3WVEB

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, before photo-activation
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
molecule tags Lyase
source organism Rhodococcus erythropolis
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3wveB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3wveB02
3A8MB 2CYZB 1JB0E 1V29B 2QDYB 1DJ7B 4L6V5 2AHJB 2WSEE 3QYGB 2PVOB 3VYGA 4ZGEB 2O01E 2WSCE 3A8HB 3X28B 4Y28E 2CZ7B 3A8OB 2ZPBB 4OB3B 2ZPHB 2CZ6B 2DXBB 1UGPB 2DD5B 1IREB 4RKUE 1UGQB 1PSEA 2PUKB 2DXCB 5L8RE 1QP2A 3QZ5B 1AHJB 3WVDB 4OB2B 2ZZDA 2PVDB 4FM4B 4ZGJB 2PVGB 3VYGB 1GXIE 4KT0E 4OB0B 1QP3A 2DXBA 2ZPFB 1UGRB 3X25B 2ZZDB 1PSFA 3VYHB 2D0QB 2ZCFB 2CZ1B 3X26B 3QYHB 2ZPIB 1UGSB 2WSFE 4XK8E 2PUOB 4OB1B 3X20B 4ZGDB 2DD5A 2DD4A 3A8LB 3X24B 3WVEB 2DXCA 3LW5E 3HHTB 3QZ9B 2ZPGB 2CZ0B 2DD4B 2DPPB 3A8GB 2ZPEB 2PU9B 3QXEB
chains in the Genus database with same CATH superfamily
4DA4A 1SHFA 4EOMB 2E5KA 5FRNA 4Q5WA 5KCHA 1DJ7B 1GBQA 1SPKA 2DE0X 1VQ5A 3TCJA 1B07A 4M7DC 2OI3A 3DB4A 5HKCA 1M1KU 2A36A 3EH1A 2W10A 3M9QA 1T3LA 3G71Q 2WJ9A 4Z8AA 2EGEA 1VYTA 4F04B 3L2ZA 3CCVQ 4O6JA 3TU4K 4ROCA 2QQSA 3SWNA 4J9BA 1YJ9T 1WHGA 3HFNA 5GAN5 4XTYA 1VQ5Q 1NLOC 3CCVA 2EQUA 4E7ZA 4HCCA 3EAEA 1Q7YR 4RTVA 1JXOA 4XTZA 5CK9A 2ABLA 3OMCA 3QHSA 1PC0A 1O9KA 5DQVA 2F2VA 2BKZB 5GAOq 2YSQA 4AT1B 1WQ7A 2NUZA 3L2UA 3LH5A 1E7PA 4BUGA 1MNEA 4IKFA 1YJWT 2FEIA 4OMFB 3ZBDA 1D0XA 3INZA 1NLPC 2VVKA 4RTXA 1ABOA 3L2QA 3EG1A 2E1HA 3P8HA 1YIJA 2DL8A 2A28A 1YJWA 4KBMB 5I2SA 4BCMD 4KH0B 4C92B 1YBYA 3CC7A 4CFNB 3UDCA 4HNVA 4ORZA 4M77F 2MIOA 4BCHB 3CCQQ 4D6WA 3PT9A 3JB9J 3L1AA 4ME7A 3CEYA 4EMKB 5HNBB 2LQNA 1KQ2A 4AG2C 3GBQA 3MY5B 2LNHB 4PK4A 2M1HA 5HBEB 2V26A 2WMAB 2DBKA 3BE3A 1C6VX 3G1JA 1WZOA 4BCND 3G71T 2BUDA 1Y96B 3S6WA 3GNGA 4C8QF 2WIPB 1ZA1B 2OTJT 4JS5A 1K4US 2JUFA 3JB9F 4CFUD 4DBRA 2XHCA 2C0TA 4M4ZA 3X28B 4FYXB 4NS5A 5EFQB 1LJOA 1OZ3A 1U1TA 1WX6A 3OS5A 1VQOT 4M75G 3JB9H 1Y07A 1ENWA 1VIEA 2ZPBB 1VQ5T 3IQLA 3JCMJ 3SWNC 1KQSA 2QTVA 2UUEB 4FYVB 4LUEA 2GFUA 1M5Q1 3VS3A 2O4XA 5FWCA 1RI9A 4M7DD 4WCIA 3RNJA 2AZVA 2DNUA 2C5OB 5L8RE 2EWNA 2G9XB 1O75A 2X35A 1N8RR 4M77A 4CFUB 2HD0A 4EMKC 2PVDB 4ZGJB 2Y4XA 1VQ7T 3BY7A 4A63B 3V8LA 1H28B 3TNWB 1Z9ZA 3VS4A 2ROLA 1X27A 4JX6A 3X25B 2ZZDB 1NYGA 3QO3A 3H9NA 2MOXA 2VKNA 1H1RB 4M7DG 4OMNA 3OYHA 3QYHB 2DBMA 2RJCA 4D8DA 3MKDA 3M0PA 3FRNA 4K11A 3REAB 3E9GA 2EFIA 3JCMW 3LWIA 3LGLA 2JTMA 3FLGA 2UZEB 3X24B 3HRSA 3HL8A 1A0NB 2QTXA 2VUBA 4CC4B 3TNIB 2DIQA 4E7HA 2BIVA 2DD4B 4M77G 4BCGB 2O88A 4J9FA 2X4XA 3BHTB 2JW4A 2UZBB 1G3YA 2J6OA 2MI6A 3T9NA 3H6ZA 3OYCA 1HJDA 1MMNA 2DZCA 3VS5A 1VQOQ 2FYKA 4Y72B 4BY1X 2WPAB 5GJWB 2C0OA 2W2HA 2EGCA 4DQ2A 3VS1A 3J80E 1UNLD 2YLBA 5LJ5g 4FT4A 3O5ZA 3VYGA 2M16A 3NTIA 2DL4A 3TNHB 4EC8B 5IXBA 4C8QG 4QKUA 5GMKm 2I2LA 3A8OB 4RG2A 1KQSS 1FINB 4ELLA 2DXTA 4M77C 4E7KA 4HXJA 1N5ZA 4M75C 5CQYA 4M7AD 4F7UE 4PJOC 1VQMT 4LDUA 1OZ2A 5GANj 1RAGB 2BE7D 3QG1A 1VQMA 3M0TA 2XDDA 1HSQA 1AD5A 1X01A 3PMTA 2D9TA 2X3WD 1G83A 3M54A 2PTKA 4EOSB 4BBRM 1UB4A 1FVVB 1OX8A 2BPMB 4AKGA 1TXQA 4BCOB 2JM9A 2MYSA 1IXDA 3M0QA 5IH2A 2MPXC 5GANf 1VQ7A 1SRLA 1Y71A 4IUQA 1U8RA 3CPFA 2XIDA 2WSFE 3OYFA 5LJ5h 4R56A 4F6WB 2HAXA 1YJNQ 1WNLA 3BG3A 4CRLB 2QDJA 2MWPA 3LLRA 3CMAQ 1I5OB 3QKJA 3VJPA 4QT7A 3WVEB 3GF5A 4AFSC 1RAEB 1NEBA 2Y90A 3CC7Q 3HHTB 3QZ9B 1D1AA 2K5LA 4A4KA 1ZSZB 3WXMB 4IUPA 2EYYA 1WYXA 1YFNA 2RNAA 2FPDA 1WGSA 2IVXA 4HLQA 3BDLA 1NPRA 2DL5A 1NM7A 1JB0E 1X6OA 2E4HA 2RO0A 4A53A 3OYGA 2QI2A 2GNCA 4PJOG 4A4EA 4C0DB 5HK3A 5I22A 2KXCA 1SF9A 4PJOB 2ED0A 4C5IA 2DXUA 4PL6A 3I56T 1N9SA 3EG3A 1QVGS 4E7IA 1PNJA 1EX4A 4FW2A 1RLQC 3R6OA 1AT1B 2E3IA 2J06A 4IUVA 4FCYA 3CCUQ 3TEEA 1ZLMA 5LJ5j 2LJ1A 2DFUA 3CCEA 4AMCA 3PGGA 3OSSC 2VXEA 1OPLA 2DYIA 1YJ9Q 5LJ3g 2QA4A 3TQ7P 2DJZA 2QYZA 4FM4B 4HCBA 4JPBW 3NTKA 2LQ8A 4RCBA 1G2BA 3SHWA 1VOLA 5LJ3f 1K73C 2P4TA 3CBPA 2I0NA 3GPLA 4YOSA 4I3ZB 4NL3A 5D6WA 1AISB 3X26B 2C5XB 2RHIA 1KG1A 4J9DA 1KHIA 4X9CA 1ZUUA 5DQWA 3QDRB 3ZL7C 3I35A 4EC9B 4MFDA 1W2BP 1GRIA 5CKEA 1JRIA 5KCOA 2GBQA 2K2VA 1XNIA 1NJIR 2LJ0A 2ATCB 4J6YA 2I53A 4XAXB 1WHKA 2DF6A 4XU3A 4BCJB 2C4GB 2EPDA 2ECZA 4JDSA 5GAOm 4PJOA 3ZEHA 3NTHA 4FSXA 4M75A 3DOGB 1JO8A 4BACA 2ZPGB 3MCAB 3AT1B 4F6UB 2HSEB 2AZSA 4QQGA 3HSBA 3DB3A 2J6FA 4VUBA 1M1KR 2KRNA 4J8OA 2DMEA 2DEQA 2FRYA 2CYZB 3JB9D 2PMIB 2QDYB 2DTIA 4HCZA 2LX9A 5LJ5d 2JXBA 3QPHA 4J5YA 1WXUA 3VS0A 4C8QC 1E6HA 2MWOA 3OSVA 1ZSZC 1YNZA 1NJIC 5IHKA 3OS0A 1QQJA 1YCSB 3O8VA 2CZ7B 1VQ6T 2K57A 2O4XB 1E7OA 1V76A 3CPWS 1N9RA 5GAMf 3CC2T 1UGPB 3QWYA 2DD5B 3RKYA 1MMGA 2COWA 1M8MA 4M77B 2UZLB 4M7AC 4FYYB 4JZ3A 1PRMC 2E12A 4F16A 1BK2A 3DDQB 3G6ET 5HVYB 3PVLA 3TW7A 4EOJB 4QVCA 1BI0A 4MZTA 2X4WA 1ACMB 2XI9A 3M58A 3FB9A 2KXDA 1V1CA 2EAYA 1OOTA 4Z6YA 4ROEA 3OYLA 4DOVA 1BBZA 4ANJA 3JCMh 4KRDB 3VYHB 1QW1A 3M4YA 4PFZA 4C8QE 2QA4T 3KUFA 4JJCA 4AI6A 4C8QB 1NJIU 3LYIA 4YOZA 4LD6A 2JTFA 2CREA 3C0CA 3POMA 2HSPA 2LW4A 2QF7A 4RTZA 2PUOB 2HZYA 2MCNA 2CUBA 1QMCA 3MEAA 4M7AB 3M4GA 4EMKA 2LP5A 3QYBA 3EGDB 3BLQB 4M75E 3CCSQ 1D0YA 2K3BA 3M0UA 3HPWA 4M75F 2X9HA 1OU8A 1UTIA 4M7DE 2V8IA 4M77E 3PIOA 1ZSGA 3CCLQ 1SSFA 3CCQT 2HNIA 1MNDA 5FROA 3F70A 2KMGA 3CCQA 3QWLA 1QVPA 2RI5A 1U1SA 5CKDA 1KD1R 3URGA 4BDZA 4QQDA 2FPEA 5GANd 3HRUA 1FMVA 3CPWP 5EC7A 3QYGB 3NFCA 2CDTA 1OULA 5HBJB 1NE8A 5LJ5e 4JRQA 3CCMQ 1OI1A 2KBTA 4FW1A 4HL4A 4CI0C 4KUDK 4FU6A 4JLGA 1M3AA 1ZBXA 1VQ4A 4EOKB 4F7SB 4XTUA 3G6EQ 3CCJA 3UA6A 4OMOA 2F5TX 2WACA 4DOWA 3C12A 1VQ4T 2XMFA 1JKWA 3MIAB 3E9FA 3Q1JA 1VQ6A 1UUEA 4C0GA 1Q81U 1GCPA 2PVGB 2ZZDA 3EIDB 1K9AA 2LQWA 1WQWA 1QCFA 5CKBA 2BS3A 3OYAA 2IVWA 4OGRB 1IRXA 4PNOA 2YUOA 4C92G 1NYFA 2RHUA 2ZCFB 2DILA 4JRPA 1QLYA 2YDLA 3KXTA 2QEXA 1VQLQ 4BI4A 1K8AR 3I5RA 2O2OA 4RMOA 3CCLT 3VV0A 5J39A 1JSTB 3F5XB 3A5ZB 4EOOB 1UHCA 3BLHB 1S72A 2CGHA 2JMAA 1H27B 2ROTA 3CBMA 4LDVA 4GBQA 5IDNB 3LW5E 3C95A 1BCOA 5FU7B 2RHZA 2R7GA 4HVUA 2EGAA 3QHRB 4NOYA 2XK0A 2PU9B 3K7AM 2FZKB 2W9ZA 2XDPA 1WDXA 3VRZA 2WFYB 1QVFS 2L0AA 1TD6A 3JCMP 2YHTA 4C0FA 2K9GA 3PVQA 5A0GA 3TVTA 3JCMV 2EJGA 1YHQQ 1G3WA 4J6XA 2O01E 2YRCA 1JEGA 4J7FA 2AKLA 3L2RA 1Q82R 1F5QB 1CKBA 4OMLA 4Y28E 1W70A 1RABB 1M2VA 2OX7A 2OTLT 4EPCA 4EOLB 2ZPHB 2ZGWA 4M77D 1JU5C 1PD0A 1KJWA 1H8KA 3EFOA 3DTOA 3M0RA 3H0FA 1PG5B 1O9SA 2AK5A 1K0XA 4A54A 3CCUT 5GAN2 3V7SA 3FIFA 1I81A 3G6EA 1TH7A 1QLBA 1T3SA 2PQWA 1VQNT 4EOQB 2VGMA 3CCUA 1M90C 5GAN3 2LT1A 4Y92A 1RAFB 2KSSA 2VWFA 2KROA 1RL2A 2DAQA 3VS7A 4E7LA 2IW8B 1BKBA 4QW2A 5IN1A 1OGUB 4BY6C 3ER0A 3VYGB 1QCOA 1OQKA 2KI7A 4FYWB 1VQ8Q 3OBWA 3TN8B 2CP7A 1JQQA 1Q86R 1X75C 3DDPB 3CC4A 2GTJA 5LMKB 3CD6Q 4II1A 5GAOl 3HKSA 1AWWA 2J7IA 2K5IA 2JNGA 3CC4T 2DTOA 2WIHB 2HKQB 4JLIA 4M78F 2RHXA 2KDSA 4PJOF 4B6MA 1VQ9Q 4CC3A 5IHNA 5GANg 1SG5A 1SEMA 1H25B 3I9QA 3CXCS 3QJYA 3MHXA 2MAMA 1D1CA 3PE0A 1Q82U 1YIJT 4M7DF 1AZGB 2DD4A 3META 5GMKe 1OL2B 2W9FA 4WTOB 1ZQ1A 4MMKA 1U5SA 5CYIB 4EMHA 1PRLC 5HBHB 1QMZB 1VOMA 3CMAT 4NL2A 3UWNA 4B9WA 5LQFB 1YCYA 3A98A 2CZ0B 5FGKB 2LJ3A 2YRVA 