKUB 1ZHIA 3TW6A 2G9XB 1WA7A 2P4RA 1NLPC 3EH2A 4MIMA 2VGMA 3EG2A 2GCXA 2J6FA 1FWZA 4C92D 3KXTA 2QA4T 1NPPA 2ZZDA 3RKWA 4PLLA 2QASA 4CFNB 1D1CA 3DKMA 2EUFA 4M7AA 2CP2A 5GAMe 1QVFP 2WFYB 3GNFB 2AZSA 4ZGJB 3VS0A 4M77F 2DTOA 3CCLA 3M54A 4CC3A 1T3SA 3EFOA 2RQUA 3TREA 4XTZA 1PHTA 2ZPHB 2MOXA 3AHUA 1ZSGA 2RQVA 3A8OB 2FYKA 1AT1B 4EORB 2X1NB 1TU0B 1VQ5A 1RACB 1QVFA 1R0BG 2L0AA 4DQ2A 1VQNA 4X1VA 3EAEA 2K5FA 2DMOA 2KQWA 3CPWS 2CP7A 2QQ9A 3VYHB 4A4KA 2PVOB 2ED1A 1JSUB 2COYA 1Q86R 3R6OA 4OGEA 2C06A 3OS1A 1M4ZA 2RPNA 1W98B 3PE0A 2IVXA 5A0GA 1QMZB 4N4GA 1B34B 3OYBA 2GTJA 4FCYA 1VQOT 1VQOQ 1OKWB 3VYGB 4Q5WA 5D6YA 2K3YA 3V7SA 4EOQB 3FRNA 1NJIC 3RESA 1TOVA 1YJNA 2O4XB 4DA4A 1RADB 4EOLB 3J7AF 1KJWA 5GJVB 1HXDA 1M5Q1 2EQJA 4M7AG 3OYIA 1JQQA 3P8DA 3BHVB 4F70B 4GY5A 3C0CA 2RHYA 1LCKA 2ZCFB 1ENWA 1EFNA 2HEQA 3HZJA 1H641 1NJIU 3F70A 3MIAB 2PJQA 4YOSA 2EYYA 3WXMB 1KK7A 1VQPA 4BDYA 1G8XA 2E6ZA 1NG2A 1VIFA 5IN1A 2SRCA 3EIDB 3LX7A 2C4GB 5GAMg 1QKWA 4KGXB 2QGGA 4FL6A 2DD5B 4KULA 3CCLT 3CCLQ 4BB7A 3ME9A 1OL1B 3HFNA 5CCAA 3OS0A 4D8DA 5GAOl 2R5AA 3VYGA 1VQ5T 1VQ5Q 2YSQA 3CPWP 2ATCB 2FEIA 1ZSZB 2O4XA 4M78D 4JS4A 2RI2A 3M03A 3DB4A 3PTAA 2JZ2A 4AG1C 4II5B 1AD6A 4E2FB 4CFWB 1UGPB 2QQSA 3EOCB 1BI0A 2CUDA 1YJ9T 1YJ9Q 3J81E 2K3XA 2V1RA 2OI3A 3CPWA 1U1SA 1QWEA 1TTHB 3CCSA 2ZPGB 2FPEA 2VKNA 3H8ZA 4C92G 4M75D 2YRVA 5FRNA 1RAAB 1X6OA 2KMGA 2JN0A 1CSKA 4YTLA 4QVZA 3QZ5B 2BZXA 4HNVA 5HVYB 2AKKA 4KH0B 1YJNQ 3ASKA 1Q95G 2JTEA 3IQLA 3QO3A 2DD5A 1X27A 2M51A 4VUBA 2AK5A 2V8JA 1VQ7T 1VQ7Q 3SD4A 3CD6A 2AHJB 5GAN8 1UG1A 1EX4A 1UJ0A 3O0GD 4C5IA 1RAFB 1W1FA 2GNCA 1ZSZA 5KE3A 3UA7A 3QKJA 3E2UA 2YWWA 4II1A 4O6JA 1E6GA 2KI7A 3HTRA 2VUBA 3CBPA 4KGZB 4OMNA 2HSEB 3CCVA 1VQPT 1VQPQ 3RERA 3JCMb 1X69A 2K5IA 2KT8A 3OQ5A 1Q81C 2RJFA 2AIRB 1OGUB 1F1BB 1OX9A 1OYXA 5LL6S 2HQXA 1VQ9T 3OYAA 1VQLT 2DXTA 1Y71A 1M27C 1AZEA 3QXEB 2CYZB 2JNGA 4EOSB 1S72T 2RHUA 4AT1B 1AWJA 3C95A 2YDLA 1H1SB 5DQVA 1G3SA 1Q81U 5FU7C 2YHTA 3G6EA 2CP6A 4F7UG 2A37A 3OW2S 4AFZC 1Q7YU 1K9MR 4FT4A 5FWBA 1JU5C 2DL7A 2XHCA 3BW1A 5IHKA 3MI9B 1N5ZA 4A53A 3CCSQ 2DD4A 1H1QB 2D8JA 3M0RA 2GQVA 1D3BB 3R6NA 3JSCA 2DNUA 1Y7XA 1WJSA 3GLXA 1H24B 4M7DB 1GFCA 2M9UA 3I56A 1AWOA 2CH4W 3JCMf 2LTOA 1MNDA 3EG0A 1M8VA 1CKAA 4F7LB 1URCB 3G71A 4M7DF 2JTFA 2NWMA 2KEAA 1LPLA 1VQKT 3OA6A 2W9ZA 4C5EA 5DLQE 2V26A 2IG0A 2YLCA 3M0QA 4J5YA 1RUWA 4HCKA 2F2CA 1SSFA 2JGZB 3CCVQ 3CCVT 1N8RR 2G6FX 4M4ZA 4OMMA 4Z02A 1AWWA 1ABOA 1TS9A 4ELYC 4E7SA 1FVVB 4C8QC 4A4EA 2KSSA 2ROLA 2E5QA 2YLBA 3M4GA 2LJ3A 4CFUB 3TEEA 2BZ8A 1I07A 4M75G 3RNJA 1D3BA 4HCBA 4IIOA 3O8VA 1GBQA 2LNHB 2XD0A 1EZZB 4QW2A 4A4HA 3L2RA 3OW2P 4CRIA 1M1KC 2E1HA 1T0JA 2I2LA 5D7UA 2KAFA 1KD1U 3UATA 2H8HA 1Y96A 4R55A 3G6ET 2OAWA 3G6EQ 3JCMW 4AFSC 3S3NA 3CMEA 5GAN2 4J9EA 2L3PA 2PUKB 4FW1A 4EIKA 2VC8A 2X9HA 3LGFA 4Y91A 2QDJA 1VQ4A 1M1KU 5GMKi 1MV3A 4E47A 1Q82C 3UPUA 1PRMC 2IW6B 1G3WA 1I81A 3THKA 2H3EB 5IXBA 4WCIA 2K2MA 5CAIA 4XTYA 4JS5A 4PK4A 1FMVA 5AT1B 9ATCB 2DL3A 2W9FA 2QYZA 3I56Q 4P5NA 2RNAA 1OPKA 3OYMA 1Q82U 3EG9B 1RAGB 3JB9I 3URGA 1A0NB 4X34A 1UGSB 4HLQA 4AKHA 2QXFA 2O88A 2LNVA 2OTJT 2DF6A 2OTJQ 3MKDA 2Y4XA 5I22A 4DBRA 4ZGEB 4ESRA 5C0MA 2LVMA 3PIPA 4A4GA 1QCFA 1N4MA 3BFMA 2FZCB 3M53A 3EGXB 3OS5A 3QIIA 2NUZA 2LX7A 1OZ2A 4FU6A 3NTKA 4BCQD 1ZUKA 4XU3A 4IMYB 4M7AC 1R8OB 2EFIA 2K6DA 1IHVA 3RKYA 2W96A 4QSHA 4OB1B 1PKDB 2PQWA 3HBLA 4J9DA 3QHRB 2PTKA 1TUDA 3NMZC 5FWCA 1JSTB 1G83A 3CMAT 3CMAQ 2P0KA 3CC2T 3G4ST 3G4SQ 1K8AR 4AI6A 2ZPIB 1IGQA 1UJYA 2MMPA 4OMOA 4PKCC 2BKZB 3EG1A 3EG9A 2WEVB 3H6ZA 4BCOB 4G6LB 1ZA1B 2K79A 2RMOA 4ZN3A 2AKLA 3CCET 3CCEQ 2EYXA 4KT0E 4C0GA 1PSEA 3RUXA 2QTVA 1VYVA 2DO3A 3X20B 1C9BA 2EGAA 3FB9A 2FPDA 3QJYA 3QJ6A 3RMQA 3ULRB 3EGXA 3BG5A 5GANf 4ZNXA 4TTHA 2HNIA 2KGTA 1X2KA 4RKUE 1N6AA 4M6VA 1P5EB 5IH2A 5HK3A 5I11A 3MP8A 1GBRA 4JRKA 4EOOB 3L2ZA 3RGFB 5GAOm 3PFSA 2OTLT 5LQFB 4IUTA 1BIAA 1M8MA 2K57A 3EGUA 3QHWB 2W10A 3M4YA 4C8QD 1RAHB 2B8AA 4I3ZB 4JJCA 4HKEA 4J6XA 3MP6A 3M0TA 3I35A 4J9BA 5HBEB 5LJ5j 2VXFA 3CCQA 1OIYB 2CS7A 2A28A 1GXIE 1AZGB 2RB6A 4ROCA 3VU3C 1O9SA 3LWIA 5IHYA 4AFQC 1Z9QA 3P8HA 2EYQA 2YXYA 1WHHA 4IUVA 3OYDA 4AKIA 3OYNA 2ENMA 4R56A 1TUGB 2D9TA 4EOMB 2D1XA 2W0ZA 4JX4A 3JB9J 4ELJA 1BCMA 2A0FB 4QQDA 1UGRB 4Z88A 2CDTA 2HZYA 5LJ5d 2D8HA 2UZDB 2BS2A 4JJNK 4F7SB 4BI3A 2KDSA 3M58A 2LT1A 1D3UB 4E7ZA 1G3YA 1VYWB 1VOLA 1E7OA 2J7IA 2FO0A 1QW1A 4LOCA 3X24B 2KE9A 3NFCA 1RABB 2RH2A 5LJ5e 4L5GA 4FX3B 2EGEA 2QA4A 4PL6A 1UNGD 2AZVA 5CEIB 4FM4B 2XU8A 1UNLD 1M30A 5KCOA 1VA7A 1QVPA 1U5SA 1X2QA 4BE1A 1YITA 4E7LA 3E1SA 1BK2A 4OF1A 2O01E 2LCSA 3TNIB 2FB7A 1YIJT 1YIJQ 4M7AD 5HQ0B 1ZSZC 1SG5A 3H0IA 4RCCA 4BY6B 4EOIB 1GUXB 3EHRA 1MGQA 1WJQA 2VV5A 4Z89A 4QVDA 4LDWA 2DFUA 4BD3A 1M9SA 4BCFB 3CCQT 3CCQQ 4N0AA 2L2PA 2KR3A 2QQRA 1TH7A 1K73C 1SSHA 4PNOA 1VQ6A 2VXEA 4EMKB 4EOJB 2MWOA 2P84A 1FMKA 3MP1A 3TNHB 4HA8A 1D1AA 3RDVA 4EMGA 3OS2A 2LCCA 2CSQA 1K73U 1VQOA 2DJQA 2M1HA 5GAN3 3OBWA 2DMEA 1ZUUA 4LN2A 5LMKB 2KXDA 3GNGA 3VS4A 4EONB 1CKBA 1M90R 3OYJA 1C0MA 4C8QG 4J8OA 5CKHA 3OYGA 1AD5A 1XOVA 2CGHA 2KVQG 1YHQA 1GUXA 4LDXA 4J9FA 2KMTA 2ESWA 3V7RA 2WIPB 5LJ3g 1VQMT 1VQMQ 1M3BA 4PJOB 3CQTA 3MHXA 5LJ5g 2QA4Q 3DTOA 3VS5A 4M77B 2E10A 2FG0A 1HSQA 1H25B 1SEMA 1ABQA 3HHTB 8AT1B 3EHQA 1K4US 1VQ8T 3HB9A 1VQ8Q 4J7IA 2V22B 1SPKA 2CT3A 4EMKA 2X4WA 4NSTB 4MZMA 4PJOF 1YITT 1YITQ 4L6V5 4AKGA 2EQKA 2CCHB 2E64A 2D0QB 2HQEA 3JB9G 3MEUA 2F2VA 4EC8B 2VWFA 3HRSA 1TWBA 5DQWA 3QYEA 1YNZA 2E12A 1BB9A 3VRZA 4M7DE 1I4K1 4BCKB 2R7GA 3L42A 2M0OA 2RQTA 1YJ9A 1VQ6T 1VQ6Q 1MMGA 5J39A 3A1PA 1RLQC 2COZA 4F6WB 1N9SA 1U1TA 3P8BB 2XK0A 1XTDA 3G33B 1YWOA 2JOYA 4J9IA 1SHFA 4M77A 4C92F 1BI3A 2XIDA 3M0SA 2DVJA 4CC7A 1X6BA 4KUIA 2EBPA 4JRIA 3BHTB 3L2VA 3TNWB 1K9AA 2CP5A 3I5SA 1WNLA 1VQ7A 3T9NA 2EKOA 1YHQT 1YHQQ 3BY7A 1PM3A 3DB3A 1XO2A 2ZPFB 3L2QA 2CZ6B 4ZTFA 2CP0A 2P0QA 1KHCA 2DEUA 3JB9H 4J6WA 1BI2A 5EFQB 1JRIA 1PG5B 1QMCA 4B9XA 1ARKA 1PRLC 1GRIA 1VQ9A 1VQLA 1S72A 3F5XB 2D0NA 1OQKA 1B34A 5CR2A 5CK9A 1KIKA 3FLGA 2OJ2A 2P0PA 2K5LA 2DLPA 5HY6A 3BLQB 5ECAA 4EC9B 4HT8A 4CXAB 4OMLA 1UUEA 1H3ZA 1WDXA 3OYFA 4BY1X 2PK9B 3VKGA 5GAN7 1BI1A 1J3TA 3MCAB 2F2XA 1OPLA 2DJZA 5EJCA 4ANJA 3OYHA 4KBMB 3MO8A 2NYSA 2XMFA 2HCKA 1WHMA 3H0FA 3I5RA 2K3BA 1RLPC 2B86A 2WIHB 4MZTA 1GY3B 2EKHA 2SEMA 1WFWA 1GCQA 4FSXA 1AOJA 1YBYA 4KRDB 1AVZC 4M78B 1BKBA 1ZBJA 2EPDA 3HP9A 2FPFA 2VGNA 1VQKA 1QWFA 3TN8B 5GMKl 2IN3A 3KHIA 4M78F 3TU4K 3FEOA 1RAIB 2WPAB 1NJIR 3EGDB 2CT4A 2EVRA 3CEYA 2HDAA 1G2BA 1VQ9Q 2DZ9A 3PT9A 1Q7YC 1JBMA 1VQLQ 1S72Q 1FKMA 4M75F 2DRKA 4E6RA 4JRPA 3PMTA 2FVUA 3DL1A 1H3HA 5KYWB 4IIMA 2J6OA 4MMLA 1D09B 1LOJA 2MPXC 2KRSA 2LMJA 4JDSA 1WQWA 2F5TX 