3WVEB

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, before photo-activation
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3wveB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3wveB02
3QXEB 2ZPEB 2CZ0B 3WVEB 1UGRB 2DD4B 3A8MB 4ZGDB 2ZZDB 2DXCA 1PSEA 2ZPFB 3X28B 4OB1B 2PUOB 2DXBA 2CZ1B 2O01E 4ZGEB 2DPPB 1UGPB 4ZGJB 2CZ7B 3A8GB 3A8LB 2WSEE 3X26B 2PVOB 2ZPBB 3QZ9B 2DD4A 2PVGB 3VYGB 2ZZDA 1GXIE 5L8RE 4OB2B 3VYHB 2DD5B 2DXBB 2CZ6B 3WVDB 1PSFA 3X20B 4OB0B 1IREB 3QYHB 2ZPHB 1UGSB 3QZ5B 1AHJB 2ZCFB 1DJ7B 2D0QB 3X25B 3QYGB 2PUKB 2PU9B 4OB3B 2QDYB 2ZPIB 2PVDB 1JB0E 4RKUE 1V29B 3HHTB 4KT0E 1QP3A 2DXCB 3A8HB 2DD5A 2ZPGB 3X24B 2WSFE 4XK8E 1UGQB 3A8OB 2AHJB 2CYZB 3LW5E 4L6V5 2WSCE 4Y28E 1QP2A 4FM4B 3VYGA
chains in the Genus database with same CATH superfamily
2W2HA 4C92C 2K2MA 1H1QB 1M1GA 4MDXA 3QUIA 2FHDA 2LQ8A 3CD6Q 1G3TA 4ROCA 4XU0A 5CR2A 4JJBA 2Y4YA 1OIYB 2IIMA 3V8JA 2YUOA 1YWPA 1VQ8Q 1VQ8A 2JN0A 1QVPA 2L8DA 4PFOA 3X28B 2BZ8A 3CXCA 2RH2A 5CK9A 4F6SB 4BCQB 2V22B 4IIMA 2M9UA 2CZ1B 1UGPB 2LJ0A 1C1AA 5IDPB 1XTDA 3BDLA 1KQ2A 5LJ5j 3X26B 1H27B 3HRTA 2EJFA 2HKQB 3O0GD 1D3BB 3REAB 1TUGB 2LCLA 4BB7A 4G6LB 2CP3A 4ZN3A 1VQOA 2FB7A 3OYBA 1WI7A 1VQOQ 4CFWB 5DLOA 3L2UA 1LVKA 1AEYA 2WPAB 4WTOB 1VQLQ 2OTJT 3TQ7P 3G33B 3NDQA 4YOOA 1VQ9A 3MO8A 1X2QA 2YRDA 2QEXT 7AT1B 3D7SB 3ER0A 3H41A 1H8KA 1XJWB 2YXYA 4LXCA 3VS1A 3CMEA 4ELJA 4M7AC 2DL3A 4BCIB 3P8DA 1ENWA 5GAOp 1KC8C 1YCYA 3JAME 2JTEA 2NUPA 1B3QA 1WHGA 3EFOA 1WXBA 1R0CB 2X4YA 4CXAB 4R0KA 2RNAA 2NLUA 3CPWS 2MOXA 3EGDB 3OY9A 4RG2A 3LWIA 1ZSZC 3OYFA 1LCKA 1MGQA 2GGRA 3NTIA 3OYNA 3X24B 1VINA 4IUVA 5BNJB 2MWPA 3VKHA 2KI7A 4M7DA 4QQDA 4WCIA 5GMKl 4L6V5 4M78E 3S3OA 1HXDA 2VB6A 2BIVA 1MMNA 1CKAA 2CSQA 2DXUA 3CCSQ 4PJOB 3OSSC 2CREA 5DY9A 1OULA 3C4SA 1NJIR 1VQMQ 2C5OB 1MMAA 3VRYA 2EKOA 1RLPC 2AIRB 3JB9G 2ESWA 1UG1A 3LX7A 2C6TB 3BG3A 4ZGDB 4MFDA 2PJQA 1TSFA 3UT1A 3CCLT 2C0IA 2EJ9A 3PNWC 1M27C 2LQWA 1O9SA 4DQ2A 1I4K1 2QA4A 3IQLA 2V1QA 2DKGA 4JZ4A 3PTAA 2CZ7B 3PGGA 4J8OA 4CFVB 1M90R 3OYDA 2RPNA 2KMGA 3A8LB 2C0OA 1BI3A 3RMSA 3MCAB 3KHIA 3EIDB 3CC4Q 3RR6A 1K73C 2QFZA 3FEOA 4PLLA 2DRMA 4PJJA 3L42A 1T0HA 3VYGB 3M56A 4C0FA 2LCSA 4AI6A 2LDMA 1I5LA 4ATOA 2WACA 3CC7T 4C0ZA 4C8QC 2P0QA 4OB0B 4CRLB 1FINB 2RQWA 2LNHB 4LDUA 3E19A 2ZCFB 1S72A 2O2OA 2XHCA 4Y92A 2FEIA 2HD0A 2KSSA 3ZEHA 1FVVB 4FYVB 3QHRB 1WHHA 5HK0A 2LP5A 2H8HA 4AKHA 3HP9A 3HHTB 3M58A 5KCHA 2CUBA 1X27A 5KYYA 3CPWA 1QLBA 3PT9A 3CCMA 3A8HB 1I81A 4PFPA 4XK8E 5GAN5 3A8OB 5LL6S 5LJ3h 2QGGA 2DVJA 5I11A 4GLKA 3PVQA 2E41A 2V26A 3M4YA 1WNLA 1R8OB 1RABB 1GH6B 4F7JB 5CQYA 4QVDA 5GAOr 1Q95G 5ECAA 2CKKA 3JCMg 1VQ6A 3HL8A 3E9FA 1VQ6Q 2LRQA 3JCMX 1OKWB 2DNUA 4M75E 3GNFB 4M75G 4FX3B 4L5GA 2E6ZA 3TNHB 2J05A 2DD4B 4M77E 2P0KA 2AZVA 5CKHA 2Y90A 2G77A 2HMAA 1E6HA 2K3BA 1D0XA 1X69A 2D9TA 5GANj 4EOOB 4CC7A 4E7SA 5EC7A 1WHKA 4C92F 2DXBA 4EPCA 4EOKB 3SFMA 3BW1A 4EOJB 2VWFA 2EGEA 3CBPA 4YC3B 2E70A 3RKXA 3EOCB 2WIPB 2CDTA 3H0FA 4FYWB 1K76A 1H24B 3I56Q 3CCMT 4BCFB 1YHQT 1WHMA 3V7RA 4ZTJA 1NM7A 3GNGA 4LDVA 4KRDB 2F69A 4UC4A 2HZYA 2DBKA 1MMGA 4E7IA 4EONB 3CCRA 3E2UA 1PSFA 2A7YA 4ELLA 2R5AA 3NGPA 1M90U 3CD6T 4M78A 5LJ3f 1NJIC 1YCSB 3ZBDA 2LX7A 2W10A 2EVRA 1H92A 2XG8D 1UNGD 3H6ZA 2DL7A 1AWJA 4C92E 3KXTA 4OMLA 2C0TA 1WQ7A 2C4GB 2ROLA 1M30A 2CUDA 2LQKA 2GFAA 2E65A 1D0YA 4JDSA 4F17A 2BTTA 4EIKA 1MNDA 1Q81U 2CP7A 4M7AB 4IMYB 1N4MA 1Y96A 4Y28E 5I2MA 1VQMT 4YOZA 4FM4B 4II1A 4J5YA 1NLPC 3M59A 3V7SA 4JRQA 1I5OB 4OMMA 1UGRB 2VGNA 2WXVB 3VJPA 1U3OA 2OAWA 1WJSA 4MMKA 3LGLA 3RMQA 5GMKj 1OQKA 1NEGA 1WXTA 3UF4A 1PRMC 4N4GA 1JBMA 4BACA 2AT1B 4NOYA 2LW4A 1Q82U 3OMCA 3OYHA 3OYIA 3BG5A 4YOSA 1NZ9A 1RAHB 4C92D 4IIOA 3HFNA 4C5EA 2ECZA 2FPEA 2VVKA 5AT1B 1K9MC 1QKXA 4CC2A 3DLMA 1VQ4A 3QDRB 1P5EB 4RCCA 1B7TA 1FYNA 2K4YA 3I55T 4J9DA 1OU9A 2ZPBB 3UA7A 1BU2A 1VOLA 1X2KA 1SG5A 2KVQG 4HLQA 2COZA 2DFUA 5D6WA 5FLXE 5GAOn 1QW1A 5J3BA 4BCND 3GTMS 1YJ9Q 1YJ9A 4Q5WA 5FRMA 5GMKe 4R56A 1JRIA 1IGUA 4LE9A 3CCRT 1PWTA 1W2BP 2EIFA 2RJEA 4OGRB 4NSTB 2EBPA 2KE9A 1VYVA 3M9QA 1GY3B 1UFFA 1J3TA 5A0DA 3G6ET 2J6KA 3X25B 2HL5C 3NPFA 5FROA 4Z02A 2PUKB 3UDCA 4QKUA 1QVFA 1Q81R 5LJ5d 2G6FX 4C5GA 1IB8A 4AMCA 2M16A 4RTUA 4A4FA 1WXUA 3M0QA 3NTHA 2QTVA 3QHWB 2EQJA 3QBYA 2X3WD 1QP3A 2DERA 1K9MU 2RJCA 5IHYA 3CC4A 3QDFA 1FKMA 1K1ZA 3H0HA 3GOXA 3GF5A 1NYGA 2EYYA 3FIFA 1XQHA 1QCFA 3EGXB 3DLLA 2YUQA 3UWNA 3V8LA 3OYKA 4ORZA 1F1BB 2P84A 2MYSA 3OS5A 3JCMW 2DTHA 2HBWA 2WMAB 4BDYA 3JCMJ 2RHZA 4BCQD 3CCJQ 1K0XA 2AKKA 2MK5A 5I21A 4PJOA 3CCVT 2VYTA 1JXMA 2QEXA 1RI9A 4BUGA 2DA9A 2HAXA 3MP8A 1OL1B 1E7OA 2SRCA 3H0IA 3BFMA 1N9SA 4EOIB 2KYMA 4M7DC 1KQ1A 5IF1B 3OYLA 1H3HA 2EQMA 5IDNB 4A4GA 1OGUB 2V8JA 5CKBA 4IUUA 5I2SA 3JB9H 2XMFA 1PC0A 2KMTA 2RM4A 1VYUA 2QDJA 4NS5A 5GAMe 4C8QE 2OTLA 3OYJA 3BHTB 3ME9A 3M03A 1X01A 2LX9A 2KT1A 2GBQA 3RKYA 4HL4A 2DRKA 3PMIA 3CC4T 4N0AC 1UTIA 3V7CA 2IW6B 2P0PA 2KR6A 4CRIA 2EYQA 1WJRA 4Y91A 4ANJA 4EMGA 1PCXA 2LNVA 4C8QD 4DEYA 2VXEA 2DK3A 1IRXA 1LNXA 3VYHB 1SHGA 4XQ3A 5AYFA 4AFSC 2JM9A 5ACBA 2BE7D 2F2VA 5FGKB 4QQ6A 2XDBA 2DL4A 2RI3A 3JCMP 3L2RA 2D0QB 2I40B 2HCKA 4FSXA 1GUXA 2JTFA 5LJ3j 2PU9B 4DOWA 1Q86R 2G9XB 3JB9F 1AVZC 2F2XA 4F6UB 3R6NA 1Z9ZA 1H26B 3I56T 4HCBA 1VQ5T 2K79A 4VUBA 2K7AA 4C8QF 5KE3A 4J6WA 1ZSZA 2LC4A 1YI2T 4J9BA 2CSIA 1AZGB 5LJ5g 1JU5C 2AHJB 3JB9J 2RA2A 2QYZA 2E12A 1KD1U 2A0FB 2KYBA 2CCIB 2P4TA 3OYGA 2DEUA 2QK0A 1VQMA 1Q7YC 2RHXA 2G3RA 3U23A 1U1SA 4BCGB 3FJPA 1MHNA 1W1FA 5KCOA 2BZXA 2RD1A 2A28A 3P8HA 1RAGB 2QQ8A 2VGMA 2J7IA 4CFXB 5HBHB 2ZPFB 2C5VB 2HNIA 2E1HA 1I07A 3CCQA 4JX5A 3GBQA 3JCMV 3OS2A 1VUBA 3KBGA 2QA4Q 3G4SQ 6AT1B 1YJNQ 1BCOA 1FMWA 1B34A 1N8RC 4ZGEB 2RF0A 3RDVA 5GAOl 2K5FA 2DMEA 3EG2A 4PJMA 3VUBA 2E10A 2QF7A 1UDLA 3TNWB 2KEAA 4B9XA 3TSWA 1TH7A 1UNHD 2DILA 2DTOA 4PJOG 5KE2A 2DM1A 1VQ7T 2LT4A 1TG0A 2YHTA 3CC2A 1W4SA 2W99A 2ZZDA 1PG5B 3CC2Q 2X9HA 1URCB 2IG0A 3PVLA 2DD5B 2AKLA 1N9RA 1SPKA 4OMFB 5HNBB 5IXFA 2X4XA 1WIEA 3X20B 5KYWA 2HSPA 4F7NB 5GAOm 1YNZA 2CGHA 1YJ9T 1JJ2A 1WQWA 2RMOA 1JO8A 2O4XB 2RO0A 4J6XA 2FPDA 2OTJQ 3ZFJA 4B9WA 1OX9A 2M02A 1ZUUA 2KY9A 1S1NA 1RACB 2DMOA 3VS0A 3CCUT 4RUGA 4JUVA 4RG8A 4UN0A 4EMKB 4OB3B 3F5XB 2NUZA 4CC3A 2ZPIB 1NE8A 5LQFB 3PFSA 2XK0A 3CMET 3H9NA 1V76A 3I56A 2P4RA 4RTTA 2DD5A 3E9GA 3BLHB 3CXCP 1M3CA 2W0ZA 3TW7A 1UGQB 3A1PA 4JRIA 4NL2A 2BE9B 2CYZB 5CVIA 1C0MA 4BCHB 2FO0A 1F5QB 2GFUA 4QVCA 3QXEB 2CP6A 1PM3A 4XAXB 1TUCA 4FT4A 5L2WB 1I0CA 1Y96B 1ZBJA 3INZA 2W9FA 1YIJT 2BZYA 1UHCA 2X3XD 2DAQA 1KC8U 3M0UA 4M7DG 5CKFA 2K3XA 5HK3A 2EGCA 3QIIA 4J9GA 3QWXX 1YJNA 1NPRA 3VKIA 1TWBA 5FU6B 1TFBA 1U06A 4CFNB 2L0AA 2COWA 1XOVA 1K9AA 3CMAQ 1D3BA 4LN2A 2MI6A 2QQ9A 2IW9B 1M3AA 2DX1A 1BYMA 1NYFA 1WFWA 2E6NA 4J7FA 3FJ5A 5D7UA 4X34A 4EORB 4F16A 2HKNA 2E4HA 4D6WA 4F7UA 2B8AA 2JW4A 4GLMA 4ESRA 4PL6A 2ENMA 1KHIA 2RB6A 4FYXB 4CFMB 2MAMA 2DL5A 3JCMb 3EH2A 1FMVA 4OP0A 4IUTA 2KRSA 3HRSA 3CCJA 4C5IA 4LUEA 3HTRA 2DL8A 1N6AA 4II5B 3OW2A 2YRCA 1K8AR 4EMKA 1IREB 3QZ5B 