3WVEB

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, before photo-activation
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 58
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3wveB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3wveB02
3X20B 2ZZDB 4RKUE 3WVDB 2ZPHB 2PUKB 1PSEA 2CZ1B 2PVDB 3WVEB 2DD5A 2DXBA 4ZGEB 2WSFE 1UGPB 2DXCB 4FM4B 3QYGB 3A8LB 3VYGA 4XK8E 1IREB 2PU9B 2ZPBB 3A8OB 3QZ5B 2D0QB 4Y28E 2O01E 4ZGDB 1DJ7B 2PVGB 2DXBB 2DD5B 1V29B 1JB0E 1PSFA 2WSEE 2CYZB 3VYGB 2ZPFB 5L8RE 2ZPEB 3LW5E 3X28B 4ZGJB 1QP3A 2PVOB 2DPPB 2DD4A 4OB1B 3QXEB 1GXIE 2ZPGB 4OB3B 2CZ6B 1QP2A 4OB2B 1UGSB 3A8MB 2PUOB 1UGQB 3VYHB 2CZ7B 4L6V5 1AHJB 2CZ0B 3X26B 2WSCE 2ZZDA 3A8GB 2DD4B 3QZ9B 3X25B 2QDYB 3A8HB 2ZCFB 3X24B 3HHTB 4OB0B 2ZPIB 2DXCA 1UGRB 3QYHB 2AHJB 4KT0E
chains in the Genus database with same CATH superfamily
2LJ0A 1HD3A 3VS7A 1LNXA 1XQHA 3H0HA 2DM1A 4KRCB 2FZGB 2RHUA 5DM7R 2GFUA 3KUFA 1I81A 1YJWA 4YOOA 1I07A 2CP2A 1WA7A 3HFNA 3JCMf 4EOPB 1RI0A 2QQSA 1X2KA 4M75E 3O5ZA 1RLPC 2KSSA 2XG8D 5HNBB 3QSUA 1X75C 4XTXA 1AWXA 1OPLA 3A98A 1IREB 2LT4A 2MAMA 1JJ2S 2CCHB 4R56A 3PMTA 4PJOD 2L5QA 1R0CB 4BI4A 8AT1B 4QW2A 2PVGB 4IIMA 1NJIC 2A37A 1OL1B 3CMEQ 2EQIA 4M7DD 2K9GA 1IGQA 5A0LA 1UDLA 3REAB 2MIOA 1W6XA 4C0ZA 3EFOB 3HB9A 3BLRB 1ZSZC 4M78D 4MMKA 1YWOA 3TEEA 3CCLT 2GGRA 3M58A 4O5VA 5LJ5f 1YNZA 1VYUA 4EMKC 4F70B 2CDTA 1BB9A 1U1TA 1YHQA 1QP2A 3UDCA 4M77E 1K8AR 2J6OA 1NEBA 4BCFB 1OX8A 4J6YA 4RMOA 3OS2A 1S72T 4J9DA 1TU0B 2RJCA 4PJOF 4C8QG 2YRDA 3M53A 4PJMA 2WSCE 4J83A 2X9HA 3MO8A 4M7DF 2RA2A 3NTKA 1MMNA 4BCJB 5CVIA 3NFCA 2IG0A 1D1CA 5CR2A 1P5EB 3P8BB 2RK2A 3A8HB 2A36A 1NJIU 2KROA 3CCVT 3EG3A 4M78F 2P0PA 4VUBA 3PIPA 1M5Q1 1B07A 2RQTA 3H4CA 1GBQA 3BFMA 3PVLA 1PD1A 1YFNA 4KH0B 4F6UB 1VQ8T 1B3QA 4E7HA 3SB2A 1SPKA 3WVEB 3OYDA 2DTHA 1X01A 1MV0B 2KRSA 1SG5A 2PHGA 2ENMA 1BU1A 1W4SA 3CC7T 2DL3A 2DKGA 2FPDA 2W99A 4F6WB 4ZNXA 3OYEA 1UUEA 2GTJA 1NZ9A 2DBMA 5HK0A 2QA4T 4E7KA 1KK7A 4D8KA 2F1LA 1OU9A 1YIJT 2EYQA 1QW1A 3E19A 1YJNQ 2KE9A 3CCSQ 2P4TA 2FEIA 3L2WA 2ZAEA 4IUTA 1U5SA 1MNDA 4J5YA 3JCMP 2KAFA 4JJDA 5KYXA 2L3SA 2QQBA 1KXUA 1WYXA 3CPWA 5J3BA 4XU2A 5HBEB 2QG9B 2E41A 1WQWA 3M55A 1UJYA 2FYKA 5LJ3d 1T3SA 1WZOA 2CS7A 2YRCA 3M4YA 1ABQA 2DIGA 4GLMA 3OB9A 4PJNA 1BK2A 3OA6A 1FKMA 2HNIA 2DVEA 1AISB 4BCMB 1M8VA 3A8GB 3G4ST 3C94A 3AHUA 2EJGA 2OTLT 3QKJA 1XTDA 4V2SA 4IUPA 4M7DE 1A0NB 3QWLA 2RF0A 2EYWA 2A3LA 3M4GA 3P8HA 5GAMh 8ATCB 3PTAA 4BI8B 1ENWA 2QEXQ 3NMZC 2M1HA 3HFOA 3SD4A 2VXFA 2I2LA 4L5GA 4M78E 4M75G 2DA9A 2RK1A 4E7JA 2ZPHB 1M1FA 5FU7B 4PK4A 4XTWA 1Q81C 3CCEQ 2HL3A 2BTTA 4ZGEB 2VKNA 1YJ9A 5CKHA 2DXUA 1IZ6A 2YUOA 3EAEA 5ECAA 1KQSA 5LJ5h 3HZJA 1N8RR 5FRNA 4WF2A 2DX1A 1VQLA 1LCKA 2B86A 4JRPA 1M1KU 3JAME 4Y72B 2ZPBB 1K4US 2BZ8A 2DFUA 4JX6A 3CCJA 2GQIA 2CT3A 1QVPA 5A2QE 2FRWA 5CYIB 3M0PA 4FX3B 4OVAA 2DL4A 1VQ6A 1V29B 2GNCA 2F5TX 3G6EQ 3DL1A 2F2XA 1YITA 2K3XA 4JJNK 2DL8A 3QIIA 2QXFA 3F70A 1VQ4T 3I56T 3VYGB 1D3BB 2NYSA 5CCAA 1Q82U 2XDDA 1H3ZA 3F5XB 1PNJA 