4AMCA 1WXUA 2HKQB 1WPYA 1UB4A 4OP0A 3GP8A 2I0NA 2DXBB 1I8FA 2YT6A 1M1GA 5J3BA 1BCOA 1VINA 4XAXB 3MPUB 1ACMB 2Y90A 2OAUA 1AISB 4PLIA 2GFUA 4BUGA 3EGDA 4ZTJA 1IRXA 2C5XB 1OOTA 5L8RE 3CPFA 4EOPB 4X9CA 4RUGA 4Y28E 3BLHB 4PFPA 1TFBA 3BDLA 3QYBA 2I53A 1VQKQ 2OTJA 2YUQA 1WYXA 1OEBA 4J6YA 1H28B 2L8DA 1MUZA 5CQXA 3TCJA 2KK4A 3CCJA 2RK1A 4ME7A 2YUNA 1PKSA 1KD1C 5CIUA 1ZUYA 2DXBA 1NEGA 3C94A 2QGFB 6AT1B 4YOOA 3HL8A 1OI9B 2RHZA 1K76A 1N27A 4MZPA 5CKBA 4CC2A 8ATCB 1OULA 5IDNB 3REAB 3EG3A 2JM9A 1KQ1A 2DXCB 4BDZA 2X35A 4M7DA 1FXXA 4JZ4A 1D0ZA 2ZAEA 3CMAA 2JVVA 3J80E 3G4SA 3CC2A 3ER0A 1NZ9A 4CI0C 1H92A 2J06A 1GFDA 2DL8A 4JJDA 5A2QE 4HCCA 3E19A 2LCLA 3HO8A 2D6FA 4E7JA 3NTIA 1Q81R 1XNIA 5GAN4 2DKGA 4C0DC 4OB0B 1FINB 3QPHA 3SDZA 3LGLA 3CCEA 2A3LA 2BKDN 1WXBA 4F6UB 4XTVA 2PUOB 3VUBA 3VS6A 1WHLA 2PVGB 4LDVA 1YP5A 4BI8B 5KYXB 4Z8AA 3VS2A 5HBHB 5GAOr 3BLRB 3KBGA 1QCOA 1WI7A 1B3QA 2DXCA 3M59A 2OTLA 1KQ2A 4BY6C 3H9NA 1E9HB 4KRTA 3ZFJA 5HNBB 2EIFA 3CCJT 3CCJQ 1SF9A 2K7AA 2KYBA 5GAOn 4ELLA 4J83A 1JKWA 4M7DG 1S1NA 2YUPA 4OR5B 4J9HA 4XU2A 2QK0A 1M2VB 3NDQA 2A36A 4DBQA 4KUDK 1V1CA 5M9OA 1KC8C 3A5ZB 1UTIA 2HSPA 3JAME 3OB9A 4QQ6A 4JX6A 3OYKA 2IVWA 2DL4A 2A7YA 4BCMD 5KYXA 3OY9A 2CZ7B 2YUOA 2HQHA 3CC2Q 3S3MA 4UC4A 1NYGA 2P4TA 3HFOA 1WIEA 1KD1R 3GIBA 1KC8U 2RK2A 3DLLA 4PJOE 4RTWA 1NLOC 4M77E 5EC7A 1YI2A 1KXUA 1OV3A 3LH0A 3VKIA 1HJDA 1K1ZA 4OB3B 2R5MA 2XDBA 5LJ3h 4PJLA 1M1KR 1F5QB 1HYOA 3UA6A 2PMIB 4F16A 3UT1A 5LJ5h 5FU7B 2RA2A 4M77C 1QP2A 2DTIA 3M57A 4JUVA 1K0XA 4HCZA 2DETA 1LVKA 5GAMf 1ZP2A 2X3WD 2WACA 3JCMd 3M5AA 2ABLA 1Q82R 3PVLA 2E6NA 2OTLQ 3CC7T 3CC7Q 3BG9A 1PNJA 1ZX6A 5KYYB 1O75A 5CKEA 5J26A 1YIJA 4LDYA 1UNHD 5LJ3j 3JCMe 2X51A 5CKFA 2BZYA 3QUIA 3PO3S 5IF1B 1M1FA 3TSZA 2KRNA 1BBZA 2CP3A 1N9RA 2JT4A 1R0CB 4F7NB 2JUFA 2HKNA 5GAOp 1SRLA 2QEXT 5A0LA 3X25B 3JB9D 5FGKB 2BE7D 1H1PB 2F5KA 3SFMA 5LJ3d 3FJPA 1RL2A 2ZPBB 4DBHA 1XQHA 1YI2T 1YI2Q 5IAYA 3CBMA 2LQWA 3FIFA 4NOYA 3CCMT 2MK5A 3C12A 3CCMQ 1OKVB 2W2HA 1O9KB 5KE2A 2DVEA 5IHIA 5GMKm 4C8QF 3CCRA 2NLUA 1VYTA 3MJXA 1HD3A 1PSFA 3LH5A 3LLRA 5LJ3e 2XDDA 3HPWA 2BIVA 3CCUT 1VQMA 2K2VA 1YWPA 1GCQC 1MMAA 2LP5A 1QCNA 1VQ8A 3TQ7P 1QVGA 4FYYB 2M02A 3VKHA 4FT2A 3MEVA 1TSFA 4F14A 2R58A 3SEMA 2RQWA 3QBYA 2DAQA 3VS3A 3JB9F 3G1JA 1P92A 3JCMJ 4IUPA 4JRQA 1NM7A 1W70A 1UECA 2IIMA 2VYTA 1BU1A 1NBEB 1YCSB 2DBKA 3CC4A 3JCMg 4BCND 2DEQA 2RI3A 2EJ9A 2DYIA 5GMKe 1O9KA 1KQSA 3M9QA 2XI9A 1Q86C 1TG0A 4Z6YA 2EQMA 1IO6A 4M78E 1H27B 4LD6A 1I5OB 3V7CA 3META 2DRMA 2L3SA 5GANj 4C5HA 4ZGDB 1UE9A 2OX7A 3KUFA 2E65A 3GPLA 4CFXB 1GH6B 4F7JB 1YFNA 1Q86U 5ACBA 1W2BA 4M7AB 2JXBA 3I55A 2V1QA 3WVEB 3SWNB 3OYEA 3POMA 4BI4A 1M3CA 3LQ5B 4M77D 5GAN5 1PD1A 4XU1A 5CO7A 3JCMP 1FYNA 4NL2A 3AT1B 2DE0X 3CCRT 1SRMA 4BXXX 3CCRQ 1Z9ZA 1RAEB 2G3RA 3EFOB 4M7AF 2J6KA 1H26B 1U06A 3REBB 4CFMB 3L2WA 1JXOA 4RG8A 1HK9A 1X6GA 5GANd 3A8GB 4AG2C 2WMAB 3QDFA 2DZCA 2YRCA 2CUBA 2RJDA 2Y4YA 3EFSA 2W99A 2JW4A 2KT1A 1TXQA 3PVQA 3JRZA 3EFRA 5GAOq 1W4SA 5GANe 4BCGB 4BCPB 4N4IA 2FL7A 2WSEE 4LE9A 3CC4T 4WTOB 3CC4Q 3SWNA 4FW2A 4BACA 4AFUC 2ED0A 1M3AA 3BDUA 5GJWB 4C92B 4A54A 4EDUA 4JZ3A 2WXVB 4BCJB 2DL5A 2HMAA 3RIRA 2CCIB 4HVVA 4PJOA 4BBRM 4M7DC 2E5KA 2WSCE 3V8JA 2DTHA 1IZ6A 4EOKB 2DILA 2V8KA 3S3OA 4BE2A 2VASA 5ICPB 1I0CA 3GOXA 2YRDA 2CREA 4L59A 3I55Q 1SHGA 3VRYA 4B9WA 3I55T 2BPMB 4MFEA 1K73R 2RQRA 1M2OA 4MMKA 4J9GA 3N5BB 1QLYA 1UGVA 3G7ZA 2LDMA 3QYHB 3UF4A 1X01A 4NS5A 3M0UA 3CXCS 2COWA 2QQ8A 1K0SA 5GAN6 2XICA 2ZGWA 4DBFA 3JCMQ 2XG8D 4C92A 4DEXA 5DM7R 2QGSA 2EW3A 2X4JA 4O5VA 3D7SB 2VB6A 3VJPA 2KY9A 4F7UB 5GANg 3NHNA 1ZBXA 2DK3A 5KH6A 2GQIA 4YOZA 1ZA2B 3A8MB 1EIFA 1MNEA 4JLGA 2PNIA 2UZBB 3OYLA 4JJBA 1VOMA 2E3HA 2RF0A 3ZEHA 1K9MC 2DIQA 1JOWA 4HT9A 4PJOG 4HNTA 4F7UF 2DBMA 2QTXA 1AEYA 4M77G 1WHKA 2FRYA 2JS0A 3NTHA 3NGPA 3LYIA 4J7FA 4Y72B 1IREB 1G3NC 1U8RA 4JX5A 3O5ZA 2FRWA 4HXJA 1C6VX 1K9MU 2HD0A 2HBPA 2PHGA 1VQNT 1VQNQ 4LUDA 3KFVA 3JCMc 3E9GA 2CZ1B 1WHGA 2WJ9A 3SB2A 1IHWA 3OSSC 1JO8A 1VUBA 4D8KA 3E9FA 2X4XA 3VV0A 1MMNA 2L89A 2EGCA 1T0HA 1ZLMA 3V8LA 4F7UA 2K4YA 2CZ0B 2Z0WA 4RODA 3CXCP 2KXCA 5L2WB 1TD6A 2DPPB 2MYSA 3TVTA 2RJCA 2LJ1A 4ROEA 2JMCA 4QT7A 1N8RC 4F6SB 3EH1A 1RI9A 5FU6B 3HSBA 2EJGA 2PK2A 2KYMA 1PWTA 1VIEA 1YJNT 1PD0A 3DDPB 4OMPA 4RMOA 3QWYA 4M75B 3CXCA 2O9SA 1UDLA 4HVUA 5CQYA 1OX8A 3JCMV 3X28B 4BBSM 1N8RU 4OGRB 2F2WA 3DLMA 5HCKA 2ZPEB 5L23A 2DD4B 3RR6A 4PFOA 4ELZC 1NEBA 2LQNA 2C6TB 3RBBB 3JCMX 1Y57A 4EMHA 4LXCA 1WZOA 3SHWA 2GF7A 3OYYA 2KROA 2C5VB 5I21A 2MAMA 1YCYA 3RKXA 1OL2B 1G5VA 4M78A 2O31A 3HRUA 4KH1B 2BS4A 4M7DD 2HBWA 4LDUA 2LQ8A 2KBTA 4UN0A 1X43A 2ROTA 3ZL7C 3QDRB 2EJFA 5I2MA 4LNPA 2QQBA 2QQAA 4C0FA 2IW8B 3K7AM 2JM8A 1LNXA 4M75A 1D0YA 2DYBA 4N4HA 1PC0A 3NPFA 1BU2A 2B9RA 3CCST 2R57A 5FRMA 1NYFA 1U3OA 4OGCA 1WLPB 4K11A 5KYWA 5D6XA 4RTYA 3UDCA 4F17A 2CSIA 3X26B 4CFUD 4IUUA 1YN8A 4JPBW 5KYNA 2C5OB 4A4FA 1FMWA 1Y96B 2WHBB 1KFZA 2J05A 4DOWA 2FHDA 3L2UA 4PJJA 3QWXX 4DOVA 4F04B 2KRMA 1AHJB 5FLXE 4PJMA 3CD6T 3DOGB 3CD6Q 4GLKA 1E7PA 4RTVA 4C8QE 3L1AA 2E3IA 1B7TA 3PIOA 3PMIA 4PFZA 2DM1A 4M78G 5HBJB 5BNJB 1K8AC 1RI0A 4MDWA 1WX6A 2LJ0A 4KGVB 3B57A 3C4SA 2DX1A 2RD1A 5D6WA 1PCXA 4XTUA 2C0OA 1OIUB 4N0AC 3HKSA 3OMCA 2WMBB 2NUTB 3OSVA 1G3TA 5EG2A 3DJBA 2MF2A 1K8AU 1Q7YR 2HL3A 2LT4A 4WF2A 5DY9A 5HKCA 4KRCB 2GFAA 4FIBA 5LJ3f 3V8KA 1QP3A 5LJ5f 2LX9A 2DERA 3FJ5A 4LD9K 4FYWB 4QKUA 4BCHB 4RG2A 2EYWA 3OW2A 1DJ7B 4C5GA 4IKFA 2V8IA 3LWHA 3GTMS 4DEYA 2GTOA 1WQ7A 4BCIB 2EQIA 4IURA 2E41A 1VYUA 2QDLA 3CBOA 2PVDB 4E7IA 4LUEA 2L3RA 4IUQA 3CC7A 2RM4A 5I5ZB 3A98A 2GGRA 1E6HA 2FZGB 3I56T 2PU9B 2UZLB 4EPCA 5IHNA 4RTTA 3H4CA 4HVWA 3VS7A 3JCMh 4FYVB 3ZBDA 1B07A 4E7HA 1UHCA 3M0PA 1UGQB 2NUTA 3G71T 3G71Q 2X3XD 4OMFB 2E70A 2L3QA 4MDXA 3FDRA 2IW9B 5CYIB 4M7AE 1Y07A 4EMKC 1WXTA 2F69A 2DA9A 2NUPB 2HL5C
chains in the Genus database with same CATH topology