3MPUB 4RG8A 4M78E 3JB9I 2CUDA 1V29B 1D3BB 3RMSA 4J9CA 1R0CB 2OTLQ 3S3MA 4ELJA 1Q95G 1HYOA 1I1JA 4OMPA 3I55T 2JS2A 3RKXA 1BI2A 4PFOA 2EYZA 3V7CA 5IHYA 2CH4W 1VQNQ 3DLLA 1VUBA 1WIEA 2DO3A 2MMPA 5GMKi 2CKKA 1M30A 2DYBA 3OYMA 1H641 1TG0A 4RTUA 5I5ZB 2X4YA 1H1SB 4A4GA 4F7UF 4F6SB 4RKUE 4IIOA 3JSCA 1VINA 2YXYA 4M7AE 2QQRA 2KVQG 1VQLT 1XOVA 4BCQB 2P0PA 1VQKA 4DEXA 3WVDB 1IO6A 3NPFA 3UPUA 2KY9A 4EIKA 2BS4A 1TFBA 5A0DA 3UT1A 1D1BA 5A0LA 2LQKA 5L23A 2DXBA 2ZPFB 5D6XA 2P4RA 4LDYA 4XTXA 4MDXA 1FMKA 4BCPB 3JCMb 2CZ1B 3G4SA 4LN2A 5LJ3d 2LCLA 2CP2A 8AT1B 3CCRQ 1UG1A 5KYUB 2GGRA 3G4ST 2QFZA 4OMQA 4OR5B 1MUZA 3CCEQ 1ZUYA 4X9DA 2A08A 5CVIA 6AT1B 3CCSA 1GL5A 2G6FX 2LC4A 1UDLA 3P8BB 5IAYA 2Y4YA 2YLCA 4M78G 4DBQA 1PHTA 1FYNA 4BE1A 3CXCP 3SWNB 4PJJA 5KYXA 4C92C 4BY7X 2M51A 4F14A 1GCQC 1ZP2A 3G71A 3G7ZA 3EJ1B 5GAOp 1AWJA 1HXDA 2M0OA 2LCCA 4LE9A 1M90U 3M03A 2DRKA 3L2WA 2K79A 1N8RC 1QKXA 1M9SA 2VV5A 2LT4A 2HDAA 4N4GA 1QCNA 2A7YA 3PMIA 2HQEA 1B34A 4CXAB 3JCMf 4E6RA 4C8QD 2DVEA 1PCXA 4YOOA 4M6VA 4PJMA 4BBSM 4LOCA 2RH2A 4F70B 2OTLA 1OI9B 1VQ8A 1YITA 3EG9A 4Z88A 3SEMA 3A8HB 1U3OA 3OW2S 1VQ8T 1OKVB 1AEYA 1R8OB 4MMLA 2DXBB 2JS0A 3RR6A 1JJ2A 4M7AF 1AD6A 2RJEA 4BE2A 2JTEA 4M75D 3JCMX 4RCCA 3H0HA 2DXCB 4E2FB 5DY9A 1WXTA 2E41A 1D09B 4OVAA 4JZ4A 1TUDA 5IT9E 1M2OA 4EDUA 3EGXA 4C92E 3FC3A 1PD1A 1X6GA 2OJ2A 2CSQA 3MP8A 1K9MC 4OB0B 1G8XA 2RPNA 2IG0A 1IHWA 1PSFA 2ENMA 4YTLA 5C6SA 3QIIA 4LUDA 1Q7YU 3EG2A 7AT1B 4FSSA 1UNHD 2DM1A 2F2WA 1Q81R 2P0QA 1XO2A 1H24B 2CH4A 3KHIA 2DJQA 1SHGA 1NZ9A 1QKWA 3BFMA 3X20B 4RTWA 1VQPT 2H3JA 4N0AA 5J26A 2WEVB 2L89A 3M56A 3EFSA 3RGFB 4PFPA 4BXXX 1YJNA 1AZEA 1I4K1 2JOYA 2YWWA 3JCMg 3I56Q 2LZ6B 4X34A 1K8AU 2DPPB 1M1KC 3ASKA 1S72T 2QQAA 4J9IA 3PIPA 2BS2A 1I8FA 4Z02A 5CAIA 1QVFA 3RKWA 1N27A 2DZ9A 2CP0A 1P5EB 5AT1B 2KEAA 3DLMA 3A8MB 1B3QA 3DKMA 4X1VA 3MEWA 3ZFJA 2KMTA 4XU1A 2NUTA 5I11A 3OB9A 5DM7R 1VYVA 3QDFA 1G3NC 1UJYA 3J81E 2EUFA 3HZJA 1BI3A 4FT2A 1YHQT 2OTJQ 3EHRA 2WMBB 1LCKA 4C5GA 1TUGB 2FHDA 4L59A 1WJQA 2CZ6B 2LTOA 1OEBA 1YITQ 3GNFB 4BI3A 3M57A 4GLKA 3R6NA 5D6YA 2PUKB 3RESA 4RODA 3LH0A 3GTMS 1OYXA 2XKOC 3BW1A 1E9HB 2G3RA 2F69A 1G3TA 4LDWA 3SD4A 2RHYA 5LL6S 5FU6C 3CCET 4F7LB 2HMAA 3VRYA 4LXCA 4AFUC 1WHHA 2BE9B 3E19A 4C8QA 5GAN7 4JJBA 2MF2A 2OAUA 1ZBJA 3CCRA 2CT4A 1RUWA 1VQNA 2RQUA 1Y96A 2FG0A 3OMGA 3MEVA 4CRIA 4MFEA 4IIMA 4PJOD 1C0MA 2DLPA 3CMEQ 1S1NA 3C4SA 2DEUA 2C0IA 2K7AA 3CC4Q 2DA9A 1K1ZA 3GP8A 4PJNA 1WXBA 4XK8E 2GFAA 4BI8B 1QWEA 2ZAEA 1PKDB 1OX9A 3QBYA 4UC4A 3JAME 4TVRA 1FMWA 4QVDA 3HFOA 4N4HA 2RD1A 5GAN6 2DERA 3BHUB 3BG5A 3HP9A 2HCKA 2H8HA 2J6KA 1VQ9T 1FWZA 1TS9A 3HBLA 2RA2A 4BCMB 2DK3A 4C92D 5GAMg 1M90R 4B9XA 1H1QB 1RAHB 1MMDA 1H4LD 2RJDA 3CC7T 2R5AA 4OMMA 1WJRA 3LQ5B 2WHBB 1D3BA 4AG1C 5EJCA 2HBPA 1YI2T 5CR2A 1ZA2B 1GBRA 5KYNA 4V2SA 5KH6A 2JZ2A 1HD3A 2K4YA 3CC2Q 1ZHIA 2R58A 1O9KB 5FRMA 2PJQA 5DLOA 3LGFA 2NUPA 3TSWA 1YITT 1UEBA 1WJSA 3THKA 1VYWB 1TUCA 1W1FA 1TSFA 4PJLA 4M78B 2V8KA 1K9MU 2QGSA 5LJ3j 3OS2A 3OYIA 2CJMB 4BCFB 1EZZB 1PKSA 4OB3B 3VKGA 3PO3S 3RBBB 4IUUA 1VQMQ 3VS2A 1VQKQ 5FW9A 1YJ9A 1JOWA 1RAIB 4RUGA 2G77A 1PSEA 2V1RA 2HL5C 2CP6A 3RDVA 2BTTA 4TTHA 1GFCA 1LPLA 1Q82C 2E3HA 2XU8A 1WHJA 1BB9A 1IZ6A 1VQPQ 4LDXA 1SKUB 4FIBA 4M78D 3H8ZA 2ESWA 1QP3A 3UATA 1N6AA 1VQLA 5CO7A 3JCMd 5KYUA 5BNJB 4EOIB 1MHNA 1KQ1A 3SB2A 1KXUA 1QVGA 1K8AC 2FVUA 4ESRA 4PLLA 1Q86U 3CD6T 2B9RA 2DTHA 3EHQA 4XU2A 2GF7A 3REBB 1JSUB 4LD9K 2CCHB 1MGQA 1PM3A 3ULRB 5KE3A 1N8RU 4UN0A 4O5VA 4ELYC 2X51A 5IF1B 1MV0B 2FPFA 1FXXA 4C5EA 5LJ3h 1WHMA 1VYUA 2EYXA 1G3SA 5KYYA 1WPYA 2EQIA 5CKHA 4JRIA 4CFVB 1TOVA 3FEOA 4PJOE 1UFFA 1XJWB 4F17A 1VQ9A 3QHWB 2OTJA 5HK0A 2A0FB 1X2QA 2VC8A 4FL6A 5A2QE 2K3XA 1SSHA 1UGVA 4E47A 2EYQA 1KC8R 1M1FA 3CC2A 1JBMA 2JVVA 3HRTA 3C94A 1VQOA 4P5NA 2LX7A 2QQ8A 4BCNB 2ED1A 2COYA 1Y0MA 2VXFA 3HO8A 4BCQD 2LMJA 4XTVA 1C1AA 1GY3B 2R5MA 4N4IA 1K73U 3I56A 2C5VB 4L5GA 1NG2A 3KFVA 4JJNK 2KNBB 4E7SA 1IREB 2K6DA 2L3SA 1IB8A 3CPWA 1H3ZA 4LNPA 1URCB 2A3LA 4II5B 5GAMh 1QP2A 2C06A 1BCMA 4OP0A 4OGEA 3JV3A 1BI1A 1GFDA 2HEQA 2BKDN 3BDUA 1Q7YC 4ZTFA 2D6FA 3NHNA 5GMKl 3B57A 2E70A 3MO8A 2PK9B 2QEXQ 2RQWA 1UNGD 2HBWA 5I21A 1KD1U 2CCIB 2FL7A 3BLRB 1UECA 4FX3B 2KR3A 3OY9A 1BU2A 2D0QB 1E6GA 1NEGA 4J9HA 4ZN1A 5J3BA 3I5SA 4XU0A 2W0ZA 5KYYB 2W99A 2HKNA 1R77A 2KK4A 2JGZB 2RI3A 2KT1A 3RIRA 1M8VA 3NMZC 5D7UA 3DJBA 1G5VA 1AOJA 2DETA 5KYXB 2BZYA 2IN3A 4ZGDB 1EFNA 2B86A 2EIFA 4JX5A 2DD5A 3PNWC 1ABQA 2QK0A 2YUQA 2RN8A 1JJ2P 3GOXA 3HB9A 3OYJA 1GCQA 1WI7A 4BCKB 2A37A 3L2VA 4BE0A 4C92A 2QDLA 3VKIA 2MK5A 2BZ8A 4R0KA 5IDPB 1ARKA 3A8GB 2IW6B 2KR6A 1W98B 4MZMA 1H26B 1AWOA 1B34B 4F7UA 3QXEB 1X2KA 1K9MR 1QWFA 4BCIB 5KE2A 4XQ3A 5GAMj 3ME9A 3GIBA 4L6V5 2WSEE 5HQ0B 3HTRA 1NPPA 2LRQA 1KSWA 1YWOA 3NDQA 1IGUA 1LVKA 2QG9B 3JCMc 3E1SA 1LNXA 5GANe 2NYSA 3S3OA 1OKWB 1H1PB 2L2PA 3MI9B 2RB6A 1KQSP 2L3RA 2CS7A 4PLIA 4IUTA 2UZDB 1KC8C 5HY6A 1JJ2S 4KULA 1VQ6Q 2QGFB 2EQKA 1N4MA 1D3UB 2QAZA 1RAAB 2DRMA 1T0JA 3OW2A 3MJXA 1JXMA 3EGXB 2JM8A 1OV3A 3CBOA 4M75B 2O31A 3EGUA 3QZ5B 2YT6A 5LJ3e 4F7JB 1LOJA 1KHCA 3A1PA 3VUBA 2QA4Q 4QQ6A 3V8KA 4R55A 3EG9B 4EONB 1C9BA 1UGRB 2IIMA 1T0HA 2V8JA 2PK2A 4KGXB 2K5FA 1UJ0A 4HKEA 1RADB 2EQJA 4JS4A 4HNUA 2ZPIB 4EORB 1FKMA 4KGVB 3QYEA 3EOCB 4C5HA 4BB7A 3CMEA 4KGZB 2PZ1A 4NC6A 4AKHA 3FDRA 1XTDA 3S3NA 2RQTA 2KQWA 4QVZA 2V22B 4C0DC 1M2VB 4J9EA 2RMOA 3CMET 4PKCC 4MIMA 1U06A 2PNIA 5GAOr 2AKKA 2JN0A 2D8HA 3SFMA 1UE9A 1K76A 1Z9QA 4IMYB 3VUZA 5GMKh 3L42A 3VS6A 1WLPB 5GAMd 2LCSA 4HNTA 2L8DA 4A4HA 2OAWA 2D8JA 4EOPB 1Q86C 2ZPEB 2FB7A 2KRSA 1Q81C 4BY6B 1YI2Q 2EW3A 3H41A 2RQRA 5CQXA 4EMGA 3EG0A 2COZA 4JX4A 4GLMA 5GJVB 2YUPA 1KD1C 1PKTA 2LNVA 1OPKA 2GCXA 2E6NA 2X3XD 2L3QA 2EKOA 1OIYB 1YI2A 2F2XA 4D8KA 2QQBA 1AVZC 3OYNA 3OYDA 4C92F 3OBYA 4HT8A 1NBEB 1YP5A 4CC2A 3NGPA 4M7AA 4J83A 3CCVT 1ZX6A 1IHVA 3EGDA 1W4SA 1EIFA 4ELZC 2XICA 3H0IA 2Z0WA 3OS1A 2HQHA 2FZCB 2KT8A 4IURA 1W2BA 2VYTA 2RM4A 1AHJB 1F1BB 1GH6B 4KRTA 4N0AC 1RACB 4M7AG 1VQKT 4KUIA 1BYMA 1KC8U 3FJPA 3CCMA 5ECAA 2M02A 1M3BA 2E5QA 1GXIE 4KT0E 5GMKj 2RI2A 3JB9G 1WA7A 5FU7C 3M53A 3RUXA 3BHVB 5ICPB 2R57A 3M55A 1YWPA 1VQPA 2XDBA 3P8DA 1CKAA 3LX7A 3M59A 2D1XA 5FU6B 2AT1B 1XQHA 1VIFA 2SRCA 4CFXB 2EBPA 3CMAA 4CFMB 3AHUA 2DIGA 3CCLA 2XD0A 2VASA 2LVMA 4G6LB 1RI0A 4MZPA 2J05A 3CCST 4Y91A 3A8LB 1X43A 2CP3A 3MY1B 2QASA 2I40B 5GAN8 4J6WA 1TTHB 2RJFA 1M3CA 2D0NA 1AWXA 2EVRA 2EYWA 2H3EB 1I07A 2NUTB 2P0KA 4HVVA 3O0GD 2IW9B 2FO0A 2M9UA 2NUPB 1MMAA 1QVFP 1YHQA 2JMCA 3OA6A 3QUIA 4ZNXA 5LJ5f 3E2UA 2FRWA 1WFWA 1ZSZA 2KAFA 2KYBA 3MP6A 2F5KA 2AHJB 4JJDA 1B7TA 5GANh 2DVJA 2DL3A 3OYKA 3CXCA 3V8JA 1QVGP 4CFWB 5DLQE 5GAOn 2L3PA 3I55Q 2AIRB 2XG8D 4ZGEB 5C0MA 2W96A 1OIUB 2DL7A 2RK1A 3UA7A 3DL1A 4DBFA 1YN8A 1D0ZA 5I2MA 3D7SB 4AFZC 2JT4A 1KK7A 2K2MA 1K0SA 2GQIA 2GTOA 4BD3A 2HL3A 1P92A 4BDYA 3V7RA 4DBHA 2C6TB 3CCJQ 3JRZA 2VB6A 2RF0A 2YUNA 1KIKA 2RQVA 4HVWA 5CIUA 3LWHA 1K73R 4ATOA 1IGQA 5FWBA 3BG9A 3JCMe 4M78C 1Y7XA 3J7AF 1R0BG 2CSIA 2L5QA 3QWXX 1H3HA 