5KYXB 3RERA 1U1TA 3BHVB 2NWMA 2X35A 1KG1A 2SEMA 2KRMA 2KGTA 5CCAA 3META 3EFSA 4PFZA 1VQLT 1KK7A 1U8RA 3DTOA 1Z9QA 4F7LB 1AD6A 1ZA1B 3GP8A 3M0RA 3QJ6A 2I0NA 5GAMh 2A3LA 1HK9A 4F04B 2QQSA 3M53A 4KH1B 4DBQA 2MIOA 3LLRA 3MP6A 3S6WA 2WSCE 3PE0A 1Q86C 4Z89A 1YITT 1UGVA 5CO7A 1TD6A 1GCPA 5C0MA 3H4CA 3LGFA 1G3YA 1YITQ 3DL1A 4OVAA 3EG1A 2YRVA 3RNJA 4OF1A 5KYWB 1ZSGA 4F7UB 2M51A 3VRZA 4KGXB 2UZDB 4XTUA 2E5KA 1JOWA 1E9HB 2DYBA 3A8MB 4X9DA 1H1PB 5GAN7 3MEUA 4P5NA 2QQAA 2JNGA 1W6XA 4E7JA 4CFUD 4C0DC 4J9HA 4BD3A 1VQPA 1M1KC 4MIMA 1Y0MA 1IO6A 4BE0A 2HL3A 2J06A 2QQBA 2L5QA 3DKMA 3L2WA 4BY1X 3POMA 2BS4A 1EZZB 4XTYA 3M0SA 3NHNA 2ZGWA 3DJBA 4C92G 1GFDA 1B34B 2YUPA 3CQTA 2KAFA 1K4US 2IVXA 3OYYA 2M1HA 1Q86U 3RBBB 1UB4A 4N0AA 4Y72B 3BG9A 2CCHB 2LT1A 4DBHA 2K3YA 1VIEA 2EQKA 2VC8A 3CCET 2UUEB 3QWYA 2JVVA 2QEXQ 3WVDB 4M78D 1KD1C 1ABOA 1D1BA 4BI3A 1G3NC 4F7UE 1UEBA 5GAN8 2QI2A 2QDLA 3M5AA 2FPFA 1KXUA 5CKEA 4A4KA 3VV0A 2E64A 2GCXA 1IHVA 2PVDB 5LJ3d 3JV3A 1Y7XA 5FWCA 2C06A 5KH6A 4AFQC 1VQPT 3CCST 1UE9A 3L2ZA 1WZOA 1WHLA 3VKGA 4C8QA 2EYXA 2DE0X 2CP0A 5FWBA 2DLPA 1PRLC 2QG9B 4E7ZA 3G4ST 3AT1B 4GBQA 3OS1A 5A2QE 1RADB 4KH0B 1EX4A 3C12A 3EG9B 4IKFA 1XNIA 3OYMA 4X9CA 3EJ1B 1QCNA 5D6XA 4BY6C 2FRWA 3RKWA 5CEIB 3MHXA 2AK5A 2AZSA 1X6GA 1MV3A 5IXBA 4BY6B 5DM7R 4I3ZB 2H3EB 3P8BB 4BCOB 4OMPA 1YWOA 1ZX6A 4M7AA 3CCQQ 3DOGB 4M75A 5KYNA 2O31A 3JCMc 1YJNT 1RLQC 4AG1C 3I55Q 2DPPB 4HVUA 1UUEA 4E6RA 4E7KA 1X43A 2XI9A 2COYA 2OAUA 1S72T 1IZ6A 1M8MA 5KYYB 2Z0WA 4QT7A 4KRCB 3SEMA 4JRKA 4NC6A 1PKDB 2OTLT 2ABLA 3G71T 1GCQC 2PZ1A 3FB9A 2PVOB 1PD1A 1SF9A 4ZNXA 4EC9B 5HY6A 1OL2B 1QWFA 4EC8B 4JRPA 1QVGS 4OR5B 1M4ZA 1FX7A 2L2PA 1M1FA 1VQNA 2EYZA 1H3ZA 3UPUA 4IURA 1GBRA 2XDPA 1WPYA 4F14A 5IHKA 2W9ZA 3QHSA 1YIJA 3G71Q 3QYHB 2PQWA 1UGSB 1OPLA 2OTJA 2EKHA 4J9FA 1V1CA 1WGSA 4AKIA 3OYEA 1ARKA 5GMKi 3ASKA 3WXMB 2HBPA 4KBMB 2M0YA 2RN8A 3CCQT 1HJDA 2EJGA 1Y57A 2WMBB 4KT0E 4JS4A 1VQ9T 4M77B 3G6EQ 3SB2A 2DVEA 2ZPGB 4EDUA 4ZTFA 1E7PA 1OZ3A 5CKDA 5CIUA 1O75A 4PK4A 2HQXA 1K73U 1VIFA 2VASA 5GAN6 1D1CA 2OI3A 2LZ6B 1OI9B 1NBEB 2ZPEB 2JXBA 2D1XA 3V8KA 2CZ0B 3VS7A 5M9OA 4LDWA 1SSFA 2DJZA 5CQXA 4XU1A 3BHUB 1H28B 1R0BG 1WJQA 3MEVA 4N4HA 2X4JA 3NTKA 3CCEQ 1VQ5Q 1BIBA 3M55A 3KUFA 2D6FA 5DQVA 1XO2A 2J6FA 4JLIA 4MZTA 3RESA 2A36A 2EWNA 1JEGA 1FMKA 3M4GA 5HQ0B 1MNEA 4AKGA 4M78C 4BY7X 5IH2A 3L2VA 4DA4A 1BI2A 2HSEB 2WSEE 4M7DF 1D1AA 3JCMQ 4HXJA 1SSHA 1OPKA 3QO3A 2UZLB 2HDAA 1RAEB 4V2SA 2PVGB 2JT4A 4PJOD 1O9KB 2F2CA 2JMCA 4BCPB 3GIBA 5J39A 3MY5B 1OEBA 1OV3A 3EG9A 1YN8A 2V8KA 3M57A 1M90C 5IAYA 3GPLA 5HKCA 1RUWA 1QWEA 4FU6A 1NJIU 3EFRA 5A0LA 4JJNK 3O5ZA 4RTZA 1KSWA 2ZAEA 5GAMf 2R5MA 1WDXA 1B07A 2DBMA 1BB9A 1W98B 3OYAA 3FRNA 1VQOT 1M3BA 2R57A 1WLPB 5GANg 2CS7A 2K2VA 3EHRA 3R6OA 5LJ5h 4OGEA 1NLOC 4QW2A 4F7SB 3CCUQ 1A0NB 1N27A 1KD1R 2XD0A 2DO3A 5GMKm 3QYBA 4A4EA 3UATA 2DZCA 1ACMB 4PJNA 4PJLA 4FL6A 2VUBA 1C9BA 3JCMf 1VQNQ 5HBJB 5GJWB 1KQSA 2EFIA 4BI4A 2WIHB 3HPWA 1SHFA 2CT4A 4JJDA 1PKTA 3CC2T 4TTHA 2DXCA 3DDPB 2L3QA 3SDZA 3OA6A 3G7ZA 3E1SA 2KT8A 5CAIA 1G83A 3C94A 4MDWA 4F70B 2UZEB 5GANd 2LCCA 2LQNA 3EHQA 2KROA 3EGDA 2O88A 1WA7A 4BCNB 2PHGA 4AFUC 4F7UG 3TNIB 1VOMA 1M9SA 4RCBA 5GANh 4JX4A 4M75C 3LQ5B 5IHIA 1X6OA 2CP2A 2DD4A 4CC4B 3DB3A 1EFNA 4HVWA 4M77G 3CEYA 1W2BS 3N5BB 2E5QA 4AT1B 4OB2B 2QASA 4CI0C 2K57A 4MZMA 3PIPA 4BCJB 2A08A 1QVGA 1G8XA 1GUXB 1PKSA 3M54A 2YWWA 2MF2A 4DBRA 4MMLA 5GJVB 3EH1A 3JCMd 3MIAB 1QMCA 2K6DA 3TEEA 3HZJA 5GAOq 2XU8A 3L2QA 1MUZA 3OW2P 2YDLA 4J9EA 1JB0E 2OTLQ 2B9RA 3JB9I 2L3SA 4RODA 1G3WA 2EW3A 2IW8B 1QLYA 4XU2A 2ED0A 2RHYA 1GCQA 4MFEA 1W70A 1FWZA 4J83A 3A5ZB 1M1KR 1SKUB 4KULA 4R55A 3KFVA 1WHJA 2XIDA 3LW5E 3QKJA 2WEVB 2RI5A 1I1JA 1VQ8T 3QPHA 5GAMg 1YITA 4FSSA 1QCOA 3S3MA 1VQKQ 4L59A 1GRIA 4JLGA 1YIJQ 4EOSB 2L3RA 1SRLA 1SEMA 2BS2A 1KFZA 5GANf 1H25B 3FDRA 1H1RB 3T9NA 2GF7A 1RAAB 1HD3A 3EGUA 2FRYA 4C8QG 3RGFB 3CMAA 3OMGA 2ATCB 2EQIA 3EG0A 4HCZA 3VU3C 4F6WB 1JJ2P 3GLXA 3TN8B 1YHQQ 3NFCA 1D0ZA 1K8AC 3QSUA 3A8GB 4M75B 3QYEA 3CC7A 1BIAA 4RTYA 1ZSZB 1RAFB 2KXDA 3CCMQ 2L89A 2HQEA 4M78F 5EG2A 2FG0A 2QQRA 1T0JA 3ULRB 2KXCA 2KK4A 4KUIA 2I53A 2RI2A 2KBTA 1GXIE 2O9VA 4BCMD 1BBZA 3CCSA 1M5Q1 2ROTA 2MCNA 2DXBB 4ME7A 4JZ3A 1O9KA 1JSUB 5GAN4 3O8VA 5LJ5f 2PK9B 2VXFA 2GTOA 4DBFA 3OYCA 4QSHA 1RI0A 4M78G 3VS5A 3I5RA 2LJ1A 3HB9A 3BE3A 1CSKA 2NUTA 1H641 3J7AF 4KGVB 3FLGA 5I5ZB 1YJWA 2D0NA 1OIUB 2CP5A 4AFZC 3CBMA 4E7HA 5FW9A 1BKBA 1LOJA 1VQ6T 3JCMh 4LOCA 4E47A 2PNIA 4PJOE 1Y71A 5DQWA 2EPDA 4M7DE 3G6EA 2A37A 1IXDA 1PHTA 2X1NB 5I22A 4HNTA 4QQGA 4HCKA 4LUDA 3TREA 3QWLA 4FW2A 1VYTA 3HRUA 1ZBXA 8AT1B 1VQKA 3WVEB 4EMKC 4HA8A 1BU1A 1HSQA 3G71A 5EFQB 4RTXA 1IHWA 2QA4T 1VQ7A 2O4XA 4X1VA 3TW6A 2E3IA 3VUZA 2KDSA 3HFOA 1VYWB 3JRZA 1VQPQ 4E7LA 2MPXC 1YHQA 3L1AA 2E3HA 3CPFA 3CXCS 3REBB 4A4HA 3J81E 4N4IA 2BS3A 3MY1B 4CFUB 1Q82C 2K5LA 2JOYA 1WX6A 2F5TX 1K8AU 2GQVA 2IN3A 2KNBB 2I2LA 3CCUA 3OBWA 1GBQA 4A63B 4FIBA 3A98A 3M0TA 3OSVA 2JM8A 2RK1A 4RMOA 3MKDA 4C92A 3VS3A 4HCCA 3QG1A 2K9GA 4BBSM 5A0GA 2D8JA 4DOVA 4M77A 4XTZA 2BUDA 2C5XB 1BI0A 3JB9D 2JMAA 4M4ZA 3RUXA 5HBEB 4HNVA 4XTXA 2LJ3A 2ED1A 4M77F 3I9QA 1Q7YR 4QVZA 1TUDA 1LPLA 1NEBA 3MJXA 3MPUB 4HKEA 5FU7B 4KUDK 1VQ4T 2JJ9A 2QGFB 5CYIB 4O6JA 1YBYA 4RKUE 1NG2A 3LWHA 4BE1A 2RQTA 3BLQB 2FZCB 3I35A 4RTWA 4FCYA 1N8RR 4ELZC 2QTXA 2WFYB 1OYXA 5KYUA 1RAIB 1VQ4Q 4XTVA 3VS6A 4HNUA 1OU8A 3Q1JA 4BXXX 4D8KA 3CCVQ 3TVTA 4JJCA 4YTLA 3HKSA 3CD6A 2YLCA 2DZ9A 5DLQE 3BDUA 2NUPB 3LH0A 3EFOB 5GMKh 1K9MR 1Y07A 2BKDN 3CCEA 3CCRQ 4HT9A 1OOTA 2M0OA 4F7UF 3LYIA 5KYXA 3OB9A 2ZZDB 1Q82R 1PSEA 1QQJA 1IGQA 4GY5A 2LMJA 2CH4A 1YI2A 4Z88A 5IT9E 3I55A 2EAYA 4EOQB 3CCJT 2PUOB 3J80E 3MEWA 2NYSA 4B6MA 5HCKA 4BE2A 4M7AG 4ZGJB 1KJWA 3DB4A 4JPBW 2R7GA 3C95A 2MWOA 2JGZB 1OX8A 1QKWA 4M7AD 4HVVA 1MMDA 3M0PA 2GNCA 1NPPA 1BI1A 3F70A 2DXTA 3PIOA 2CJMB 2DIGA 2OJ2A 2H3JA 3LH5A 5GANe 2LVMA 1VQ9Q 2KR3A 2LTOA 2XICA 5L8RE 4JX6A 3SWNA 1TOVA 2WJ9A 1ZLMA 2RJFA 3HO8A 1H4LD 1D3UB 2JS2A 1ZUYA 4FW1A 4A54A 1AHJB 1T3SA 2W96A 1AD5A 2O9SA 4M77D 3SHWA 3CPWP 4BBRM 1K0SA 1K73R 2KRNA 5GAN2 4RTVA 1GL5A 4C92B 4FT2A 4OMNA 9ATCB 1YI2Q 3CC7Q 1OI1A 3MEAA 1UJYA 2L3PA 4PLIA 2FYKA 4EOMB 3SWNB 4M7AE 1M8VA 4M7DD 1H1SB 1ZA2B 5IN1A 3CCVA 2KQWA 1JSTB 4J7IA 5FU6C 8ATCB 3TCJA 3SD4A 1OZ2A 1Q7YU 2GQIA 1BK2A 2EGAA 4XU3A 2YLBA 4MZPA 1M2VB 2DYIA 3OQ5A 2Y4XA 2NUTB 4D8DA 5GAMd 4LDXA 3CMEQ 2X4WA 1UJ0A 1AWWA 2RHUA 2V8IA 2RQRA 5KYUB 5GAN3 4NL3A 4A53A 2PMIB 2IVWA 2O01E 2XDDA 1N8RU 1JQQA 2F5KA 4PJOF 3TU4K 4OMQA 2YT6A 1G2BA 1YP5A 3RIRA 3SWNC 1KQSS 2F2WA 2QAZA 4LD6A 4KRTA 3AHUA 2CH4W 2JTMA 2DF6A 4OGCA 2FL7A 1JXOA 4M7AF 1R77A 2DJQA 2WHBB 2QXFA 4BDZA 1YFNA 1KHCA 3VS2A 3NMZC 2UZBB 4C0DB 3MI9B 1T3LA 4EOLB 1AISB 4PJOC 2CZ6B 4IUPA 1C6VX 1VQ7Q 3I5SA 1M2OA 1G3SA 4IUQA 4PNOA 3OS0A 1LJOA 1TS9A 4C0GA 3CCLA 2MMPA 2ZPHB 1FXXA 3G1JA 3CCLQ 2EYWA 3HSBA 2QGSA 3PO3S 1PD0A 1DJ7B 2EUFA 2K5IA 3EAEA 3QYGB 1OKVB 2V1RA 4XTWA 2QDYB 1QVGP 4BCKB 1MV0B 1E6GA 1M1KU 5LJ5e 1HYOA 