4JRIA 4FT2A 3VKHA 3L2VA 3MEVA 3LW5E 4QVCA 3OW2S 1Q7YU 2JTMA 2R58A 2LQKA 3MEWA 4FT4A 2EAYA 3OBYA 2QEXA 3QBYA 2DAQA 5I2SA 1WNLA 2XHCA 3JB9F 2RJEA 1VQ7A 1ZQ1A 3BW1A 2EKOA 3T9NA 1YHQT 3BY7A 1P92A 3DB3A 2ZPFB 3HRTA 3JCMJ 4IUPA 4XK8E 2DD4A 4A53A 3L2QA 4JRQA 3SWNC 2CZ6B 2VYTA 4ZTFA 2GQVA 4JLIA 1D3BB 2H3JA 3QG1A 4HL4A 3JSCA 3CC4A 3JCMg 2P0QA 1KHCA 3JB9H 4J6WA 4NL3A 1Y7XA 1WJSA 1BI2A 2DEQA 2RI3A 3GLXA 2EJ9A 1JRIA 2MWPA 5A0DA 5GMKe 3CCMA 3VUZA 2WSFE 1KQSA 3M9QA 4M7DB 5DLOA 2QDYB 4B9XA 2XI9A 1Q86C 2M9UA 3QZ9B 3I56A 3PNWC 4Z6YA 2EQMA 1NPRA 3JCMf 3CMET 4M78E 1WGSA 4PJOC 3S6WA 2LTOA 4LD6A 2QA4T 1VQ9A 4OVAA 3V7CA 3META 1VQLA 1M8VA 1X75C 1S72A 3CCUA 3UWNA 3G71A 1B34A 4M7DF 4NC6A 5GANj 1UEBA 4C5HA 4ZGDB 2JTFA 1VQ4T 1I5LA 5CR2A 5CK9A 1QVGS 4BE0A 3FLGA 3BG3A 4XTXA 3OA6A 3KUFA 4C5EA 2QFZA 2E65A 5DLQE 3GPLA 2P0PA 1BYMA 2K5LA 1Q86U 3Q1JA 5HY6A 2IG0A 2YLCA 4J5YA 1W2BA 4M7AB 4TVRA 3I55A 2CKKA 3CCVT 1SSFA 3WVEB 3SWNB 3OYEA 3WVDB 4BI4A 4C92E 1OZ3A 4M77D 4Z02A 5CO7A 4XU1A 5GAN5 3JCMP 4HT8A 4NL2A 4ELYC 2RHIA 4C8QC 1H3ZA 2KR6A 3OYFA 4A4EA 2KSSA 3CCRT 2E5QA 3VKGA 2G3RA 2YLBA 3M4GA 5GAN7 2HAXA 4M7AF 1BI1A 4RCBA 4E7KA 2G77A 3MCAB 3TEEA 2XDPA 4M75G 4HCBA 1D3BA 2DJZA 3L2WA 5EJCA 3OYHA 4KBMB 4RG8A 1HK9A 2QI2A 3O8VA 5GMKh 1KQSS 5GANd 4C92C 3A8GB 3MO8A 1WJRA 2XD0A 2XKOC 1KHIA 4QW2A 4A4HA 3L2RA 4CRIA 1M1KC 2DZCA 2E1HA 2I2LA 3QYGB 2KAFA 5CVIA 1KD1U 2Y4YA 2RJDA 1Y96A 4MZTA 4R55A 3G6ET 3EFSA 3JCMW 4XQ3A 1JB0E 3S3NA 3CMEA 5GAN2 2LC4A 3RMSA 4FSXA 3JRZA 3EFRA 3M55A 2PUKB 1YBYA 5GAOq 2VC8A 2X4YA 1W4SA 1V29B 4M78B 1BKBA 5GANe 3HP9A 1W2BS 3LGFA 4Y91A 2QDJA 1VQ4A 1M1KU 5GMKi 2VGNA 4N4IA 1VQKA 4OB2B 4E47A 1Q82C 3QSUA 1JJ2S 4C8QB 1YJWA 2QF7A 3UPUA 2FL7A 2WSEE 1M90C 1G3WA 1I81A 3M56A 2RI5A 3CC4T 5GMKl 3SWNA 3KHIA 4M78F 3TU4K 3FEOA 5CAIA 3OYCA 5GMKj 4BACA 2LRQA 4XTYA 4JS5A 3BDUA 1KG1A 5HK0A 4C92B 4A54A 4EDUA 3A8LB 3CEYA 4P5NA 3OYMA 2DIGA 3FC3A 1Q82U 5IT9E 3JB9I 3URGA 4F7UE 2DZ9A 3PT9A 3RIRA 1JBMA 3QHSA 4XU0A 1Q7YC 4X34A 1M90U 2BUDA 1FX7A 1FKMA 4BBRM 4M75F 4D6WA 4M7DC 4PJOA 2WSCE 3V8JA 4JRPA 2DTHA 2EWNA 3PMTA 2FVUA 1UGSB 1IZ6A 4HLQA 3DL1A 4AKHA 2QXFA 2V8KA 3S3OA 2LNVA 4BE2A 2OTJT 4MMLA 4C0DB 3GOXA 2EQUA 1LOJA 5FROA 2Y4XA 4L59A 4ZGEB 2MI6A 3I55T 4B9WA 5C0MA 4JDSA 2LVMA 1WQWA 3PIPA 4A4GA 2F5TX 4MFEA 3BFMA 3M53A 3OS5A 5GANh 4MMKA 4V2SA 1WPYA 3QWLA 1UB4A 3N5BB 3QIIA 4OP0A 4FU6A 1OZ2A 3NTKA 3GP8A 1QVGA 4XU3A 3G7ZA 2DXBB 2LDMA 3QYHB 1I8FA 1QLBA 1M1GA 1R8OB 4M7AC 2EFIA 4HNUA 5J3BA 3RKYA 5GAMh 4C8QA 4XAXB 4ATOA 1X01A 2Y90A 4QSHA 4OB1B 4NS5A 2OAUA 3PGGA 3A8HB 3CXCS 2PQWA 2QQ8A 3HBLA 5KCHA 1OI1A 5GAN6 2XICA 2ZGWA 4PLIA 3JCMQ 2XG8D 2GFUA 4C92A 4BUGA 4ZTJA 3CMAT 3OMGA 5AYFA 2P0KA 3CC2T 3G4ST 4AI6A 2ZPIB 4PKCC 1QVFS 2MMPA 5DM7R 5L8RE 3CPFA 4X9CA 2X4JA 3INZA 4O5VA 4Y28E 3H6ZA 3MEAA 4X9DA 1NE8A 3VJPA 3TW7A 2KY9A 4ZN3A 4F7UB 3BDLA 3QYBA 3CCET 5GANg 4KT0E 1ZBXA 2DK3A 5KH6A 4C0GA 2RO0A 4QQGA 1PSEA 2DXUA 3RUXA 2ZZDB 2M16A 2OTJA 3A8MB 1EIFA 4JLGA 1YJWT 2DO3A 3X20B 3FB9A 4J6YA 3OYLA 1K9MC 3QJYA 3ZEHA 2L8DA 1MHNA 2DIQA 3QJ6A 4M78C 4M75E 5CQXA 3TCJA 1BIBA 4ZN1A 3RMQA 4HT9A 4PJOG 4HNTA 4F7UF 2BS3A 3BG5A 2QTXA 2KK4A 4M77G 5GANf 3CCJA 2RK1A 3NTHA 1JJ2A 4PJOD 4ME7A 5C6SA 2HNIA 3LYIA 4J7FA 1KD1C 5CIUA 2DXBA 3C94A 4RKUE 1N6AA 5FU6C 1IREB 3HL8A 4M6VA 2RHZA 1U8RA 4JX5A 1N27A 4MZPA 5CKBA 4MFDA 4C0ZA 5HK3A 1K9MU 3MP8A 4M75C 2HD0A 2HBPA 4JRKA 1LJOA 3L2ZA 4XTWA 1VQNT 5CKDA 1KQ1A 5GAOm 3PFSA 2DXCB 4BDZA 2X35A 3GF5A 4M7DA 1FXXA 2OTLT 3JCMc 3E9GA 2CZ1B 1BIAA 4IUTA 2WJ9A 3CMAA 2K57A 3SB2A 2JVVA 3J80E 5GAMd 3G4SA 3CC2A 3M4YA 3OSSC 1VUBA 2RHXA 1NZ9A 2L5QA 3E9FA 3ER0A 4C8QD 2X4XA 4CI0C 1ZHIA 5A2QE 3TW6A 3E19A 2B8AA 2LCLA 3HO8A 4HCCA 3VV0A 4E7JA 3NTIA 4MIMA 2D6FA 1XNIA 2L89A 4HKEA 4J6XA 3V8LA 2VGMA 2K4YA 3MP6A 4F7UA 5GAN4 2CZ0B 2GCXA 2DKGA 4C0DC 5LJ5j 4OB0B 1FWZA 3QPHA 2VXFA 3SDZA 3LGLA 4C92D 2DPPB 3KXTA 3CCEA 2A3LA 3CCQA 1NPPA 2RJCA 2ZZDA 2CS7A 3RKWA 4PLLA 1GXIE 2BKDN 1N8RC 3DKMA 4M7AA 2RB6A 5FU6B 4XTVA 2PUOB 5GAMe 3HSBA 3VU3C 3VUBA 2EJGA 1O9SA 1VIEA 3LWIA 1YJNT 2PVGB 3GNFB 5GAMj 4ZGJB 4LDVA 4RMOA 3P8HA 4M75B 2EYQA 4BI8B 3CXCA 4M77F 4IUVA 2DTOA 3OYDA 3CCLA 3M54A 5CQYA 4AKIA 3OYNA 5GAOr 3TREA 4XTZA 4R56A 2ZPHB 3AHUA 2D9TA 3JCMV 3KBGA 3X28B 4JX4A 4BBSM 3JB9J 3A8OB 4ELJA 2FYKA 1N8RU 3DLMA 2ZPEB 2DD4B 4QQDA 1UGRB 1VQ5A 1QVFA 4DQ2A 5LJ5d 4ELZC 2DXCA 2BS2A 1VQNA 4JJNK 4BI3A 3EAEA 2K5FA 2KDSA 3M59A 3M58A 3JCMX 2OTLA 2KQWA 2LT1A 4EMHA 1KQ2A 3CPWS 4BY6C 1G3YA 2QQ9A 3VYHB 2GF7A 3OYYA 5I21A 2MAMA 4A4KA 1YCYA 3ZFJA 2PVOB 2EIFA 3RKXA 3CCJT 1QW1A 1G5VA 4M78A 4LOCA 3X24B 3R6OA 3NFCA 4J83A 4OGEA 5GAOn 2C06A 3HRUA 3OS1A 1M4ZA 4M7DG 2RH2A 5LJ5e 2BS4A 4L5GA 4M7DD 5A0GA 4LDUA 2LQ8A 4N4GA 4XU2A 1B34B 2QA4A 3OYBA 4PL6A 4FM4B 2XU8A 1VQOT 3VYGB 4KUDK 3QDRB 5M9OA 4Q5WA 2EJFA 3A5ZB 5D6YA 2K3YA 5I2MA 1KC8C 2QQBA 3JAME 3V7SA 2QQAA 3OB9A 3FRNA 4QQ6A 4JX6A 5KCOA 3OYKA 4C0FA 1NJIC 3RESA 2IVWA 1YJNA 1LNXA 2O4XB 4M75A 4DA4A 2A7YA 3J7AF 3OY9A 1QVPA 2CZ7B 4BE1A 1YITA 1HXDA 1M5Q1 2EQJA 4N4HA 4E7LA 3E1SA 4OF1A 2O01E 4M7AG 3OYIA 2FB7A 1YIJT 4M7AD 3P8DA 4UC4A 3S3MA 2P4TA 3HFOA 4RCCA 4BY6B 4GY5A 3CCST 3GIBA 1KC8U 2RHYA 1MGQA 1WJQA 2R57A 2RK2A 2ZCFB 2VV5A 4QVDA 4LDWA 3DLLA 5FRMA 4PJOE 3HZJA 4M77E 1H641 1YI2A 1NJIU 4OGCA 3F70A 4BD3A 1M9SA 3CCQT 4N0AA 5D6XA 3WXMB 3LH0A 3UDCA 4BDYA 1VQPA 2QQRA 2E6ZA 3VKIA 1TH7A 1VIFA 1K73C 3X26B 4IUUA 5IN1A 4OB3B 2R5MA 2XDBA 3LX7A 4PNOA 4A4FA 1Y96B 5LJ3h 1VQ6A 5GAMg 4DOWA 3L2UA 2FHDA 2VXEA 4EMKB 4DOVA 3UT1A 4FL6A 2MWOA 5LJ5h 5FU7B 2RA2A 2DD5B 4KULA 4M77C 3CCLT 1QP2A 1AHJB 2DTIA 3M57A 5FLXE 4BB7A 4JUVA 3ME9A 3MP1A 4HA8A 4HCZA 4EMGA 3HFNA 5CCAA 3CD6T 3OS2A 2LCCA 4GLKA 3OS0A 1E7PA 4C8QE 5GAMf 5GAOl 2R5AA 3VYGA 1K73U 3L1AA 3PIOA 2WACA 1VQOA 1VQ5T 3PMIA 2M1HA 5GAN3 3OBWA 3JCMd 4M78G 3M5AA 2O4XA 4M78D 3GNGA 4JS4A 2RI2A 3DB4A 1VQKT 3PTAA 1K8AC 2JZ2A 2E6NA 1RI0A 3CC7T 3BG9A 1UGPB 3OYJA 2QQSA 1BI0A 4C8QG 1YJ9T 4MDWA 3J81E 1O75A 4J8OA 5CKEA 5CKHA 2K3XA 5J26A 3OYGA 3C4SA 1XOVA 2CGHA 2KVQG 1YHQA 2RD1A 4LDYA 5D6WA 1YIJA 3CPWA 1U1SA 4LDXA 3CCSA 4XTUA 2ZPGB 2KMTA 3V7RA 5LJ3j 3H8ZA 4N0AC 5LJ3g 3JCMe 4C92G 4M75D 1VQMT 3HKSA 3OMCA 5CKFA 2YRVA 3OSVA 3QUIA 1G3TA 5EG2A 3MHXA 2MF2A 5LJ5g 1K8AU 5FRNA 4PJOB 4M77B 4WF2A 2LT4A 5DY9A 1X6OA 2KMGA 2E10A 2JN0A 1M1FA 5HKCA 4YTLA 3HHTB 4QVZA 3QZ5B 1N9RA 3HB9A 4HNVA 2GFAA 4FIBA 5LJ3f 4J7IA 1VQ8T 3V8KA 4EMKA 2JUFA 3ASKA 1QP3A 2X4WA 3QO3A 4MZMA 2DD5A 5LJ5f 2LX9A 4PJOF 5GAOp 1YITT 4L6V5 4AKGA 2EQKA 4LD9K 2E64A 2QEXT 4VUBA 5A0LA 2D0QB 2HQEA 3JB9G 3MEUA 3X25B 2V8JA 4RG2A 3JB9D 1VQ7T 3OW2A 3SD4A 3CD6A 2AHJB 1DJ7B 4C5GA 5GAN8 4IKFA 2V8IA 2F5KA 3LWHA 3SFMA 4C5IA 5LJ3d 1WQ7A 3FJPA 3HRSA 1RL2A 2ZPBB 1XQHA 1YI2T 3QYEA 2E12A 5KE3A 4IURA 2E41A 3QKJA 3CBOA 4II1A 4O6JA 5IAYA 3CBMA 4NOYA 3FIFA 2VUBA 3CBPA 2PVDB 3CCMT 3CCVA 3C12A 4E7IA 1VQPT 3RERA 1I4K1 4M7DE 3JCMb 3L42A 2L3RA 4IUQA 3CC7A 2K5IA 2M0OA 2RM4A 3OQ5A 5KE2A 2DVEA 5GMKm 1YJ9A 1Q81C 2RJFA 3I56T 4C8QF 2PU9B 1VQ6T 3CCRA 2NLUA 4EPCA 5J39A 3H4CA 1OYXA 3JCMh 3ZBDA 5LL6S 1PSFA 2HQXA 3LLRA 5LJ3e 2XDDA 3HPWA 4E7HA 2BIVA 3OYAA 1VQ9T 1N9SA 1U1TA 1Y71A 2DXTA 3QXEB 3P8BB 1VQLT 2CYZB 1UGQB 2JNGA 2XK0A 3CCUT 3G71T 1VQMA 1XTDA 2JOYA 1S72T 2RHUA 4M77A 2K2VA 4C92F 1BI3A 4OMFB 2E70A 3C95A 4MDXA 3FDRA 2XIDA 1G3SA 4M7AE 1Y07A 4EMKC 1Q81U 4KUIA 2F69A 5FU7C 2YHTA 3G6EA 1VQ8A 4F7UG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ1 B;  3LW5 E;  3A8L B;  2DD5 B;  1QP2 A;  1AHJ B;  2ZPF B;  2CZ0 B;  4XK8 E;  2DD4 A;  2CZ6 B;  4OB0 B;  2DPP B;  3VYG A;  2WSC E;  2ZZD A;  1GXI E;  1UGS B;  2PUO B;  2WSF E;  2PVG B;  4ZGE B;  2QDY B;  4ZGJ B;  1UGP B;  3QZ9 B;  2ZPH B;  2ZPG B;  3X28 B;  2DXB B;  3A8O B;  3QYH B;  2ZPE B;  4ZGD B;  2DD4 B;  1UGR B;  4OB1 B;  3A8H B;  2DXC A;  3HHT B;  3QZ5 B;  3WVE B;  3WVD B;  3VYH B;  1QP3 A;  2DD5 A;  2ZPI B;  4L6V 5;  2PVO B;  5L8R E;  2D0Q B;  3X24 B;  3X25 B;  4Y28 E;  2AHJ B;  1DJ7 B;  2ZPB B;  4KT0 E;  3A8G B;  4FM4 B;  3VYG B;  1PSE A;  2ZZD B;  3A8M B;  3X20 B;  2PVD B;  3QYG B;  2CZ7 B;  1JB0 E;  2PU9 B;  2O01 E;  2PUK B;  1PSF A;  2DXB A;  1V29 B;  4RKU E;  1IRE B;  3QXE B;  2CYZ B;  1UGQ B;  2ZCF B;  4OB2 B;  2WSE E;  2DXC B;  3X26 B;  4OB3 B; 