1PC0A 2DD4A 4FIBA 1JXOA 1UGVA 1PKTA 3QXEB 1BCMA 1Q81U 4II1A 4YC3B 4LD6A 2WHBB 3PVQA 1D09B 3EG0A 3MJXA 1OZ2A 3BHTB 2YXYA 2GBQA 4AFQC 2R58A 1WHHA 1S1NA 3C95A 4A54A 4E2FB 1NYGA 1Q95G 5EFQB 4C92G 1RAHB 4Z89A 1O9KB 3QDFA 2M0OA 5J39A 2F5KA 2NUPB 2C0IA 3OYBA 1VQKT 4LDYA 2R5MA 2K3YA 2DBKA 1VQNQ 2F2VA 1F5QB 1D0XA 3JV3A 1YI2A 3X24B 1ZA1B 3BHUB 1NPPA 1NYFA 3JCMJ 2EJFA 2EWNA 4OB0B 2OJ2A 1UTIA 2VGNA 5IDNB 3QYHB 3SEMA 3EOCB 2LX7A 2XK0A 4RG8A 4PFPA 4EOJB 5KCHA 1WQ7A 4BCIB 3JB9D 3VU3C 1TD6A 3CCSA 4XAXB 5AT1B 3GOXA 3MEAA 3M54A 2LDMA 1UGPB 3ZFJA 2EYYA 2WXVB 1K9AA 2MPXC 4ELZC 2F2WA 2YDLA 3OMCA 2WEVB 3MP8A 2MOXA 1ZBJA 2PU9B 4AFSC 5LJ3e 4MDWA 4PLLA 3FIFA 2CT4A 3I55Q 2DJZA 1UNHD 1R8OB 3CMAT 4DOVA 5GAMd 2L3QA 4F7UF 1YHQT 1H4LD 2RJDA 1SRLA 3TN8B 2KQWA 4CXAB 2QTVA 2ATCB 3JB9F 1BIAA 2GTOA 4LUEA 4DEXA 4FYVB 2KI7A 3LW5E 1NLPC 4UN0A 1M9SA 2WIPB 2QAZA 4LE9A 3L2UA 1VQ7Q 1GBRA 1JO8A 2UUEB 1C0MA 2Z0WA 4OB2B 3CBPA 2W9FA 2QEXA 4C8QA 2YSQA 2RO0A 1H25B 2W96A 3G71T 1TXQA 1YJWQ 5GANg 2HAXA 4II5B 4I3ZB 4BB7A 2QFZA 2HQXA 1AHJB 3KXTA 1TUDA 1X6BA 1GUXB 2YUNA 5IAYA 4ROCA 5LJ3f 2QDYB 3NDQA 1GY3B 2C5XB 3BG9A 4YOSA 1G3YA 4M77B 3LGFA 1NG2A 3EG9B 2QDLA 3TSWA 3TCJA 4MZMA 4ORZA 3EH1A 3META 1SF9A 3GIBA 2E6ZA 3HKSA 1WHLA 5A0DA 2DNUA 4BCKB 2JN0A 4M75C 1JRIA 3NHNA 3OYJA 2CZ1B 5DLOA 3BLQB 3UA6A 3H0IA 2NUTA 1QCOA 2E1HA 2LQNA 3I9QA 3EGUA 3E9FA 2KNBB 1TUCA 2H8HA 2D1XA 2CP3A 4C0DC 2Y4YA 3CPWS 5FWCA 2QI2A 2VB6A 1G5VA 3FLGA 1IHWA 2JOYA 2ED1A 4QKUA 1C1AA 3OMGA 5I2MA 2JT4A 2X4XA 5FGKB 2YHTA 1YN8A 2CYZB 4TVRA 3MEWA 4J9CA 4F7UE 4ZGJB 4M7AA 3RGFB 5KYUA 1JQQA 4A4HA 4B9XA 4M77C 4AG1C 2P0QA 4JPBW 2JS2A 1VINA 3PFSA 4J9FA 2UZLB 2AKKA 3A8MB 2BZYA 1NBEB 2CP7A 1TSFA 4F16A 4FT2A 2V22B 4BCNB 3CCRQ 4FU6A 3EH2A 3S3MA 2F2CA 4A63B 4BUGA 3NGPA 3CQTA 2COWA 3GNFB 2DZCA 3CMET 5IXFA 4NL2A 1MNEA 1NJIR 3H6ZA 4EOKB 2X35A 5GMKl 1KQSS 3L2QA 5C6SA 1ABOA 3VS5A 3MIAB 4N0AC 5ICPB 1K9MC 2DJQA 1GRIA 2LCLA 1OGUB 4KT0E 2HKNA 1FINB 1H24B 1XJWB 5GANd 3RKWA 1VQ5A 2FRYA 2EGCA 4HCZA 1N6AA 2YLCA 2JZ2A 3TU4K 2VGMA 1Y57A 2UZDB 2M16A 3MCAB 4PJJA 4PJOB 4F6SB 2DXBA 4CC3A 2KGTA 1UFFA 4F7SB 1HYOA 4M7DB 2QQRA 5GMKi 2X3XD 3QDRB 4GBQA 2HQHA 3VKHA 3M03A 1CKBA 4BY1X 1RL2A 3SWNB 2VV5A 5CO7A 4M78B 2K2VA 4OGEA 2D0QB 2IW8B 5CK9A 2O01E 1OOTA 1PD0A 2DRMA 2P0KA 2FO0A 2CP5A 3EG2A 3EIDB 2O4XA 2JM9A 3I5SA 2YRVA 3CCQQ 5I21A 1I8FA 1M3AA 4ZN3A 3CC2T 3LH0A 1K9MU 1Y96B 4JLGA 4A4EA 5LJ3h 2VC8A 2KR6A 3HO8A 1GCQA 2I0NA 1FMWA 3M59A 5GAMf 5A0GA 2B8AA 4OB1B 4EOLB 3RR6A 2CCIB 2D9TA 2H3JA 2RHYA 2CZ6B 3FJPA 1XO2A 1JU5C 3PO3S 4C92A 1UG1A 4EPCA 1KQ2A 1I5OB 2CZ7B 1YJ9Q 2DERA 1MGQA 2UZEB 4AKIA 2FL7A 1D0ZA 2KT1A 3ZEHA 3JCMW 1VIFA 4N4GA 5CKBA 3EFSA 5KH6A 1VQLQ 4M7DC 3VUBA 1YJNT 2E65A 3TNIB 1M2VB 1O9SA 2W0ZA 3CCST 1W2BP 1W70A 3SWNC 1ZQ1A 1BI3A 3CCJQ 2PK9B 4F7JB 4M78C 5EC7A 1TS9A 2I53A 2ESWA 3PGGA 5KYWA 4RTZA 2EUFA 3TQ7P 1SSHA 1X6GA 4BACA 1VQ6Q 4QQDA 1OIYB 3MY5B 2ROLA 4E7IA 3OYLA 1UJ0A 1T0HA 3X20B 4FL6A 1VQPA 3MP1A 1YITQ 2RQWA 2BIVA 4OMFB 4F7NB 3MP6A 1X43A 2MCNA 2RNAA 4JJCA 