2V1QA 2M0YA 4ZTJA 1BIAA 4HCKA 3VU3C 2E65A 2KGTA 2BZXA 4A4FA 4WF2A 1I0CA 1S72Q 3M0SA 2KE9A 1UGSB 3G4SQ 2QGGA 2X1NB 3M5AA 1HK9A 1BU1A 3PFSA 4MDWA 1OL1B 4NSTB 5CEIB 5EG2A 3EH2A 3TSZA 8ATCB 1TWBA 2EKHA 4GY5A 2DX1A 3PTAA 1YIJQ 4F7UB 2KRMA 2O9SA 1W6XA 2B8AA 4OGCA 5KYWA 4F7UG 1MV3A 2NLUA 2SEMA 3UF4A 4M7DA 4KRCB 4AKIA 1BIBA 5FLXE 3VKHA 1J3TA 3I55A 4M78A 1Y57A 1ZUKA 2PVOB 3TW6A 2QXFA 1X69A 3QSUA 2F1LA 2LDMA 1PWTA 2WSCE 2P84A 1VA7A 3CCJT 1TU0B 1GUXB 4F7NB 4QSHA 4M7DB 5ACBA 2FZGB 2RK2A 3QJ6A 9ATCB 5GAN4 1I5LA 1SRMA 4RTTA 1X6BA 2K3YA 5AYFA 1UGQB 2X4JA 4XTWA 5GAMe 4J7IA 4E7JA 4KH1B 3G33B 2E64A 2DMOA 1FX7A 2EQMA 3CCMT 3TREA 4CC7A 4OB2B 1GUXA 3FJ5A 5CKFA 4ZN3A 2O9VA 4DEYA 5CCAA 3CD6A 1CSKA 2EJ9A 4HT9A 4RTYA 4C0ZA 3RERA 2DKGA 1KFZA 4Z89A 1VQ4Q 3OYEA 3OYBA 3H4CA 2QEXT 2HQXA 2KYMA 3GLXA 3CCRT 1M1GA 2YRDA 5KYWB 2VGNA 2E10A 3N5BB 5HCKA 3U23A 1M4ZA 4OF1A 1WHLA 4AFQC 2C5NB 1YJNT 1OU9A 4OB1B 2CT3A 1VQ7Q 2PHGA 4JRKA 2JJ9A 5M9OA 3EFOB 2E6ZA 5IXFA 4HA8A 3KBGA 2IPOB 4JUVA 5L2WB 1YJWQ 1M27C 3MEUA 2CP5A 2QQ9A 3CQTA 2F2CA 3OYYA 2DXCA 3OQ5A 3RMQA 3OW2P 1H92A 2GQVA 1UHFA 3MP1A 2EJFA 1W2BS 2WXVB 4YC3B 1RLPC 3SDZA 2NWMA 5IHIA 3EFRA 3JCMQ 4J9GA
chains in the Genus database with same CATH topology
2VV5A 5KE2A 4DA4A 4XQ3A 2DEQA 2LT4A 4Q5WA 5FRNA 4N4GA 2CYZB 5GAMj 5KCHA 3JB9D 2A7YA 3ME9A 3GIBA 2QDYB 3PMIA 1DJ7B 2DTIA 2HQEA 4L6V5 1B34A 4HCZA 3JCMf 1VQ5A 2LX9A 2WSEE 5LJ5d 3QPHA 1NPPA 2LRQA 2DVEA 4J5YA 3TCJA 4C8QD 4M7DC 4C8QC 1QVFA 2MWOA 3OSVA 3DB4A 5HKCA 4M6VA 1M1KU 4BBSM 4LOCA 2RH2A 3JCMc 3E1SA 1NJIC 2OTLA 1LNXA 5GANe 1VQ8A 1YITA 3S3OA 3M9QA 3OS0A 3A8HB 2WJ9A 3O8VA 2CZ7B 1VQ6T 2K57A 2RB6A 2L3RA 3OW2S 2O4XB 2CS7A 1VQ8T 4PLIA 3CPWS 4IUTA 1R8OB 1KC8C 5HY6A 1N9RA 3L2ZA 2DXBB 4MMLA 1UGPB 5GAMf 1JJ2S 4KULA 3CC2T 2DD5B 1JJ2A 4M7AF 4O6JA 2EQKA 3TU4K 2RJEA 3RKYA 4BE2A 2QQSA 4M77B 4M75D 3SWNA 3OW2A 3JCMX 4RCCA 4M7AC 2DXCB 3CBOA 3OYGA 4M75B 5DY9A 2E12A 1YJ9T 3HFNA 5GAN5 3QZ5B 2E41A 4XTYA 5LJ3e 3G6ET 4OVAA 3TW7A 3CCVA 5IT9E 2EQUA 1LOJA 4EDUA 4QVCA 4HCCA 1BI0A 1KHCA 3EAEA 4MZTA 4C92E 3FC3A 4XTZA 2X4WA 3M58A 2XI9A 5CK9A 3FB9A 3MP8A 3VUBA 1K9MC 4OB0B 2EAYA 3OMCA 4QQ6A 3QHSA 3V8KA 4R55A 4Z6YA 3OYLA 4DOVA 2IG0A 1UGRB 2V8JA 1PSFA 3JCMh 5GAOq 3VYHB 1QW1A 2K5FA 3M4YA 4HKEA 4C8QE 1WQ7A 3KUFA 4C8QB 4AI6A 3L2UA 2QA4T 1E7PA 4YTLA 3LYIA 2EQJA 3QIIA 4BUGA 5C6SA 4IKFA 4LD6A 1YJWT 4JS4A 2JTFA 1Q7YU 4OMFB 4HNUA 3ZBDA 2ZPIB 3INZA 1FKMA 3QYEA 4C5HA 2QF7A 4BB7A 3L2QA 2E1HA 2P0QA 4NC6A 3P8HA 4AKHA 3FDRA 1XTDA 2PUOB 4KBMB 5I2SA 3KHIA 3S3NA 4C92B 1YBYA 2KQWA 1NZ9A 3BFMA 4QVZA 3X20B 3CC7A 3MEAA 4M7AB 4C0DC 3M4GA 4EMKA 3UDCA 1VQPT 3CMET 2H3JA 4PKCC 4MIMA 4HNVA 4N0AA 3QYBA 4M77F 5J26A 5GAOr 2JN0A 4D6WA 3PT9A 2L89A 3M56A 3EFSA 4M75E 3SFMA 3JB9J 3HPWA 3L1AA 4M75F 4ME7A 4M7DE 2V8IA 4M77E 3PIOA 3CEYA 4EMKB 1SSFA 3VUZA 5GMKh 1I4K1 2HNIA 3CCQT 2JOYA 3L42A 1KQ2A 3JCMg 5GAMd 5FROA 4X34A 3F70A 1K8AU 2DPPB 2KMGA 4HNTA 3ASKA 2L8DA 4A4HA 1S72T 3CCQA 2QQAA 1M1KC 2M1HA 3QWLA 2BS2A 2ZPEB 1I8FA 1QVPA 2FB7A 4Z02A 2RI5A 1U1SA 3RKWA 4BY6B 1Q81C 1N27A 5CKDA 2DZ9A 3URGA 3DLMA 5CQXA 3A8MB 4EMGA 3DKMA 4BDZA 3G71T 2BUDA 4QQDA 4JX4A 1Y96B 3MEWA 3ZFJA 2KMTA 3GNGA 3S6WA 5GANd 4XU1A 4C8QF 1KD1C 2LNVA 3HRUA 2OTJT 2GCXA 2E6NA 4JS5A 3QYGB 3NFCA 3OB9A 5DM7R 2EKOA 2JUFA 1YI2A 3JB9F 3J81E 5LJ5e 3HZJA 1NE8A 4JRQA 1BI3A 2QQBA 2XHCA 4FT2A 1YHQT 1OI1A 4CI0C 4HL4A 4KUDK 3OYNA 4FU6A 4C92F 3OYDA 3OBYA 1YJNA 4HT8A 3X28B 4JLGA 4NS5A 4C5GA 1LJOA 1OZ3A 1U1TA 1ZBXA 3OS5A 1VQ4A 4M75G 1VQOT 1Y07A 2FHDA 3JB9H 4M7AA 4L59A 1VIEA 2ZPBB 4J83A 1WJQA 4XTUA 3CCJA 3SWNC 3JCMJ 1KQSA 2CZ6B 2LTOA 3CCVT 2F5TX 2WACA 4DOWA 1W4SA 3C12A 1VQ4T 3GNFB 1EIFA 4BI3A 3M57A 4GLKA 5D6YA 2GFUA 1M5Q1 4ELZC 2O4XA 2XICA 2PUKB 4M7DD 3E9FA 3RESA 3LH0A 3Q1JA 3OS1A 1VQ6A 1OYXA 2XKOC 5L8RE 3BW1A 2EWNA 1O75A 4IURA 2G3RA 2F69A 2X35A 1W2BA 1G3TA 4LDWA 3SD4A 2RHYA 2VYTA 5LL6S 2RM4A 1AHJB 5FU6C 4N0AC 4C0GA 4M77A 1Q81U 3CCET 4M7AG 2HD0A 4EMKC 2PVGB 4ZGJB 2PVDB 2Y4XA 2ZZDA 4KUIA 1VQ7T 1KC8U 1VQKT 3E19A 4C8QA 5GAN7 3FJPA 3BY7A 3CCMA 2MF2A 1WQWA 2E5QA 5CKBA 2OAUA 4KT0E 3V8LA 3CCRA 1GXIE 5GMKj 2RI2A 3JB9G 2BS3A 5FU7C 1VQNA 3M53A 1Y96A 2IVWA 3RUXA 3OYAA 4JX6A 3OMGA 3MEVA 4CRIA 4PNOA 4MFEA 2R57A 3X25B 3M55A 2ZZDB 4C92G 1YJWA 4PJOD 3QO3A 2RHUA 2ZCFB 3P8DA 1VQPA 2XDBA 3C4SA 3LX7A 4JRPA 3M59A 3KXTA 4M7DG 2QEXA 4BI4A 5FU6B 3QYHB 3OYHA 2RJCA 1XQHA 1VIFA 3GP8A 4RMOA 3CCLT 3VV0A 4XK8E 2GFAA 4BI8B 3FRNA 5J39A 3CMAA 3E9GA 3QBYA 4UC4A 2EFIA 3A5ZB 4TVRA 3JAME 2DIGA 3AHUA 4QVDA 3HFOA 3CCLA 3JCMW 3LWIA 2XD0A 4N4HA 3LGLA 1S72A 2CGHA 2JTMA 2LVMA 2RD1A 1RI0A 3FLGA 4MZPA 5GAN6 3CCST 4Y91A 3A8LB 3BG5A 3HP9A 3HRSA 3X24B 3HL8A 3CBMA 1FWZA 1VQ9T 4LDVA 3HBLA 2RA2A 4C92D 2DK3A 3LW5E 2QTXA 5GAMg 3C95A 2VUBA 4B9XA 2RJDA 2DIQA 3CC7T 2R5AA 4E7HA 1WJRA 2BIVA 1YITT 5FU7B 2RHZA 2DD4B 5GAN8 4M77G 4J6WA 1D3BA 2RJFA 3CMEA 4NOYA 2X4XA 5EJCA 2HBPA 2XK0A 2P0KA 2PU9B 5CR2A 1G3YA 1YI2T 2M9UA 2MI6A 5KH6A 1YHQA 3T9NA 2JZ2A 2XDPA 4V2SA 2K4YA 3H6ZA 3OYCA 1ZHIA 2R58A 3OA6A 3QUIA 5LJ5f 2DZCA 2FYKA 2KAFA 3MP6A 5FRMA 1QVFS 2F5KA 5DLOA 2AHJB 3PIPA 3JCMP 3LGFA 4DQ2A 2YHTA 3J80E 4C0FA 5GANh 3OYKA 1UEBA 2YLBA 5A0GA 1WJSA 4FT4A 5LJ5g 3V8JA 3JCMV 3CXCA 5DLQE 2EJGA 3VYGA 2M16A 5GAOn 1G3WA 2XG8D 4ZGEB 4J6XA 3NTIA 2O01E 5C0MA 4J7FA 3L2RA 2RK1A 3DL1A 4M78B 2V8KA 1K9MU 4C8QG 4Y28E 5GMKm 5LJ3j 3OS2A 2I2LA 3OYIA 3A8OB 2OTLT 4RG2A 5I2MA 4EPCA 1KQSS 4OB3B 2ZPHB 3VKGA 2ZGWA 4M77D 2DXTA 4M77C 4E7KA 4IUUA 1BYMA 1O9SA 4BD3A 4A54A 1P92A 4M75C 5CQYA 3V7RA 3CCUT 5GAN2 4BDYA 3V7SA 1YJ9A 3FIFA 1VQ5T 1I81A 2G77A 4F7UE 4M7AD 1PSEA 4PJOC 3G6EA 1VQMT 1TH7A 4LDUA 1QLBA 2PQWA 1VQNT 1OZ2A 5GANj 3JRZA 2VGMA 3CCUA 1M90C 5GAN3 2LT1A 3QG1A 1VQMA 2XDDA 1Q82C 2KSSA 1X01A 3PMTA 1RL2A 2D9TA 2DAQA 2XU8A 4E7LA 1BKBA 4QW2A 5CIUA 1IZ6A 5IN1A 3M54A 3ER0A 3VYGB 4BY6C 3LWHA 4ATOA 4LDXA 4BBRM 3OBWA 4FIBA 3H8ZA 3BG9A 4M78D 1QP3A 1UB4A 4M78C 3JCMe 1N6AA 1VQLA 5CO7A 3JCMd 1Y7XA 1X75C 4AKGA 3J7AF 2L5QA 3CC4A 1MHNA 1KQ1A 4II1A 3SB2A 4ZTJA 1QVGA 5GAOl 1BIAA 3HKSA 1K8AC 3VU3C 5GANf 1VQ7A 2K5IA 2E65A 2JNGA 3CC4T 2DTOA 1Y71A 2FVUA 4PLLA 4M78F 4JLIA 4WF2A 4IUQA 4A4FA 2RHXA 1U8RA 3CD6T 2KDSA 4PJOF 3CPFA 2DTHA 2XIDA 4XU2A 1UGSB 2WSFE 2GF7A 3OYFA 5LJ5h 4R56A 5GANg 4LD9K 3M5AA 1HK9A 1MGQA 3CXCS 2HAXA 3PFSA 1WNLA 3QJYA 4MDWA 3MHXA 2MAMA 5KE3A 3BG3A 1N8RU 2QDJA 5EG2A 1Q82U 1YIJT 4O5VA 2MWPA 4ELYC 4M7DF 3LLRA 2DD4A 3QKJA 3META 3VJPA 5GMKe 4GY5A 1ZQ1A 4MMKA 1FXXA 3PTAA 4C5EA 4EMHA 3WVEB 4F7UB 5LJ3h 3GF5A 3CMAT 2Y90A 4NL2A 3HHTB 2B8AA 4OGCA 3UWNA 1G3SA 3QZ9B 4B9WA 2K5LA 1YCYA 4F7UG 2CZ0B 4A4KA 3WXMB 1WPYA 4IUPA 5CKHA 4JRIA 2NLUA 2YRVA 3FEOA 4PJOE 4M7DA 1WGSA 4RG8A 4M78E 1VQ9A 2OTJA 4HLQA 3BDLA 1NPRA 5HK0A 3JB9I 4AKIA 2VC8A 1JB0E 1V29B 1D3BB 1X6OA 2RO0A 1BIBA 4FL6A 3RMSA 4A53A 3VKHA 5FLXE 5A2QE 2K3XA 2QI2A 4ELJA 4M78A 4PJOG 4A4EA 4C0DB 5HK3A 3I55A 3S3MA 1YIJA 4E47A 2EYQA 2PVOB 1M1FA 1Q86U 1JBMA 3CC2A 3TW6A 4PJOB 3I55T 4C5IA 2DXUA 2JVVA 2QXFA 3HRTA 3RKXA 3C94A 4PL6A 1VQOA 1BI2A 4P5NA 