#chains in the Genus database with same CATH topology
 4PJN A;  3LW5 E;  4QVC A;  2JTM A;  2LQK A;  3MEW A;  1H4L D;  3VS1 A;  2EAY A;  3OBY A;  2QEX A;  1QKX A;  4CFV B;  5I2S A;  2RJE A;  1ZQ1 A;  2LW4 A;  3HRT A;  4XK8 E;  4YC3 B;  3SWN C;  4JLI A;  2H3J A;  3QG1 A;  4HL4 A;  1XJW B;  1OU9 A;  4NL3 A;  4BY7 X;  5A0D A;  3CCM A;  2MWP A;  2O9V A;  3VUZ A;  2WSF E;  4BCQ B;  4A63 B;  5KYU B;  5DLO A;  1MMD A;  2QDY B;  1JEG A;  1QQJ A;  3QZ9 B;  3MY5 B;  3PNW C;  2QG9 B;  1NPR A;  3CME T;  3CME Q;  1WGS A;  3I9Q A;  4PJO C;  3S6W A;  4OVA A;  1T3L A;  1X75 C;  1H8K A;  4R0K A;  3CCU A;  3UWN A;  4NC6 A;  1M2V A;  4ORZ A;  4BCM B;  1UEB A;  1I5L A;  1VQ4 T;  1VQ4 Q;  2AT1 B;  1D0X A;  3H41 A;  1QVG S;  4BE0 A;  2C0I A;  3BG3 A;  4XTX A;  5IT9 E;  2QFZ A;  1BYM A;  2NUP A;  3Q1J A;  5IDP B;  4TVR A;  2CKK A;  3WVD B;  4C92 E;  1OZ3 A;  2RHI A;  2KR6 A;  2C0T A;  4FSS A;  5FW9 A;  2HAX A;  3EJ1 B;  1I1J A;  4RCB A;  4E7K A;  2G77 A;  2XDP A;  1AWX A;  2PZ1 A;  1KQS S;  5GMK h;  2QI2 A;  1UHF A;  4C92 C;  3GBQ A;  1WJR A;  2XKO C;  1KHI A;  5KYU A;  3QYG B;  2IPO B;  5CVI A;  1JXM A;  2RN8 A;  2GBQ A;  5IXF A;  2ECZ A;  4XQ3 A;  1JB0 E;  2LC4 A;  2KNB B;  3RMS A;  3M55 A;  2QEX Q;  2X4Y A;  1V29 B;  3JV3 A;  3TSW A;  2CJM B;  1W2B S;  2UZE B;  2QAZ A;  4OB2 B;  3QSU A;  1JJ2 S;  4C8Q B;  2M0Y A;  1YJW A;  2QF7 A;  1M90 C;  3M56 A;  2RI5 A;  3OYC A;  2VVK A;  1KC8 R;  5GMK j;  2LRQ A;  2C5N B;  1KG1 A;  1R77 A;  5KYY A;  1D1B A;  5HK0 A;  7AT1 B;  1GL5 A;  2MCN A;  3A8L B;  1KSW A;  1QVG P;  2DIG A;  3FC3 A;  4F7U E;  3QHS A;  4XU0 A;  1M90 U;  3CCU Q;  2BUD A;  1FX7 A;  4D6W A;  2EWN A;  4OMQ A;  4Y92 A;  4RTZ A;  4C0D B;  2EQU A;  5FRO A;  1TUC A;  1H1R B;  2MI6 A;  2K9G A;  5GAN h;  4V2S A;  3DDQ B;  3QWL A;  1W6X A;  2JS2 A;  1KQS P;  2O2O A;  4GLM A;  1QLB A;  4HNU A;  5GAM h;  4C8Q A;  1IGU A;  4ATO A;  4RTX A;  3PGG A;  3A8H B;  4CC4 B;  2F1L A;  5KCH A;  1OI1 A;  2I40 B;  2MIO A;  1Y0M A;  2CH4 A;  1PKT A;  3OMG A;  3BHU B;  5AYF A;  1UFF A;  1V76 A;  4RTU A;  1QVF S;  1W2B P;  2EYZ A;  3INZ A;  3MEA A;  4X9D A;  1NE8 A;  3MY1 B;  1JJ2 P;  3TW7 A;  1IXD A;  2RO0 A;  4QQG A;  2DXU A;  4CRL B;  2ZZD B;  2M16 A;  1YJW T;  4B6M A;  1YJW Q;  4J9C A;  2UUE B;  2JJ9 A;  1MHN A;  4M78 C;  5GAM j;  4M75 E;  4ZN1 A;  1BIB A;  2FZK B;  2BTT A;  2JMA A;  2BS3 A;  1JJ2 A;  4PJO D;  5C6S A;  3U23 A;  2LZ6 B;  1OU8 A;  2A08 A;  4BCN B;  5FU6 C;  1GCP A;  1MV0 B;  4C0Z A;  4MFD A;  2E4H A;  4M75 C;  2BE9 B;  1LJO A;  4XTW A;  4GBQ A;  5CKD A;  3GF5 A;  3H0H A;  1WHJ A;  1C1A A;  3BE3 A;  5GAM d;  2RHX A;  4FYX B;  2L5Q A;  1IB8 A;  1SKU B;  1ZHI A;  3TW6 A;  2G9X B;  1WA7 A;  2P4R A;  1NLP C;  3EH2 A;  4MIM A;  2VGM A;  3EG2 A;  2GCX A;  2J6F A;  1FWZ A;  4C92 D;  3KXT A;  2QA4 T;  1NPP A;  2ZZD A;  3RKW A;  4PLL A;  2QAS A;  4CFN B;  1D1C A;  3DKM A;  2EUF A;  4M7A A;  2CP2 A;  5GAM e;  1QVF P;  2WFY B;  3GNF B;  2AZS A;  4ZGJ B;  3VS0 A;  4M77 F;  2DTO A;  3CCL A;  3M54 A;  4CC3 A;  1T3S A;  3EFO A;  2RQU A;  3TRE A;  4XTZ A;  1PHT A;  2ZPH B;  2MOX A;  3AHU A;  1ZSG A;  2RQV A;  3A8O B;  2FYK A;  1AT1 B;  4EOR B;  2X1N B;  1TU0 B;  1VQ5 A;  1RAC B;  1QVF A;  1R0B G;  2L0A A;  4DQ2 A;  1VQN A;  4X1V A;  3EAE A;  2K5F A;  2DMO A;  2KQW A;  3CPW S;  2CP7 A;  2QQ9 A;  3VYH B;  4A4K A;  2PVO B;  2ED1 A;  1JSU B;  2COY A;  1Q86 R;  3R6O A;  4OGE A;  2C06 A;  3OS1 A;  1M4Z A;  2RPN A;  1W98 B;  3PE0 A;  2IVX A;  5A0G A;  1QMZ B;  4N4G A;  1B34 B;  3OYB A;  2GTJ A;  4FCY A;  1VQO T;  1VQO Q;  1OKW B;  3VYG B;  4Q5W A;  5D6Y A;  2K3Y A;  3V7S A;  4EOQ B;  3FRN A;  1NJI C;  3RES A;  1TOV A;  1YJN A;  2O4X B;  4DA4 A;  1RAD B;  4EOL B;  3J7A F;  1KJW A;  5GJV B;  1HXD A;  1M5Q 1;  2EQJ A;  4M7A G;  3OYI A;  1JQQ A;  3P8D A;  3BHV B;  4F70 B;  4GY5 A;  3C0C A;  2RHY A;  1LCK A;  2ZCF B;  1ENW A;  1EFN A;  2HEQ A;  3HZJ A;  1H64 1;  1NJI U;  3F70 A;  3MIA B;  2PJQ A;  4YOS A;  2EYY A;  3WXM B;  1KK7 A;  1VQP A;  4BDY A;  1G8X A;  2E6Z A;  1NG2 A;  1VIF A;  5IN1 A;  2SRC A;  3EID B;  3LX7 A;  2C4G B;  5GAM g;  1QKW A;  4KGX B;  2QGG A;  4FL6 A;  2DD5 B;  4KUL A;  3CCL T;  3CCL Q;  4BB7 A;  3ME9 A;  1OL1 B;  3HFN A;  5CCA A;  3OS0 A;  4D8D A;  5GAO l;  2R5A A;  3VYG A;  1VQ5 T;  1VQ5 Q;  2YSQ A;  3CPW P;  2ATC B;  2FEI A;  1ZSZ B;  2O4X A;  4M78 D;  4JS4 A;  2RI2 A;  3M03 A;  3DB4 A;  3PTA A;  2JZ2 A;  4AG1 C;  4II5 B;  1AD6 A;  4E2F B;  4CFW B;  1UGP B;  2QQS A;  3EOC B;  1BI0 A;  2CUD A;  1YJ9 T;  1YJ9 Q;  3J81 E;  2K3X A;  2V1R A;  2OI3 A;  3CPW A;  1U1S A;  1QWE A;  1TTH B;  3CCS A;  2ZPG B;  2FPE A;  2VKN A;  3H8Z A;  4C92 G;  4M75 D;  2YRV A;  5FRN A;  1RAA B;  1X6O A;  2KMG A;  2JN0 A;  1CSK A;  4YTL A;  4QVZ A;  3QZ5 B;  2BZX A;  4HNV A;  5HVY B;  2AKK A;  4KH0 B;  1YJN Q;  3ASK A;  1Q95 G;  2JTE A;  3IQL A;  3QO3 A;  2DD5 A;  1X27 A;  2M51 A;  4VUB A;  2AK5 A;  2V8J A;  1VQ7 T;  1VQ7 Q;  3SD4 A;  3CD6 A;  2AHJ B;  5GAN 8;  1UG1 A;  1EX4 A;  1UJ0 A;  3O0G D;  4C5I A;  1RAF B;  1W1F A;  2GNC A;  1ZSZ A;  5KE3 A;  3UA7 A;  3QKJ A;  3E2U A;  2YWW A;  4II1 A;  4O6J A;  1E6G A;  2KI7 A;  3HTR A;  2VUB A;  3CBP A;  4KGZ B;  4OMN A;  2HSE B;  3CCV A;  1VQP T;  1VQP Q;  3RER A;  3JCM b;  1X69 A;  2K5I A;  2KT8 A;  3OQ5 A;  1Q81 C;  2RJF A;  2AIR B;  1OGU B;  1F1B B;  1OX9 A;  1OYX A;  5LL6 S;  2HQX A;  1VQ9 T;  3OYA A;  1VQL T;  2DXT A;  1Y71 A;  1M27 C;  1AZE A;  3QXE B;  2CYZ B;  2JNG A;  4EOS B;  1S72 T;  2RHU A;  4AT1 B;  1AWJ A;  3C95 A;  2YDL A;  1H1S B;  5DQV A;  1G3S A;  1Q81 U;  5FU7 C;  2YHT A;  3G6E A;  2CP6 A;  4F7U G;  2A37 A;  3OW2 S;  4AFZ C;  1Q7Y U;  1K9M R;  4FT4 A;  5FWB A;  1JU5 C;  2DL7 A;  2XHC A;  3BW1 A;  5IHK A;  3MI9 B;  1N5Z A;  4A53 A;  3CCS Q;  2DD4 A;  1H1Q B;  2D8J A;  3M0R A;  