1PSEA 4AT1B 3RUXA 1N27A 9ATCB 2M0YA 2WSFE 1M27C 2C6TB 3L2RA 1NLOC 3V8JA 2R57A 2DXCB 4FM4B 1G3WA 1IXDA 1U8RA 1V76A 1OULA 2MK5A 1WHKA 1WNLA 2QF7A 1M1KR 1QCNA 3EG1A 4ZGDB 1WHJA 2DTIA 4EC8B 1PCXA 2LZ6B 2E6NA 2LNVA 2QEXT 3CCRA 3M56A 4DBRA 3OW2P 1PKSA 1VQOA 1E6GA 1K0XA 1KD1C 3EGXA 2A0FB 1N5ZA 1YI2Q 1Q82R 5L8RE 3CCUQ 3LGLA 2CJMB 2HD0A 4JDSA 4RTUA 1BU2A 1QP3A 4K11A 4NS5A 4BY7X 4IKFA 1QWFA 3CCET 4ME7A 1NPRA 2D8JA 1ZSZA 4CC4B 1IB8A 3KHIA 1PG5B 3VS3A 4MMLA 4PJLA 4RTWA 4E6RA 2J05A 5GANe 2LT1A 4OGCA 4C0FA 2X4WA 4EMKA 3OSSC 3BY7A 3X26B 4B6MA 2JW4A 2BPMB 5L2WB 1QMCA 2RD1A 3QZ9B 2CH4A 5GAN2 1P92A 1ACMB 3RBBB 2HL5C 4JRKA 1QKXA 3MPUB 3G6ET 1H641 4JRQA 4KUDK 3ZL7C 5HY6A 5IHYA 4XTYA 1RAAB 2JXBA 2E3IA 3VS6A 1KD1U 3QBYA 1W98B 3TREA 5HBHB 2EJ9A 4FYXB 1AZEA 1TWBA 4RKUE 1RACB 2DF6A 3PNWC 2V8IA 2QDJA 4EOSB 2X4JA 3CCQA 5HVYB 3LLRA 1X2QA 4BE1A 4HVVA 3OS5A 4PJOE 4YOZA 2VASA 5KYYB 5GJWB 2XD0A 1IRXA 4AG2C 5DQVA 2JTEA 2LJ3A 5GANf 2XDBA 3EFOA 4Y91A 2K5FA 2VUBA 3QZ5B 1AD5A 2LNHB 4IUVA 5GJVB 3REBB 1XNIA 2CH4W 2ZGWA 2YUPA 3JSCA 5D6XA 4BCHB 1VQNT 3JCMg 2DD5B 4EMHA 4MZTA 1WJQA 4BCOB 2WPAB 2JJ9A 3OYKA 3EJ1B 2KBTA 4D8DA 3DOGB 2JGZB 3N5BB 5DQWA 4BD3A 2PNIA 4XTVA 1U06A 4DA4A 2VYTA 3QO3A 2JTFA 3OYCA 2EBPA 1FVVB 3FB9A 2LQ8A 1CKAA 2E70A 2IVXA 3PT9A 5IN1A 4OMOA 1ZP2A 1QVGP 2LQWA 4CRIA 2EAYA 3GP8A 2KEAA 4JS5A 3CEYA 1BCOA 1H3HA 4Z8AA 4NL3A 1FWZA 1JOWA 2BUDA 3G1JA 2LP5A 4M77G 1OL2B 5LJ5g 5GMKe 4F7UB 3H41A 3I55T 1U1SA 3O8VA 1V1CA 3VS2A 2RPNA 2XHCA 4DQ2A 2JTMA 4MFDA 1G3TA 1NM7A 4OMNA 4E7LA 5KE3A 2QTXA 2G9XB 2JMCA 3CC4T 1UEBA 5LJ5j 2NUZA 2D6FA 5GAOp 2J7IA 1BI0A 1JBMA 7AT1B 3QHRB 4QSHA 5FU7C 1LJOA 2MI6A 2RM4A 2ZZDB 1RABB 1VQ7T 3JCMX 3NPFA 4DBHA 3A5ZB 3CBOA 3M0RA 5IHNA 1K76A 1AWOA 4C8QD 2WFYB 2W2HA 1YJWT 4ROEA 3MEVA 4RG2A 3CCUA 4FSSA 4LDVA 2KMGA 1BI1A 2GF7A 1WFWA 1ZLMA 3JRZA 2E64A 3QWYA 3L42A 2C4GB 2K4YA 1B34B 5BNJB 3MKDA 2VXEA 4PFOA 4HT9A 1ZBXA 4CFUD 2PTKA 1H92A 3VKIA 4F04B 5HCKA 2J06A 4BDZA 2C0OA 3I5RA 1LVKA 1Y07A 4M7AB 4C8QF 3CPFA 1D1BA 2AIRB 2QQAA 4N4HA 2G6FX 3C0CA 2BZXA 2PMIB 4A4KA 4MFEA 1SHFA 1VQ9Q 3UT1A 4O6JA 1GXIE 1O75A 3G7ZA 1VQ5Q 4Z6YA 3U23A 3TVTA 4LUDA 1S72A 2EPDA 2AZSA 2YT6A 4Z02A 4L6V5 4AI6A 2IVWA 1AOJA 5ACBA 5CAIA 6AT1B 1HXDA 2COZA 2DE0X 4PKCC 3DTOA 4LOCA 1TG0A 2V1QA 2L8DA 1WIEA 4OMMA 2QQ9A 1JSTB 3CXCP 3BG5A 3X25B 3POMA 4A4GA 1NEGA 3PMIA 5KCOA 5GANh 3JCMQ 1IGUA 3CBMA 5FW9A 3S6WA 1FX7A 2DZ9A 2GQVA 4CFVB 3JCMb 3V8KA 1KIKA 4J9IA 4FW2A 1H1PB 2PJQA 1ZSGA 2NLUA 4PJOG 1QLYA 4M7AD 2FG0A 1KHCA 4R55A 1E7PA 4M7DG 2YUQA 3OYHA 2C5OB 5FU6B 3M9QA 3M57A 2CSQA 4XU3A 1M4ZA 1WHMA 4M78G 2E4HA 2KMTA 2M51A 3CC7A 1OYXA 4EOMB 3ULRB 3VV0A 1K73C 1WPYA 2R5AA 3CCRT 1RAFB 4LN2A 2DXTA 4FYWB 1OV3A 5C0MA 4LDXA 1VQMQ 3VYGA 1D3BA 5D7UA 4BCQD 3OYYA 3V7SA 1AWWA 2LTOA 4J9EA 4JJBA 4GY5A 1YIJA 3OYFA 2OTJQ 3K7AM 1G2BA 5LMKB 4C0GA 2PQWA 3BW1A 4ANJA 1RAIB 2EQUA 1QVFP 4M7AF 2AK5A 2HDAA 4CFMB 2KXDA 5LL6S 2E12A 5HBJB 2DLPA 4X9CA 4EDUA 3H9NA 1E9HB 1WXBA 3UPUA 5GAOl 3ER0A 5L23A 1K9MR 4IURA 3EHRA 1SKUB 1K1ZA 