3I56T 2QQ8A 3QSUA 2LDMA 1N9SA 3V7CA 2WSCE 2VXFA 3CCJT 3HO8A 1QVGS 3DLLA 4XTVA 4E7IA 1VUBA 2DO3A 2MMPA 2R5MA 4N4IA 1K73U 1NJIU 3I56A 4QSHA 4M7DB 5GMKi 2CKKA 3OYMA 1H641 4L5GA 2RK2A 3R6OA 2X4YA 4JJNK 3QJ6A 5GAN4 1I5LA 1IREB 4IUVA 4A4GA 4F7UF 4RKUE 2K3YA 5AYFA 1UGQB 2X4JA 4XTWA 3TEEA 5GAMe 5LJ5j 3JSCA 4J7IA 3CPWA 4E7JA 4M7AE 3CCEA 2QQRA 1H3ZA 2KVQG 1VQLT 2A3LA 1XOVA 2E64A 2P0PA 2VXEA 3OSSC 3PGGA 5GAMh 1VQKA 1QP2A 1FX7A 2C06A 2EQMA 4OP0A 4OGEA 3CCMT 1BI1A 3TREA 2BKDN 3BDUA 3WVDB 5LJ3g 2QA4A 4OB2B 4ZTFA 1Q7YC 2DJZA 4FM4B 2D6FA 5GMKl 3UPUA 2KY9A 5CKFA 4ZN3A 2E70A 3MO8A 2BS4A 4HCBA 5A0DA 3NTKA 2LQ8A 4RCBA 5CCAA 3CD6A 3UT1A 2EJ9A 4HT9A 5I21A 1KD1U 5LJ3f 4C0ZA 5A0LA 3RERA 2LQKA 1K73C 2P4TA 2DXBA 2DKGA 2FL7A 2ZPFB 3CBPA 5D6XA 3GPLA 4XTXA 4LDYA 3OYEA 3OYBA 3H4CA 2QEXT 4NL3A 2HQXA 3GLXA 3OY9A 3CCRT 4MDXA 2D0QB 3JCMb 2CZ1B 5D6WA 5CAIA 3G4SA 3X26B 1M1GA 4ZN1A 5J3BA 2RHIA 4XU0A 1KG1A 1KHIA 2E10A 2VGNA 3N5BB 4X9CA 5LJ3d 2LCLA 3QDRB 2KK4A 2RI3A 3G4ST 2QFZA 1M4ZA 4OF1A 3RIRA 1M8VA 4MFDA 5CKEA 1G5VA 1YJNT 4OB1B 1JRIA 5KCOA 1Q86C 4JRKA 5CVIA 2K2VA 1XNIA 4X9DA 3CCSA 5M9OA 2E6ZA 2LC4A 3P8BB 4J6YA 4HA8A 4ZGDB 4XAXB 5IAYA 2EIFA 4JX5A 2Y4YA 2DD5A 2YLCA 3KBGA 3PNWC 4JUVA 4M78G 4XU3A 3MEUA 2QQ9A 4BE1A 3GOXA 3HB9A 3OYYA 3OYJA 3SWNB 4JDSA 5GAOm 4C92C 3L2VA 4C92A 4BE0A 4PJOA 3VKIA 2DXCA 3OQ5A 3RMQA 3NTHA 3ZEHA 4FSXA 2GQVA 3G7ZA 3G71A 4M75A 3MP1A 2EJFA 5GAOp 1HXDA 1W2BS 4BACA 2ZPGB 2M0OA 2LCCA 3A8GB 1M90U 2KR6A 3MCAB 3SDZA 4QQGA 4MZMA 3L2WA 3HSBA 1B34B 3EFRA 3DB3A 4F7UA 4VUBA 3QXEB 3JCMQ 1N8RC 4J8OA 1M9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8M B;  2CYZ B;  1JB0 E;  1V29 B;  2QDY B;  1DJ7 B;  4L6V 5;  2AHJ B;  2WSE E;  3QYG B;  2PVO B;  3VYG A;  4ZGE B;  2O01 E;  2WSC E;  3A8H B;  3X28 B;  4Y28 E;  2CZ7 B;  3A8O B;  2ZPB B;  4OB3 B;  2ZPH B;  2CZ6 B;  2DXB B;  1UGP B;  2DD5 B;  1IRE B;  4RKU E;  1UGQ B;  1PSE A;  2PUK B;  2DXC B;  5L8R E;  1QP2 A;  3QZ5 B;  1AHJ B;  3WVD B;  4OB2 B;  2ZZD A;  2PVD B;  4FM4 B;  4ZGJ B;  2PVG B;  3VYG B;  1GXI E;  4KT0 E;  4OB0 B;  1QP3 A;  2DXB A;  2ZPF B;  1UGR B;  3X25 B;  2ZZD B;  1PSF A;  3VYH B;  2D0Q B;  2ZCF B;  2CZ1 B;  3X26 B;  3QYH B;  2ZPI B;  1UGS B;  2WSF E;  4XK8 E;  2PUO B;  4OB1 B;  3X20 B;  4ZGD B;  2DD5 A;  2DD4 A;  3A8L B;  3X24 B;  3WVE B;  2DXC A;  3LW5 E;  3HHT B;  3QZ9 B;  2ZPG B;  2CZ0 B;  2DD4 B;  2DPP B;  3A8G B;  2ZPE B;  2PU9 B;  3QXE B; 
#chains in the Genus database with same CATH topology
 4DA4 A;  1SHF A;  4EOM B;  2E5K A;  5FRN A;  4Q5W A;  5KCH A;  1DJ7 B;  1GBQ A;  1SPK A;  2DE0 X;  1VQ5 A;  3TCJ A;  1B07 A;  4M7D C;  2OI3 A;  3DB4 A;  5HKC A;  1M1K U;  2A36 A;  3EH1 A;  2W10 A;  3M9Q A;  1T3L A;  3G71 Q;  2WJ9 A;  4Z8A A;  2EGE A;  1VYT A;  4F04 B;  3L2Z A;  3CCV Q;  4O6J A;  3TU4 K;  4ROC A;  2QQS A;  3SWN A;  4J9B A;  1YJ9 T;  1WHG A;  3HFN A;  5GAN 5;  4XTY A;  1VQ5 Q;  1NLO C;  3CCV A;  2EQU A;  4E7Z A;  4HCC A;  3EAE A;  1Q7Y R;  4RTV A;  1JXO A;  4XTZ A;  5CK9 A;  2ABL A;  3OMC A;  3QHS A;  1PC0 A;  1O9K A;  5DQV A;  2F2V A;  2BKZ B;  5GAO q;  2YSQ A;  4AT1 B;  1WQ7 A;  2NUZ A;  3L2U A;  3LH5 A;  1E7P A;  4BUG A;  1MNE A;  4IKF A;  1YJW T;  2FEI A;  4OMF B;  3ZBD A;  1D0X A;  3INZ A;  1NLP C;  2VVK A;  4RTX A;  1ABO A;  3L2Q A;  3EG1 A;  2E1H A;  3P8H A;  1YIJ A;  2DL8 A;  2A28 A;  1YJW A;  4KBM B;  5I2S A;  4BCM D;  4KH0 B;  4C92 B;  1YBY A;  3CC7 A;  4CFN B;  3UDC A;  4HNV A;  4ORZ A;  4M77 F;  2MIO A;  4BCH B;  3CCQ Q;  4D6W A;  3PT9 A;  3JB9 J;  3L1A A;  4ME7 A;  3CEY A;  4EMK B;  5HNB B;  2LQN A;  1KQ2 A;  4AG2 C;  3GBQ A;  3MY5 B;  2LNH B;  4PK4 A;  2M1H A;  5HBE B;  2V26 A;  2WMA B;  2DBK A;  3BE3 A;  1C6V X;  3G1J A;  1WZO A;  4BCN D;  3G71 T;  2BUD A;  1Y96 B;  3S6W A;  3GNG A;  4C8Q F;  2WIP B;  1ZA1 B;  2OTJ T;  4JS5 A;  1K4U S;  2JUF A;  3JB9 F;  4CFU D;  4DBR A;  2XHC A;  2C0T A;  4M4Z A;  3X28 B;  4FYX B;  4NS5 A;  5EFQ B;  1LJO A;  1OZ3 A;  1U1T A;  1WX6 A;  3OS5 A;  1VQO T;  4M75 G;  3JB9 H;  1Y07 A;  1ENW A;  1VIE A;  2ZPB B;  1VQ5 T;  3IQL A;  3JCM J;  3SWN C;  1KQS A;  2QTV A;  2UUE B;  4FYV B;  4LUE A;  2GFU A;  1M5Q 1;  3VS3 A;  2O4X A;  5FWC A;  1RI9 A;  4M7D D;  4WCI A;  3RNJ A;  2AZV A;  2DNU A;  2C5O B;  5L8R E;  2EWN A;  2G9X B;  1O75 A;  2X35 A;  1N8R R;  4M77 A;  4CFU B;  2HD0 A;  4EMK C;  2PVD B;  4ZGJ B;  2Y4X A;  1VQ7 T;  3BY7 A;  4A63 B;  3V8L A;  1H28 B;  3TNW B;  1Z9Z A;  3VS4 A;  2ROL A;  1X27 A;  4JX6 A;  3X25 B;  2ZZD B;  1NYG A;  3QO3 A;  3H9N A;  2MOX A;  2VKN A;  1H1R B;  4M7D G;  4OMN A;  3OYH A;  3QYH B;  2DBM A;  2RJC A;  4D8D A;  3MKD A;  3M0P A;  3FRN A;  4K11 A;  3REA B;  3E9G A;  2EFI A;  3JCM W;  3LWI A;  3LGL A;  2JTM A;  3FLG A;  2UZE B;  3X24 B;  3HRS A;  3HL8 A;  1A0N B;  2QTX A;  2VUB A;  4CC4 B;  3TNI B;  2DIQ A;  4E7H A;  2BIV A;  2DD4 B;  4M77 G;  4BCG B;  2O88 A;  4J9F A;  2X4X A;  3BHT B;  2JW4 A;  2UZB B;  1G3Y A;  2J6O A;  2MI6 A;  3T9N A;  3H6Z A;  3OYC A;  1HJD A;  1MMN A;  2DZC A;  3VS5 A;  1VQO Q;  2FYK A;  4Y72 B;  4BY1 X;  2WPA B;  5GJW B;  2C0O A;  2W2H A;  2EGC A;  4DQ2 A;  3VS1 A;  3J80 E;  1UNL D;  2YLB A;  5LJ5 g;  4FT4 A;  3O5Z A;  3VYG A;  2M16 A;  3NTI A;  2DL4 A;  3TNH B;  4EC8 B;  5IXB A;  4C8Q G;  4QKU A;  5GMK m;  2I2L A;  3A8O B;  4RG2 A;  1KQS S;  1FIN B;  4ELL A;  2DXT A;  4M77 C;  4E7K A;  4HXJ A;  1N5Z A;  4M75 C;  5CQY A;  4M7A D;  4F7U E;  4PJO C;  1VQM T;  4LDU A;  1OZ2 A;  5GAN j;  1RAG B;  2BE7 D;  3QG1 A;  1VQM A;  3M0T A;  2XDD A;  1HSQ A;  1AD5 A;  1X01 A;  3PMT A;  2D9T A;  2X3W D;  1G83 A;  3M54 A;  2PTK A;  4EOS B;  4BBR M;  1UB4 A;  1FVV B;  1OX8 A;  2BPM B;  4AKG A;  1TXQ A;  4BCO B;  2JM9 A;  2MYS A;  1IXD A;  3M0Q A;  5IH2 A;  2MPX C;  5GAN f;  1VQ7 A;  1SRL A;  1Y71 A;  4IUQ A;  1U8R A;  3CPF A;  2XID A;  2WSF E;  3OYF A;  5LJ5 h;  4R56 A;  4F6W B;  2HAX A;  1YJN Q;  1WNL A;  3BG3 A;  4CRL B;  2QDJ A;  2MWP A;  3LLR A;  3CMA Q;  1I5O B;  3QKJ A;  3VJP A;  4QT7 A;  3WVE B;  3GF5 A;  4AFS C;  1RAE B;  1NEB A;  2Y90 A;  3CC7 Q;  3HHT B;  3QZ9 B;  1D1A A;  2K5L A;  4A4K A;  1ZSZ B;  3WXM B;  4IUP A;  2EYY A;  1WYX A;  1YFN A;  2RNA A;  2FPD A;  1WGS A;  2IVX A;  4HLQ A;  3BDL A;  1NPR A;  2DL5 A;  1NM7 A;  1JB0 E;  1X6O A;  2E4H A;  2RO0 A;  4A53 A;  3OYG A;  2QI2 A;  2GNC A;  4PJO G;  4A4E A;  4C0D B;  5HK3 A;  5I22 A;  2KXC A;  1SF9 A;  4PJO B;  2ED0 A;  4C5I A;  2DXU A;  4PL6 A;  3I56 T;  1N9S A;  3EG3 A;  1QVG S;  4E7I A;  1PNJ A;  1EX4 A;  4FW2 A;  1RLQ C;  3R6O A;  1AT1 B;  2E3I A;  2J06 A;  4IUV A;  4FCY A;  3CCU Q;  3TEE A;  1ZLM A;  5LJ5 j;  2LJ1 A;  2DFU A;  3CCE A;  4AMC A;  3PGG A;  3OSS C;  2VXE A;  1OPL A;  2DYI A;  1YJ9 Q;  5LJ3 g;  2QA4 A;  3TQ7 P;  2DJZ A;  2QYZ A;  4FM4 B;  4HCB A;  4JPB W;  3NTK A;  2LQ8 A;  4RCB A;  1G2B A;  3SHW A;  1VOL A;  5LJ3 f;  1K73 C;  2P4T A;  3CBP A;  2I0N A;  3GPL A;  4YOS A;  4I3Z B;  4NL3 A;  5D6W A;  1AIS