2GQV A;  1D3B B;  3R6N A;  3JSC A;  2DNU A;  1Y7X A;  1WJS A;  3GLX A;  1H24 B;  4M7D B;  1GFC A;  2M9U A;  3I56 A;  1AWO A;  2CH4 W;  3JCM f;  2LTO A;  1MND A;  3EG0 A;  1M8V A;  1CKA A;  4F7L B;  1URC B;  3G71 A;  4M7D F;  2JTF A;  2NWM A;  2KEA A;  1LPL A;  1VQK T;  3OA6 A;  2W9Z A;  4C5E A;  5DLQ E;  2V26 A;  2IG0 A;  2YLC A;  3M0Q A;  4J5Y A;  1RUW A;  4HCK A;  2F2C A;  1SSF A;  2JGZ B;  3CCV Q;  3CCV T;  1N8R R;  2G6F X;  4M4Z A;  4OMM A;  4Z02 A;  1AWW A;  1ABO A;  1TS9 A;  4ELY C;  4E7S A;  1FVV B;  4C8Q C;  4A4E A;  2KSS A;  2ROL A;  2E5Q A;  2YLB A;  3M4G A;  2LJ3 A;  4CFU B;  3TEE A;  2BZ8 A;  1I07 A;  4M75 G;  3RNJ A;  1D3B A;  4HCB A;  4IIO A;  3O8V A;  1GBQ A;  2LNH B;  2XD0 A;  1EZZ B;  4QW2 A;  4A4H A;  3L2R A;  3OW2 P;  4CRI A;  1M1K C;  2E1H A;  1T0J A;  2I2L A;  5D7U A;  2KAF A;  1KD1 U;  3UAT A;  2H8H A;  1Y96 A;  4R55 A;  3G6E T;  2OAW A;  3G6E Q;  3JCM W;  4AFS C;  3S3N A;  3CME A;  5GAN 2;  4J9E A;  2L3P A;  2PUK B;  4FW1 A;  4EIK A;  2VC8 A;  2X9H A;  3LGF A;  4Y91 A;  2QDJ A;  1VQ4 A;  1M1K U;  5GMK i;  1MV3 A;  4E47 A;  1Q82 C;  3UPU A;  1PRM C;  2IW6 B;  1G3W A;  1I81 A;  3THK A;  2H3E B;  5IXB A;  4WCI A;  2K2M A;  5CAI A;  4XTY A;  4JS5 A;  4PK4 A;  1FMV A;  5AT1 B;  9ATC B;  2DL3 A;  2W9F A;  2QYZ A;  3I56 Q;  4P5N A;  2RNA A;  1OPK A;  3OYM A;  1Q82 U;  3EG9 B;  1RAG B;  3JB9 I;  3URG A;  1A0N B;  4X34 A;  1UGS B;  4HLQ A;  4AKH A;  2QXF A;  2O88 A;  2LNV A;  2OTJ T;  2DF6 A;  2OTJ Q;  3MKD A;  2Y4X A;  5I22 A;  4DBR A;  4ZGE B;  4ESR A;  5C0M A;  2LVM A;  3PIP A;  4A4G A;  1QCF A;  1N4M A;  3BFM A;  2FZC B;  3M53 A;  3EGX B;  3OS5 A;  3QII A;  2NUZ A;  2LX7 A;  1OZ2 A;  4FU6 A;  3NTK A;  4BCQ D;  1ZUK A;  4XU3 A;  4IMY B;  4M7A C;  1R8O B;  2EFI A;  2K6D A;  1IHV A;  3RKY A;  2W96 A;  4QSH A;  4OB1 B;  1PKD B;  2PQW A;  3HBL A;  4J9D A;  3QHR B;  2PTK A;  1TUD A;  3NMZ C;  5FWC A;  1JST B;  1G83 A;  3CMA T;  3CMA Q;  2P0K A;  3CC2 T;  3G4S T;  3G4S Q;  1K8A R;  4AI6 A;  2ZPI B;  1IGQ A;  1UJY A;  2MMP A;  4OMO A;  4PKC C;  2BKZ B;  3EG1 A;  3EG9 A;  2WEV B;  3H6Z A;  4BCO B;  4G6L B;  1ZA1 B;  2K79 A;  2RMO A;  4ZN3 A;  2AKL A;  3CCE T;  3CCE Q;  2EYX A;  4KT0 E;  4C0G A;  1PSE A;  3RUX A;  2QTV A;  1VYV A;  2DO3 A;  3X20 B;  1C9B A;  2EGA A;  3FB9 A;  2FPD A;  3QJY A;  3QJ6 A;  3RMQ A;  3ULR B;  3EGX A;  3BG5 A;  5GAN f;  4ZNX A;  4TTH A;  2HNI A;  2KGT A;  1X2K A;  4RKU E;  1N6A A;  4M6V A;  1P5E B;  5IH2 A;  5HK3 A;  5I11 A;  3MP8 A;  1GBR A;  4JRK A;  4EOO B;  3L2Z A;  3RGF B;  5GAO m;  3PFS A;  2OTL T;  5LQF B;  4IUT A;  1BIA A;  1M8M A;  2K57 A;  3EGU A;  3QHW B;  2W10 A;  3M4Y A;  4C8Q D;  1RAH B;  2B8A A;  4I3Z B;  4JJC A;  4HKE A;  4J6X A;  3MP6 A;  3M0T A;  3I35 A;  4J9B A;  5HBE B;  5LJ5 j;  2VXF A;  3CCQ A;  1OIY B;  2CS7 A;  2A28 A;  1GXI E;  1AZG B;  2RB6 A;  4ROC A;  3VU3 C;  1O9S A;  3LWI A;  5IHY A;  4AFQ C;  1Z9Q A;  3P8H A;  2EYQ A;  2YXY A;  1WHH A;  4IUV A;  3OYD A;  4AKI A;  3OYN A;  2ENM A;  4R56 A;  1TUG B;  2D9T A;  4EOM B;  2D1X A;  2W0Z A;  4JX4 A;  3JB9 J;  4ELJ A;  1BCM A;  2A0F B;  4QQD A;  1UGR B;  4Z88 A;  2CDT A;  2HZY A;  5LJ5 d;  2D8H A;  2UZD B;  2BS2 A;  4JJN K;  4F7S B;  4BI3 A;  2KDS A;  3M58 A;  2LT1 A;  1D3U B;  4E7Z A;  1G3Y A;  1VYW B;  1VOL A;  1E7O A;  2J7I A;  2FO0 A;  1QW1 A;  4LOC A;  3X24 B;  2KE9 A;  3NFC A;  1RAB B;  2RH2 A;  5LJ5 e;  4L5G A;  4FX3 B;  2EGE A;  2QA4 A;  4PL6 A;  1UNG D;  2AZV A;  5CEI B;  4FM4 B;  2XU8 A;  1UNL D;  1M30 A;  5KCO A;  1VA7 A;  1QVP A;  1U5S A;  1X2Q A;  4BE1 A;  1YIT A;  4E7L A;  3E1S A;  1BK2 A;  4OF1 A;  2O01 E;  2LCS A;  3TNI B;  2FB7 A;  1YIJ T;  1YIJ Q;  4M7A D;  5HQ0 B;  1ZSZ C;  1SG5 A;  3H0I A;  4RCC A;  4BY6 B;  4EOI B;  1GUX B;  3EHR A;  1MGQ A;  1WJQ A;  2VV5 A;  4Z89 A;  4QVD A;  4LDW A;  2DFU A;  4BD3 A;  1M9S A;  4BCF B;  3CCQ T;  3CCQ Q;  4N0A A;  2L2P A;  2KR3 A;  2QQR A;  1TH7 A;  1K73 C;  1SSH A;  4PNO A;  1VQ6 A;  2VXE A;  4EMK B;  4EOJ B;  2MWO A;  2P84 A;  1FMK A;  3MP1 A;  3TNH B;  4HA8 A;  1D1A A;  3RDV A;  4EMG A;  3OS2 A;  2LCC A;  2CSQ A;  1K73 U;  1VQO A;  2DJQ A;  2M1H A;  5GAN 3;  3OBW A;  2DME A;  1ZUU A;  4LN2 A;  5LMK B;  2KXD A;  3GNG A;  3VS4 A;  4EON B;  1CKB A;  1M90 R;  3OYJ A;  1C0M A;  4C8Q G;  4J8O A;  5CKH A;  3OYG A;  1AD5 A;  1XOV A;  2CGH A;  2KVQ G;  1YHQ A;  1GUX A;  4LDX A;  4J9F A;  2KMT A;  2ESW A;  3V7R A;  2WIP B;  5LJ3 g;  1VQM T;  1VQM Q;  1M3B A;  4PJO B;  3CQT A;  3MHX A;  5LJ5 g;  2QA4 Q;  3DTO A;  3VS5 A;  4M77 B;  2E10 A;  2FG0 A;  1HSQ A;  1H25 B;  1SEM A;  1ABQ A;  3HHT B;  8AT1 B;  3EHQ A;  1K4U S;  1VQ8 T;  3HB9 A;  1VQ8 Q;  4J7I A;  2V22 B;  1SPK A;  2CT3 A;  4EMK A;  2X4W A;  4NST B;  4MZM A;  4PJO F;  1YIT T;  1YIT Q;  4L6V 5;  4AKG A;  2EQK A;  2CCH B;  2E64 A;  2D0Q B;  2HQE A;  3JB9 G;  3MEU A;  2F2V A;  4EC8 B;  2VWF A;  3HRS A;  1TWB A;  5DQW A;  3QYE A;  1YNZ A;  2E12 A;  1BB9 A;  3VRZ A;  4M7D E;  1I4K 1;  4BCK B;  2R7G A;  3L42 A;  2M0O A;  2RQT A;  1YJ9 A;  1VQ6 T;  1VQ6 Q;  1MMG A;  5J39 A;  3A1P A;  1RLQ C;  2COZ A;  4F6W B;  1N9S A;  1U1T A;  3P8B B;  2XK0 A;  1XTD A;  3G33 B;  1YWO A;  2JOY A;  4J9I A;  1SHF A;  4M77 A;  4C92 F;  1BI3 A;  2XID A;  3M0S A;  2DVJ A;  4CC7 A;  1X6B A;  4KUI A;  2EBP A;  4JRI A;  3BHT B;  3L2V A;  3TNW B;  1K9A A;  2CP5 A;  3I5S A;  1WNL A;  1VQ7 A;  3T9N A;  2EKO A;  1YHQ T;  1YHQ Q;  3BY7 A;  1PM3 A;  3DB3 A;  1XO2 A;  2ZPF B;  3L2Q A;  2CZ6 B;  4ZTF A;  2CP0 A;  2P0Q A;  1KHC A;  2DEU A;  3JB9 H;  4J6W A;  1BI2 A;  5EFQ B;  1JRI A;  1PG5 B;  1QMC A;  4B9X A;  1ARK A;  1PRL C;  1GRI A;  1VQ9 A;  1VQL A;  1S72 A;  3F5X B;  2D0N A;  1OQK A;  1B34 A;  5CR2 A;  5CK9 A;  1KIK A;  3FLG A;  2OJ2 A;  2P0P A;  2K5L A;  2DLP A;  5HY6 A;  3BLQ B;  5ECA A;  4EC9 B;  4HT8 A;  4CXA B;  4OML A;  1UUE A;  1H3Z A;  1WDX A;  3OYF A;  4BY1 X;  2PK9 B;  3VKG A;  5GAN 7;  1BI1 A;  1J3T A;  3MCA B;  2F2X A;  1OPL A;  2DJZ A;  5EJC A;  4ANJ A;  3OYH A;  4KBM B;  3MO8 A;  2NYS A;  2XMF A;  2HCK A;  1WHM A;  3H0F A;  3I5R A;  2K3B A;  1RLP C;  2B86 A;  2WIH B;  4MZT A;  1GY3 B;  2EKH A;  2SEM A;  1WFW A;  1GCQ A;  4FSX A;  1AOJ A;  1YBY A;  4KRD B;  1AVZ C;  4M78 B;  1BKB A;  1ZBJ A;  2EPD A;  3HP9 A;  2FPF A;  2VGN A;  1VQK A;  1QWF A;  3TN8 B;  5GMK l;  2IN3 A;  3KHI A;  4M78 F;  3TU4 K;  3FEO A;  1RAI B;  2WPA B;  1NJI R;  3EGD B;  2CT4 A;  2EVR A;  3CEY A;  2HDA A;  1G2B A;  1VQ9 Q;  2DZ9 A;  3PT9 A;  1Q7Y C;  1JBM A;  1VQL Q;  1S72 Q;  1FKM A;  4M75 F;  2DRK A;  4E6R A;  4JRP A;  3PMT A;  