2DETA 1TTHB 2OX7A 1I8FA 5LMKB 2DXCB 1ABQA 4TVRA 1BCMA 2JUFA 3THKA 4LNPA 5FU7C 2X51A 3JCMe 4M78B 1QVFS 2RQVA 2BKZB 5FRNA 1GFCA 5J26A 1QP2A 5L23A 2YUNA 1SRMA 5ICPB 1EIFA 1VQLA 3OBYA 4LD9K 1Q81C 4Z6YA 4C5HA 4ELYC 1AWXA 2JS0A 1RL2A 4E2FB 5EJCA 4KGZB 5C6SA 2RHIA 3JSCA 4LDYA 2PTKA 3MP1A 3HBLA 4Z8AA 2J6OA 1S72Q 2RQUA 1JJ2S 4OB1B 2JZ2A 3CMAT 1VQNT 3H8ZA 2FZGB 3BLRB 3VS4A 5LJ3g 1AOJA 2RK2A 4BCMB 2DEQA 4M77C 3ZL7C 4M7DB 1UNLD 5D6YA 4K11A 3CBOA 3QZ9B 2F1LA 1QMZB 4ROEA 3EG3A 1W2BA 2DTIA 2GTJA 1TXQA 4EOPB 2D8HA 1ZHIA 4M75D 3UA6A 3S3NA 4WF2A 2EQUA 3URGA 4DEXA 4J9CA 1KIKA 1X75C 4FYYB 4C8QB 4M75F 4M6VA 1QVFP 1ZUKA 4J6YA 2C5NB 3K7AM 2IPOB 1VQKT 2FZKB 3EGXA 3FC3A 1VQ5A 2BPMB 1TU0B 1ZQ1A 1P92A 2VKNA 1M2VA 2CT3A 1WYXA 2DIQA 2PK2A 1PNJA 3C0CA 5IHNA 1YJWQ 3OW2S 4OMOA 1ZP2A 1AWOA 3QJYA 1KQSP 3G4SA 1X6BA 1V29B 4EMHA 2FVUA 3PMTA 1YJWT 2XKOC 1UECA 5HVYB 2VV5A 5GAMj 2HEQA 1UHFA 1KC8R 2HQHA 1AT1B 4JS5A 4J9IA 1VA7A 2R58A 3DDQB 4ZN1A 2RJDA 2WSFE 4PKCC 4HT8A 1G5VA 4BI8B 1JKWA 2B86A 1N5ZA 1AZEA 3B57A 1CKBA 1D09B 4AG2C 4O5VA 2YSQA 3BY7A 3TSZA 1U5SA 3VYGA 5LJ3e
chains in the Genus database with same CATH topology
1ZBXA 3C12A 4V2SA 4IKFA 4C92C 1XNIA 1VQKA 1M1GA 3OS5A 3WVEB 4X9CA 4EMKC 2DTHA 3OYMA 4HA8A 3JCMW 4MDXA 3QUIA 4BDYA 3JCMJ 5D6XA 2FHDA 2LQ8A 2RHZA 4BY6C 3G71A 1G3TA 3RKWA 4XU0A 2QA4T 5CR2A 2Y4YA 3MHXA 1VQ7A 2O4XA 3V8JA 5I21A 4PJOA 3CCVT 2VYTA 2QEXA 4BUGA 4BY6B 5DM7R 3TW6A 2HAXA 3VUZA 3MP8A 2KDSA 1VQ8A 3HFOA 2JN0A 3JRZA 3P8BB 3BFMA 1N9SA 1QVPA 2L8DA 3X28B 4E7LA 4M7DC 1KQ1A 3CXCA 1YHQA 2RH2A 3L1AA 4M7AA 5CK9A 3OYLA 3CPFA 4M75A 3CXCS 3JCMc 2EQMA 4A4HA 3J81E 4N4IA 1YJNT 4A4GA 2M9UA 2BS3A 2CZ1B 2V8JA 1Q82C 2DPPB 2K5LA 4IUUA 1UGPB 5CKBA 5I2SA 2JOYA 3JB9H 2KMTA 2RM4A 4E7KA 2QDJA 2XI9A 2F5TX 4NS5A 2GQVA 5GAMe 1K8AU 1XTDA 3BDLA 4C8QE 2OAUA 3OYJA 1S72T 2OTLA 1KQ2A 1IZ6A 2I2LA 3ME9A 5LJ5j 4JRKA 4NC6A 3X26B 1X01A 3HRTA 2EJFA 3OBWA 3CCUA 1D3BB 2LX9A 4FIBA 3G71T 2OTLT 3OSVA 3RKYA 4HL4A 3PMIA 3CC4T 2LCLA 2RK1A 3FB9A 4N0AC 4BB7A 2PVOB 3V7CA 4ZN3A 4RMOA 1VQOA 2FB7A 2P0PA 2KR6A 4C92A 4CRIA 3OYBA 2EYQA 4HCCA 1WJRA 5HY6A 4Y91A 5DLOA 3L2UA 3QG1A 4JRPA 4EMGA 4C8QD 2LNVA 1QVGS 2OTJT 4BBSM 2VXEA 2DK3A 5A0GA 1M4ZA 1LNXA 3VYHB 1VQ9A 4XQ3A 4DOVA 3MO8A 5AYFA 1FX7A 4M77A 4XTZA 2BUDA 1M1FA 1VQNA 1BI0A 3JB9D 2QEXT 1H3ZA 3UPUA 4IURA 3RUXA 3ER0A 2XDPA 4HNVA 1WPYA 4QQ6A 4XTXA 4M77F 2XDBA 3QHSA 4QVZA 1YIJA 3CMEA 3QYHB 2PQWA 1UGSB 4ELJA 4M7AC 2RI3A 3JCMP 2OTJA 3P8DA 3L2RA 2D0QB 4HKEA 5FU7B 5GAOp 1VQ4T 4KUDK 4FSXA 1KC8C 1YCYA 2JTFA 2PU9B 4DOWA 5LJ3j 3JAME 1WGSA 4AKIA 3OYEA 3JB9F 4O6JA 1YBYA 3ASKA 5GMKi 3WXMB 2HBPA 2X4YA 4RKUE 4KBMB 3CCQT 3LWHA 3I56T 2NLUA 2EJGA 4BE1A 3CPWS 4HCBA 4KT0E 3OY9A 4RG2A 3LWIA 4VUBA 4JS4A 1VQ9T 1VQ5T 3OYFA 4C8QF 4M77B 1MGQA 3SB2A 5KE3A 3NTIA 2DVEA 2ZPGB 4J6WA 3X24B 4ELZC 3OYNA 4IUVA 2MWPA 3VKHA 2LC4A 2QTXA 4EDUA 4ZTFA 1YI2T 4M7DA 1E7PA 1OZ3A 4QQDA 5CKDA 5LJ5g 2AHJB 5CIUA 5GMKl 3JB9J 1OYXA 1O75A 2HQXA 4L6V5 4M78E 3S3OA 1HXDA 2RA2A 1K73U 1VIFA 2E12A 4XTVA 5GAN6 4HNUA 2BIVA 1KD1U 3Q1JA 2DXUA 2P4TA 2ZPEB 3V8KA 3OYGA 4YTLA 2CZ0B 3HKSA 1VQMA 3OSSC 3CD6A 4PJOB 5DY9A 5M9OA 4LDWA 1SSFA 2YLCA 3C4SA 2DZ9A 2RHXA 2DJZA 3BDUA 5CQXA 4XU1A 5DLQE 2G3RA 1WJQA 3LH0A 1U1SA 3FJPA 5GMKh 1Y07A 2BKDN 1MHNA 2EKOA 3MEVA 4N4HA 5KCOA 3CCEA 4HT9A 2X4JA 3NTKA 2M0OA 3JB9G 2RD1A 4F7UF 3LX7A 3LYIA 3P8HA 3BG3A 4ZGDB 2QQ8A 2ZZDB 4MFDA 2VGMA 3OB9A 3UT1A 1PSEA 3CCLT 4GY5A 1YI2A 2ZPFB 2HNIA 2E1HA 2EJ9A 1BIBA 3M55A 3KUFA 3CCQA 3I55A 2EAYA 4JX5A 3PNWC 3JCMV 3OS2A 5IT9E 2D6FA 1VUBA 1O9SA 3KBGA 4JLIA 2PUOB 4MZTA 3RESA 3J80E 2EWNA 4DQ2A 3CCJT 1I4K1 3MEWA 2QA4A 3M4GA 1B34A 1N8RC 4ZGEB 4AKGA 4M78C 4BE2A 4M7AG 2DKGA 3PTAA 4ZGJB 2CZ7B 3PGGA 3DB4A 4J8OA 5GAOl 2K5FA 3L2VA 4DA4A 1BI2A 3OYDA 3C95A 2KMGA 3VUBA 2MWOA 2E10A 3A8LB 2QF7A 2WSEE 4M7DF 4M7AD 1BI3A 3RMSA 3MCAB 3KHIA 4B9XA 1TH7A 2DTOA 4PJOG 3JCMQ 5KE2A 3QO3A 2LT4A 1VQ7T 1NPPA 2PVGB 2QFZA 1K73C 1BI1A 2YHTA 3F70A 3FEOA 2DXTA 3PIOA 4PLLA 3CC2A 4PJOD 1W4SA 2DIGA 3L42A 3VYGB 3M56A 2ZZDA 4C0FA 2H3JA 5GANe 2LVMA 2IG0A 4AI6A 3GIBA 5L8RE 2LTOA 2LDMA 2XICA 5J39A 4JX6A 1I5LA 2DD5B 3SWNA 4ATOA 1N9RA 2WACA 4OMFB 3CC7T 2V8KA 3M57A 2WJ9A 5IAYA 2X4XA 1M90C 3X20B 2RJFA 3HO8A 4C0ZA 4C8QC 2P0QA 5GAOm 3GPLA 5HKCA 4FU6A 1NJIU 4OB0B 2CGHA 1YJ9T 1JJ2A 3EFRA 5A0LA 1WQWA 2RO0A 4J6XA 2O4XB 4LDUA 4A54A 3E19A 4JJNK 1AHJB 2ZCFB 3ZFJA 1S72A 4M77D 4B9WA 2XHCA 2KY9A 5GAMf 4BBRM 3CCUT 2R5MA 2HD0A 2KSSA 4JUVA 3ZEHA 4RG8A 5GAN2 4EMKB 4OB3B 4C92B 4FT2A 2ZPIB 3OYAA 3FRNA 1VQOT 5HK0A 1NE8A 4AKHA 3HP9A 1OI1A 3MEAA 3HHTB 2R57A 3PFSA 2XK0A 3M58A 5KCHA 3CMET 5GANg 2CS7A 2K2VA 3CPWA 3I56A 1QLBA 4PLIA 3PT9A 3CCMA 3A8HB 2FYKA 2DD5A 3E9GA 3SWNB 1I81A 3R6OA 4XK8E 3TW7A 5GAN5 1UGQB 3A8OB 4JRIA 4NL2A 4OGEA 5LJ5h 1Q7YC 5LL6S 5LJ3h 4QW2A 4M7AE 1M8VA 4M7DD 4GLKA 2CYZB 5IN1A 3CCVA 2KQWA 5CVIA 2E41A 3M4YA 1WNLA 1R8OB 1N27A 4QVDA 5CQYA 5GAOr 2XD0A 4J7IA 2DO3A 2CKKA 5FU6C 3QYBA 5GMKm 2GFUA 3JCMg 4A4EA 4QVCA 1VQ6A 3QXEB 3HL8A 3TCJA 2DZCA 3E9FA 4XAXB 4FT4A 2LRQA 3SD4A 3JCMX 4FL6A 1Y96B 1OZ2A 4M75E 1Q7YU 2VUBA 3GNFB 4M75G 3INZA 4L5GA 2E6ZA 3JCMf 1YIJT 2DAQA 1KQSA 1KC8U 2DD4B 2YLBA 2EFIA 4M77E 4XU3A 4BI4A 4M7DG 2P0KA 5CKHA 4MZPA 3HPWA 2K3XA 2Y90A 5CKFA 5HK3A 2G77A 3CC2T 2DXCA 3OQ5A 3QIIA 2Y4XA 3SDZA 1YJNA 1NPRA 5GAMd 3OA6A 3VKIA 4LDXA 2X4WA 3G7ZA 2D9TA 5FU6B 5GANj 3E1SA 2RHUA 2V8IA 5CAIA 3C94A 4MDWA 5GAN3 1XOVA 5GANd 2LCCA 4NL3A 4A53A 4C92F 2DXBA 2IVWA 4EPCA 1D3BA 2O01E 2MI6A 2XDDA 1N8RU 2F5KA 2QQ9A 3SFMA 4PJOF 3BW1A 3TU4K 1BYMA 3RIRA 2E6NA 4J7FA 3SWNC 3CBPA 4X34A 2E70A 4F7UG 1KQSS 3RKXA 4LD6A 1M9SA 3AHUA 2JTMA 4RCBA 5GANh 4JX4A 2FL7A 4OGCA 4M7AF 4M75C 3CCMT 4D6WA 4F7UA 1YHQT 2B8AA 1X6OA 3V7RA 2DD4A 4PL6A 2RB6A 1KHIA 4ZTJA 3DB3A 3GNGA 4LDVA 2QXFA 4BDZA 2MAMA 4M77G 3JCMb 1KHCA 3CEYA 3N5BB 1W2BS 2F69A 2E5QA 4UC4A 4OB2B 4C0DB 4OP0A 4CI0C 2K57A 4IUTA 4MZMA 3HRSA 3PIPA 3CCJA 2CZ6B 4C5IA 3CCRA 4E7IA 1PSFA 4PJOC 1N6AA 2A7YA 2R5AA 1M90U 4IUPA 1QVGA 3CD6T 1G3SA 4IUQA 3OW2A 4PNOA 3OS0A 1LJOA 3M54A 4EMKA 4C0GA 4M78A 1IREB 5LJ3f 1NJIC 2MF2A 2MMPA 3CCLA 2ZPHB 3QZ5B 1FXXA 3ZBDA 1KG1A 3HSBA 1U1TA 4MMLA 2X35A 3RERA 5CCAA 1DJ7B 3META 2K5IA 3EFSA 3JCMd 3EAEA 3QYGB 3TEEA 1VQLT 3HZJA 2XG8D 5GAOq 2XU8A 4XTWA 3L2QA 1U8RA 2QDYB 3H6ZA 3GP8A 4C92E 1JB0E 3QJ6A 3KXTA 1M1KU 5LJ5e 3JB9I 5GAMh 1G3WA 1WQ7A 1I8FA 2A3LA 2LQKA 2DXCB 2GFAA 4XU2A 2RHYA 4MFEA 1HK9A 2E65A 2QQSA 4TVRA 2JUFA 4JDSA 1FWZA 4J83A 3A5ZB 3M53A 4KULA 5FU7C 3JCMe 4M78B 4R55A 1QVFS 3LLRA 2XIDA 3MP6A 1Q81U 3LW5E 4M7AB 5FRNA 3S6WA 2WSCE 1Y96A 3QKJA 1QP2A 4Y28E 5I2MA 5J26A 1VQMT 1Q86C 2RI5A 1YITT 4FM4B 4II1A 4J5YA 1EIFA 3QPHA 5CO7A 5GAMg 1VQ8T 1VQLA 5C0MA 1YITA 3H4CA 3S3MA 3M59A 3LGFA 1G3YA 3OBYA 4LD9K 1Q81C 3DL1A 4Z6YA 3V7SA 4OVAA 4L59A 4JRQA 4C5HA 4ELYC 4JLGA 1UGRB 2L3RA 2VGNA 1RL2A 2YRVA 5EJCA 4OF1A 4F7UB 3VJPA 2BS2A 4XTUA 1WJSA 5GANf 3FDRA 4MMKA 3LGLA 2RHIA 5C6SA 3A8MB 3RMQA 4X9DA 3T9NA 3JSCA 4LDYA 5GMKj 2GF7A 3HBLA 3MP1A 5GAN7 3MEUA 4C8QG 4P5NA 