1O9KA 1M90C 2LW4A 1VQPQ 1G83A 1G8XA 3HL8A 1Q86C 2C06A 1GH6B 3VS1A 4Z88A 4QVCA 1UHCA 2K57A 4C8QE 1D3UB 1W2BA 1K73U 3FJ5A 2FHDA 2Y90A 4RTTA 3UWNA 1UGQB 3RERA 2XMFA 2KRMA 4HNUA 4OMQA 4ZTJA 1M2OA 2O9VA 1WX6A 3QYBA 1MMGA 5FWBA 5GAOr 3G4SA 2CZ0B 1TH7A 4EONB 2VWFA 1QQJA 1VYWB 3BLHB 3E2UA 3E1SA 4JZ3A 2EGAA 4C5IA 2OTLA 1JJ2P 1N9SA 2D8HA 2DO3A 1UE9A 1KC8C 3CCQT 4BE0A 2AZVA 4N4IA 3R6NA 4LXCA 2HSEB 2QYZA 4DOWA 1FMVA 1UNLD 2OAUA 2QGFB 3OS1A 2WMBB 1Y7XA 3JB9I 4HCKA 5GMKh 2JM8A 4HT8A 5GAN3 1URCB 1VQOQ 3OBWA 3GBQA 2HKQB 2LCCA 1MHNA 1M90U 3WVDB 3RNJA 4ELJA 3SDZA 4J9GA 1I5LA 4RTVA 1H1SB 3H0FA 4MDXA 1Q86U 2SEMA 2YLBA 3QWXX 4QQ6A 2PVDB 4WTOB 3UATA 2OX7A 3GTMS 3LX7A 4M6VA 4C92D 4HCBA 4OF1A 2QASA 1OKWB 3BG3A 4ZN1A 2RI3A 3OW2A 4X9DA 1YJ9T 3BE3A 2EKHA 4LDUA 4M75A 1C6VX 4HA8A 3MI9B 4FW1A 5GAOn 1LPLA 2C0TA 3CD6Q 4IMYB 1VQ9A 2J6KA 1VQLT 2J6FA 4PNOA 3A8OB 1UNGD 2KYMA 3JCMe 1KC8U 3CCJT 3HBLA 3UA7A 2LQKA 2V26A 4OMPA 4ATOA 2F69A 3CCMQ 2KY9A 3FEOA 2DVJA 2OAWA 4A53A 1VQ4A 1VQ6T 3I56A 2E5KA 4EORB 3NTHA 1YITT 2HQEA 1AEYA 2IW9B 4BDYA 4M7AE 4Y92A 2LCSA 1H1QB 2PVOB 2KR3A 3KFVA 4C92F 3QUIA 1GUXA 3OYMA 4RTXA 1PWTA 3FC3A 5HQ0B 2Y4XA 1EX4A 2HCKA 1HK9A 1AZGB 2ZPGB 1BI2A 5D6YA 2ED0A 2BE7D 1OKVB 4ESRA 3SFMA 1SEMA 1RAGB 3HPWA 2QGSA 5D6WA 2JS0A 1WXUA 1PRLC 4M77A 1XOVA 4EMKB 1W1FA 2H3EB 3ZBDA 1WGSA 4KRTA 2CKKA 5IHIA 2L2PA 2EGEA 2KYBA 4G6LB 5KYXB 1Q7YC 1VQKA 4KH1B 4IUUA 2HSPA 4HVWA 3JCMc 1MUZA 2CUDA 3URGA 2KRNA 1ZX6A 1VQMA 1JSUB 1KSWA 1VYVA 1YI2T 1T3LA 3DKMA 1MMDA 3CCUT 1KD1R 3DB3A 2AHJB 2RB6A 4KGXB 2OTJA 1YBYA 4PJOC 5IDPB 3LQ5B 5IH2A 1I0CA 4YTLA 5LJ3g 1G3NC 2MMPA 5EJCA 1UHFA 1M8MA 4N0AA 2DEQA 3RMQA 5I5ZB 5DY9A 2AT1B 2XI9A 3D7SB 4KBMB 1D1AA 3QJYA 2WIHB 2V8JA 2ROTA 2KXCA 5LJ3j 1M3CA 5GMKm 3JB9H 1C9BA 3A8LB 3I35A 4XU1A 4J7IA 1FMKA 1VIEA 1RLQC 1D0YA 3OYGA 3CMAA 2AKLA 1Q7YU 3EGDA 3VRZA 4DBFA 5IF1B 4KGZB 3PE0A 3M0QA 4AFZC 2O2OA 1EFNA 1RUWA 1QVGA 2K7AA 1PHTA 3L2VA 4CC7A 3WXMB 1PSFA 2WSEE 1ZUYA 4JS4A 1M30A 2BKZB 2V1RA 2ZPFB 1E6HA 4FSXA 3R6OA 3RKYA 1QWEA 2WJ9A 4CI0C 2DPPB 3FDRA 2WMAB 2PK2A 3S3OA 5IXBA 2MF2A 3H8ZA 4RUGA 4F7LB 4E7SA 4F7UG 2BS3A 3G71A 4C92E 2O9SA 3JB9G 2XU8A 4ELLA 1UECA 2RJFA 3CC2Q 2LMJA 2FVUA 1FYNA 3L1AA 1QLBA 4RTYA 1GFDA 2DD4B 2SRCA 1B7TA 2RJEA 4OP0A 1H27B 1Q81R 4HL4A 4PJOA 2DYBA 5GAN8 3HHTB 2HBPA 2LJ1A 4EMGA 4M7DA 3CD6A 4EOQB 2K2MA 1WJRA 4R0KA 3HP9A 5CKFA 4EIKA 4L59A 3QPHA 3SWNA 4KGVB 1CSKA 2M02A 4M78A 2RMOA 3OS0A 2NWMA 1KG1A 4EOIB 1RADB 3LH5A 3CCLQ 2HMAA 5GAN5 2DEUA 3CCMA 2KDSA 4CFWB 4DBQA 1VYTA 3RMSA 1K8AC 2E5QA 3QHWB 1KHIA 3J80E 4FCYA 4BI3A 1NE8A 3JB9J 1Y96A 1S72Q 2K5LA 2WACA 1JKWA 3VS4A 2EQKA 3QHSA 2X1NB 5CQXA 2VVKA 2W9ZA 4M7AG 1W2BS 1MV3A 1OZ3A 4IUQA 2DMOA 4LD9K 3CCVQ 5KE2A 4XU0A 2DTOA 1F1BB 2K5IA 2EFIA 3DDQB 3OBYA 4PFZA 1HJDA 1M1KC 3HRUA 3X28B 3JCMh 1OEBA 2DILA 3CXCA 1VQ8Q 3VUZA 1M2VA 4OB3B 3OYAA 3IQLA 1K8AU 5FLXE 3HRTA 2PUOB 3C12A 2P4RA 4PLIA 2KT8A 2P84A 5CQYA 1Q82C 2HBWA 3CC7Q 3V7RA 2IPOB 1U3OA 1ZUUA 5GAMg 1AD6A 4CRLB 3DLMA 4OGRB 3E9GA 3O0GD 1ZUKA 3CMEA 1N4MA 