2FVU A;  3DL1 A;  1H3H A;  5KYW B;  4IIM A;  2J6O A;  4MML A;  1D09 B;  1LOJ A;  2MPX C;  2KRS A;  2LMJ A;  4JDS A;  1WQW A;  2F5T X;  4AMC A;  1WXU A;  2HKQ B;  1WPY A;  1UB4 A;  4OP0 A;  3GP8 A;  2I0N A;  2DXB B;  1I8F A;  2YT6 A;  1M1G A;  5J3B A;  1BCO A;  1VIN A;  4XAX B;  3MPU B;  1ACM B;  2Y90 A;  2OAU A;  1AIS B;  4PLI A;  2GFU A;  4BUG A;  3EGD A;  4ZTJ A;  1IRX A;  2C5X B;  1OOT A;  5L8R E;  3CPF A;  4EOP B;  4X9C A;  4RUG A;  4Y28 E;  3BLH B;  4PFP A;  1TFB A;  3BDL A;  3QYB A;  2I53 A;  1VQK Q;  2OTJ A;  2YUQ A;  1WYX A;  1OEB A;  4J6Y A;  1H28 B;  2L8D A;  1MUZ A;  5CQX A;  3TCJ A;  2KK4 A;  3CCJ A;  2RK1 A;  4ME7 A;  2YUN A;  1PKS A;  1KD1 C;  5CIU A;  1ZUY A;  2DXB A;  1NEG A;  3C94 A;  2QGF B;  6AT1 B;  4YOO A;  3HL8 A;  1OI9 B;  2RHZ A;  1K76 A;  1N27 A;  4MZP A;  5CKB A;  4CC2 A;  8ATC B;  1OUL A;  5IDN B;  3REA B;  3EG3 A;  2JM9 A;  1KQ1 A;  2DXC B;  4BDZ A;  2X35 A;  4M7D A;  1FXX A;  4JZ4 A;  1D0Z A;  2ZAE A;  3CMA A;  2JVV A;  3J80 E;  3G4S A;  3CC2 A;  3ER0 A;  1NZ9 A;  4CI0 C;  1H92 A;  2J06 A;  1GFD A;  2DL8 A;  4JJD A;  5A2Q E;  4HCC A;  3E19 A;  2LCL A;  3HO8 A;  2D6F A;  4E7J A;  3NTI A;  1Q81 R;  1XNI A;  5GAN 4;  2DKG A;  4C0D C;  4OB0 B;  1FIN B;  3QPH A;  3SDZ A;  3LGL A;  3CCE A;  2A3L A;  2BKD N;  1WXB A;  4F6U B;  4XTV A;  2PUO B;  3VUB A;  3VS6 A;  1WHL A;  2PVG B;  4LDV A;  1YP5 A;  4BI8 B;  5KYX B;  4Z8A A;  3VS2 A;  5HBH B;  5GAO r;  3BLR B;  3KBG A;  1QCO A;  1WI7 A;  1B3Q A;  2DXC A;  3M59 A;  2OTL A;  1KQ2 A;  4BY6 C;  3H9N A;  1E9H B;  4KRT A;  3ZFJ A;  5HNB B;  2EIF A;  3CCJ T;  3CCJ Q;  1SF9 A;  2K7A A;  2KYB A;  5GAO n;  4ELL A;  4J83 A;  1JKW A;  4M7D G;  1S1N A;  2YUP A;  4OR5 B;  4J9H A;  4XU2 A;  2QK0 A;  1M2V B;  3NDQ A;  2A36 A;  4DBQ A;  4KUD K;  1V1C A;  5M9O A;  1KC8 C;  3A5Z B;  1UTI A;  2HSP A;  3JAM E;  3OB9 A;  4QQ6 A;  4JX6 A;  3OYK A;  2IVW A;  2DL4 A;  2A7Y A;  4BCM D;  5KYX A;  3OY9 A;  2CZ7 B;  2YUO A;  2HQH A;  3CC2 Q;  3S3M A;  4UC4 A;  1NYG A;  2P4T A;  3HFO A;  1WIE A;  1KD1 R;  3GIB A;  1KC8 U;  2RK2 A;  3DLL A;  4PJO E;  4RTW A;  1NLO C;  4M77 E;  5EC7 A;  1YI2 A;  1KXU A;  1OV3 A;  3LH0 A;  3VKI A;  1HJD A;  1K1Z A;  4OB3 B;  2R5M A;  2XDB A;  5LJ3 h;  4PJL A;  1M1K R;  1F5Q B;  1HYO A;  3UA6 A;  2PMI B;  4F16 A;  3UT1 A;  5LJ5 h;  5FU7 B;  2RA2 A;  4M77 C;  1QP2 A;  2DTI A;  3M57 A;  4JUV A;  1K0X A;  4HCZ A;  2DET A;  1LVK A;  5GAM f;  1ZP2 A;  2X3W D;  2WAC A;  3JCM d;  3M5A A;  2ABL A;  1Q82 R;  3PVL A;  2E6N A;  2OTL Q;  3CC7 T;  3CC7 Q;  3BG9 A;  1PNJ A;  1ZX6 A;  5KYY B;  1O75 A;  5CKE A;  5J26 A;  1YIJ A;  4LDY A;  1UNH D;  5LJ3 j;  3JCM e;  2X51 A;  5CKF A;  2BZY A;  3QUI A;  3PO3 S;  5IF1 B;  1M1F A;  3TSZ A;  2KRN A;  1BBZ A;  2CP3 A;  1N9R A;  2JT4 A;  1R0C B;  4F7N B;  2JUF A;  2HKN A;  5GAO p;  1SRL A;  2QEX T;  5A0L A;  3X25 B;  3JB9 D;  5FGK B;  2BE7 D;  1H1P B;  2F5K A;  3SFM A;  5LJ3 d;  3FJP A;  1RL2 A;  2ZPB B;  4DBH A;  1XQH A;  1YI2 T;  1YI2 Q;  5IAY A;  3CBM A;  2LQW A;  3FIF A;  4NOY A;  3CCM T;  2MK5 A;  3C12 A;  3CCM Q;  1OKV B;  2W2H A;  1O9K B;  5KE2 A;  2DVE A;  5IHI A;  5GMK m;  4C8Q F;  3CCR A;  2NLU A;  1VYT A;  3MJX A;  1HD3 A;  1PSF A;  3LH5 A;  3LLR A;  5LJ3 e;  2XDD A;  3HPW A;  2BIV A;  3CCU T;  1VQM A;  2K2V A;  1YWP A;  1GCQ C;  1MMA A;  2LP5 A;  1QCN A;  1VQ8 A;  3TQ7 P;  1QVG A;  4FYY B;  2M02 A;  3VKH A;  4FT2 A;  3MEV A;  1TSF A;  4F14 A;  2R58 A;  3SEM A;  2RQW A;  3QBY A;  2DAQ A;  3VS3 A;  3JB9 F;  3G1J A;  1P92 A;  3JCM J;  4IUP A;  4JRQ A;  1NM7 A;  1W70 A;  1UEC A;  2IIM A;  2VYT A;  1BU1 A;  1NBE B;  1YCS B;  2DBK A;  3CC4 A;  3JCM g;  4BCN D;  2DEQ A;  2RI3 A;  2EJ9 A;  2DYI A;  5GMK e;  1O9K A;  1KQS A;  3M9Q A;  2XI9 A;  1Q86 C;  1TG0 A;  4Z6Y A;  2EQM A;  1IO6 A;  4M78 E;  1H27 B;  4LD6 A;  1I5O B;  3V7C A;  3MET A;  2DRM A;  2L3S A;  5GAN j;  4C5H A;  4ZGD B;  1UE9 A;  2OX7 A;  3KUF A;  2E65 A;  3GPL A;  4CFX B;  1GH6 B;  4F7J B;  1YFN A;  1Q86 U;  5ACB A;  1W2B A;  4M7A B;  2JXB A;  3I55 A;  2V1Q A;  3WVE B;  3SWN B;  3OYE A;  3POM A;  4BI4 A;  1M3C A;  3LQ5 B;  4M77 D;  5GAN 5;  1PD1 A;  4XU1 A;  5CO7 A;  3JCM P;  1FYN A;  4NL2 A;  3AT1 B;  2DE0 X;  3CCR T;  1SRM A;  4BXX X;  3CCR Q;  1Z9Z A;  1RAE B;  2G3R A;  3EFO B;  4M7A F;  2J6K A;  1H26 B;  1U06 A;  3REB B;  4CFM B;  3L2W A;  1JXO A;  4RG8 A;  1HK9 A;  1X6G A;  5GAN d;  3A8G B;  4AG2 C;  2WMA B;  3QDF A;  2DZC A;  2YRC A;  2CUB A;  2RJD A;  2Y4Y A;  3EFS A;  2W99 A;  2JW4 A;  2KT1 A;  1TXQ A;  3PVQ A;  3JRZ A;  3EFR A;  5GAO q;  1W4S A;  5GAN e;  4BCG B;  4BCP B;  4N4I A;  2FL7 A;  2WSE E;  4LE9 A;  3CC4 T;  4WTO B;  3CC4 Q;  3SWN A;  4FW2 A;  4BAC A;  4AFU C;  2ED0 A;  1M3A A;  3BDU A;  5GJW B;  4C92 B;  4A54 A;  4EDU A;  4JZ3 A;  2WXV B;  4BCJ B;  2DL5 A;  2HMA A;  3RIR A;  2CCI B;  4HVV A;  4PJO A;  4BBR M;  4M7D C;  2E5K A;  2WSC E;  3V8J A;  2DTH A;  1IZ6 A;  4EOK B;  2DIL A;  2V8K A;  3S3O A;  4BE2 A;  2VAS A;  5ICP B;  1I0C A;  3GOX A;  2YRD A;  2CRE A;  4L59 A;  3I55 Q;  1SHG A;  3VRY A;  4B9W A;  3I55 T;  2BPM B;  4MFE A;  1K73 R;  2RQR A;  1M2O A;  4MMK A;  4J9G A;  3N5B B;  1QLY A;  1UGV A;  3G7Z A;  2LDM A;  3QYH B;  3UF4 A;  1X01 A;  4NS5 A;  3M0U A;  3CXC S;  2COW A;  2QQ8 A;  1K0S A;  5GAN 6;  2XIC A;  2ZGW A;  4DBF A;  3JCM Q;  2XG8 D;  4C92 A;  4DEX A;  5DM7 R;  2QGS A;  2EW3 A;  2X4J A;  4O5V A;  3D7S B;  2VB6 A;  3VJP A;  2KY9 A;  4F7U B;  5GAN g;  3NHN A;  1ZBX A;  2DK3 A;  5KH6 A;  2GQI A;  4YOZ A;  1ZA2 B;  3A8M B;  1EIF A;  1MNE A;  4JLG A;  2PNI A;  2UZB B;  3OYL A;  4JJB A;  1VOM A;  2E3H A;  2RF0 A;  3ZEH A;  1K9M C;  2DIQ A;  1JOW A;  4HT9 A;  4PJO G;  4HNT A;  4F7U F;  2DBM A;  2QTX A;  1AEY A;  4M77 G;  1WHK A;  2FRY A;  2JS0 A;  3NTH A;  3NGP A;  3LYI A;  4J7F A;  4Y72 B;  1IRE B;  1G3N C;  1U8R A;  4JX5 A;  3O5Z A;  2FRW A;  4HXJ A;  1C6V X;  1K9M U;  2HD0 A;  2HBP A;  2PHG A;  1VQN T;  1VQN Q;  4LUD A;  3KFV A;  3JCM c;  3E9G A;  2CZ1 B;  1WHG A;  2WJ9 A;  3SB2 A;  1IHW A;  3OSS C;  1JO8 A;  1VUB A;  4D8K A;  3E9F A;  2X4X A;  3VV0 A;  1MMN A;  2L89 A;  2EGC A;  1T0H A;  1ZLM A;  3V8L A;  4F7U A;  2K4Y A;  2CZ0 B;  2Z0W A;  4ROD A;  3CXC P;  2KXC A;  5L2W B;  1TD6 A;  2DPP B;  2MYS A;  3TVT A;  2RJC A;  2LJ1 A;  4ROE A;  2JMC A;  4QT7 A;  1N8R C;  4F6S B;  3EH1 A;  1RI9 A;  5FU6 B;  3HSB A;  2EJG A;  2PK2 A;  2KYM A;  1PWT A;  1VIE A;  1YJN T;  1PD0 A;  3DDP B;  4OMP A;  4RMO A;  3QWY A;  4M75 B;  3CXC A;  2O9S A;  1UDL A;  4HVU A;  5CQY A;  1OX8 A;  3JCM V;  3X28 B;  4BBS M;  