2QQAA 3CMAA 1JJ2S 3OMGA 2JNGA 4E7JA 4N4GA 4C0DC 4HCZA 4OB1B 1JBMA 4BACA 2JZ2A 3VU3C 3CMAT 1VQNT 3H8ZA 4BD3A 1VQPA 1M1KC 4MIMA 1Q82U 4NOYA 3OMCA 3GLXA 3OYHA 3OYIA 4BE0A 3NFCA 3BG5A 1K8AC 1NZ9A 4C92D 3QSUA 2QQBA 3HFNA 5LJ3g 3A8GB 4C5EA 2L5QA 3DKMA 3L2WA 2BS4A 2RK2A 4M75B 1K9MC 3QYEA 3CC7A 4XTYA 1BIAA 2DEQA 3DLMA 2ZGWA 4M77C 4C92G 1VQ4A 1B34B 4M7DB 3QDRB 2KAFA 5D6YA 4RCCA 3OYYA 2K4YA 3CBOA 3I55T 2L89A 2HQEA 2ZPBB 2M1HA 3QZ9B 1Q86U 4M78F 5EG2A 1UB4A 2KVQG 2QQRA 2DTIA 4N0AA 1W2BA 4HLQA 5D6WA 2KK4A 3BG9A 4KUIA 1ZHIA 5FLXE 2RI2A 5GAOn 1GXIE 1QW1A 5J3BA 4M75D 3S3NA 2LT1A 3CCSA 1M5Q1 2K3YA 4WF2A 1VIEA 2EQKA 2VC8A 2EQUA 3URGA 3CCET 1YJ9A 1X75C 4Q5WA 4C8QB 5GMKe 5FRMA 2DXBB 4M75F 4ME7A 4M6VA 1JRIA 3WVDB 2JVVA 4R56A 4M78D 1KD1C 4J6YA 1VQKT 5GAN4 3O8VA 5LJ5f 2VXFA 3CCRT 4BI3A 2EIFA 1UEBA 2RJEA 4F7UE 3FC3A 1VQ5A 5GAN8 3OYCA 4QSHA 1RI0A 2QI2A 1ZQ1A 3M9QA 4M78G 1P92A 5A0DA 3M5AA 3HB9A 3G6ET 3X25B 2DIQA 1H641 3J7AF 5CKEA 5FROA 4Z02A 2PUKB 3UDCA 4A4KA 3VV0A 2E64A 3FLGA 2GCXA 5LJ5d 3OW2S 4C5GA 1QVFA 2PVDB 5LJ3d 2M16A 1YJWA 3QJYA 1Y7XA 4A4FA 2C06A 3G4SA 3CBMA 4E7HA 5KH6A 1V29B 4EMHA 1BKBA 2FVUA 3PMTA 1YJWT 3NTHA 1LOJA 1VQ6T 3JCMh 2XKOC 4LOCA 4E47A 2VV5A 1Y71A 5GAMj 2EQJA 3QBYA 4PJOE 1QP3A 1VQPT 1K9MU 3CCST 2RJCA 3CC4A 4JS5A 3L2ZA 2R58A 4M7DE 3G6EA 4ZN1A 2RJDA 1FKMA 2WSFE 4PKCC 4HT8A 3VKGA 4C8QA 1G5VA 4BI8B 3GOXA 3GF5A 4HNTA 4QQGA 3FIFA 1XQHA 3TREA 3QWLA 4O5VA 3G4ST 3DLLA 3HRUA 3UWNA 3BY7A 3V8LA 5A2QE 3OS1A 3VYGA 5LJ3e 3OYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QXE B;  2ZPE B;  2CZ0 B;  3WVE B;  1UGR B;  2DD4 B;  3A8M B;  4ZGD B;  2ZZD B;  2DXC A;  1PSE A;  2ZPF B;  3X28 B;  4OB1 B;  2PUO B;  2DXB A;  2CZ1 B;  2O01 E;  4ZGE B;  2DPP B;  1UGP B;  4ZGJ B;  2CZ7 B;  3A8G B;  3A8L B;  2WSE E;  3X26 B;  2PVO B;  2ZPB B;  3QZ9 B;  2DD4 A;  2PVG B;  3VYG B;  2ZZD A;  1GXI E;  5L8R E;  4OB2 B;  3VYH B;  2DD5 B;  2DXB B;  2CZ6 B;  3WVD B;  1PSF A;  3X20 B;  4OB0 B;  1IRE B;  3QYH B;  2ZPH B;  1UGS B;  3QZ5 B;  1AHJ B;  2ZCF B;  1DJ7 B;  2D0Q B;  3X25 B;  3QYG B;  2PUK B;  2PU9 B;  4OB3 B;  2QDY B;  2ZPI B;  2PVD B;  1JB0 E;  4RKU E;  1V29 B;  3HHT B;  4KT0 E;  1QP3 A;  2DXC B;  3A8H B;  2DD5 A;  2ZPG B;  3X24 B;  2WSF E;  4XK8 E;  1UGQ B;  3A8O B;  2AHJ B;  2CYZ B;  3LW5 E;  4L6V 5;  2WSC E;  4Y28 E;  1QP2 A;  4FM4 B;  3VYG A; 
#chains in the Genus database with same CATH topology
 2W2H A;  4C92 C;  2K2M A;  1H1Q B;  1M1G A;  4MDX A;  3QUI A;  2FHD A;  2LQ8 A;  3CD6 Q;  1G3T A;  4ROC A;  4XU0 A;  5CR2 A;  4JJB A;  2Y4Y A;  1OIY B;  2IIM A;  3V8J A;  2YUO A;  1YWP A;  1VQ8 Q;  1VQ8 A;  2JN0 A;  1QVP A;  2L8D A;  4PFO A;  3X28 B;  2BZ8 A;  3CXC A;  2RH2 A;  5CK9 A;  4F6S B;  4BCQ B;  2V22 B;  4IIM A;  2M9U A;  2CZ1 B;  1UGP B;  2LJ0 A;  1C1A A;  5IDP B;  1XTD A;  3BDL A;  1KQ2 A;  5LJ5 j;  3X26 B;  1H27 B;  3HRT A;  2EJF A;  2HKQ B;  3O0G D;  1D3B B;  3REA B;  1TUG B;  2LCL A;  4BB7 A;  4G6L B;  2CP3 A;  4ZN3 A;  1VQO A;  2FB7 A;  3OYB A;  1WI7 A;  1VQO Q;  4CFW B;  5DLO A;  3L2U A;  1LVK A;  1AEY A;  2WPA B;  4WTO B;  1VQL Q;  2OTJ T;  3TQ7 P;  3G33 B;  3NDQ A;  4YOO A;  1VQ9 A;  3MO8 A;  1X2Q A;  2YRD A;  2QEX T;  7AT1 B;  3D7S B;  3ER0 A;  3H41 A;  1H8K A;  1XJW B;  2YXY A;  4LXC A;  3VS1 A;  3CME A;  4ELJ A;  4M7A C;  2DL3 A;  4BCI B;  3P8D A;  1ENW A;  5GAO p;  1KC8 C;  1YCY A;  3JAM E;  2JTE A;  2NUP A;  1B3Q A;  1WHG A;  3EFO A;  1WXB A;  1R0C B;  2X4Y A;  4CXA B;  4R0K A;  2RNA A;  2NLU A;  3CPW S;  2MOX A;  3EGD B;  3OY9 A;  4RG2 A;  3LWI A;  1ZSZ C;  3OYF A;  1LCK A;  1MGQ A;  2GGR A;  3NTI A;  3OYN A;  3X24 B;  1VIN A;  4IUV A;  5BNJ B;  2MWP A;  3VKH A;  2KI7 A;  4M7D A;  4QQD A;  4WCI A;  5GMK l;  4L6V 5;  4M78 E;  3S3O A;  1HXD A;  2VB6 A;  2BIV A;  1MMN A;  1CKA A;  2CSQ A;  2DXU A;  3CCS Q;  4PJO B;  3OSS C;  2CRE A;  5DY9 A;  1OUL A;  3C4S A;  1NJI R;  1VQM Q;  2C5O B;  1MMA A;  3VRY A;  2EKO A;  1RLP C;  2AIR B;  3JB9 G;  2ESW A;  1UG1 A;  3LX7 A;  2C6T B;  3BG3 A;  4ZGD B;  4MFD A;  2PJQ A;  1TSF A;  3UT1 A;  3CCL T;  2C0I A;  2EJ9 A;  3PNW C;  1M27 C;  2LQW A;  1O9S A;  4DQ2 A;  1I4K 1;  2QA4 A;  3IQL A;  2V1Q A;  2DKG A;  4JZ4 A;  3PTA A;  2CZ7 B;  3PGG A;  4J8O A;  4CFV B;  1M90 R;  3OYD A;  2RPN A;  2KMG A;  3A8L B;  2C0O A;  1BI3 A;  3RMS A;  3MCA B;  3KHI A;  3EID B;  3CC4 Q;  3RR6 A;  1K73 C;  2QFZ A;  3FEO A;  4PLL A;  2DRM A;  4PJJ A;  3L42 A;  1T0H A;  3VYG B;  3M56 A;  4C0F A;  2LCS A;  4AI6 A;  2LDM A;  1I5L A;  4ATO A;  2WAC A;  3CC7 T;  4C0Z A;  4C8Q C;  2P0Q A;  4OB0 B;  4CRL B;  1FIN B;  2RQW A;  2LNH B;  4LDU A;  3E19 A;  2ZCF B;  1S72 A;  2O2O A;  2XHC A;  4Y92 A;  2FEI A;  2HD0 A;  2KSS A;  3ZEH A;  1FVV B;  4FYV B;  3QHR B;  1WHH A;  5HK0 A;  2LP5 A;  2H8H A;  4AKH A;  3HP9 A;  3HHT B;  3M58 A;  5KCH A;  2CUB A;  1X27 A;  5KYY A;  3CPW A;  1QLB A;  3PT9 A;  3CCM A;  3A8H B;  1I81 A;  4PFP A;  4XK8 E;  5GAN 5;  3A8O B;  5LL6 S;  5LJ3 h;  2QGG A;  2DVJ A;  5I11 A;  4GLK A;  3PVQ A;  2E41 A;  2V26 A;  3M4Y A;  1WNL A;  1R8O B;  1RAB B;  1GH6 B;  4F7J B;  5CQY A;  4QVD A;  5GAO r;  1Q95 G;  5ECA A;  2CKK A;  3JCM g;  1VQ6 A;  3HL8 A;  3E9F A;  1VQ6 Q;  2LRQ A;  3JCM X;  1OKW B;  2DNU A;  4M75 E;  3GNF B;  4M75 G;  4FX3 B;  4L5G A;  2E6Z A;  3TNH B;  2J05 A;  2DD4 B;  4M77 E;  2P0K A;  2AZV A;  5CKH A;  2Y90 A;  2G77 A;  2HMA A;  1E6H A;  2K3B A;  1D0X A;  1X69 A;  2D9T A;  5GAN j;  4EOO B;  4CC7 A;  4E7S A;  5EC7 A;  1WHK A;  4C92 F;  2DXB A;  4EPC A;  4EOK B;  3SFM A;  3BW1 A;  4EOJ B;  2VWF A;  2EGE A;  3CBP A;  4YC3 B;  2E70 A;  3RKX A;  3EOC B;  2WIP B;  2CDT A;  3H0F A;  4FYW B;  1K76 A;  1H24 B;  3I56 Q;  3CCM T;  4BCF B;  1YHQ T;  1WHM A;  3V7R A;  4ZTJ A;  1NM7 A;  3GNG A;  4LDV A;  4KRD B;  2F69 A;  4UC4 A;  2HZY A;  2DBK A;  1MMG A;  4E7I A;  4EON B;  3CCR A;  3E2U A;  1PSF A;  2A7Y A;  4ELL A;  2R5A A;  3NGP A;  1M90 U;  3CD6 T;  4M78 A;  5LJ3 f;  1NJI C;  1YCS B;  3ZBD A;  2LX7 A;  2W10 A;  2EVR A;  1H92 A;  2XG8 D;  1UNG D;  3H6Z A;  2DL7 A;  1AWJ A;  4C92 E;  3KXT A;  4OML A;  2C0T A;  1WQ7 A;  2C4G B;  2ROL A;  1M30 A;  2CUD A;  2LQK A;  2GFA A;  2E65 A;  1D0Y A;  4JDS A;  4F17 A;  2BTT A;  4EIK A;  1MND A;  1Q81 U;  2CP7 A;  4M7A B;  4IMY B;  1N4M A;  1Y96 A;  4Y28 E;  5I2M A;  1VQM T;  4YOZ A;  4FM4 B;  4II1 A;  4J5Y A;  1NLP C;  3M59 A;  3V7S A;  4JRQ A;  1I5O B;  4OMM A;  1UGR B;  2VGN A;  2WXV B;  3VJP A;  1U3O A;  2OAW A;  1WJS A;  4MMK A;  3LGL A;  3RMQ A;  5GMK j;  1OQK A;  1NEG A;  1WXT A;  3UF4 A;  1PRM C;  4N4G A;  1JBM A;  4BAC A;  2AT1 B;  4NOY A;  2LW4 A;  1Q82 U;  3OMC A;  3OYH A;  3OYI A;  3BG5 A;  4YOS A;  1NZ9 A;  1RAH B;  4C92 D;  4IIO A;  3HFN A;  4C5E A;  2ECZ A;  2FPE A;  2VVK A;  5AT1 B;  1K9M C;  1QKX A;  4CC2 A;  3DLM A;  1VQ4 A;  3QDR B;  1P5E B;  4RCC A;  1B7T A;  1FYN A;  2K4Y A;  3I55 T;  4J9D A;  1OU9 A;  2ZPB B;  3UA7 A;  1BU2 