B;  3X26 B;  2C5X B;  2RHI A;  1KG1 A;  4J9D A;  1KHI A;  4X9C A;  1ZUU A;  5DQW A;  3QDR B;  3ZL7 C;  3I35 A;  4EC9 B;  4MFD A;  1W2B P;  1GRI A;  5CKE A;  1JRI A;  5KCO A;  2GBQ A;  2K2V A;  1XNI A;  1NJI R;  2LJ0 A;  2ATC B;  4J6Y A;  2I53 A;  4XAX B;  1WHK A;  2DF6 A;  4XU3 A;  4BCJ B;  2C4G B;  2EPD A;  2ECZ A;  4JDS A;  5GAO m;  4PJO A;  3ZEH A;  3NTH A;  4FSX A;  4M75 A;  3DOG B;  1JO8 A;  4BAC A;  2ZPG B;  3MCA B;  3AT1 B;  4F6U B;  2HSE B;  2AZS A;  4QQG A;  3HSB A;  3DB3 A;  2J6F A;  4VUB A;  1M1K R;  2KRN A;  4J8O A;  2DME A;  2DEQ A;  2FRY A;  2CYZ B;  3JB9 D;  2PMI B;  2QDY B;  2DTI A;  4HCZ A;  2LX9 A;  5LJ5 d;  2JXB A;  3QPH A;  4J5Y A;  1WXU A;  3VS0 A;  4C8Q C;  1E6H A;  2MWO A;  3OSV A;  1ZSZ C;  1YNZ A;  1NJI C;  5IHK A;  3OS0 A;  1QQJ A;  1YCS B;  3O8V A;  2CZ7 B;  1VQ6 T;  2K57 A;  2O4X B;  1E7O A;  1V76 A;  3CPW S;  1N9R A;  5GAM f;  3CC2 T;  1UGP B;  3QWY A;  2DD5 B;  3RKY A;  1MMG A;  2COW A;  1M8M A;  4M77 B;  2UZL B;  4M7A C;  4FYY B;  4JZ3 A;  1PRM C;  2E12 A;  4F16 A;  1BK2 A;  3DDQ B;  3G6E T;  5HVY B;  3PVL A;  3TW7 A;  4EOJ B;  4QVC A;  1BI0 A;  4MZT A;  2X4W A;  1ACM B;  2XI9 A;  3M58 A;  3FB9 A;  2KXD A;  1V1C A;  2EAY A;  1OOT A;  4Z6Y A;  4ROE A;  3OYL A;  4DOV A;  1BBZ A;  4ANJ A;  3JCM h;  4KRD B;  3VYH B;  1QW1 A;  3M4Y A;  4PFZ A;  4C8Q E;  2QA4 T;  3KUF A;  4JJC A;  4AI6 A;  4C8Q B;  1NJI U;  3LYI A;  4YOZ A;  4LD6 A;  2JTF A;  2CRE A;  3C0C A;  3POM A;  2HSP A;  2LW4 A;  2QF7 A;  4RTZ A;  2PUO B;  2HZY A;  2MCN A;  2CUB A;  1QMC A;  3MEA A;  4M7A B;  3M4G A;  4EMK A;  2LP5 A;  3QYB A;  3EGD B;  3BLQ B;  4M75 E;  3CCS Q;  1D0Y A;  2K3B A;  3M0U A;  3HPW A;  4M75 F;  2X9H A;  1OU8 A;  1UTI A;  4M7D E;  2V8I A;  4M77 E;  3PIO A;  1ZSG A;  3CCL Q;  1SSF A;  3CCQ T;  2HNI A;  1MND A;  5FRO A;  3F70 A;  2KMG A;  3CCQ A;  3QWL A;  1QVP A;  2RI5 A;  1U1S A;  5CKD A;  1KD1 R;  3URG A;  4BDZ A;  4QQD A;  2FPE A;  5GAN d;  3HRU A;  1FMV A;  3CPW P;  5EC7 A;  3QYG B;  3NFC A;  2CDT A;  1OUL A;  5HBJ B;  1NE8 A;  5LJ5 e;  4JRQ A;  3CCM Q;  1OI1 A;  2KBT A;  4FW1 A;  4HL4 A;  4CI0 C;  4KUD K;  4FU6 A;  4JLG A;  1M3A A;  1ZBX A;  1VQ4 A;  4EOK B;  4F7S B;  4XTU A;  3G6E Q;  3CCJ A;  3UA6 A;  4OMO A;  2F5T X;  2WAC A;  4DOW A;  3C12 A;  1VQ4 T;  2XMF A;  1JKW A;  3MIA B;  3E9F A;  3Q1J A;  1VQ6 A;  1UUE A;  4C0G A;  1Q81 U;  1GCP A;  2PVG B;  2ZZD A;  3EID B;  1K9A A;  2LQW A;  1WQW A;  1QCF A;  5CKB A;  2BS3 A;  3OYA A;  2IVW A;  4OGR B;  1IRX A;  4PNO A;  2YUO A;  4C92 G;  1NYF A;  2RHU A;  2ZCF B;  2DIL A;  4JRP A;  1QLY A;  2YDL A;  3KXT A;  2QEX A;  1VQL Q;  4BI4 A;  1K8A R;  3I5R A;  2O2O A;  4RMO A;  3CCL T;  3VV0 A;  5J39 A;  1JST B;  3F5X B;  3A5Z B;  4EOO B;  1UHC A;  3BLH B;  1S72 A;  2CGH A;  2JMA A;  1H27 B;  2ROT A;  3CBM A;  4LDV A;  4GBQ A;  5IDN B;  3LW5 E;  3C95 A;  1BCO A;  5FU7 B;  2RHZ A;  2R7G A;  4HVU A;  2EGA A;  3QHR B;  4NOY A;  2XK0 A;  2PU9 B;  3K7A M;  2FZK B;  2W9Z A;  2XDP A;  1WDX A;  3VRZ A;  2WFY B;  1QVF S;  2L0A A;  1TD6 A;  3JCM P;  2YHT A;  4C0F A;  2K9G A;  3PVQ A;  5A0G A;  3TVT A;  3JCM V;  2EJG A;  1YHQ Q;  1G3W A;  4J6X A;  2O01 E;  2YRC A;  1JEG A;  4J7F A;  2AKL A;  3L2R A;  1Q82 R;  1F5Q B;  1CKB A;  4OML A;  4Y28 E;  1W70 A;  1RAB B;  1M2V A;  2OX7 A;  2OTL T;  4EPC A;  4EOL B;  2ZPH B;  2ZGW A;  4M77 D;  1JU5 C;  1PD0 A;  1KJW A;  1H8K A;  3EFO A;  3DTO A;  3M0R A;  3H0F A;  1PG5 B;  1O9S A;  2AK5 A;  1K0X A;  4A54 A;  3CCU T;  5GAN 2;  3V7S A;  3FIF A;  1I81 A;  3G6E A;  1TH7 A;  1QLB A;  1T3S A;  2PQW A;  1VQN T;  4EOQ B;  2VGM A;  3CCU A;  1M90 C;  5GAN 3;  2LT1 A;  4Y92 A;  1RAF B;  2KSS A;  2VWF A;  2KRO A;  1RL2 A;  2DAQ A;  3VS7 A;  4E7L A;  2IW8 B;  1BKB A;  4QW2 A;  5IN1 A;  1OGU B;  4BY6 C;  3ER0 A;  3VYG B;  1QCO A;  1OQK A;  2KI7 A;  4FYW B;  1VQ8 Q;  3OBW A;  3TN8 B;  2CP7 A;  1JQQ A;  1Q86 R;  1X75 C;  3DDP B;  3CC4 A;  2GTJ A;  5LMK B;  3CD6 Q;  4II1 A;  5GAO l;  3HKS A;  1AWW A;  2J7I A;  2K5I A;  2JNG A;  3CC4 T;  2DTO A;  2WIH B;  2HKQ B;  4JLI A;  4M78 F;  2RHX A;  2KDS A;  4PJO F;  4B6M A;  1VQ9 Q;  4CC3 A;  5IHN A;  5GAN g;  1SG5 A;  1SEM A;  1H25 B;  3I9Q A;  3CXC S;  3QJY A;  3MHX A;  2MAM A;  1D1C A;  3PE0 A;  1Q82 U;  1YIJ T;  4M7D F;  1AZG B;  2DD4 A;  3MET A;  5GMK e;  1OL2 B;  2W9F A;  4WTO B;  1ZQ1 A;  4MMK A;  1U5S A;  5CYI B;  4EMH A;  1PRL C;  5HBH B;  1QMZ B;  1VOM A;  3CMA T;  4NL2 A;  3UWN A;  4B9W A;  5LQF B;  1YCY A;  3A98 A;  2CZ0 B;  5FGK B;  2LJ3 A;  2YRV A;  3MPU B;  4RG8 A;  4M78 E;  3JB9 I;  2CUD A;  1V29 B;  1D3B B;  3RMS A;  4J9C A;  1R0C B;  2OTL Q;  3S3M A;  4ELJ A;  1Q95 G;  1HYO A;  1I1J A;  4OMP A;  3I55 T;  2JS2 A;  3RKX A;  1BI2 A;  4PFO A;  2EYZ A;  3V7C A;  5IHY A;  2CH4 W;  1VQN Q;  3DLL A;  1VUB A;  1WIE A;  2DO3 A;  2MMP A;  5GMK i;  2CKK A;  1M30 A;  2DYB A;  3OYM A;  1H64 1;  1TG0 A;  4RTU A;  5I5Z B;  2X4Y A;  1H1S B;  4A4G A;  4F7U F;  4F6S B;  4RKU E;  4IIO A;  3JSC A;  1VIN A;  2YXY A;  4M7A E;  2QQR A;  2KVQ G;  1VQL T;  1XOV A;  4BCQ B;  2P0P A;  1VQK A;  4DEX A;  3WVD B;  1IO6 A;  3NPF A;  3UPU A;  2KY9 A;  4EIK A;  2BS4 A;  1TFB A;  5A0D A;  3UT1 A;  1D1B A;  5A0L A;  2LQK A;  5L23 A;  2DXB A;  2ZPF B;  5D6X A;  2P4R A;  4LDY A;  4XTX A;  4MDX A;  1FMK A;  4BCP B;  3JCM b;  2CZ1 B;  3G4S A;  4LN2 A;  5LJ3 d;  2LCL A;  2CP2 A;  8AT1 B;  3CCR Q;  1UG1 A;  5KYU B;  2GGR A;  3G4S T;  2QFZ A;  4OMQ A;  4OR5 B;  1MUZ A;  3CCE Q;  1ZUY A;  4X9D A;  2A08 A;  5CVI A;  6AT1 B;  3CCS A;  1GL5 A;  2G6F X;  2LC4 A;  1UDL A;  3P8B B;  5IAY A;  2Y4Y A;  2YLC A;  4M78 G;  4DBQ A;  1PHT A;  1FYN A;  4BE1 A;  3CXC P;  3SWN B;  4PJJ A;  5KYX A;  4C92 C;  4BY7 X;  2M51 A;  4F14 A;  1GCQ C;  1ZP2 A;  3G71 A;  3G7Z A;  3EJ1 B;  5GAO p;  1AWJ A;  1HXD A;  2M0O A;  2LCC A;  4LE9 A;  1M90 U;  3M03 A;  2DRK A;  3L2W A;  2K79 A;  1N8R C;  1QKX A;  1M9S A;  2VV5 A;  2LT4 A;  2HDA A;  4N4G A;  1QCN A;  2A7Y A;  3PMI A;  2HQE A;  1B34 A;  4CXA B;  3JCM f;  4E6R A;  4C8Q D;  2DVE A;  1PCX A;  4YOO A;  4M6V A;  4PJM A;  4BBS M;  4LOC A;  2RH2 A;  4F70 B;  2OTL A;  1OI9 B;  1VQ8 A;  1YIT A;  3EG9 A;  4Z88 A;  3SEM A;  3A8H B;  1U3O A;  3OW2 S;  1VQ8 T;  1OKV B;  1AEY A;  1R8O B;  4MML A;  2DXB B;  2JS0 A;  3RR6 A;  1JJ2 A;  4M7A F;  1AD6 A;  2RJE A;  4BE2 A;  2JTE A;  4M75 D;  3JCM X;  4RCC A;  3H0H A;  2DXC B;  4E2F B;  5DY9 A;  1WXT A;  2E41 A;  1D09 B;  4OVA A;  4JZ4 A;  1TUD A;  5IT9 E;  1M2O A;  4EDU A;  3EGX A;  4C92 E;  3FC3 A;  1PD1 A;  1X6G A;  2OJ2 A;  2CSQ A;  3MP8 A;  1K9M C;  4OB0 B;  1G8X A;  2RPN A;  2IG0 A;  1IHW A;  1PSF A;  2ENM A;  4YTL A;  5C6S A;  3QII A;  4LUD A;  1Q7Y U;  3EG2 A;  7AT1 B;  4FSS A;  1UNH D;  2DM1 A;  2F2W A;  1Q81 R;  2P0Q A;  1XO2 A;  1H24 B;  2CH4 A;  3KHI A;  2DJQ A;  1SHG A;  1NZ9 A;  1QKW A;  3BFM A;  3X20 B;  4RTW A;  1VQP T;  2H3J A;  4N0A A;  5J26 A;  