1N8R U;  4OGR B;  2F2W A;  3DLM A;  5HCK A;  2ZPE B;  5L23 A;  2DD4 B;  3RR6 A;  4PFO A;  4ELZ C;  1NEB A;  2LQN A;  2C6T B;  3RBB B;  3JCM X;  1Y57 A;  4EMH A;  4LXC A;  1WZO A;  3SHW A;  2GF7 A;  3OYY A;  2KRO A;  2C5V B;  5I21 A;  2MAM A;  1YCY A;  3RKX A;  1OL2 B;  1G5V A;  4M78 A;  2O31 A;  3HRU A;  4KH1 B;  2BS4 A;  4M7D D;  2HBW A;  4LDU A;  2LQ8 A;  2KBT A;  4UN0 A;  1X43 A;  2ROT A;  3ZL7 C;  3QDR B;  2EJF A;  5I2M A;  4LNP A;  2QQB A;  2QQA A;  4C0F A;  2IW8 B;  3K7A M;  2JM8 A;  1LNX A;  4M75 A;  1D0Y A;  2DYB A;  4N4H A;  1PC0 A;  3NPF A;  1BU2 A;  2B9R A;  3CCS T;  2R57 A;  5FRM A;  1NYF A;  1U3O A;  4OGC A;  1WLP B;  4K11 A;  5KYW A;  5D6X A;  4RTY A;  3UDC A;  4F17 A;  2CSI A;  3X26 B;  4CFU D;  4IUU A;  1YN8 A;  4JPB W;  5KYN A;  2C5O B;  4A4F A;  1FMW A;  1Y96 B;  2WHB B;  1KFZ A;  2J05 A;  4DOW A;  2FHD A;  3L2U A;  4PJJ A;  3QWX X;  4DOV A;  4F04 B;  2KRM A;  1AHJ B;  5FLX E;  4PJM A;  3CD6 T;  3DOG B;  3CD6 Q;  4GLK A;  1E7P A;  4RTV A;  4C8Q E;  3L1A A;  2E3I A;  1B7T A;  3PIO A;  3PMI A;  4PFZ A;  2DM1 A;  4M78 G;  5HBJ B;  5BNJ B;  1K8A C;  1RI0 A;  4MDW A;  1WX6 A;  2LJ0 A;  4KGV B;  3B57 A;  3C4S A;  2DX1 A;  2RD1 A;  5D6W A;  1PCX A;  4XTU A;  2C0O A;  1OIU B;  4N0A C;  3HKS A;  3OMC A;  2WMB B;  2NUT B;  3OSV A;  1G3T A;  5EG2 A;  3DJB A;  2MF2 A;  1K8A U;  1Q7Y R;  2HL3 A;  2LT4 A;  4WF2 A;  5DY9 A;  5HKC A;  4KRC B;  2GFA A;  4FIB A;  5LJ3 f;  3V8K A;  1QP3 A;  5LJ5 f;  2LX9 A;  2DER A;  3FJ5 A;  4LD9 K;  4FYW B;  4QKU A;  4BCH B;  4RG2 A;  2EYW A;  3OW2 A;  1DJ7 B;  4C5G A;  4IKF A;  2V8I A;  3LWH A;  3GTM S;  4DEY A;  2GTO A;  1WQ7 A;  4BCI B;  2EQI A;  4IUR A;  2E41 A;  1VYU A;  2QDL A;  3CBO A;  2PVD B;  4E7I A;  4LUE A;  2L3R A;  4IUQ A;  3CC7 A;  2RM4 A;  5I5Z B;  3A98 A;  2GGR A;  1E6H A;  2FZG B;  3I56 T;  2PU9 B;  2UZL B;  4EPC A;  5IHN A;  4RTT A;  3H4C A;  4HVW A;  3VS7 A;  3JCM h;  4FYV B;  3ZBD A;  1B07 A;  4E7H A;  1UHC A;  3M0P A;  1UGQ B;  2NUT A;  3G71 T;  3G71 Q;  2X3X D;  4OMF B;  2E70 A;  2L3Q A;  4MDX A;  3FDR A;  2IW9 B;  5CYI B;  4M7A E;  1Y07 A;  4EMK C;  1WXT A;  2F69 A;  2DA9 A;  2NUP B;  2HL5 C; 
#chains in the Genus database with same CATH homology
 4JRI A;  4FT2 A;  3VKH A;  3L2V A;  3MEV A;  3LW5 E;  4QVC A;  3OW2 S;  1Q7Y U;  2JTM A;  2R58 A;  2LQK A;  3MEW A;  4FT4 A;  2EAY A;  3OBY A;  2QEX A;  3QBY A;  2DAQ A;  5I2S A;  1WNL A;  2XHC A;  3JB9 F;  2RJE A;  1VQ7 A;  1ZQ1 A;  3BW1 A;  2EKO A;  3T9N A;  1YHQ T;  3BY7 A;  1P92 A;  3DB3 A;  2ZPF B;  3HRT A;  3JCM J;  4IUP A;  4XK8 E;  2DD4 A;  4A53 A;  3L2Q A;  4JRQ A;  3SWN C;  2CZ6 B;  2VYT A;  4ZTF A;  2GQV A;  4JLI A;  1D3B B;  2H3J A;  3QG1 A;  4HL4 A;  3JSC A;  3CC4 A;  3JCM g;  2P0Q A;  1KHC A;  3JB9 H;  4J6W A;  4NL3 A;  1Y7X A;  1WJS A;  1BI2 A;  2DEQ A;  2RI3 A;  3GLX A;  2EJ9 A;  1JRI A;  2MWP A;  5A0D A;  5GMK e;  3CCM A;  3VUZ A;  2WSF E;  1KQS A;  3M9Q A;  4M7D B;  5DLO A;  2QDY B;  4B9X A;  2XI9 A;  1Q86 C;  2M9U A;  3QZ9 B;  3I56 A;  3PNW C;  4Z6Y A;  2EQM A;  1NPR A;  3JCM f;  3CME T;  4M78 E;  1WGS A;  4PJO C;  3S6W A;  2LTO A;  4LD6 A;  2QA4 T;  1VQ9 A;  4OVA A;  3V7C A;  3MET A;  1VQL A;  1M8V A;  1X75 C;  1S72 A;  3CCU A;  3UWN A;  3G71 A;  1B34 A;  4M7D F;  4NC6 A;  5GAN j;  1UEB A;  4C5H A;  4ZGD B;  2JTF A;  1VQ4 T;  1I5L A;  5CR2 A;  5CK9 A;  1QVG S;  4BE0 A;  3FLG A;  3BG3 A;  4XTX A;  3OA6 A;  3KUF A;  4C5E A;  2QFZ A;  2E65 A;  5DLQ E;  3GPL A;  2P0P A;  1BYM A;  2K5L A;  1Q86 U;  3Q1J A;  5HY6 A;  2IG0 A;  2YLC A;  4J5Y A;  1W2B A;  4M7A B;  4TVR A;  3I55 A;  2CKK A;  3CCV T;  1SSF A;  3WVE B;  3SWN B;  3OYE A;  3WVD B;  4BI4 A;  4C92 E;  1OZ3 A;  4M77 D;  4Z02 A;  5CO7 A;  4XU1 A;  5GAN 5;  3JCM P;  4HT8 A;  4NL2 A;  4ELY C;  2RHI A;  4C8Q C;  1H3Z A;  2KR6 A;  3OYF A;  4A4E A;  2KSS A;  3CCR T;  2E5Q A;  3VKG A;  2G3R A;  2YLB A;  3M4G A;  5GAN 7;  2HAX A;  4M7A F;  1BI1 A;  4RCB A;  4E7K A;  2G77 A;  3MCA B;  3TEE A;  2XDP A;  4M75 G;  4HCB A;  1D3B A;  2DJZ A;  3L2W A;  5EJC A;  3OYH A;  4KBM B;  4RG8 A;  1HK9 A;  2QI2 A;  3O8V A;  5GMK h;  1KQS S;  5GAN d;  4C92 C;  3A8G B;  3MO8 A;  1WJR A;  2XD0 A;  2XKO C;  1KHI A;  4QW2 A;  4A4H A;  3L2R A;  4CRI A;  1M1K C;  2DZC A;  2E1H A;  2I2L A;  3QYG B;  2KAF A;  5CVI A;  1KD1 U;  2Y4Y A;  2RJD A;  1Y96 A;  4MZT A;  4R55 A;  3G6E T;  3EFS A;  3JCM W;  4XQ3 A;  1JB0 E;  3S3N A;  3CME A;  5GAN 2;  2LC4 A;  3RMS A;  4FSX A;  3JRZ A;  3EFR A;  3M55 A;  2PUK B;  1YBY A;  5GAO q;  2VC8 A;  2X4Y A;  1W4S A;  1V29 B;  4M78 B;  1BKB A;  5GAN e;  3HP9 A;  1W2B S;  3LGF A;  4Y91 A;  2QDJ A;  1VQ4 A;  1M1K U;  5GMK i;  2VGN A;  4N4I A;  1VQK A;  4OB2 B;  4E47 A;  1Q82 C;  3QSU A;  1JJ2 S;  4C8Q B;  1YJW A;  2QF7 A;  3UPU A;  2FL7 A;  2WSE E;  1M90 C;  1G3W A;  1I81 A;  3M56 A;  2RI5 A;  3CC4 T;  5GMK l;  3SWN A;  3KHI A;  4M78 F;  3TU4 K;  3FEO A;  5CAI A;  3OYC A;  5GMK j;  4BAC A;  2LRQ A;  4XTY A;  4JS5 A;  3BDU A;  1KG1 A;  5HK0 A;  4C92 B;  4A54 A;  4EDU A;  3A8L B;  3CEY A;  4P5N A;  3OYM A;  2DIG A;  3FC3 A;  1Q82 U;  5IT9 E;  3JB9 I;  3URG A;  4F7U E;  2DZ9 A;  3PT9 A;  3RIR A;  1JBM A;  3QHS A;  4XU0 A;  1Q7Y C;  4X34 A;  1M90 U;  2BUD A;  1FX7 A;  1FKM A;  4BBR M;  4M75 F;  4D6W A;  4M7D C;  4PJO A;  2WSC E;  3V8J A;  4JRP A;  2DTH A;  2EWN A;  3PMT A;  2FVU A;  1UGS B;  1IZ6 A;  4HLQ A;  3DL1 A;  4AKH A;  2QXF A;  2V8K A;  3S3O A;  2LNV A;  4BE2 A;  2OTJ T;  4MML A;  4C0D B;  3GOX A;  2EQU A;  1LOJ A;  5FRO A;  2Y4X A;  4L59 A;  4ZGE B;  2MI6 A;  3I55 T;  4B9W A;  5C0M A;  4JDS A;  2LVM A;  1WQW A;  3PIP A;  4A4G A;  2F5T X;  4MFE A;  3BFM A;  3M53 A;  3OS5 A;  5GAN h;  4MMK A;  4V2S A;  1WPY A;  3QWL A;  1UB4 A;  3N5B B;  3QII A;  4OP0 A;  4FU6 A;  1OZ2 A;  3NTK A;  3GP8 A;  1QVG A;  4XU3 A;  3G7Z A;  2DXB B;  2LDM A;  3QYH B;  1I8F A;  1QLB A;  1M1G A;  1R8O B;  4M7A C;  2EFI A;  4HNU A;  5J3B A;  3RKY A;  5GAM h;  4C8Q A;  4XAX B;  4ATO A;  1X01 A;  2Y90 A;  4QSH A;  4OB1 B;  4NS5 A;  2OAU A;  3PGG A;  3A8H B;  3CXC S;  2PQW A;  2QQ8 A;  3HBL A;  5KCH A;  1OI1 A;  5GAN 6;  2XIC A;  2ZGW A;  4PLI A;  3JCM Q;  2XG8 D;  2GFU A;  4C92 A;  4BUG A;  4ZTJ A;  3CMA T;  3OMG A;  5AYF A;  2P0K A;  3CC2 T;  3G4S T;  4AI6 A;  2ZPI B;  4PKC C;  1QVF S;  2MMP A;  5DM7 R;  5L8R E;  3CPF A;  4X9C A;  2X4J A;  3INZ A;  4O5V A;  4Y28 E;  3H6Z A;  3MEA A;  4X9D A;  1NE8 A;  3VJP A;  3TW7 A;  2KY9 A;  4ZN3 A;  4F7U B;  3BDL A;  3QYB A;  3CCE T;  5GAN g;  4KT0 E;  1ZBX A;  2DK3 A;  5KH6 A;  4C0G A;  2RO0 A;  4QQG A;  1PSE A;  