2QA4Q 2RHZA 4XQ3A 1OQKA 2LVMA 5GAN4 1X69A 4C8QB 1PRMC 2RHXA 3OW2S 1YIJQ 3M5AA 5GAMj 1BKBA 1H8KA 2XIDA 2KK4A 1OI1A 2QK0A 5KYNA 1Y0MA 3DB4A 4WCIA 2ZPIB 1X27A 5I2SA 2DXCA 1YCYA 2RHIA 3L2ZA 2CP0A 4C5HA 2X3WD 5IHKA 1BYMA 4BCMD 5AYFA 1WJSA 2K6DA 3FRNA 1VQ9T 2CREA 2PUKB 4JRIA 4RCBA 1VQ5T 2FPFA 1ZHIA 4EC9B 3UF4A 2IIMA 5FRMA 2RQUA 2D0NA 1QVFA 3VJPA 4X1VA 2JVVA 4CC2A 2L0AA 4PL6A 4X34A 2XKOC 4LDWA 4CFUB 1AT1B 3VKGA 4P5NA 4BBRM 2ABLA 1R77A 2EQJA 4HNVA 1WXTA 2CGHA 5CKEA 3TW7A 3C4SA 1SRMA 2HZYA 2C5VB 4J6WA 4FT4A 4QT7A 3G4SQ 4GLKA 2EIFA 3BDUA 3HRSA 5LQFB 1JXMA 3TW6A 4J9BA 3LWIA 1HSQA 2OTLQ 2R7GA 1LOJA 1I4K1 3CC2A 1TOVA 2NUTB 1RAEB 2JUFA 3QJ6A 3G33B 2EW3A 4NOYA 2ZPEB 3M0UA 1MMAA 4C8QC 2C5NB 1J3TA 4CFNB 4KUIA 4M4ZA 4KRDB 4BBSM 1PM3A 1JJ2A 2DRKA 5GAN6 5GAOq 1GCPA 1Z9QA 2FPEA 2G3RA 1M1GA 1TTHB 2DK3A 2LC4A 4F17A 1K73R 4NSTB 2DAQA 3Q1JA 2K79A 4JLIA 4J7FA 2YWWA 4QVZA 1VQMT 1SSFA 2QGGA 1N8RC 1IHVA 2EKOA 1WDXA 3VS0A 4Q5WA 5HK3A 4IIOA 3CCLA 4BCGB 2HEQA 4RCCA 5KYUB 1IO6A 2OTJT 2A7YA 1VA7A 4XTUA 1YJNA 2PZ1A 3CPWP 3T9NA 5KYYA 5EG2A 1VUBA 3QG1A 1GL5A 2JMAA 2RQRA 1AVZC 1H1RB 3JCMd 1UGRB 3OQ5A 2LRQA 2RI2A 3V8LA 4UC4A 1VQ4Q 2L3PA 3I56Q 4BCQB 1M90R 1VQPT 1G3SA 1TFBA 1Q86R 1ARKA 3CCVA 1QVGS 2X4YA 2DD5A 4F14A 4OMLA 2QQ8A 1VOMA 4D6WA 4M75B 2GFAA 3BDLA 3CC4Q 3ASKA 3QYGB 1M3BA 1N8RU 1YCSB 3OSVA 3MHXA 3DJBA 5GAN7 1JEGA 1VQ8A 3TSZA 2DL5A 1EIFA 1OPKA 3A1PA 4HVUA 2XICA 3TNHB 2CSIA 2FZCB 2A08A 3MY1B 4ELYC 1KC8R 3M0TA 2UZBB 1DJ7B 2DXBB 2E10A 4J9HA 5LJ5d 2O31A 1OX9A 1TUGB 2FZKB 2GCXA 4C0DB 2EYZA 1VQKQ 4M7AC 4ZTFA 1JB0E 4LNPA 3VRYA 2KVQG 2JNGA 5CEIB 3V7CA 1KQSP 1VOLA 4C5GA 1VQOT 2G77A 4RODA 4JX4A 2A28A 4MIMA 3RKXA 4KULA 1KJWA 2QA4A 3S3NA 4F7UA 3CCEA 2DL7A 3RDVA 3DLLA 1QKWA 2MWPA 5GANj 2O88A 2EVRA 3DDPB 2O4XB 1R0BG 1UGSB 1RI9A 3P8DA 2IN3A 1KFZA 4M75D 1YWPA 4HXJA 1X6OA 5M9OA 3EHQA 3GPLA 3CD6T 1Y71A 2M9UA 3HSBA 1K0SA 4HLQA 1UB4A 2IW6B 2ZZDA 4DEYA 3INZA 3HTRA 2K3BA 3ME9A 5DLQE 1I1JA 1QMZB 1WI7A 3G6EA 2NUPA 3LWHA 3CCMT 3OYNA 3CMAQ 4FYYB 1KQ1A 2ZCFB 2COYA 5FROA 4C92B 1YHQQ 2DYIA 2MWOA 5FU6C 4MZPA 4C5EA 4HCCA 4HNTA 1Z9ZA 4AKHA 5I22A 4HKEA 4M75F 2RH2A 1B34A 4E47A 4BY6B 2CUBA 2EYXA 5J26A 4B9WA 4AMCA 4M77D 3NTIA 3B57A 4QVDA 1GFCA 3GF5A 2DETA 2I40B 1BBZA 3M0SA 3RESA 1T0JA 5KYWB 3GLXA 1OIUB 1WHGA 3G71Q 5I11A 4EOOB 4J6XA 2V8KA 4NC6A 4CFXB 4XK8E 3J81E 2BS4A 3EFRA 4E7ZA 4J8OA 3GNGA 3EGDB 3CXCS 3BHVB 3THKA 1VQNA 2RI5A 2X51A 1Q7YR 1H26B 4Y28E 2L89A 4BXXX 4BE2A 2OI3A 4A4FA 2MYSA 4AFUC 1GCQC 4XTZA 5HKCA 4JX5A 3PIOA 4QQGA 1QCFA 3RIRA 2RQVA 2LX9A 2EQMA 1BIBA 2ECZA 5CIUA 4BCPB 4M77F 2L3RA 1OU8A 3AT1B 1AWJA 4C92C 5IT9E 2CP6A 2B9RA 1FXXA 3OYIA 1E7OA 3JCMV 3SHWA 1PKDB 2W10A 3TNWB 3VYHB 2DIQA 2BKDN 5GMKj 3EGXB 2RN8A 3KBGA 5GAMe 1OI9B 5CKDA 2E3HA 3I55A 4AKGA 4BY6C 3J7AF 1N9RA 5GAOm 1WLPB 3OY9A 1H28B 2FB7A 1ZA2B 4TTHA 2BS2A 1QVFS 1ZSZB 2BE9B 3CC4A 3MEUA 3LYIA 2DMEA 4JZ4A 4OR5B 4BCND 1SHGA 3EG9A 2XDPA 3QYEA 1VQ7A 1YP5A 1EZZB 5LJ5e 4JUVA
chains in the Genus database with same CATH topology