2WEV B;  2L89 A;  3M56 A;  3EFS A;  3RGF B;  4PFP A;  4BXX X;  1YJN A;  1AZE A;  1I4K 1;  2JOY A;  2YWW A;  3JCM g;  3I56 Q;  2LZ6 B;  4X34 A;  1K8A U;  2DPP B;  1M1K C;  3ASK A;  1S72 T;  2QQA A;  4J9I A;  3PIP A;  2BS2 A;  1I8F A;  4Z02 A;  5CAI A;  1QVF A;  3RKW A;  1N27 A;  2DZ9 A;  2CP0 A;  1P5E B;  5AT1 B;  2KEA A;  3DLM A;  3A8M B;  1B3Q A;  3DKM A;  4X1V A;  3MEW A;  3ZFJ A;  2KMT A;  4XU1 A;  2NUT A;  5I11 A;  3OB9 A;  5DM7 R;  1VYV A;  3QDF A;  1G3N C;  1UJY A;  3J81 E;  2EUF A;  3HZJ A;  1BI3 A;  4FT2 A;  1YHQ T;  2OTJ Q;  3EHR A;  2WMB B;  1LCK A;  4C5G A;  1TUG B;  2FHD A;  4L59 A;  1WJQ A;  2CZ6 B;  2LTO A;  1OEB A;  1YIT Q;  3GNF B;  4BI3 A;  3M57 A;  4GLK A;  3R6N A;  5D6Y A;  2PUK B;  3RES A;  4ROD A;  3LH0 A;  3GTM S;  1OYX A;  2XKO C;  3BW1 A;  1E9H B;  2G3R A;  2F69 A;  1G3T A;  4LDW A;  3SD4 A;  2RHY A;  5LL6 S;  5FU6 C;  3CCE T;  4F7L B;  2HMA A;  3VRY A;  4LXC A;  4AFU C;  1WHH A;  2BE9 B;  3E19 A;  4C8Q A;  5GAN 7;  4JJB A;  2MF2 A;  2OAU A;  1ZBJ A;  3CCR A;  2CT4 A;  1RUW A;  1VQN A;  2RQU A;  1Y96 A;  2FG0 A;  3OMG A;  3MEV A;  4CRI A;  4MFE A;  4IIM A;  4PJO D;  1C0M A;  2DLP A;  3CME Q;  1S1N A;  3C4S A;  2DEU A;  2C0I A;  2K7A A;  3CC4 Q;  2DA9 A;  1K1Z A;  3GP8 A;  4PJN A;  1WXB A;  4XK8 E;  2GFA A;  4BI8 B;  1QWE A;  2ZAE A;  1PKD B;  1OX9 A;  3QBY A;  4UC4 A;  3JAM E;  4TVR A;  1FMW A;  4QVD A;  3HFO A;  4N4H A;  2RD1 A;  5GAN 6;  2DER A;  3BHU B;  3BG5 A;  3HP9 A;  2HCK A;  2H8H A;  2J6K A;  1VQ9 T;  1FWZ A;  1TS9 A;  3HBL A;  2RA2 A;  4BCM B;  2DK3 A;  4C92 D;  5GAM g;  1M90 R;  4B9X A;  1H1Q B;  1RAH B;  1MMD A;  1H4L D;  2RJD A;  3CC7 T;  2R5A A;  4OMM A;  1WJR A;  3LQ5 B;  2WHB B;  1D3B A;  4AG1 C;  5EJC A;  2HBP A;  1YI2 T;  5CR2 A;  1ZA2 B;  1GBR A;  5KYN A;  4V2S A;  5KH6 A;  2JZ2 A;  1HD3 A;  2K4Y A;  3CC2 Q;  1ZHI A;  2R58 A;  1O9K B;  5FRM A;  2PJQ A;  5DLO A;  3LGF A;  2NUP A;  3TSW A;  1YIT T;  1UEB A;  1WJS A;  3THK A;  1VYW B;  1TUC A;  1W1F A;  1TSF A;  4PJL A;  4M78 B;  2V8K A;  1K9M U;  2QGS A;  5LJ3 j;  3OS2 A;  3OYI A;  2CJM B;  4BCF B;  1EZZ B;  1PKS A;  4OB3 B;  3VKG A;  3PO3 S;  3RBB B;  4IUU A;  1VQM Q;  3VS2 A;  1VQK Q;  5FW9 A;  1YJ9 A;  1JOW A;  1RAI B;  4RUG A;  2G77 A;  1PSE A;  2V1R A;  2HL5 C;  2CP6 A;  3RDV A;  2BTT A;  4TTH A;  1GFC A;  1LPL A;  1Q82 C;  2E3H A;  2XU8 A;  1WHJ A;  1BB9 A;  1IZ6 A;  1VQP Q;  4LDX A;  1SKU B;  4FIB A;  4M78 D;  3H8Z A;  2ESW A;  1QP3 A;  3UAT A;  1N6A A;  1VQL A;  5CO7 A;  3JCM d;  5KYU A;  5BNJ B;  4EOI B;  1MHN A;  1KQ1 A;  3SB2 A;  1KXU A;  1QVG A;  1K8A C;  2FVU A;  4ESR A;  4PLL A;  1Q86 U;  3CD6 T;  2B9R A;  2DTH A;  3EHQ A;  4XU2 A;  2GF7 A;  3REB B;  1JSU B;  4LD9 K;  2CCH B;  1MGQ A;  1PM3 A;  3ULR B;  5KE3 A;  1N8R U;  4UN0 A;  4O5V A;  4ELY C;  2X51 A;  5IF1 B;  1MV0 B;  2FPF A;  1FXX A;  4C5E A;  5LJ3 h;  1WHM A;  1VYU A;  2EYX A;  1G3S A;  5KYY A;  1WPY A;  2EQI A;  5CKH A;  4JRI A;  4CFV B;  1TOV A;  3FEO A;  4PJO E;  1UFF A;  1XJW B;  4F17 A;  1VQ9 A;  3QHW B;  2OTJ A;  5HK0 A;  2A0F B;  1X2Q A;  2VC8 A;  4FL6 A;  5A2Q E;  2K3X A;  1SSH A;  1UGV A;  4E47 A;  2EYQ A;  1KC8 R;  1M1F A;  3CC2 A;  1JBM A;  2JVV A;  3HRT A;  3C94 A;  1VQO A;  4P5N A;  2LX7 A;  2QQ8 A;  4BCN B;  2ED1 A;  2COY A;  1Y0M A;  2VXF A;  3HO8 A;  4BCQ D;  2LMJ A;  4XTV A;  1C1A A;  1GY3 B;  2R5M A;  4N4I A;  1K73 U;  3I56 A;  2C5V B;  4L5G A;  1NG2 A;  3KFV A;  4JJN K;  2KNB B;  4E7S A;  1IRE B;  2K6D A;  2L3S A;  1IB8 A;  3CPW A;  1H3Z A;  4LNP A;  1URC B;  2A3L A;  4II5 B;  5GAM h;  1QP2 A;  2C06 A;  1BCM A;  4OP0 A;  4OGE A;  3JV3 A;  1BI1 A;  1GFD A;  2HEQ A;  2BKD N;  3BDU A;  1Q7Y C;  4ZTF A;  2D6F A;  3NHN A;  5GMK l;  3B57 A;  2E70 A;  3MO8 A;  2PK9 B;  2QEX Q;  2RQW A;  1UNG D;  2HBW A;  5I21 A;  1KD1 U;  2CCI B;  2FL7 A;  3BLR B;  1UEC A;  4FX3 B;  2KR3 A;  3OY9 A;  1BU2 A;  2D0Q B;  1E6G A;  1NEG A;  4J9H A;  4ZN1 A;  5J3B A;  3I5S A;  4XU0 A;  2W0Z A;  5KYY B;  2W99 A;  2HKN A;  1R77 A;  2KK4 A;  2JGZ B;  2RI3 A;  2KT1 A;  3RIR A;  1M8V A;  3NMZ C;  5D7U A;  3DJB A;  1G5V A;  1AOJ A;  2DET A;  5KYX B;  2BZY A;  2IN3 A;  4ZGD B;  1EFN A;  2B86 A;  2EIF A;  4JX5 A;  2DD5 A;  3PNW C;  1ABQ A;  2QK0 A;  2YUQ A;  2RN8 A;  1JJ2 P;  3GOX A;  3HB9 A;  3OYJ A;  1GCQ A;  1WI7 A;  4BCK B;  2A37 A;  3L2V A;  4BE0 A;  4C92 A;  2QDL A;  3VKI A;  2MK5 A;  2BZ8 A;  4R0K A;  5IDP B;  1ARK A;  3A8G B;  2IW6 B;  2KR6 A;  1W98 B;  4MZM A;  1H26 B;  1AWO A;  1B34 B;  4F7U A;  3QXE B;  1X2K A;  1K9M R;  1QWF A;  4BCI B;  5KE2 A;  4XQ3 A;  5GAM j;  3ME9 A;  3GIB A;  4L6V 5;  2WSE E;  5HQ0 B;  3HTR A;  1NPP A;  2LRQ A;  1KSW A;  1YWO A;  3NDQ A;  1IGU A;  1LVK A;  2QG9 B;  3JCM c;  3E1S A;  1LNX A;  5GAN e;  2NYS A;  3S3O A;  1OKW B;  1H1P B;  2L2P A;  3MI9 B;  2RB6 A;  1KQS P;  2L3R A;  2CS7 A;  4PLI A;  4IUT A;  2UZD B;  1KC8 C;  5HY6 A;  1JJ2 S;  4KUL A;  1VQ6 Q;  2QGF B;  2EQK A;  1N4M A;  1D3U B;  2QAZ A;  1RAA B;  2DRM A;  1T0J A;  3OW2 A;  3MJX A;  1JXM A;  3EGX B;  2JM8 A;  1OV3 A;  3CBO A;  4M75 B;  2O31 A;  3EGU A;  3QZ5 B;  2YT6 A;  5LJ3 e;  4F7J B;  1LOJ A;  1KHC A;  3A1P A;  3VUB A;  2QA4 Q;  4QQ6 A;  3V8K A;  4R55 A;  3EG9 B;  4EON B;  1C9B A;  1UGR B;  2IIM A;  1T0H A;  2V8J A;  2PK2 A;  4KGX B;  2K5F A;  1UJ0 A;  4HKE A;  1RAD B;  2EQJ A;  4JS4 A;  4HNU A;  2ZPI B;  4EOR B;  1FKM A;  4KGV B;  3QYE A;  3EOC B;  4C5H A;  4BB7 A;  3CME A;  4KGZ B;  2PZ1 A;  4NC6 A;  4AKH A;  3FDR A;  1XTD A;  3S3N A;  2RQT A;  2KQW A;  4QVZ A;  2V22 B;  4C0D C;  1M2V B;  4J9E A;  2RMO A;  3CME T;  4PKC C;  4MIM A;  1U06 A;  2PNI A;  5GAO r;  2AKK A;  2JN0 A;  2D8H A;  3SFM A;  1UE9 A;  1K76 A;  1Z9Q A;  4IMY B;  3VUZ A;  5GMK h;  3L42 A;  3VS6 A;  1WLP B;  5GAM d;  2LCS A;  4HNT A;  2L8D A;  4A4H A;  2OAW A;  2D8J A;  4EOP B;  1Q86 C;  2ZPE B;  2FB7 A;  2KRS A;  1Q81 C;  4BY6 B;  1YI2 Q;  2EW3 A;  3H41 A;  2RQR A;  5CQX A;  4EMG A;  3EG0 A;  2COZ A;  4JX4 A;  4GLM A;  5GJV B;  2YUP A;  1KD1 C;  1PKT A;  2LNV A;  1OPK A;  2GCX A;  2E6N A;  2X3X D;  2L3Q A;  2EKO A;  1OIY B;  1YI2 A;  2F2X A;  4D8K A;  2QQB A;  1AVZ C;  3OYN A;  3OYD A;  4C92 F;  3OBY A;  4HT8 A;  1NBE B;  1YP5 A;  4CC2 A;  3NGP A;  4M7A A;  4J83 A;  3CCV T;  1ZX6 A;  1IHV A;  3EGD A;  1W4S A;  1EIF A;  4ELZ C;  2XIC A;  3H0I A;  2Z0W A;  3OS1 A;  2HQH A;  2FZC B;  2KT8 A;  4IUR A;  1W2B A;  2VYT A;  2RM4 A;  1AHJ B;  1F1B B;  1GH6 B;  4KRT A;  4N0A C;  1RAC B;  4M7A G;  1VQK T;  4KUI A;  1BYM A;  1KC8 U;  3FJP A;  3CCM A;  5ECA A;  2M02 A;  1M3B A;  2E5Q A;  1GXI E;  4KT0 E;  5GMK j;  2RI2 A;  3JB9 G;  1WA7 A;  5FU7 C;  3M53 A;  3RUX A;  3BHV B;  5ICP B;  2R57 A;  3M55 A;  1YWP A;  1VQP A;  2XDB A;  3P8D A;  1CKA A;  3LX7 A;  3M59 A;  2D1X A;  5FU6 B;  2AT1 B;  1XQH A;  1VIF A;  2SRC A;  4CFX B;  2EBP A;  3CMA A;  4CFM B;  3AHU A;  2DIG A;  3CCL A;  2XD0 A;  2VAS A;  2LVM