2DXU A;  3RUX A;  2ZZD B;  2M16 A;  2OTJ A;  3A8M B;  1EIF A;  4JLG A;  1YJW T;  2DO3 A;  3X20 B;  3FB9 A;  4J6Y A;  3OYL A;  1K9M C;  3QJY A;  3ZEH A;  2L8D A;  1MHN A;  2DIQ A;  3QJ6 A;  4M78 C;  4M75 E;  5CQX A;  3TCJ A;  1BIB A;  4ZN1 A;  3RMQ A;  4HT9 A;  4PJO G;  4HNT A;  4F7U F;  2BS3 A;  3BG5 A;  2QTX A;  2KK4 A;  4M77 G;  5GAN f;  3CCJ A;  2RK1 A;  3NTH A;  1JJ2 A;  4PJO D;  4ME7 A;  5C6S A;  2HNI A;  3LYI A;  4J7F A;  1KD1 C;  5CIU A;  2DXB A;  3C94 A;  4RKU E;  1N6A A;  5FU6 C;  1IRE B;  3HL8 A;  4M6V A;  2RHZ A;  1U8R A;  4JX5 A;  1N27 A;  4MZP A;  5CKB A;  4MFD A;  4C0Z A;  5HK3 A;  1K9M U;  3MP8 A;  4M75 C;  2HD0 A;  2HBP A;  4JRK A;  1LJO A;  3L2Z A;  4XTW A;  1VQN T;  5CKD A;  1KQ1 A;  5GAO m;  3PFS A;  2DXC B;  4BDZ A;  2X35 A;  3GF5 A;  4M7D A;  1FXX A;  2OTL T;  3JCM c;  3E9G A;  2CZ1 B;  1BIA A;  4IUT A;  2WJ9 A;  3CMA A;  2K57 A;  3SB2 A;  2JVV A;  3J80 E;  5GAM d;  3G4S A;  3CC2 A;  3M4Y A;  3OSS C;  1VUB A;  2RHX A;  1NZ9 A;  2L5Q A;  3E9F A;  3ER0 A;  4C8Q D;  2X4X A;  4CI0 C;  1ZHI A;  5A2Q E;  3TW6 A;  3E19 A;  2B8A A;  2LCL A;  3HO8 A;  4HCC A;  3VV0 A;  4E7J A;  3NTI A;  4MIM A;  2D6F A;  1XNI A;  2L89 A;  4HKE A;  4J6X A;  3V8L A;  2VGM A;  2K4Y A;  3MP6 A;  4F7U A;  5GAN 4;  2CZ0 B;  2GCX A;  2DKG A;  4C0D C;  5LJ5 j;  4OB0 B;  1FWZ A;  3QPH A;  2VXF A;  3SDZ A;  3LGL A;  4C92 D;  2DPP B;  3KXT A;  3CCE A;  2A3L A;  3CCQ A;  1NPP A;  2RJC A;  2ZZD A;  2CS7 A;  3RKW A;  4PLL A;  1GXI E;  2BKD N;  1N8R C;  3DKM A;  4M7A A;  2RB6 A;  5FU6 B;  4XTV A;  2PUO B;  5GAM e;  3HSB A;  3VU3 C;  3VUB A;  2EJG A;  1O9S A;  1VIE A;  3LWI A;  1YJN T;  2PVG B;  3GNF B;  5GAM j;  4ZGJ B;  4LDV A;  4RMO A;  3P8H A;  4M75 B;  2EYQ A;  4BI8 B;  3CXC A;  4M77 F;  4IUV A;  2DTO A;  3OYD A;  3CCL A;  3M54 A;  5CQY A;  4AKI A;  3OYN A;  5GAO r;  3TRE A;  4XTZ A;  4R56 A;  2ZPH B;  3AHU A;  2D9T A;  3JCM V;  3KBG A;  3X28 B;  4JX4 A;  4BBS M;  3JB9 J;  3A8O B;  4ELJ A;  2FYK A;  1N8R U;  3DLM A;  2ZPE B;  2DD4 B;  4QQD A;  1UGR B;  1VQ5 A;  1QVF A;  4DQ2 A;  5LJ5 d;  4ELZ C;  2DXC A;  2BS2 A;  1VQN A;  4JJN K;  4BI3 A;  3EAE A;  2K5F A;  2KDS A;  3M59 A;  3M58 A;  3JCM X;  2OTL A;  2KQW A;  2LT1 A;  4EMH A;  1KQ2 A;  3CPW S;  4BY6 C;  1G3Y A;  2QQ9 A;  3VYH B;  2GF7 A;  3OYY A;  5I21 A;  2MAM A;  4A4K A;  1YCY A;  3ZFJ A;  2PVO B;  2EIF A;  3RKX A;  3CCJ T;  1QW1 A;  1G5V A;  4M78 A;  4LOC A;  3X24 B;  3R6O A;  3NFC A;  4J83 A;  4OGE A;  5GAO n;  2C06 A;  3HRU A;  3OS1 A;  1M4Z A;  4M7D G;  2RH2 A;  5LJ5 e;  2BS4 A;  4L5G A;  4M7D D;  5A0G A;  4LDU A;  2LQ8 A;  4N4G A;  4XU2 A;  1B34 B;  2QA4 A;  3OYB A;  4PL6 A;  4FM4 B;  2XU8 A;  1VQO T;  3VYG B;  4KUD K;  3QDR B;  5M9O A;  4Q5W A;  2EJF A;  3A5Z B;  5D6Y A;  2K3Y A;  5I2M A;  1KC8 C;  2QQB A;  3JAM E;  3V7S A;  2QQA A;  3OB9 A;  3FRN A;  4QQ6 A;  4JX6 A;  5KCO A;  3OYK A;  4C0F A;  1NJI C;  3RES A;  2IVW A;  1YJN A;  1LNX A;  2O4X B;  4M75 A;  4DA4 A;  2A7Y A;  3J7A F;  3OY9 A;  1QVP A;  2CZ7 B;  4BE1 A;  1YIT A;  1HXD A;  1M5Q 1;  2EQJ A;  4N4H A;  4E7L A;  3E1S A;  4OF1 A;  2O01 E;  4M7A G;  3OYI A;  2FB7 A;  1YIJ T;  4M7A D;  3P8D A;  4UC4 A;  3S3M A;  2P4T A;  3HFO A;  4RCC A;  4BY6 B;  4GY5 A;  3CCS T;  3GIB A;  1KC8 U;  2RHY A;  1MGQ A;  1WJQ A;  2R57 A;  2RK2 A;  2ZCF B;  2VV5 A;  4QVD A;  4LDW A;  3DLL A;  5FRM A;  4PJO E;  3HZJ A;  4M77 E;  1H64 1;  1YI2 A;  1NJI U;  4OGC A;  3F70 A;  4BD3 A;  1M9S A;  3CCQ T;  4N0A A;  5D6X A;  3WXM B;  3LH0 A;  3UDC A;  4BDY A;  1VQP A;  2QQR A;  2E6Z A;  3VKI A;  1TH7 A;  1VIF A;  1K73 C;  3X26 B;  4IUU A;  5IN1 A;  4OB3 B;  2R5M A;  2XDB A;  3LX7 A;  4PNO A;  4A4F A;  1Y96 B;  5LJ3 h;  1VQ6 A;  5GAM g;  4DOW A;  3L2U A;  2FHD A;  2VXE A;  4EMK B;  4DOV A;  3UT1 A;  4FL6 A;  2MWO A;  5LJ5 h;  5FU7 B;  2RA2 A;  2DD5 B;  4KUL A;  4M77 C;  3CCL T;  1QP2 A;  1AHJ B;  2DTI A;  3M57 A;  5FLX E;  4BB7 A;  4JUV A;  3ME9 A;  3MP1 A;  4HA8 A;  4HCZ A;  4EMG A;  3HFN A;  5CCA A;  3CD6 T;  3OS2 A;  2LCC A;  4GLK A;  3OS0 A;  1E7P A;  4C8Q E;  5GAM f;  5GAO l;  2R5A A;  3VYG A;  1K73 U;  3L1A A;  3PIO A;  2WAC A;  1VQO A;  1VQ5 T;  3PMI A;  2M1H A;  5GAN 3;  3OBW A;  3JCM d;  4M78 G;  3M5A A;  2O4X A;  4M78 D;  3GNG A;  4JS4 A;  2RI2 A;  3DB4 A;  1VQK T;  3PTA A;  1K8A C;  2JZ2 A;  2E6N A;  1RI0 A;  3CC7 T;  3BG9 A;  1UGP B;  3OYJ A;  2QQS A;  1BI0 A;  4C8Q G;  1YJ9 T;  4MDW A;  3J81 E;  1O75 A;  4J8O A;  5CKE A;  5CKH A;  2K3X A;  5J26 A;  3OYG A;  3C4S A;  1XOV A;  2CGH A;  2KVQ G;  1YHQ A;  2RD1 A;  4LDY A;  5D6W A;  1YIJ A;  3CPW A;  1U1S A;  4LDX A;  3CCS A;  4XTU A;  2ZPG B;  2KMT A;  3V7R A;  5LJ3 j;  3H8Z A;  4N0A C;  5LJ3 g;  3JCM e;  4C92 G;  4M75 D;  1VQM T;  3HKS A;  3OMC A;  5CKF A;  2YRV A;  3OSV A;  3QUI A;  1G3T A;  5EG2 A;  3MHX A;  2MF2 A;  5LJ5 g;  1K8A U;  5FRN A;  4PJO B;  4M77 B;  4WF2 A;  2LT4 A;  5DY9 A;  1X6O A;  2KMG A;  2E10 A;  2JN0 A;  1M1F A;  5HKC A;  4YTL A;  3HHT B;  4QVZ A;  3QZ5 B;  1N9R A;  3HB9 A;  4HNV A;  2GFA A;  4FIB A;  5LJ3 f;  4J7I A;  1VQ8 T;  3V8K A;  4EMK A;  2JUF A;  3ASK A;  1QP3 A;  2X4W A;  3QO3 A;  4MZM A;  2DD5 A;  5LJ5 f;  2LX9 A;  4PJO F;  5GAO p;  1YIT T;  4L6V 5;  4AKG A;  2EQK A;  4LD9 K;  2E64 A;  2QEX T;  4VUB A;  5A0L A;  2D0Q B;  2HQE A;  3JB9 G;  3MEU A;  3X25 B;  2V8J A;  4RG2 A;  3JB9 D;  1VQ7 T;  3OW2 A;  3SD4 A;  3CD6 A;  2AHJ B;  1DJ7 B;  4C5G A;  5GAN 8;  4IKF A;  2V8I A;  2F5K A;  3LWH A;  3SFM A;  4C5I A;  5LJ3 d;  1WQ7 A;  3FJP A;  3HRS A;  1RL2 A;  2ZPB B;  1XQH A;  1YI2 T;  3QYE A;  2E12 A;  5KE3 A;  4IUR A;  2E41 A;  3QKJ A;  3CBO A;  4II1 A;  4O6J A;  5IAY A;  3CBM A;  4NOY A;  3FIF A;  2VUB A;  3CBP A;  2PVD B;  3CCM T;  3CCV A;  3C12 A;  4E7I A;  1VQP T;  3RER A;  1I4K 1;  4M7D E;  3JCM b;  3L42 A;  2L3R A;  4IUQ A;  3CC7 A;  2K5I A;  2M0O A;  2RM4 A;  3OQ5 A;  5KE2 A;  2DVE A;  5GMK m;  1YJ9 A;  1Q81 C;  2RJF A;  3I56 T;  4C8Q F;  2PU9 B;  1VQ6 T;  3CCR A;  2NLU A;  4EPC A;  5J39 A;  3H4C A;  1OYX A;  3JCM h;  3ZBD A;  5LL6 S;  1PSF A;  2HQX A;  3LLR A;  5LJ3 e;  2XDD A;  3HPW A;  4E7H A;  2BIV A;  3OYA A;  1VQ9 T;  1N9S A;  1U1T A;  1Y71 A;  2DXT A;  3QXE B;  3P8B B;  1VQL T;  2CYZ B;  1UGQ B;  2JNG A;  2XK0 A;  3CCU T;  3G71 T;  1VQM A;  1XTD A;  2JOY A;  1S72 T;  2RHU A;  4M77 A;  2K2V A;  4C92 F;  1BI3 A;  4OMF B;  2E70 A;  3C95 A;  4MDX A;  3FDR A;  2XID A;  1G3S A;  4M7A E;  1Y07 A;  4EMK C;  1Q81 U;  4KUI A;  2F69 A;  5FU7 C;  2YHT A;  3G6E A;  1VQ8 A;  4F7U G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...