2ZZDB 1LNXA 1VQ7T 1XQHA 4M78A 3JCMX 2E6ZA 3HKSA 5A0DA 3OS0A 1KG1A 2RHUA 5DM7R 5GAN5 3A5ZB 2JN0A 3CBOA 3CCMA 4M75C 1JRIA 2GFUA 3KUFA 1I81A 2KDSA 3OYJA 4C8QD 1YJWA 2CZ1B 5DLOA 3RMSA 3HFNA 1YJWT 3JCMf 1K8AC 2E5QA 1RI0A 2QQSA 1KHIA 3J80E 3MEVA 4RG2A 3CCUA 4M75E 4BI3A 2KSSA 2XG8D 1NE8A 2E1HA 3QSUA 1X75C 3E9FA 4LDVA 4XTXA 3JB9J 2KMGA 1Y96A 1YITT 2K5LA 2WACA 1IREB 1BI1A 2LT4A 2GF7A 2MAMA 2EQKA 3QHSA 3JRZA 2E64A 1JJ2S 3L42A 4C0DC 2Y4YA 3CPWS 2QI2A 4R56A 5CQXA 2K4YA 3PMTA 1B34B 4PJOD 1G5VA 4M7AG 2L5QA 1W2BS 3FLGA 4BI4A 2VXEA 1OZ3A 4QW2A 2PVGB 4IUQA 1NJIC 4HT9A 4M7DD 2JOYA 4LD9K 5A0LA 1ZBXA 5KE2A 4XU0A 3OMGA 5I2MA 3VKIA 2DTOA 2X4XA 2YHTA 2K5IA 2EFIA 4BDZA 3OBYA 2CYZB 4C0ZA 3HB9A 1M1KC 4TVRA 3MEWA 3HRUA 1Y07A 4M78D 4MMKA 4M7AB 4C8QF 3TEEA 4F7UE 3X28B 4ZGJB 3CPFA 4M7AA 2QQAA 4N4HA 3CCLT 3JCMh 3M58A 4A4HA 4A4KA 4B9XA 4M77C 4O5VA 4MFEA 5LJ5f 4EMKC 3CXCA 2P0QA 3UT1A 4O6JA 1GXIE 1O75A 3G7ZA 3VUZA 4OB3B 1U1TA 3PFSA 1QP2A 1YHQA 3UDCA 4Z6YA 3OYAA 3A8MB 1K8AU 4M77E 5FLXE 3HRTA 1S72A 2PUOB 3C12A 4PLIA 4J6YA 4FT2A 4RMOA 3OS2A 1S72T 4Z02A 4L6V5 4AI6A 5CQYA 1Q82C 2RJCA 2IVWA 4PJOF 3V7RA 4C8QG 4FU6A 5GAMg 5CAIA 1HXDA 3S3MA 4PKCC 3M53A 4LOCA 2WSCE 4J83A 4BUGA 3DLMA 3MO8A 3E9GA 4M7DF 2RA2A 3GNFB 3CMEA 2L8DA 2DZCA 3NTKA 5CVIA 2QQ9A 3NFCA 2IG0A 5CR2A 3BG5A 3X25B 2RHZA 3P8BB 3OW2S 4A4GA 4XQ3A 3CMET 2RK2A 3A8HB 3PMIA 5KCOA 2LVMA 4NL2A 5GANh 5GAN4 1NJIU 3JCMQ 3CBMA 3H6ZA 3S6WA 4C8QB 3CCVT 2RHXA 1FX7A 2DZ9A 2GQVA 2P0PA 2X35A 3M5AA 1BKBA 4M78F 5GMKl 2XIDA 2KK4A 4VUBA 3V8KA 1OI1A 3JCMb 3L2QA 1KQSS 5C6SA 3PIPA 1M5Q1 3DB4A 2ZPIB 2NLUA 4PJOG 5I2SA 2DXCA 1YCYA 4N0AC 2RHIA 1K9MC 3L2ZA 4C5HA 3H4CA 4M7AD 4R55A 1KHCA 1BYMA 2LCLA 3BFMA 1E7PA 4KT0E 5AYFA 1WJSA 4M7DG 5GANd 3OYHA 3RKWA 1VQ5A 3FRNA 1VQ9T 5FU6B 2PUKB 3M9QA 4JRIA 1VQ8T 4HCZA 4RCBA 3M57A 1N6AA 1VQ5T 4E7HA 2YLCA 1ZHIA 2JZ2A 3TU4K 2VGMA 4XU3A 3SB2A 5FRMA 2M16A 1M4ZA 3MCAB 3WVEB 3OYDA 4PJOB 2DXBA 4M78G 1QVFA 2DTHA 3VJPA 1X01A 2KMTA 3CC7A 2JVVA 1OYXA 1K73C 3VV0A 4M7DB 1WPYA 2QQRA 4PL6A 4X34A 3CC7T 1W4SA 2XKOC 4LDWA 2R5AA 5GMKi 3CCRT 2DXTA 3QDRB 3VKGA 4P5NA 2DKGA 5C0MA 4BBRM 4LDXA 3VKHA 3VYGA 1D3BA 1RL2A 2EQJA 3OYYA 3SWNB 4HNVA 3OYEA 3V7SA 2CGHA 5CKEA 2VV5A 5CO7A 3TW7A 3C4SA 1NZ9A 4M78B 5HK0A 2LTOA 2QA4T 4E7KA 2K2VA 4OGEA 4GY5A 2D0QB 4FT4A 4J6WA 3OYFA 1YIJA 5CK9A 4GLKA 4C0GA 2EIFA 2O01E 2PQWA 3BW1A 3QPHA 1YIJT 2EYQA 2P0KA 3BDUA 2EQUA 3HRSA 1QW1A 3E19A 4M7AF 3TW6A 2O4XA 3LWIA 1LOJA 2YRVA 1I4K1 3CC2A 2P4TA 5LL6S 2E12A 5I21A 3L2WA 1I8FA 4ZN3A 4X9CA 4EDUA 3CC2T 2JUFA 3LH0A 3QJ6A 3UPUA 5GAOl 1K9MU 3ER0A 1Y96B 4JLGA 4NOYA 5LJ3h 4A4EA 2VC8A 4IURA 2ZPEB 2KR6A 3HO8A 4IUTA 4C8QC 3M59A 1M90C 4J5YA 3JCMP 2KAFA 5GAMf 5A0GA 2B8AA 4KUIA 4BBSM 4OB1B 2QQBA 1JJ2A 5GAN6 3HL8A 2D9TA 3CPWA 5J3BA 4XU2A 5GAOq 1Q86C 2H3JA 2C06A 2E41A 1WQWA 2RHYA 3M55A 2CZ6B 2FYKA 2K57A 3FJPA 2G3RA 4C8QE 4QVCA 1W2BA 1M1GA 2DK3A 2LC4A 1K73U 5LJ3d 2FHDA 2DAQA 2CS7A 2Y90A 3Q1JA 1UGQB 3UWNA 3RERA 4JLIA 4C92A 3M4YA 4HNUA 4EPCA 4J7FA 4QVZA 4ZTJA 1VQMT 1SSFA 1KQ2A 2DIGA 1N8RC 