A;  4G6L B;  1RI0 A;  4MZP A;  2J05 A;  3CCS T;  4Y91 A;  3A8L B;  1X43 A;  2CP3 A;  3MY1 B;  2QAS A;  2I40 B;  5GAN 8;  4J6W A;  1TTH B;  2RJF A;  1M3C A;  2D0N A;  1AWX A;  2EVR A;  2EYW A;  2H3E B;  1I07 A;  2NUT B;  2P0K A;  4HVV A;  3O0G D;  2IW9 B;  2FO0 A;  2M9U A;  2NUP B;  1MMA A;  1QVF P;  1YHQ A;  2JMC A;  3OA6 A;  3QUI A;  4ZNX A;  5LJ5 f;  3E2U A;  2FRW A;  1WFW A;  1ZSZ A;  2KAF A;  2KYB A;  3MP6 A;  2F5K A;  2AHJ B;  4JJD A;  1B7T A;  5GAN h;  2DVJ A;  2DL3 A;  3OYK A;  3CXC A;  3V8J A;  1QVG P;  4CFW B;  5DLQ E;  5GAO n;  2L3P A;  3I55 Q;  2AIR B;  2XG8 D;  4ZGE B;  5C0M A;  2W96 A;  1OIU B;  2DL7 A;  2RK1 A;  3UA7 A;  3DL1 A;  4DBF A;  1YN8 A;  1D0Z A;  5I2M A;  3D7S B;  4AFZ C;  2JT4 A;  1KK7 A;  2K2M A;  1K0S A;  2GQI A;  2GTO A;  4BD3 A;  2HL3 A;  1P92 A;  4BDY A;  3V7R A;  4DBH A;  2C6T B;  3CCJ Q;  3JRZ A;  2VB6 A;  2RF0 A;  2YUN A;  1KIK A;  2RQV A;  4HVW A;  5CIU A;  3LWH A;  1K73 R;  4ATO A;  1IGQ A;  5FWB A;  3BG9 A;  3JCM e;  4M78 C;  1Y7X A;  3J7A F;  1R0B G;  2CSI A;  2L5Q A;  3QWX X;  1H3H A;  2V1Q A;  2M0Y A;  4ZTJ A;  1BIA A;  4HCK A;  3VU3 C;  2E65 A;  2KGT A;  2BZX A;  4A4F A;  4WF2 A;  1I0C A;  1S72 Q;  3M0S A;  2KE9 A;  1UGS B;  3G4S Q;  2QGG A;  2X1N B;  3M5A A;  1HK9 A;  1BU1 A;  3PFS A;  4MDW A;  1OL1 B;  4NST B;  5CEI B;  5EG2 A;  3EH2 A;  3TSZ A;  8ATC B;  1TWB A;  2EKH A;  4GY5 A;  2DX1 A;  3PTA A;  1YIJ Q;  4F7U B;  2KRM A;  2O9S A;  1W6X A;  2B8A A;  4OGC A;  5KYW A;  4F7U G;  1MV3 A;  2NLU A;  2SEM A;  3UF4 A;  4M7D A;  4KRC B;  4AKI A;  1BIB A;  5FLX E;  3VKH A;  1J3T A;  3I55 A;  4M78 A;  1Y57 A;  1ZUK A;  2PVO B;  3TW6 A;  2QXF A;  1X69 A;  3QSU A;  2F1L A;  2LDM A;  1PWT A;  2WSC E;  2P84 A;  1VA7 A;  3CCJ T;  1TU0 B;  1GUX B;  4F7N B;  4QSH A;  4M7D B;  5ACB A;  2FZG B;  2RK2 A;  3QJ6 A;  9ATC B;  5GAN 4;  1I5L A;  1SRM A;  4RTT A;  1X6B A;  2K3Y A;  5AYF A;  1UGQ B;  2X4J A;  4XTW A;  5GAM e;  4J7I A;  4E7J A;  4KH1 B;  3G33 B;  2E64 A;  2DMO A;  1FX7 A;  2EQM A;  3CCM T;  3TRE A;  4CC7 A;  4OB2 B;  1GUX A;  3FJ5 A;  5CKF A;  4ZN3 A;  2O9V A;  4DEY A;  5CCA A;  3CD6 A;  1CSK A;  2EJ9 A;  4HT9 A;  4RTY A;  4C0Z A;  3RER A;  2DKG A;  1KFZ A;  4Z89 A;  1VQ4 Q;  3OYE A;  3OYB A;  3H4C A;  2QEX T;  2HQX A;  2KYM A;  3GLX A;  3CCR T;  1M1G A;  2YRD A;  5KYW B;  2VGN A;  2E10 A;  3N5B B;  5HCK A;  3U23 A;  1M4Z A;  4OF1 A;  1WHL A;  4AFQ C;  2C5N B;  1YJN T;  1OU9 A;  4OB1 B;  2CT3 A;  1VQ7 Q;  2PHG A;  4JRK A;  2JJ9 A;  5M9O A;  3EFO B;  2E6Z A;  5IXF A;  4HA8 A;  3KBG A;  2IPO B;  4JUV A;  5L2W B;  1YJW Q;  1M27 C;  3MEU A;  2CP5 A;  2QQ9 A;  3CQT A;  2F2C A;  3OYY A;  2DXC A;  3OQ5 A;  3RMQ A;  3OW2 P;  1H92 A;  2GQV A;  1UHF A;  3MP1 A;  2EJF A;  1W2B S;  2WXV B;  4YC3 B;  1RLP C;  3SDZ A;  2NWM A;  5IHI A;  3EFR A;  3JCM Q;  4J9G A; 
#chains in the Genus database with same CATH homology
 2VV5 A;  5KE2 A;  4DA4 A;  4XQ3 A;  2DEQ A;  2LT4 A;  4Q5W A;  5FRN A;  4N4G A;  2CYZ B;  5GAM j;  5KCH A;  3JB9 D;  2A7Y A;  3ME9 A;  3GIB A;  2QDY B;  3PMI A;  1DJ7 B;  2DTI A;  2HQE A;  4L6V 5;  1B34 A;  4HCZ A;  3JCM f;  1VQ5 A;  2LX9 A;  2WSE E;  5LJ5 d;  3QPH A;  1NPP A;  2LRQ A;  2DVE A;  4J5Y A;  3TCJ A;  4C8Q D;  4M7D C;  4C8Q C;  1QVF A;  2MWO A;  3OSV A;  3DB4 A;  5HKC A;  4M6V A;  1M1K U;  4BBS M;  4LOC A;  2RH2 A;  3JCM c;  3E1S A;  1NJI C;  2OTL A;  1LNX A;  5GAN e;  1VQ8 A;  1YIT A;  3S3O A;  3M9Q A;  3OS0 A;  3A8H B;  2WJ9 A;  3O8V A;  2CZ7 B;  1VQ6 T;  2K57 A;  2RB6 A;  2L3R A;  3OW2 S;  2O4X B;  2CS7 A;  1VQ8 T;  4PLI A;  3CPW S;  4IUT A;  1R8O B;  1KC8 C;  5HY6 A;  1N9R A;  3L2Z A;  2DXB B;  4MML A;  1UGP B;  5GAM f;  1JJ2 S;  4KUL A;  3CC2 T;  2DD5 B;  1JJ2 A;  4M7A F;  4O6J A;  2EQK A;  3TU4 K;  2RJE A;  3RKY A;  4BE2 A;  2QQS A;  4M77 B;  4M75 D;  3SWN A;  3OW2 A;  3JCM X;  4RCC A;  4M7A C;  2DXC B;  3CBO A;  3OYG A;  4M75 B;  5DY9 A;  2E12 A;  1YJ9 T;  3HFN A;  5GAN 5;  3QZ5 B;  2E41 A;  4XTY A;  5LJ3 e;  3G6E T;  4OVA A;  3TW7 A;  3CCV A;  5IT9 E;  2EQU A;  1LOJ A;  4EDU A;  4QVC A;  4HCC A;  1BI0 A;  1KHC A;  3EAE A;  4MZT A;  4C92 E;  3FC3 A;  4XTZ A;  2X4W A;  3M58 A;  2XI9 A;  5CK9 A;  3FB9 A;  3MP8 A;  3VUB A;  1K9M C;  4OB0 B;  2EAY A;  3OMC A;  4QQ6 A;  3QHS A;  3V8K A;  4R55 A;  4Z6Y A;  3OYL A;  4DOV A;  2IG0 A;  1UGR B;  2V8J A;  1PSF A;  3JCM h;  5GAO q;  3VYH B;  1QW1 A;  2K5F A;  3M4Y A;  4HKE A;  4C8Q E;  1WQ7 A;  3KUF A;  4C8Q B;  4AI6 A;  3L2U A;  2QA4 T;  1E7P A;  4YTL A;  3LYI A;  2EQJ A;  3QII A;  4BUG A;  5C6S A;  4IKF A;  4LD6 A;  1YJW T;  4JS4 A;  2JTF A;  1Q7Y U;  4OMF B;  4HNU A;  3ZBD A;  2ZPI B;  3INZ A;  1FKM A;  3QYE A;  4C5H A;  2QF7 A;  4BB7 A;  3L2Q A;  2E1H A;  2P0Q A;  4NC6 A;  3P8H A;  4AKH A;  3FDR A;  1XTD A;  2PUO B;  4KBM B;  5I2S A;  3KHI A;  3S3N A;  4C92 B;  1YBY A;  2KQW A;  1NZ9 A;  3BFM A;  4QVZ A;  3X20 B;  3CC7 A;  3MEA A;  4M7A B;  4C0D C;  3M4G A;  4EMK A;  3UDC A;  1VQP T;  3CME T;  2H3J A;  4PKC C;  4MIM A;  4HNV A;  4N0A A;  3QYB A;  4M77 F;  5J26 A;  5GAO r;  2JN0 A;  4D6W A;  3PT9 A;  2L89 A;  3M56 A;  3EFS A;  4M75 E;  3SFM A;  3JB9 J;  3HPW A;  3L1A A;  4M75 F;  4ME7 A;  4M7D E;  2V8I A;  4M77 E;  3PIO A;  3CEY A;  4EMK B;  1SSF A;  3VUZ A;  5GMK h;  1I4K 1;  2HNI A;  3CCQ T;  2JOY A;  3L42 A;  1KQ2 A;  3JCM g;  5GAM d;  5FRO A;  4X34 A;  3F70 A;  1K8A U;  2DPP B;  2KMG A;  4HNT A;  3ASK A;  2L8D A;  4A4H A;  1S72 T;  3CCQ A;  2QQA A;  1M1K C;  2M1H A;  3QWL A;  2BS2 A;  2ZPE B;  1I8F A;  1QVP A;  2FB7 A;  4Z02 A;  2RI5 A;  1U1S A;  3RKW A;  4BY6 B;  1Q81 C;  1N27 A;  5CKD A;  2DZ9 A;  3URG A;  3DLM A;  5CQX A;  3A8M B;  4EMG A;  3DKM A;  4BDZ A;  3G71 T;  2BUD A;  4QQD A;  4JX4 A;  1Y96 B;  3MEW A;  3ZFJ A;  2KMT A;  3GNG A;  3S6W A;  5GAN d;  4XU1 A;  4C8Q F;  1KD1 C;  2LNV A;  3HRU A;  2OTJ T;  2GCX A;  2E6N A;  4JS5 A;  3QYG B;  3NFC A;  3OB9 A;  5DM7 R;  2EKO A;  2JUF A;  1YI2 A;  3JB9 F;  3J81 E;  5LJ5 e;  3HZJ A;  1NE8 A;  4JRQ A;  1BI3 A;  2QQB A;  2XHC A;  4FT2 A;  1YHQ T;  1OI1 A;  4CI0 C;  4HL4 A;  4KUD K;  3OYN A;  4FU6 A;  4C92 F;  3OYD A;  3OBY A;  1YJN A;  4HT8 A;  3X28 B;  4JLG A;  4NS5 A;  4C5G A;  1LJO A;  1OZ3 A;  1U1T A;  1ZBX A;  3OS5 A;  1VQ4 A;  4M75 G;  1VQO T;  1Y07 A;  2FHD A;  3JB9 H;  4M7A A;  4L59 A;  1VIE A;  2ZPB B;  4J83 A;  1WJQ A;  4XTU A;  3CCJ A;  3SWN C;  3JCM J;  1KQS A;  2CZ6 B;  2LTO A;  3CCV T;  2F5T X;  2WAC A;  4DOW A;  1W4S A;  3C12 A;  1VQ4 T;  3GNF B;  1EIF A;  4BI3 A;  3M57 A;  4GLK A;  5D6Y A;  2GFU A;  1M5Q 1;  4ELZ C;  2O4X A;  2XIC A;  2PUK B;  4M7D D;  3E9F A;  3RES A;  3LH0 A;  3Q1J A;  3OS1 A;  1VQ6 A;  1OYX A;  2XKO C;  5L8R E;  3BW1 A;  2EWN A;  1O75 A;  4IUR A;  2G3R A;  2F69 A;  2X35 A;  1W2B A;  1G3T A;  4LDW A;  3SD4 A;  2RHY A;  2VYT A;  5LL6 S;  2RM4 A;  1AHJ B;  5FU6 C;  4N0A C;  4C0G A;  4M77 A;  1Q81 U;  3CCE T;  4M7A G;  2HD0 A;  