A;  1VOL A;  1X2K A;  1SG5 A;  2KVQ G;  4HLQ A;  2COZ A;  2DFU A;  5D6W A;  5FLX E;  5GAO n;  1QW1 A;  5J3B A;  4BCN D;  3GTM S;  1YJ9 Q;  1YJ9 A;  4Q5W A;  5FRM A;  5GMK e;  4R56 A;  1JRI A;  1IGU A;  4LE9 A;  3CCR T;  1PWT A;  1W2B P;  2EIF A;  2RJE A;  4OGR B;  4NST B;  2EBP A;  2KE9 A;  1VYV A;  3M9Q A;  1GY3 B;  1UFF A;  1J3T A;  5A0D A;  3G6E T;  2J6K A;  3X25 B;  2HL5 C;  3NPF A;  5FRO A;  4Z02 A;  2PUK B;  3UDC A;  4QKU A;  1QVF A;  1Q81 R;  5LJ5 d;  2G6F X;  4C5G A;  1IB8 A;  4AMC A;  2M16 A;  4RTU A;  4A4F A;  1WXU A;  3M0Q A;  3NTH A;  2QTV A;  3QHW B;  2EQJ A;  3QBY A;  2X3W D;  1QP3 A;  2DER A;  1K9M U;  2RJC A;  5IHY A;  3CC4 A;  3QDF A;  1FKM A;  1K1Z A;  3H0H A;  3GOX A;  3GF5 A;  1NYG A;  2EYY A;  3FIF A;  1XQH A;  1QCF A;  3EGX B;  3DLL A;  2YUQ A;  3UWN A;  3V8L A;  3OYK A;  4ORZ A;  1F1B B;  2P84 A;  2MYS A;  3OS5 A;  3JCM W;  2DTH A;  2HBW A;  2WMA B;  4BDY A;  3JCM J;  2RHZ A;  4BCQ D;  3CCJ Q;  1K0X A;  2AKK A;  2MK5 A;  5I21 A;  4PJO A;  3CCV T;  2VYT A;  1JXM A;  2QEX A;  1RI9 A;  4BUG A;  2DA9 A;  2HAX A;  3MP8 A;  1OL1 B;  1E7O A;  2SRC A;  3H0I A;  3BFM A;  1N9S A;  4EOI B;  2KYM A;  4M7D C;  1KQ1 A;  5IF1 B;  3OYL A;  1H3H A;  2EQM A;  5IDN B;  4A4G A;  1OGU B;  2V8J A;  5CKB A;  4IUU A;  5I2S A;  3JB9 H;  2XMF A;  1PC0 A;  2KMT A;  2RM4 A;  1VYU A;  2QDJ A;  4NS5 A;  5GAM e;  4C8Q E;  2OTL A;  3OYJ A;  3BHT B;  3ME9 A;  3M03 A;  1X01 A;  2LX9 A;  2KT1 A;  2GBQ A;  3RKY A;  4HL4 A;  2DRK A;  3PMI A;  3CC4 T;  4N0A C;  1UTI A;  3V7C A;  2IW6 B;  2P0P A;  2KR6 A;  4CRI A;  2EYQ A;  1WJR A;  4Y91 A;  4ANJ A;  4EMG A;  1PCX A;  2LNV A;  4C8Q D;  4DEY A;  2VXE A;  2DK3 A;  1IRX A;  1LNX A;  3VYH B;  1SHG A;  4XQ3 A;  5AYF A;  4AFS C;  2JM9 A;  5ACB A;  2BE7 D;  2F2V A;  5FGK B;  4QQ6 A;  2XDB A;  2DL4 A;  2RI3 A;  3JCM P;  3L2R A;  2D0Q B;  2I40 B;  2HCK A;  4FSX A;  1GUX A;  2JTF A;  5LJ3 j;  2PU9 B;  4DOW A;  1Q86 R;  2G9X B;  3JB9 F;  1AVZ C;  2F2X A;  4F6U B;  3R6N A;  1Z9Z A;  1H26 B;  3I56 T;  4HCB A;  1VQ5 T;  2K79 A;  4VUB A;  2K7A A;  4C8Q F;  5KE3 A;  4J6W A;  1ZSZ A;  2LC4 A;  1YI2 T;  4J9B A;  2CSI A;  1AZG B;  5LJ5 g;  1JU5 C;  2AHJ B;  3JB9 J;  2RA2 A;  2QYZ A;  2E12 A;  1KD1 U;  2A0F B;  2KYB A;  2CCI B;  2P4T A;  3OYG A;  2DEU A;  2QK0 A;  1VQM A;  1Q7Y C;  2RHX A;  2G3R A;  3U23 A;  1U1S A;  4BCG B;  3FJP A;  1MHN A;  1W1F A;  5KCO A;  2BZX A;  2RD1 A;  2A28 A;  3P8H A;  1RAG B;  2QQ8 A;  2VGM A;  2J7I A;  4CFX B;  5HBH B;  2ZPF B;  2C5V B;  2HNI A;  2E1H A;  1I07 A;  3CCQ A;  4JX5 A;  3GBQ A;  3JCM V;  3OS2 A;  1VUB A;  3KBG A;  2QA4 Q;  3G4S Q;  6AT1 B;  1YJN Q;  1BCO A;  1FMW A;  1B34 A;  1N8R C;  4ZGE B;  2RF0 A;  3RDV A;  5GAO l;  2K5F A;  2DME A;  3EG2 A;  4PJM A;  3VUB A;  2E10 A;  2QF7 A;  1UDL A;  3TNW B;  2KEA A;  4B9X A;  3TSW A;  1TH7 A;  1UNH D;  2DIL A;  2DTO A;  4PJO G;  5KE2 A;  2DM1 A;  1VQ7 T;  2LT4 A;  1TG0 A;  2YHT A;  3CC2 A;  1W4S A;  2W99 A;  2ZZD A;  1PG5 B;  3CC2 Q;  2X9H A;  1URC B;  2IG0 A;  3PVL A;  2DD5 B;  2AKL A;  1N9R A;  1SPK A;  4OMF B;  5HNB B;  5IXF A;  2X4X A;  1WIE A;  3X20 B;  5KYW A;  2HSP A;  4F7N B;  5GAO m;  1YNZ A;  2CGH A;  1YJ9 T;  1JJ2 A;  1WQW A;  2RMO A;  1JO8 A;  2O4X B;  2RO0 A;  4J6X A;  2FPD A;  2OTJ Q;  3ZFJ A;  4B9W A;  1OX9 A;  2M02 A;  1ZUU A;  2KY9 A;  1S1N A;  1RAC B;  2DMO A;  3VS0 A;  3CCU T;  4RUG A;  4JUV A;  4RG8 A;  4UN0 A;  4EMK B;  4OB3 B;  3F5X B;  2NUZ A;  4CC3 A;  2ZPI B;  1NE8 A;  5LQF B;  3PFS A;  2XK0 A;  3CME T;  3H9N A;  1V76 A;  3I56 A;  2P4R A;  4RTT A;  2DD5 A;  3E9G A;  3BLH B;  3CXC P;  1M3C A;  2W0Z A;  3TW7 A;  1UGQ B;  3A1P A;  4JRI A;  4NL2 A;  2BE9 B;  2CYZ B;  5CVI A;  1C0M A;  4BCH B;  2FO0 A;  1F5Q B;  2GFU A;  4QVC A;  3QXE B;  2CP6 A;  1PM3 A;  4XAX B;  1TUC A;  4FT4 A;  5L2W B;  1I0C A;  1Y96 B;  1ZBJ A;  3INZ A;  2W9F A;  1YIJ T;  2BZY A;  1UHC A;  2X3X D;  2DAQ A;  1KC8 U;  3M0U A;  4M7D G;  5CKF A;  2K3X A;  5HK3 A;  2EGC A;  3QII A;  4J9G A;  3QWX X;  1YJN A;  1NPR A;  3VKI A;  1TWB A;  5FU6 B;  1TFB A;  1U06 A;  4CFN B;  2L0A A;  2COW A;  1XOV A;  1K9A A;  3CMA Q;  1D3B A;  4LN2 A;  2MI6 A;  2QQ9 A;  2IW9 B;  1M3A A;  2DX1 A;  1BYM A;  1NYF A;  1WFW A;  2E6N A;  4J7F A;  3FJ5 A;  5D7U A;  4X34 A;  4EOR B;  4F16 A;  2HKN A;  2E4H A;  4D6W A;  4F7U A;  2B8A A;  2JW4 A;  4GLM A;  4ESR A;  4PL6 A;  2ENM A;  1KHI A;  2RB6 A;  4FYX B;  4CFM B;  2MAM A;  2DL5 A;  3JCM b;  3EH2 A;  1FMV A;  4OP0 A;  4IUT A;  2KRS A;  3HRS A;  3CCJ A;  4C5I A;  4LUE A;  3HTR A;  2DL8 A;  1N6A A;  4II5 B;  3OW2 A;  2YRC A;  1K8A R;  4EMK A;  1IRE B;  3QZ5 B;  5KYX B;  3RER A;  1U1T A;  3BHV B;  2NWM A;  2X35 A;  1KG1 A;  2SEM A;  2KRM A;  2KGT A;  5CCA A;  3MET A;  3EFS A;  4PFZ A;  1VQL T;  1KK7 A;  1U8R A;  3DTO A;  1Z9Q A;  4F7L B;  1AD6 A;  1ZA1 B;  3GP8 A;  3M0R A;  3QJ6 A;  2I0N A;  5GAM h;  2A3L A;  1HK9 A;  4F04 B;  2QQS A;  3M53 A;  4KH1 B;  4DBQ A;  2MIO A;  3LLR A;  3MP6 A;  3S6W A;  2WSC E;  3PE0 A;  1Q86 C;  4Z89 A;  1YIT T;  1UGV A;  5CO7 A;  1TD6 A;  1GCP A;  5C0M A;  3H4C A;  3LGF A;  1G3Y A;  1YIT Q;  3DL1 A;  4OVA A;  3EG1 A;  2YRV A;  3RNJ A;  4OF1 A;  5KYW B;  1ZSG A;  4F7U B;  2M51 A;  3VRZ A;  4KGX B;  2UZD B;  4XTU A;  2E5K A;  1JOW A;  1E9H B;  2DYB A;  3A8M B;  4X9D A;  1H1P B;  5GAN 7;  3MEU A;  4P5N A;  2QQA A;  2JNG A;  1W6X A;  4E7J A;  4CFU D;  4C0D C;  4J9H A;  4BD3 A;  1VQP A;  1M1K C;  4MIM A;  1Y0M A;  1IO6 A;  4BE0 A;  2HL3 A;  2J06 A;  2QQB A;  2L5Q A;  3DKM A;  3L2W A;  4BY1 X;  3POM A;  2BS4 A;  1EZZ B;  4XTY A;  3M0S A;  3NHN A;  2ZGW A;  3DJB A;  4C92 G;  1GFD A;  1B34 B;  2YUP A;  3CQT A;  2KAF A;  1K4U S;  2IVX A;  3OYY A;  2M1H A;  1Q86 U;  3RBB B;  1UB4 A;  4N0A A;  4Y72 B;  3BG9 A;  2CCH B;  2LT1 A;  4DBH A;  2K3Y A;  1VIE A;  2EQK A;  2VC8 A;  3CCE T;  2UUE B;  3QWY A;  2JVV A;  2QEX Q;  3WVD B;  4M78 D;  1KD1 C;  1ABO A;  1D1B A;  4BI3 A;  1G3N C;  4F7U E;  1UEB A;  5GAN 8;  2QI2 A;  2QDL A;  3M5A A;  2FPF A;  1KXU A;  5CKE A;  4A4K A;  3VV0 A;  2E64 A;  2GCX A;  1IHV A;  2PVD B;  5LJ3 d;  3JV3 A;  1Y7X A;  5FWC A;  2C06 A;  5KH6 A;  4AFQ C;  1VQP T;  3CCS T;  1UE9 A;  3L2Z A;  1WZO A;  1WHL A;  3VKG A;  4C8Q A;  2EYX A;  2DE0 X;  2CP0 A;  5FWB A;  2DLP A;  1PRL C;  2QG9 B;  4E7Z A;  3G4S T;  3AT1 B;  4GBQ A;  3OS1 A;  5A2Q E;  1RAD B;  4KH0 B;  1EX4 A;  3C12 A;  3EG9 B;  4IKF A;  1XNI A;  3OYM A;  4X9C A;  3EJ1 B;  1QCN A;  5D6X A;  4BY6 C;  2FRW A;  3RKW A;  5CEI B;  3MHX A;  2AK5 A;  2AZS A;  1X6G A;  1MV3 A;  5IXB A;  4BY6 B;  5DM7 R;  4I3Z B;  2H3E B;  3P8B B;  4BCO B;  4OMP A;  1YWO A;  1ZX6 A;  4M7A A;  3CCQ Q;  3DOG B;  4M75 A;  5KYN A;  2O31 A;  3JCM c;  1YJN T;  1RLQ C;  4AG1 C;  3I55 Q;  2DPP B;  4HVU A;  1UUE A;  4E6R A;  4E7K A;  1X43 A;  2XI9 A;  2COY A;  2OAU A;  1S72 T;  1IZ6 A;  1M8M A;  5KYY B;  2Z0W A;  4QT7 A;  4KRC