2CZ7B 2EKOA 3OB9A 3QYBA 4Q5WA 1MGQA 3OA6A 5HK3A 1FKMA 2CZ0B 1TH7A 2HNIA 3G4SA 2DVEA 5GAOr 4AKIA 3CCLA 4RCCA 2FL7A 1M8VA 2OTJT 2A7YA 3A8GB 3ZEHA 3G4ST 1VIFA 3JCMW 4N4GA 4XTUA 3E1SA 3EFSA 5CKBA 5KH6A 1YJNA 4M7DC 4C5IA 2OTLA 1N9SA 3C94A 2DO3A 3AHUA 3VUBA 1YJNT 2E65A 2EJGA 1O9SA 3T9NA 1KC8C 2OTLT 3CCQT 4BE0A 4N4IA 3CCST 3QKJA 1XTDA 3SWNC 1ZQ1A 1BI3A 4V2SA 4IUPA 4DOWA 4M7DE 5EG2A 1VUBA 3QWLA 3QG1A 4M78C 2A3LA 3M4GA 3P8HA 2OAUA 5GAMh 3PGGA 3OS1A 3PTAA 1Y7XA 4BI8B 3JCMd 3JB9I 1UGRB 2M1HA 3OQ5A 4BACA 2LRQA 3HFOA 4QQDA 3SD4A 5GMKh 2VXFA 2RI2A 2I2LA 4L5GA 3V8LA 5GAN3 3OYLA 4E7IA 3X20B 4FL6A 4UC4A 3OBWA 1VQPA 4M78E 3MP1A 2LCCA 4M75G 2BIVA 1MHNA 4OMFB 3WVDB 2RK1A 4ELJA 3SDZA 1VQPT 1M90U 1G3SA 2ZPHB 4E7JA 1I5LA 3MP6A 1M1FA 5FU7B 4MDXA 1Q86U 4XTWA 1Q81C 2YLBA 3CCVA 4QQ6A 1PSEA 2X4YA 3RUXA 2PVDB 1QVGS 1N27A 2DD5A 3LX7A 4ZGEB 4M6VA 2WSFE 4C92D 1YJ9A 4HCBA 2QQ8A 4OF1A 5CKHA 3L2RA 2DXUA 1IZ6A 3V8JA 3BG3A 4D6WA 2RI3A 3EAEA 2GFAA 3BDLA 4M75B 4X9DA 3ASKA 4ZN1A 3OW2A 2R57A 2DXCB 4FM4B 1G3WA 4LDUA 3QYGB 4HA8A 4M75A 3HZJA 5LJ5h 1U8RA 1N8RU 5GAOn 4WF2A 3OSVA 1VQLA 5FRNA 1WNLA 2QF7A 3MHXA 4JRPA 1M1KU 3JAME 1VQ9A 5GAN7 1VQLT 2ZPBB 1VQ8A 4PNOA 3A8OB 1EIFA 3CCJA 4JX6A 2XICA 3JCMe 1QVPA 4ELYC 1KC8U 5A2QE 3CCJT 3HBLA 4ZGDB 1DJ7B 2DTIA 2DXBB 2E10A 2LQKA 5LJ5d 4OVAA 2GCXA 4C0DB 1VQ6A 1V29B 2E6NA 2F69A 1JB0E 5GAMj 4ZTFA 4ATOA 2LNVA 4M7AC 2KY9A 3FEOA 2QEXT 3CCRA 2F5TX 2KVQG 3M56A 4A53A 1VQ4A 1VQOA 3I56A 2JNGA 1VQ6T 3DL1A 1YITA 2K3XA 3V7CA 3QIIA 4JJNK 1KD1C 2QXFA 4C5GA 3F70A 3NTHA 1VQ4T 1VQOT 3I56T 3VYGB 1D3BB 1Q82U 2G77A 5CCAA 2HQEA 5L8RE 4JX4A 2XDDA 4BDYA 4MIMA 2HD0A 3LGLA 3RKXA 4M7AE 4KULA 4JDSA 2QA4A 3S3NA 1H3ZA 1QP3A 4F7UA 3CCEA 4NS5A 2PVOB 4C92F 3DLLA 2MWPA 4IKFA 2DD4A 3QUIA 4FIBA 3OYMA 4ME7A 3CCET 5GANj 3QXEB 1NPRA 2Y4XA 3FC3A 1Q81U 4II1A 3GIBA 1HK9A 1BI2A 4LD6A 2ZPGB 5D6YA 2O4XB 3KHIA 3SFMA 1UGSB 4MMLA 5GANe 3HPWA 3P8DA 5D6WA 2LT1A 4M75D 4M77A 1XOVA 1OZ2A 4OGCA 4EMKB 1X6OA 2X4WA 4C0FA 1YJ9T 4EMKA 5M9OA 3OSSC 3BY7A 3ZBDA 3GPLA 3CD6T 1WGSA 2CKKA 2R58A 3C95A 1Y71A 2M9UA 4A54A 3HSBA 3X26B 4HLQA 4C92G 1UB4A 2ZZDA 3INZA 2RD1A 2M0OA 3QZ9B 3ME9A 5J39A 1Q7YC 1VQKA 5DLQE 2F5KA 4IUUA 5GAN2 1P92A 3OYBA 3G6EA 4LDYA 3JCMc 3LWHA 1VQKT 3CCMT 2R5MA 3OYNA 2K3YA 4JRKA 1KQ1A 2ZCFB 3G6ET 3URGA 1YI2A 3X24B 1H641 4JRQA 4KUDK 1NPPA 5HY6A 4XTYA 5FROA 4C92B 1VQMA 3JCMJ 2MWOA 2EJFA 1YI2T 2EWNA 4OB0B 3DKMA 5FU6C 1KD1U 3QBYA 3CCUT 3DB3A 3TREA 2VGNA 4MZPA 3QYHB 2EJ9A 2AHJB 2RB6A 4C5EA 4HCCA 4HNTA 2OTJA 1YBYA 4PJOC 4RG8A 2XK0A 4RKUE 4AKHA 3PNWC 4YTLA 5KCHA 5LJ3g 1WQ7A 2V8IA 2QDJA 5EJCA 2MMPA 3JB9D 1KQSA 4HKEA 4M75F 3VU3C 2RH2A 2X4JA 4N0AA 3CCQA 1B34A 3LLRA 3CCSA 4BE1A 4XAXB 2DEQA 3GOXA 3OS5A 3RMQA 4E47A 4PJOE 4BY6B 3MEAA 3M54A 5DY9A 5J26A 4B9WA 4M77D 2LDMA 3NTIA 1UGPB 2XI9A 3GF5A 4KBMB 3ZFJA 3QJYA 4QVDA 2XD0A 3RESA 2V8JA 3GLXA 4ELZC 5LJ3j 3OMCA 3MP8A 4J6XA 2V8KA 3A8LB 5GMKm 5GANf 2XDBA 4Y91A 4NC6A 3JB9H 4XK8E 4J7IA 4XU1A 1VIEA 2BS4A 2PU9B 2K5FA 3J81E 2VUBA 3EFRA 5LJ3e 4J8OA 3QZ5B 3GNGA 