4EMK C;  2PVG B;  4ZGJ B;  2PVD B;  2Y4X A;  2ZZD A;  4KUI A;  1VQ7 T;  1KC8 U;  1VQK T;  3E19 A;  4C8Q A;  5GAN 7;  3FJP A;  3BY7 A;  3CCM A;  2MF2 A;  1WQW A;  2E5Q A;  5CKB A;  2OAU A;  4KT0 E;  3V8L A;  3CCR A;  1GXI E;  5GMK j;  2RI2 A;  3JB9 G;  2BS3 A;  5FU7 C;  1VQN A;  3M53 A;  1Y96 A;  2IVW A;  3RUX A;  3OYA A;  4JX6 A;  3OMG A;  3MEV A;  4CRI A;  4PNO A;  4MFE A;  2R57 A;  3X25 B;  3M55 A;  2ZZD B;  4C92 G;  1YJW A;  4PJO D;  3QO3 A;  2RHU A;  2ZCF B;  3P8D A;  1VQP A;  2XDB A;  3C4S A;  3LX7 A;  4JRP A;  3M59 A;  3KXT A;  4M7D G;  2QEX A;  4BI4 A;  5FU6 B;  3QYH B;  3OYH A;  2RJC A;  1XQH A;  1VIF A;  3GP8 A;  4RMO A;  3CCL T;  3VV0 A;  4XK8 E;  2GFA A;  4BI8 B;  3FRN A;  5J39 A;  3CMA A;  3E9G A;  3QBY A;  4UC4 A;  2EFI A;  3A5Z B;  4TVR A;  3JAM E;  2DIG A;  3AHU A;  4QVD A;  3HFO A;  3CCL A;  3JCM W;  3LWI A;  2XD0 A;  4N4H A;  3LGL A;  1S72 A;  2CGH A;  2JTM A;  2LVM A;  2RD1 A;  1RI0 A;  3FLG A;  4MZP A;  5GAN 6;  3CCS T;  4Y91 A;  3A8L B;  3BG5 A;  3HP9 A;  3HRS A;  3X24 B;  3HL8 A;  3CBM A;  1FWZ A;  1VQ9 T;  4LDV A;  3HBL A;  2RA2 A;  4C92 D;  2DK3 A;  3LW5 E;  2QTX A;  5GAM g;  3C95 A;  2VUB A;  4B9X A;  2RJD A;  2DIQ A;  3CC7 T;  2R5A A;  4E7H A;  1WJR A;  2BIV A;  1YIT T;  5FU7 B;  2RHZ A;  2DD4 B;  5GAN 8;  4M77 G;  4J6W A;  1D3B A;  2RJF A;  3CME A;  4NOY A;  2X4X A;  5EJC A;  2HBP A;  2XK0 A;  2P0K A;  2PU9 B;  5CR2 A;  1G3Y A;  1YI2 T;  2M9U A;  2MI6 A;  5KH6 A;  1YHQ A;  3T9N A;  2JZ2 A;  2XDP A;  4V2S A;  2K4Y A;  3H6Z A;  3OYC A;  1ZHI A;  2R58 A;  3OA6 A;  3QUI A;  5LJ5 f;  2DZC A;  2FYK A;  2KAF A;  3MP6 A;  5FRM A;  1QVF S;  2F5K A;  5DLO A;  2AHJ B;  3PIP A;  3JCM P;  3LGF A;  4DQ2 A;  2YHT A;  3J80 E;  4C0F A;  5GAN h;  3OYK A;  1UEB A;  2YLB A;  5A0G A;  1WJS A;  4FT4 A;  5LJ5 g;  3V8J A;  3JCM V;  3CXC A;  5DLQ E;  2EJG A;  3VYG A;  2M16 A;  5GAO n;  1G3W A;  2XG8 D;  4ZGE B;  4J6X A;  3NTI A;  2O01 E;  5C0M A;  4J7F A;  3L2R A;  2RK1 A;  3DL1 A;  4M78 B;  2V8K A;  1K9M U;  4C8Q G;  4Y28 E;  5GMK m;  5LJ3 j;  3OS2 A;  2I2L A;  3OYI A;  3A8O B;  2OTL T;  4RG2 A;  5I2M A;  4EPC A;  1KQS S;  4OB3 B;  2ZPH B;  3VKG A;  2ZGW A;  4M77 D;  2DXT A;  4M77 C;  4E7K A;  4IUU A;  1BYM A;  1O9S A;  4BD3 A;  4A54 A;  1P92 A;  4M75 C;  5CQY A;  3V7R A;  3CCU T;  5GAN 2;  4BDY A;  3V7S A;  1YJ9 A;  3FIF A;  1VQ5 T;  1I81 A;  2G77 A;  4F7U E;  4M7A D;  1PSE A;  4PJO C;  3G6E A;  1VQM T;  1TH7 A;  4LDU A;  1QLB A;  2PQW A;  1VQN T;  1OZ2 A;  5GAN j;  3JRZ A;  2VGM A;  3CCU A;  1M90 C;  5GAN 3;  2LT1 A;  3QG1 A;  1VQM A;  2XDD A;  1Q82 C;  2KSS A;  1X01 A;  3PMT A;  1RL2 A;  2D9T A;  2DAQ A;  2XU8 A;  4E7L A;  1BKB A;  4QW2 A;  5CIU A;  1IZ6 A;  5IN1 A;  3M54 A;  3ER0 A;  3VYG B;  4BY6 C;  3LWH A;  4ATO A;  4LDX A;  4BBR M;  3OBW A;  4FIB A;  3H8Z A;  3BG9 A;  4M78 D;  1QP3 A;  1UB4 A;  4M78 C;  3JCM e;  1N6A A;  1VQL A;  5CO7 A;  3JCM d;  1Y7X A;  1X75 C;  4AKG A;  3J7A F;  2L5Q A;  3CC4 A;  1MHN A;  1KQ1 A;  4II1 A;  3SB2 A;  4ZTJ A;  1QVG A;  5GAO l;  1BIA A;  3HKS A;  1K8A C;  3VU3 C;  5GAN f;  1VQ7 A;  2K5I A;  2E65 A;  2JNG A;  3CC4 T;  2DTO A;  1Y71 A;  2FVU A;  4PLL A;  4M78 F;  4JLI A;  4WF2 A;  4IUQ A;  4A4F A;  2RHX A;  1U8R A;  3CD6 T;  2KDS A;  4PJO F;  3CPF A;  2DTH A;  2XID A;  4XU2 A;  1UGS B;  2WSF E;  2GF7 A;  3OYF A;  5LJ5 h;  4R56 A;  5GAN g;  4LD9 K;  3M5A A;  1HK9 A;  1MGQ A;  3CXC S;  2HAX A;  3PFS A;  1WNL A;  3QJY A;  4MDW A;  3MHX A;  2MAM A;  5KE3 A;  3BG3 A;  1N8R U;  2QDJ A;  5EG2 A;  1Q82 U;  1YIJ T;  4O5V A;  2MWP A;  4ELY C;  4M7D F;  3LLR A;  2DD4 A;  3QKJ A;  3MET A;  3VJP A;  5GMK e;  4GY5 A;  1ZQ1 A;  4MMK A;  1FXX A;  3PTA A;  4C5E A;  4EMH A;  3WVE B;  4F7U B;  5LJ3 h;  3GF5 A;  3CMA T;  2Y90 A;  4NL2 A;  3HHT B;  2B8A A;  4OGC A;  3UWN A;  1G3S A;  3QZ9 B;  4B9W A;  2K5L A;  1YCY A;  4F7U G;  2CZ0 B;  4A4K A;  3WXM B;  1WPY A;  4IUP A;  5CKH A;  4JRI A;  2NLU A;  2YRV A;  3FEO A;  4PJO E;  4M7D A;  1WGS A;  4RG8 A;  4M78 E;  1VQ9 A;  2OTJ A;  4HLQ A;  3BDL A;  1NPR A;  5HK0 A;  3JB9 I;  4AKI A;  2VC8 A;  1JB0 E;  1V29 B;  1D3B B;  1X6O A;  2RO0 A;  1BIB A;  4FL6 A;  3RMS A;  4A53 A;  3VKH A;  5FLX E;  5A2Q E;  2K3X A;  2QI2 A;  4ELJ A;  4M78 A;  4PJO G;  4A4E A;  4C0D B;  5HK3 A;  3I55 A;  3S3M A;  1YIJ A;  4E47 A;  2EYQ A;  2PVO B;  1M1F A;  1Q86 U;  1JBM A;  3CC2 A;  3TW6 A;  4PJO B;  3I55 T;  4C5I A;  2DXU A;  2JVV A;  2QXF A;  3HRT A;  3RKX A;  3C94 A;  4PL6 A;  1VQO A;  1BI2 A;  4P5N A;  3I56 T;  2QQ8 A;  3QSU A;  2LDM A;  1N9S A;  3V7C A;  2WSC E;  2VXF A;  3CCJ T;  3HO8 A;  1QVG S;  3DLL A;  4XTV A;  4E7I A;  1VUB A;  2DO3 A;  2MMP A;  2R5M A;  4N4I A;  1K73 U;  1NJI U;  3I56 A;  4QSH A;  4M7D B;  5GMK i;  2CKK A;  3OYM A;  1H64 1;  4L5G A;  2RK2 A;  3R6O A;  2X4Y A;  4JJN K;  3QJ6 A;  5GAN 4;  1I5L A;  1IRE B;  4IUV A;  4A4G A;  4F7U F;  4RKU E;  2K3Y A;  5AYF A;  1UGQ B;  2X4J A;  4XTW A;  3TEE A;  5GAM e;  5LJ5 j;  3JSC A;  4J7I A;  3CPW A;  4E7J A;  4M7A E;  3CCE A;  2QQR A;  1H3Z A;  2KVQ G;  1VQL T;  2A3L A;  1XOV A;  2E64 A;  2P0P A;  2VXE A;  3OSS C;  3PGG A;  5GAM h;  1VQK A;  1QP2 A;  1FX7 A;  2C06 A;  2EQM A;  4OP0 A;  4OGE A;  3CCM T;  1BI1 A;  3TRE A;  2BKD N;  3BDU A;  3WVD B;  5LJ3 g;  2QA4 A;  4OB2 B;  4ZTF A;  1Q7Y C;  2DJZ A;  4FM4 B;  2D6F A;  5GMK l;  3UPU A;  2KY9 A;  5CKF A;  4ZN3 A;  2E70 A;  3MO8 A;  2BS4 A;  4HCB A;  5A0D A;  3NTK A;  2LQ8 A;  4RCB A;  5CCA A;  3CD6 A;  3UT1 A;  2EJ9 A;  4HT9 A;  5I21 A;  1KD1 U;  5LJ3 f;  4C0Z A;  5A0L A;  3RER A;  2LQK A;  1K73 C;  2P4T A;  2DXB A;  2DKG A;  2FL7 A;  2ZPF B;  3CBP A;  5D6X A;  3GPL A;  4XTX A;  4LDY A;  3OYE A;  3OYB A;  3H4C A;  2QEX T;  4NL3 A;  2HQX A;  3GLX A;  3OY9 A;  3CCR T;  4MDX A;  2D0Q B;  3JCM b;  2CZ1 B;  5D6W A;  5CAI A;  3G4S A;  3X26 B;  1M1G A;  4ZN1 A;  5J3B A;  2RHI A;  4XU0 A;  1KG1 A;  1KHI A;  2E10 A;  2VGN A;  3N5B B;  4X9C A;  5LJ3 d;  2LCL A;  3QDR B;  2KK4 A;  2RI3 A;  3G4S T;  2QFZ A;  1M4Z A;  4OF1 A;  3RIR A;  1M8V A;  4MFD A;  5CKE A;  1G5V A;  1YJN T;  4OB1 B;  1JRI A;  5KCO A;  1Q86 C;  4JRK A;  5CVI A;  2K2V A;  1XNI A;  4X9D A;  3CCS A;  5M9O A;  2E6Z A;  2LC4 A;  3P8B B;  4J6Y A;  4HA8 A;  4ZGD B;  4XAX B;  5IAY A;  2EIF A;  4JX5 A;  2Y4Y A;  2DD5 A;  2YLC A;  3KBG A;  3PNW C;  4JUV A;  4M78 G;  4XU3 A;  3MEU A;  2QQ9 A;  4BE1 A;  3GOX A;  3HB9 A;  3OYY A;  3OYJ A;  3SWN B;  4JDS A;  5GAO m;  4C92 C;  3L2V A;  4C92 A;  4BE0 A;  4PJO A;  3VKI A;  2DXC A;  3OQ5 A;  3RMQ A;  3NTH A;  3ZEH A;  4FSX A;  2GQV A;  3G7Z A;  3G71 A;  4M75 A;  3MP1 A;  2EJF A;  5GAO p;  1HXD A;  1W2B S;  4BAC A;  2ZPG B;  2M0O A;  2LCC A;  3A8G B;  1M90 U;  2KR6 A;  3MCA B;  3SDZ A;  4QQG A;  4MZM A;  3L2W A;  3HSB A;  1B34 B;  3EFR A;  3DB3 A;  4F7U A;  4VUB A;  3QXE B;  3JCM Q;  1N8R C;  4J8O A;  1M9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...