B;  3SEM A;  4JRK A;  4NC6 A;  1PKD B;  2OTL T;  2ABL A;  3G71 T;  1GCQ C;  2PZ1 A;  3FB9 A;  2PVO B;  1PD1 A;  1SF9 A;  4ZNX A;  4EC9 B;  5HY6 A;  1OL2 B;  1QWF A;  4EC8 B;  4JRP A;  1QVG S;  4OR5 B;  1M4Z A;  1FX7 A;  2L2P A;  1M1F A;  1VQN A;  2EYZ A;  1H3Z A;  3UPU A;  4IUR A;  1GBR A;  2XDP A;  1WPY A;  4F14 A;  5IHK A;  2W9Z A;  3QHS A;  1YIJ A;  3G71 Q;  3QYH B;  2PQW A;  1UGS B;  1OPL A;  2OTJ A;  2EKH A;  4J9F A;  1V1C A;  1WGS A;  4AKI A;  3OYE A;  1ARK A;  5GMK i;  3ASK A;  3WXM B;  2HBP A;  4KBM B;  2M0Y A;  2RN8 A;  3CCQ T;  1HJD A;  2EJG A;  1Y57 A;  2WMB B;  4KT0 E;  4JS4 A;  1VQ9 T;  4M77 B;  3G6E Q;  3SB2 A;  2DVE A;  2ZPG B;  4EDU A;  4ZTF A;  1E7P A;  1OZ3 A;  5CKD A;  5CIU A;  1O75 A;  4PK4 A;  2HQX A;  1K73 U;  1VIF A;  2VAS A;  5GAN 6;  1D1C A;  2OI3 A;  2LZ6 B;  1OI9 B;  1NBE B;  2ZPE B;  2JXB A;  2D1X A;  3V8K A;  2CZ0 B;  3VS7 A;  5M9O A;  4LDW A;  1SSF A;  2DJZ A;  5CQX A;  4XU1 A;  3BHU B;  1H28 B;  1R0B G;  1WJQ A;  3MEV A;  4N4H A;  2X4J A;  3NTK A;  3CCE Q;  1VQ5 Q;  1BIB A;  3M55 A;  3KUF A;  2D6F A;  5DQV A;  1XO2 A;  2J6F A;  4JLI A;  4MZT A;  3RES A;  2A36 A;  2EWN A;  1JEG A;  1FMK A;  3M4G A;  5HQ0 B;  1MNE A;  4AKG A;  4M78 C;  4BY7 X;  5IH2 A;  3L2V A;  4DA4 A;  1BI2 A;  2HSE B;  2WSE E;  4M7D F;  1D1A A;  3JCM Q;  4HXJ A;  1SSH A;  1OPK A;  3QO3 A;  2UZL B;  2HDA A;  1RAE B;  4V2S A;  2PVG B;  2JT4 A;  4PJO D;  1O9K B;  2F2C A;  2JMC A;  4BCP B;  3GIB A;  5J39 A;  3MY5 B;  1OEB A;  1OV3 A;  3EG9 A;  1YN8 A;  2V8K A;  3M57 A;  1M90 C;  5IAY A;  3GPL A;  5HKC A;  1RUW A;  1QWE A;  4FU6 A;  1NJI U;  3EFR A;  5A0L A;  4JJN K;  3O5Z A;  4RTZ A;  1KSW A;  2ZAE A;  5GAM f;  2R5M A;  1WDX A;  1B07 A;  2DBM A;  1BB9 A;  1W98 B;  3OYA A;  3FRN A;  1VQO T;  1M3B A;  2R57 A;  1WLP B;  5GAN g;  2CS7 A;  2K2V A;  3EHR A;  3R6O A;  5LJ5 h;  4OGE A;  1NLO C;  4QW2 A;  4F7S B;  3CCU Q;  1A0N B;  1N27 A;  1KD1 R;  2XD0 A;  2DO3 A;  5GMK m;  3QYB A;  4A4E A;  3UAT A;  2DZC A;  1ACM B;  4PJN A;  4PJL A;  4FL6 A;  2VUB A;  1C9B A;  3JCM f;  1VQN Q;  5HBJ B;  5GJW B;  1KQS A;  2EFI A;  4BI4 A;  2WIH B;  3HPW A;  1SHF A;  2CT4 A;  4JJD A;  1PKT A;  3CC2 T;  4TTH A;  2DXC A;  3DDP B;  2L3Q A;  3SDZ A;  3OA6 A;  3G7Z A;  3E1S A;  2KT8 A;  5CAI A;  1G83 A;  3C94 A;  4MDW A;  4F70 B;  2UZE B;  5GAN d;  2LCC A;  2LQN A;  3EHQ A;  2KRO A;  3EGD A;  2O88 A;  1WA7 A;  4BCN B;  2PHG A;  4AFU C;  4F7U G;  3TNI B;  1VOM A;  1M9S A;  4RCB A;  5GAN h;  4JX4 A;  4M75 C;  3LQ5 B;  5IHI A;  1X6O A;  2CP2 A;  2DD4 A;  4CC4 B;  3DB3 A;  1EFN A;  4HVW A;  4M77 G;  3CEY A;  1W2B S;  3N5B B;  2E5Q A;  4AT1 B;  4OB2 B;  2QAS A;  4CI0 C;  2K57 A;  4MZM A;  3PIP A;  4BCJ B;  2A08 A;  1QVG A;  1G8X A;  1GUX B;  1PKS A;  3M54 A;  2YWW A;  2MF2 A;  4DBR A;  4MML A;  5GJV B;  3EH1 A;  3JCM d;  3MIA B;  1QMC A;  2K6D A;  3TEE A;  3HZJ A;  5GAO q;  2XU8 A;  3L2Q A;  1MUZ A;  3OW2 P;  2YDL A;  4J9E A;  1JB0 E;  2OTL Q;  2B9R A;  3JB9 I;  2L3S A;  4ROD A;  1G3W A;  2EW3 A;  2IW8 B;  1QLY A;  4XU2 A;  2ED0 A;  2RHY A;  1GCQ A;  4MFE A;  1W70 A;  1FWZ A;  4J83 A;  3A5Z B;  1M1K R;  1SKU B;  4KUL A;  4R55 A;  3KFV A;  1WHJ A;  2XID A;  3LW5 E;  3QKJ A;  2WEV B;  2RI5 A;  1I1J A;  1VQ8 T;  3QPH A;  5GAM g;  1YIT A;  4FSS A;  1QCO A;  3S3M A;  1VQK Q;  4L59 A;  1GRI A;  4JLG A;  1YIJ Q;  4EOS B;  2L3R A;  1SRL A;  1SEM A;  2BS2 A;  1KFZ A;  5GAN f;  1H25 B;  3FDR A;  1H1R B;  3T9N A;  2GF7 A;  1RAA B;  1HD3 A;  3EGU A;  2FRY A;  4C8Q G;  3RGF B;  3CMA A;  3OMG A;  2ATC B;  2EQI A;  3EG0 A;  4HCZ A;  3VU3 C;  4F6W B;  1JJ2 P;  3GLX A;  3TN8 B;  1YHQ Q;  3NFC A;  1D0Z A;  1K8A C;  3QSU A;  3A8G B;  4M75 B;  3QYE A;  3CC7 A;  1BIA A;  4RTY A;  1ZSZ B;  1RAF B;  2KXD A;  3CCM Q;  2L89 A;  2HQE A;  4M78 F;  5EG2 A;  2FG0 A;  2QQR A;  1T0J A;  3ULR B;  2KXC A;  2KK4 A;  4KUI A;  2I53 A;  2RI2 A;  2KBT A;  1GXI E;  2O9V A;  4BCM D;  1BBZ A;  3CCS A;  1M5Q 1;  2ROT A;  2MCN A;  2DXB B;  4ME7 A;  4JZ3 A;  1O9K A;  1JSU B;  5GAN 4;  3O8V A;  5LJ5 f;  2PK9 B;  2VXF A;  2GTO A;  4DBF A;  3OYC A;  4QSH A;  1RI0 A;  4M78 G;  3VS5 A;  3I5R A;  2LJ1 A;  3HB9 A;  3BE3 A;  1CSK A;  2NUT A;  1H64 1;  3J7A F;  4KGV B;  3FLG A;  5I5Z B;  1YJW A;  2D0N A;  1OIU B;  2CP5 A;  4AFZ C;  3CBM A;  4E7H A;  5FW9 A;  1BKB A;  1LOJ A;  1VQ6 T;  3JCM h;  4LOC A;  4E47 A;  2PNI A;  4PJO E;  1Y71 A;  5DQW A;  2EPD A;  4M7D E;  3G6E A;  2A37 A;  1IXD A;  1PHT A;  2X1N B;  5I22 A;  4HNT A;  4QQG A;  4HCK A;  4LUD A;  3TRE A;  3QWL A;  4FW2 A;  1VYT A;  3HRU A;  1ZBX A;  8AT1 B;  1VQK A;  3WVE B;  4EMK C;  4HA8 A;  1BU1 A;  1HSQ A;  3G71 A;  5EFQ B;  4RTX A;  1IHW A;  2QA4 T;  1VQ7 A;  2O4X A;  4X1V A;  3TW6 A;  2E3I A;  3VUZ A;  2KDS A;  3HFO A;  1VYW B;  3JRZ A;  1VQP Q;  4E7L A;  2MPX C;  1YHQ A;  3L1A A;  2E3H A;  3CPF A;  3CXC S;  3REB B;  4A4H A;  3J81 E;  4N4I A;  2BS3 A;  3MY1 B;  4CFU B;  1Q82 C;  2K5L A;  2JOY A;  1WX6 A;  2F5T X;  1K8A U;  2GQV A;  2IN3 A;  2KNB B;  2I2L A;  3CCU A;  3OBW A;  1GBQ A;  4A63 B;  4FIB A;  3A98 A;  3M0T A;  3OSV A;  2JM8 A;  2RK1 A;  4RMO A;  3MKD A;  4C92 A;  3VS3 A;  4HCC A;  3QG1 A;  2K9G A;  4BBS M;  5A0G A;  2D8J A;  4DOV A;  4M77 A;  4XTZ A;  2BUD A;  2C5X B;  1BI0 A;  3JB9 D;  2JMA A;  4M4Z A;  3RUX A;  5HBE B;  4HNV A;  4XTX A;  2LJ3 A;  2ED1 A;  4M77 F;  3I9Q A;  1Q7Y R;  4QVZ A;  1TUD A;  1LPL A;  1NEB A;  3MJX A;  3MPU B;  4HKE A;  5FU7 B;  4KUD K;  1VQ4 T;  2JJ9 A;  2QGF B;  5CYI B;  4O6J A;  1YBY A;  4RKU E;  1NG2 A;  3LWH A;  4BE1 A;  2RQT A;  3BLQ B;  2FZC B;  3I35 A;  4RTW A;  4FCY A;  1N8R R;  4ELZ C;  2QTX A;  2WFY B;  1OYX A;  5KYU A;  1RAI B;  1VQ4 Q;  4XTV A;  3VS6 A;  4HNU A;  1OU8 A;  3Q1J A;  4BXX X;  4D8K A;  3CCV Q;  3TVT A;  4JJC A;  4YTL A;  3HKS A;  3CD6 A;  2YLC A;  2DZ9 A;  5DLQ E;  3BDU A;  2NUP B;  3LH0 A;  3EFO B;  5GMK h;  1K9M R;  1Y07 A;  2BKD N;  3CCE A;  3CCR Q;  4HT9 A;  1OOT A;  2M0O A;  4F7U F;  3LYI A;  5KYX A;  3OB9 A;  2ZZD B;  1Q82 R;  1PSE A;  1QQJ A;  1IGQ A;  4GY5 A;  2LMJ A;  2CH4 A;  1YI2 A;  4Z88 A;  5IT9 E;  3I55 A;  2EAY A;  4EOQ B;  3CCJ T;  2PUO B;  3J80 E;  3MEW A;  2NYS A;  4B6M A;  5HCK A;  4BE2 A;  4M7A G;  4ZGJ B;  1KJW A;  3DB4 A;  4JPB W;  2R7G A;  3C95 A;  2MWO A;  2JGZ B;  1OX8 A;  1QKW A;  4M7A D;  4HVV A;  1MMD A;  3M0P A;  2GNC A;  1NPP A;  1BI1 A;  3F70 A;  2DXT A;  3PIO A;  2CJM B;  2DIG A;  2OJ2 A;  2H3J A;  3LH5 A;  5GAN e;  2LVM A;  1VQ9 Q;  2KR3 A;  2LTO A;  2XIC A;  5L8R E;  4JX6 A;  3SWN A;  1TOV A;  2WJ9 A;  1ZLM A;  2RJF A;  3HO8 A;  1H4L D;  1D3U B;  2JS2 A;  1ZUY A;  4FW1 A;  4A54 A;  1AHJ B;  1T3S A;  2W96 A;  1AD5 A;  2O9S A;  4M77 D;  3SHW A;  3CPW P;  4BBR M;  1K0S A;  1K73 R;  2KRN A;  5GAN 2;  4RTV A;  1GL5 A;  4C92 B;  4FT2 A;  4OMN A;  9ATC B;  1YI2 Q;  3CC7 Q;  1OI1 A;  3MEA A;  1UJY A;  2L3P A;  4PLI A;  2FYK A;  4EOM B;  3SWN B;  4M7A E;  1M8V A;  4M7D D;  1H1S B;  1ZA2 B;  5IN1 A;  3CCV A;  2KQW A;  1JST B;  4J7I A;  5FU6 C;  8ATC B;  3TCJ A;  3SD4 A;  1OZ2 A;  1Q7Y U;  2GQI A;  1BK2 A;  2EGA A;  4XU3 A;  2YLB A;  4MZP A;  1M2V B;  2DYI A;  3OQ5 A;  2Y4X A;  2NUT B;  4D8D A;  5GAM d;  4LDX A;  3CME Q;  2X4W A;  1UJ0 A;  1AWW A;  2RHU A;  2V8I A;  2RQR A;  5KYU B;  5GAN 3;  4NL3 A;  4A53 A;  2PMI B;  2IVW A;  2O01 E;  2XDD A;  1N8R U;  1JQQ A;  2F5K A;  4PJO F;  3TU4 K;  4OMQ A;  2YT6 A;  1G2B A;  1YP5 A;  3RIR A;  3SWN C;  1KQS S;  2F2W A;  2QAZ A;  4LD6 A;  4KRT A;  3AHU A;  2CH4 W;  2JTM A;  2DF6 A;  4OGC A;  2FL7 A;  1JXO A;  4M7A F;  1R77 A;  2DJQ A;  2WHB B;  2QXF A;  4BDZ A;  1YFN A;  1KHC A;  3VS2 A;  3NMZ C;  2UZB B;  4C0D B;  3MI9 B;  1T3L A;  4EOL B;  1AIS B;  4PJO C;  2CZ6 B;  4IUP A;  1C6V X;  1VQ7 Q;  3I5S A;  1M2O A;  1G3S A;  4IUQ A;  4PNO A;  3OS0 A;  1LJO A;  1TS9 A;  4C0G A;  3CCL A;  2MMP A;  2ZPH B;  1FXX A;  3G1J A;  3CCL Q;  2EYW A;  3HSB A;  2QGS A;  3PO3 S;  1PD0 A;  1DJ7 B;  2EUF A;  2K5I A;  3EAE A;  3QYG B;  1OKV B;  2V1R A;  4XTW A;  2QDY B;  1QVG P;  4BCK B;  1MV0 B;  1E6G A;  1M1K U;  5LJ5 e;  1HYO A;  2DET A;  1TTH B;  2OX7 A;  1I8F A;  5LMK B;  2DXC B;  1ABQ A;  4TVR A;  1BCM A;  2JUF A;  3THK A;  4LNP A;  5FU7 C;  2X51 A;  3JCM e;  4M78 B;  1QVF S;  2RQV A;  2BKZ B;  5FRN A;  1GFC A;  5J26 A;  1QP2 A;  5L23 A;  2YUN A;  1SRM A;  5ICP B;  1EIF A;  1VQL A;  3OBY A;  4LD9 K;  1Q81 C;  4Z6Y A;  4C5H A;  4ELY C;  1AWX A;  2JS0 A;  1RL2 A;  4E2F B;  5EJC A;  4KGZ B;  5C6S A;  2RHI A;  3JSC A;  4LDY A;  2PTK A;  3MP1 A;  3HBL A;  4Z8A A;  2J6O A;  1S72 Q;  2RQU A;  1JJ2 S;  4OB1 B;  2JZ2 A;  3CMA T;  1VQN T;  3H8Z A;  2FZG B;  3BLR B;  3VS4 A;  5LJ3 g;  1AOJ A;  2RK2 A;  4BCM B;  2DEQ A;  4M77 C;  3ZL7 C;  4M7D B;  1UNL D;  5D6Y A;  4K11 A;  3CBO A;  3QZ9 B;  2F1L A;  1QMZ B;  4ROE A;  3EG3 A;  1W2B A;  2DTI A;  2GTJ A;  1TXQ A;  4EOP B;  2D8H A;  1ZHI A;  4M75 D;  3UA6 A;  3S3N A;  4WF2 A;  2EQU A;  3URG A;  4DEX A;  4J9C A;  1KIK A;  1X75 C;  4FYY B;  4C8Q B;  4M75 F;  4M6V A;  1QVF P;  1ZUK A;  4J6Y A;  2C5N B;  3K7A M;  2IPO B;  1VQK T;  2FZK B;  3EGX A;  3FC3 A;  1VQ5 A;  2BPM B;  1TU0 B;  1ZQ1 A;  1P92 A;  2VKN A;  1M2V A;  2CT3 A;  1WYX A;  2DIQ A;  2PK2 A;  1PNJ A;  3C0C A;  5IHN A;  1YJW Q;  3OW2 S;  4OMO A;  1ZP2 A;  1AWO A;  3QJY A;  1KQS P;  3G4S A;  1X6B A;  1V29 B;  4EMH A;  2FVU A;  3PMT A;  1YJW T;  2XKO C;  1UEC A;  5HVY B;  2VV5 A;  5GAM j;  2HEQ A;  1UHF A;  1KC8 R;  2HQH A;  1AT1 B;  4JS5 A;  4J9I A;  1VA7 A;  2R58 A;  3DDQ B;  4ZN1 A;  2RJD A;  2WSF E;  4PKC C;  4HT8 A;  1G5V A;  4BI8 B;  1JKW A;  2B86 A;  1N5Z A;  1AZE A;  3B57 A;  1CKB A;  1D09 B;  4AG2 C;  4O5V A;  2YSQ A;  3BY7 A;  3TSZ A;  1U5S A;  3VYG A;  5LJ3 e; 
#chains in the Genus database with same CATH homology
 1ZBX A;  3C12 A;  4V2S A;  4IKF A;  4C92 C;  1XNI A;  1VQK A;  1M1G A;  3OS5 A;  3WVE B;  4X9C A;  4EMK C;  2DTH A;  3OYM A;  4HA8 A;  3JCM W;  4MDX A;  3QUI A;  4BDY A;  3JCM J;  5D6X A;  2FHD A;  2LQ8 A;  2RHZ A;  4BY6 C;  3G71 A;  1G3T A;  3RKW A;  4XU0 A;  2QA4 T;  5CR2 A;  2Y4Y A;  3MHX A;  1VQ7 A;  2O4X A;  3V8J A;  5I21 A;  4PJO A;  3CCV T;  2VYT A;  2QEX A;  4BUG A;  4BY6 B;  5DM7 R;  3TW6 A;  2HAX A;  3VUZ A;  3MP8 A;  2KDS A;  1VQ8 A;  3HFO A;  2JN0 A;  3JRZ A;  3P8B B;  3BFM A;  1N9S A;  1QVP A;  2L8D A;  3X28 B;  4E7L A;  4M7D C;  1KQ1 A;  3CXC A;  1YHQ A;  2RH2 A;  3L1A A;  4M7A A;  5CK9 A;  3OYL A;  3CPF A;  4M75 A;  3CXC S;  3JCM c;  2EQM A;  4A4H A;  3J81 E;  4N4I A;  1YJN T;  4A4G A;  2M9U A;  2BS3 A;  2CZ1 B;  2V8J A;  1Q82 C;  2DPP B;  2K5L A;  4IUU A;  1UGP B;  5CKB A;  5I2S A;  2JOY A;  3JB9 H;  2KMT A;  2RM4 A;  4E7K A;  2QDJ A;  2XI9 A;  2F5T X;  4NS5 A;  2GQV A;  5GAM e;  1K8A U;  1XTD A;  3BDL A;  4C8Q E;  2OAU A;  3OYJ A;  1S72 T;  2OTL A;  1KQ2 A;  1IZ6 A;  2I2L A;  3ME9 A;  5LJ5 j;  4JRK A;  4NC6 A;  3X26 B;  1X01 A;  3HRT A;  2EJF A;  3OBW A;  3CCU A;  1D3B B;  2LX9 A;  4FIB A;  3G71 T;  2OTL T;  3OSV A;  3RKY A;  4HL4 A;  3PMI A;  3CC4 T;  2LCL A;  2RK1 A;  3FB9 A;  4N0A C;  4BB7 A;  2PVO B;  3V7C A;  4ZN3 A;  4RMO A;  1VQO A;  2FB7 A;  2P0P A;  2KR6 A;  4C92 A;  4CRI A;  3OYB A;  2EYQ A;  4HCC A;  1WJR A;  5HY6 A;  4Y91 A;  5DLO A;  3L2U A;  3QG1 A;  4JRP A;  4EMG A;  4C8Q D;  2LNV A;  1QVG S;  2OTJ T;  4BBS M;  2VXE A;  2DK3 A;  5A0G A;  1M4Z A;  1LNX A;  3VYH B;  1VQ9 A;  4XQ3 A;  4DOV A;  3MO8 A;  5AYF A;  1FX7 A;  4M77 A;  4XTZ A;  2BUD A;  1M1F A;  1VQN A;  1BI0 A;  3JB9 D;  2QEX T;  1H3Z A;  3UPU A;  4IUR A;  3RUX A;  3ER0 A;  2XDP A;  4HNV A;  1WPY A;  4QQ6 A;  4XTX A;  4M77 F;  2XDB A;  3QHS A;  4QVZ A;  1YIJ A;  3CME A;  3QYH B;  2PQW A;  1UGS B;  4ELJ A;  4M7A C;  2RI3 A;  3JCM P;  2OTJ A;  3P8D A;  3L2R A;  2D0Q B;  4HKE A;  5FU7 B;  5GAO p;  1VQ4 T;  4KUD K;  4FSX A;  1KC8 C;  1YCY A;  2JTF A;  2PU9 B;  4DOW A;  5LJ3 j;  3JAM E;  1WGS A;  4AKI A;  3OYE A;  3JB9 F;  4O6J A;  1YBY A;  3ASK A;  5GMK i;  3WXM B;  2HBP A;  2X4Y A;  4RKU E;  4KBM B;  3CCQ T;  3LWH A;  3I56 T;  2NLU A;  2EJG A;  4BE1 A;  3CPW S;  4HCB A;  4KT0 E;  3OY9 A;  4RG2 A;  3LWI A;  4VUB A;  4JS4 A;  1VQ9 T;  1VQ5 T;  3OYF A;  4C8Q F;  4M77 B;  1MGQ A;  3SB2 A;  5KE3 A;  3NTI A;  2DVE A;  2ZPG B;  4J6W A;  3X24 B;  4ELZ C;  3OYN A;  4IUV A;  2MWP A;  3VKH A;  2LC4 A;  2QTX A;  4EDU A;  4ZTF A;  1YI2 T;  4M7D A;  1E7P A;  1OZ3 A;  4QQD A;  5CKD A;  5LJ5 g;  2AHJ B;  5CIU A;  5GMK l;  3JB9 J;  1OYX A;  1O75 A;  2HQX A;  4L6V 5;  4M78 E;  3S3O A;  1HXD A;  2RA2 A;  1K73 U;  1VIF A;  2E12 A;  4XTV A;  5GAN 6;  4HNU A;  2BIV A;  1KD1 U;  3Q1J A;  2DXU A;  2P4T A;  2ZPE B;  3V8K A;  3OYG A;  4YTL A;  2CZ0 B;  3HKS A;  1VQM A;  3OSS C;  3CD6 A;  4PJO B;  5DY9 A;  5M9O A;  4LDW A;  1SSF A;  2YLC A;  3C4S A;  2DZ9 A;  2RHX A;  2DJZ A;  3BDU A;  5CQX A;  4XU1 A;  5DLQ E;  2G3R A;  1WJQ A;  3LH0 A;  1U1S A;  3FJP A;  5GMK h;  1Y07 A;  2BKD N;  1MHN A;  2EKO A;  3MEV A;  4N4H A;  5KCO A;  3CCE A;  4HT9 A;  2X4J A;  3NTK A;  2M0O A;  3JB9 G;  2RD1 A;  4F7U F;  3LX7 A;  3LYI A;  3P8H A;  3BG3 A;  4ZGD B;  2QQ8 A;  2ZZD B;  4MFD A;  2VGM A;  3OB9 A;  3UT1 A;  1PSE A;  3CCL T;  4GY5 A;  1YI2 A;  2ZPF B;  2HNI A;  2E1H A;  2EJ9 A;  1BIB A;  3M55 A;  3KUF A;  3CCQ A;  3I55 A;  2EAY A;  4JX5 A;  3PNW C;  3JCM V;  3OS2 A;  5IT9 E;  2D6F A;  1VUB A;  1O9S A;  3KBG A;  4JLI A;  2PUO B;  4MZT A;  3RES A;  3J80 E;  2EWN A;  4DQ2 A;  3CCJ T;  1I4K 1;  3MEW A;  2QA4 A;  3M4G A;  1B34 A;  1N8R C;  4ZGE B;  4AKG A;  4M78 C;  4BE2 A;  4M7A G;  2DKG A;  3PTA A;  4ZGJ B;  2CZ7 B;  3PGG A;  3DB4 A;  4J8O A;  5GAO l;  2K5F A;  3L2V A;  4DA4 A;  1BI2 A;  3OYD A;  3C95 A;  2KMG A;  3VUB A;  2MWO A;  2E10 A;  3A8L B;  2QF7 A;  2WSE E;  4M7D F;  4M7A D;  1BI3 A;  3RMS A;  3MCA B;  3KHI A;  4B9X A;  1TH7 A;  2DTO A;  4PJO G;  3JCM Q;  5KE2 A;  3QO3 A;  2LT4 A;  1VQ7 T;  1NPP A;  2PVG B;  2QFZ A;  1K73 C;  1BI1 A;  2YHT A;  3F70 A;  3FEO A;  2DXT A;  3PIO A;  4PLL A;  3CC2 A;  4PJO D;  1W4S A;  2DIG A;  3L42 A;  3VYG B;  3M56 A;  2ZZD A;  4C0F A;  2H3J A;  5GAN e;  2LVM A;  2IG0 A;  4AI6 A;  3GIB A;  5L8R E;  2LTO A;  2LDM A;  2XIC A;  5J39 A;  4JX6 A;  1I5L A;  2DD5 B;  3SWN A;  4ATO A;  1N9R A;  2WAC A;  4OMF B;  3CC7 T;  2V8K A;  3M57 A;  2WJ9 A;  5IAY A;  2X4X A;  1M90 C;  3X20 B;  2RJF A;  3HO8 A;  4C0Z A;  4C8Q C;  2P0Q A;  5GAO m;  3GPL A;  5HKC A;  4FU6 A;  1NJI U;  4OB0 B;  2CGH A;  1YJ9 T;  1JJ2 A;  3EFR A;  5A0L A;  1WQW A;  2RO0 A;  4J6X A;  2O4X B;  4LDU A;  4A54 A;  3E19 A;  4JJN K;  1AHJ B;  2ZCF B;  3ZFJ A;  1S72 A;  4M77 D;  4B9W A;  2XHC A;  2KY9 A;  5GAM f;  4BBR M;  3CCU T;  2R5M A;  2HD0 A;  2KSS A;  4JUV A;  3ZEH A;  4RG8 A;  5GAN 2;  4EMK B;  4OB3 B;  4C92 B;  4FT2 A;  2ZPI B;  3OYA A;  3FRN A;  1VQO T;  5HK0 A;  1NE8 A;  4AKH A;  3HP9 A;  1OI1 A;  3MEA A;  3HHT B;  2R57 A;  3PFS A;  2XK0 A;  3M58 A;  5KCH A;  3CME T;  5GAN g;  2CS7 A;  2K2V A;  3CPW A;  3I56 A;  1QLB A;  4PLI A;  3PT9 A;  3CCM A;  3A8H B;  2FYK A;  2DD5 A;  3E9G A;  3SWN B;  1I81 A;  3R6O A;  4XK8 E;  3TW7 A;  5GAN 5;  1UGQ B;  3A8O B;  4JRI A;  4NL2 A;  4OGE A;  5LJ5 h;  1Q7Y C;  5LL6 S;  5LJ3 h;  4QW2 A;  4M7A E;  1M8V A;  4M7D D;  4GLK A;  2CYZ B;  5IN1 A;  3CCV A;  2KQW A;  5CVI A;  2E41 A;  3M4Y A;  1WNL A;  1R8O B;  1N27 A;  4QVD A;  5CQY A;  5GAO r;  2XD0 A;  4J7I A;  2DO3 A;  2CKK A;  5FU6 C;  3QYB A;  5GMK m;  2GFU A;  3JCM g;  4A4E A;  4QVC A;  1VQ6 A;  3QXE B;  3HL8 A;  3TCJ A;  2DZC A;  3E9F A;  4XAX B;  4FT4 A;  2LRQ A;  3SD4 A;  3JCM X;  4FL6 A;  1Y96 B;  1OZ2 A;  4M75 E;  1Q7Y U;  2VUB A;  3GNF B;  4M75 G;  3INZ A;  4L5G A;  2E6Z A;  3JCM f;  1YIJ T;  2DAQ A;  1KQS A;  1KC8 U;  2DD4 B;  2YLB A;  2EFI A;  4M77 E;  4XU3 A;  4BI4 A;  4M7D G;  2P0K A;  5CKH A;  4MZP A;  3HPW A;  2K3X A;  2Y90 A;  5CKF A;  5HK3 A;  2G77 A;  3CC2 T;  2DXC A;  3OQ5 A;  3QII A;  2Y4X A;  3SDZ A;  1YJN A;  1NPR A;  5GAM d;  3OA6 A;  3VKI A;  4LDX A;  2X4W A;  3G7Z A;  2D9T A;  5FU6 B;  5GAN j;  3E1S A;  2RHU A;  2V8I A;  5CAI A;  3C94 A;  4MDW A;  5GAN 3;  1XOV A;  5GAN d;  2LCC A;  4NL3 A;  4A53 A;  4C92 F;  2DXB A;  2IVW A;  4EPC A;  1D3B A;  2O01 E;  2MI6 A;  2XDD A;  1N8R U;  2F5K A;  2QQ9 A;  3SFM A;  4PJO F;  3BW1 A;  3TU4 K;  1BYM A;  3RIR A;  2E6N A;  4J7F A;  3SWN C;  3CBP A;  4X34 A;  2E70 A;  4F7U G;  1KQS S;  3RKX A;  4LD6 A;  1M9S A;  3AHU A;  2JTM A;  4RCB A;  5GAN h;  4JX4 A;  2FL7 A;  4OGC A;  4M7A F;  4M75 C;  3CCM T;  4D6W A;  4F7U A;  1YHQ T;  2B8A A;  1X6O A;  3V7R A;  2DD4 A;  4PL6 A;  2RB6 A;  1KHI A;  4ZTJ A;  3DB3 A;  3GNG A;  4LDV A;  2QXF A;  4BDZ A;  2MAM A;  4M77 G;  3JCM b;  1KHC A;  3CEY A;  3N5B B;  1W2B S;  2F69 A;  2E5Q A;  4UC4 A;  4OB2 B;  4C0D B;  4OP0 A;  4CI0 C;  2K57 A;  4IUT A;  4MZM A;  3HRS A;  3PIP A;  3CCJ A;  2CZ6 B;  4C5I A;  3CCR A;  4E7I A;  1PSF A;  4PJO C;  1N6A A;  2A7Y A;  2R5A A;  1M90 U;  4IUP A;  1QVG A;  3CD6 T;  1G3S A;  4IUQ A;  3OW2 A;  4PNO A;  3OS0 A;  1LJO A;  3M54 A;  4EMK A;  4C0G A;  4M78 A;  1IRE B;  5LJ3 f;  1NJI C;  2MF2 A;  2MMP A;  3CCL A;  2ZPH B;  3QZ5 B;  1FXX A;  3ZBD A;  1KG1 A;  3HSB A;  1U1T A;  4MML A;  2X35 A;  3RER A;  5CCA A;  1DJ7 B;  3MET A;  2K5I A;  3EFS A;  3JCM d;  3EAE A;  3QYG B;  3TEE A;  1VQL T;  3HZJ A;  2XG8 D;  5GAO q;  2XU8 A;  4XTW A;  3L2Q A;  1U8R A;  2QDY B;  3H6Z A;  3GP8 A;  4C92 E;  1JB0 E;  3QJ6 A;  3KXT A;  1M1K U;  5LJ5 e;  3JB9 I;  5GAM h;  1G3W A;  1WQ7 A;  1I8F A;  2A3L A;  2LQK A;  2DXC B;  2GFA A;  4XU2 A;  2RHY A;  4MFE A;  1HK9 A;  2E65 A;  2QQS A;  4TVR A;  2JUF A;  4JDS A;  1FWZ A;  4J83 A;  3A5Z B;  3M53 A;  4KUL A;  5FU7 C;  3JCM e;  4M78 B;  4R55 A;  1QVF S;  3LLR A;  2XID A;  3MP6 A;  1Q81 U;  3LW5 E;  4M7A B;  5FRN A;  3S6W A;  2WSC E;  1Y96 A;  3QKJ A;  1QP2 A;  4Y28 E;  5I2M A;  5J26 A;  1VQM T;  1Q86 C;  2RI5 A;  1YIT T;  4FM4 B;  4II1 A;  4J5Y A;  1EIF A;  3QPH A;  5CO7 A;  5GAM g;  1VQ8 T;  1VQL A;  5C0M A;  1YIT A;  3H4C A;  3S3M A;  3M59 A;  3LGF A;  1G3Y A;  3OBY A;  4LD9 K;  1Q81 C;  3DL1 A;  4Z6Y A;  3V7S A;  4OVA A;  4L59 A;  4JRQ A;  4C5H A;  4ELY C;  4JLG A;  1UGR B;  2L3R A;  2VGN A;  1RL2 A;  2YRV A;  5EJC A;  4OF1 A;  4F7U B;  3VJP A;  2BS2 A;  4XTU A;  1WJS A;  5GAN f;  3FDR A;  4MMK A;  3LGL A;  2RHI A;  5C6S A;  3A8M B;  3RMQ A;  4X9D A;  3T9N A;  3JSC A;  4LDY A;  5GMK j;  2GF7 A;  3HBL A;  3MP1 A;  5GAN 7;  3MEU A;  4C8Q G;  4P5N A;  2QQA A;  3CMA A;  1JJ2 S;  3OMG A;  2JNG A;  4E7J A;  4N4G A;  4C0D C;  4HCZ A;  4OB1 B;  1JBM A;  4BAC A;  2JZ2 A;  3VU3 C;  3CMA T;  1VQN T;  3H8Z A;  4BD3 A;  1VQP A;  1M1K C;  4MIM A;  1Q82 U;  4NOY A;  3OMC A;  3GLX A;  3OYH A;  3OYI A;  4BE0 A;  3NFC A;  3BG5 A;  1K8A C;  1NZ9 A;  4C92 D;  3QSU A;  2QQB A;  3HFN A;  5LJ3 g;  3A8G B;  4C5E A;  2L5Q A;  3DKM A;  3L2W A;  2BS4 A;  2RK2 A;  4M75 B;  1K9M C;  3QYE A;  3CC7 A;  4XTY A;  1BIA A;  2DEQ A;  3DLM A;  2ZGW A;  4M77 C;  4C92 G;  1VQ4 A;  1B34 B;  4M7D B;  3QDR B;  2KAF A;  5D6Y A;  4RCC A;  3OYY A;  2K4Y A;  3CBO A;  3I55 T;  2L89 A;  2HQE A;  2ZPB B;  2M1H A;  3QZ9 B;  1Q86 U;  4M78 F;  5EG2 A;  1UB4 A;  2KVQ G;  2QQR A;  2DTI A;  4N0A A;  1W2B A;  4HLQ A;  5D6W A;  2KK4 A;  3BG9 A;  4KUI A;  1ZHI A;  5FLX E;  2RI2 A;  5GAO n;  1GXI E;  1QW1 A;  5J3B A;  4M75 D;  3S3N A;  2LT1 A;  3CCS A;  1M5Q 1;  2K3Y A;  4WF2 A;  1VIE A;  2EQK A;  2VC8 A;  2EQU A;  3URG A;  3CCE T;  1YJ9 A;  1X75 C;  4Q5W A;  4C8Q B;  5GMK e;  5FRM A;  2DXB B;  4M75 F;  4ME7 A;  4M6V A;  1JRI A;  3WVD B;  2JVV A;  4R56 A;  4M78 D;  1KD1 C;  4J6Y A;  1VQK T;  5GAN 4;  3O8V A;  5LJ5 f;  2VXF A;  3CCR T;  4BI3 A;  2EIF A;  1UEB A;  2RJE A;  4F7U E;  3FC3 A;  1VQ5 A;  5GAN 8;  3OYC A;  4QSH A;  1RI0 A;  2QI2 A;  1ZQ1 A;  3M9Q A;  4M78 G;  1P92 A;  5A0D A;  3M5A A;  3HB9 A;  3G6E T;  3X25 B;  2DIQ A;  1H64 1;  3J7A F;  5CKE A;  5FRO A;  4Z02 A;  2PUK B;  3UDC A;  4A4K A;  3VV0 A;  2E64 A;  3FLG A;  2GCX A;  5LJ5 d;  3OW2 S;  4C5G A;  1QVF A;  2PVD B;  5LJ3 d;  2M16 A;  1YJW A;  3QJY A;  1Y7X A;  4A4F A;  2C06 A;  3G4S A;  3CBM A;  4E7H A;  5KH6 A;  1V29 B;  4EMH A;  1BKB A;  2FVU A;  3PMT A;  1YJW T;  3NTH A;  1LOJ A;  1VQ6 T;  3JCM h;  2XKO C;  4LOC A;  4E47 A;  2VV5 A;  1Y71 A;  5GAM j;  2EQJ A;  3QBY A;  4PJO E;  1QP3 A;  1VQP T;  1K9M U;  3CCS T;  2RJC A;  3CC4 A;  4JS5 A;  3L2Z A;  2R58 A;  4M7D E;  3G6E A;  4ZN1 A;  2RJD A;  1FKM A;  2WSF E;  4PKC C;  4HT8 A;  3VKG A;  4C8Q A;  1G5V A;  4BI8 B;  3GOX A;  3GF5 A;  4HNT A;  4QQG A;  3FIF A;  1XQH A;  3TRE A;  3QWL A;  4O5V A;  3G4S T;  3DLL A;  3HRU A;  3UWN A;  3BY7 A;  3V8L A;  5A2Q E;  3OS1 A;  3VYG A;  5LJ3 e;  3OYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...