3OYGA 4MDWA 4PLLA 4IUVA 3CXCS 3CMAA 1VQNA 1Q7YU 2RI5A 3FIFA 1XNIA 2ZGWA 4Y28E 2DJZA 2L89A 3JSCA 1R8OB 5D6XA 3CMAT 1VQNT 3JCMg 4DOVA 5GAMd 4BE2A 2DD5B 4EMHA 4A4FA 4MZTA 1WJQA 4F7UF 1YHQT 1QVGA 2RJDA 3L2VA 4XTZA 2KQWA 5HKCA 3WXMB 4JX5A 1PSFA 2WSEE 3PIOA 4QQGA 3OYKA 4JS4A 3JB9F 3RIRA 1BIAA 2LX9A 2EQMA 2ZPFB 1BIBA 3R6OA 4FSXA 3RKYA 3N5BB 3LW5E 5CIUA 4BD3A 4XTVA 2WJ9A 1M9SA 4M77F 4CI0C 4DA4A 2L3RA 2DPPB 2JTFA 2VYTA 3FDRA 3QO3A 3OYCA 3L2UA 4C92C 3FB9A 2LQ8A 3S3OA 5IT9E 2MF2A 3H8ZA 2E70A 1FXXA 4F7UG 3OYIA 4OB2B 2BS3A 3G71A 3PT9A 3CBPA 5IN1A 2QEXA 4C8QA 2RO0A 3JCMV 4C92E 4CRIA 3G71T 2EAYA 3GP8A 4JS5A 3CEYA 5GANg 3JB9G 2HAXA 3VYHB 2DIQA 1FWZA 2BKDN 2XU8A 4BB7A 2QFZA 5GMKj 2BUDA 3KBGA 4NL3A 2HQXA 5GAMe 2RJFA 1AHJB 5CKDA 3I55A 3KXTA 4AKGA 4BY6C 3J7AF 4M77G 2FVUA 1N9RA 5LJ5g 3L1AA 5GMKe 4F7UB 4HT8A 1QLBA 5GAOm 3I55T 1U1SA 3OY9A 3O8VA 2FB7A 2DD4B 2BS2A 2XHCA 5IAYA 1QVFS 2RJEA 5LJ3f 2QDYB 2JTMA 4MFDA 1G3TA 4OP0A 4DQ2A 4E7LA 4HL4A 4PJOA 3CC4A 5GAN8 5KE3A 3BG9A 2QTXA 3MEUA 3LYIA 3HHTB 1G3YA 2HBPA 3LGFA 4M77B 1UEBA 4EMGA 5LJ5j 3CC4T 2D6FA 3CD6A 4M7DA 5GAOp 5LJ5e 1WJRA 1BI0A 1JBMA 5CKFA 3HP9A 3TCJA 4MZMA 2XDPA 3QYEA 4QSHA 5FU7C 4L59A 1VQ7A 1LJOA 3META 2MI6A 2RM4A 3SWNA 4JUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X20 B;  2ZZD B;  4RKU E;  3WVD B;  2ZPH B;  2PUK B;  1PSE A;  2CZ1 B;  2PVD B;  3WVE B;  2DD5 A;  2DXB A;  4ZGE B;  2WSF E;  1UGP B;  2DXC B;  4FM4 B;  3QYG B;  3A8L B;  3VYG A;  4XK8 E;  1IRE B;  2PU9 B;  2ZPB B;  3A8O B;  3QZ5 B;  2D0Q B;  4Y28 E;  2O01 E;  4ZGD B;  1DJ7 B;  2PVG B;  2DXB B;  2DD5 B;  1V29 B;  1JB0 E;  1PSF A;  2WSE E;  2CYZ B;  3VYG B;  2ZPF B;  5L8R E;  2ZPE B;  3LW5 E;  3X28 B;  4ZGJ B;  1QP3 A;  2PVO B;  2DPP B;  2DD4 A;  4OB1 B;  3QXE B;  1GXI E;  2ZPG B;  4OB3 B;  2CZ6 B;  1QP2 A;  4OB2 B;  1UGS B;  3A8M B;  2PUO B;  1UGQ B;  3VYH B;  2CZ7 B;  4L6V 5;  1AHJ B;  2CZ0 B;  3X26 B;  2WSC E;  2ZZD A;  3A8G B;  2DD4 B;  3QZ9 B;  3X25 B;  2QDY B;  3A8H B;  2ZCF B;  3X24 B;  3HHT B;  4OB0 B;  2ZPI B;  2DXC A;  1UGR B;  3QYH B;  2AHJ B;  4KT0 E; 
#chains in the Genus database with same CATH topology
 2LJ0 A;  1HD3 A;  3VS7 A;  1LNX A;  1XQH A;  3H0H A;  2DM1 A;  4KRC B;  2FZG B;  2RHU A;  5DM7 R;  2GFU A;  3KUF A;  1I81 A;  1YJW A;  4YOO A;  1I07 A;  2CP2 A;  1WA7 A;  3HFN A;  3JCM f;  4EOP B;  1RI0 A;  2QQS A;  1X2K A;  4M75 E;  3O5Z A;  1RLP C;  2KSS A;  2XG8 D;  5HNB B;  3QSU A;  1X75 C;  4XTX A;  1AWX A;  1OPL A;  3A98 A;  1IRE B;  2LT4 A;  2MAM A;  1JJ2 S;  2CCH B;  4R56 A;  3PMT A;  4PJO D;  2L5Q A;  1R0C B;  4BI4 A;  8AT1 B;  4QW2 A;  2PVG B;  4IIM A;  1NJI C;  2A37 A;  1OL1 B;  3CME Q;  2EQI A;  4M7D D;  2K9G A;  1IGQ A;  5A0L A;  1UDL A;  3REA B;  2MIO A;  1W6X A;  4C0Z A;  3EFO B;  3HB9 A;  3BLR B;  1ZSZ C;  4M78 D;  4MMK A;  1YWO A;  3TEE A;  3CCL T;  2GGR A;  3M58 A;  4O5V A;  5LJ5 f;  1YNZ A;  1VYU A;  4EMK C;  4F70 B;  2CDT A;  1BB9 A;  1U1T A;  1YHQ A;  1QP2 A;  3UDC A;  4M77 E;  1K8A R;  2J6O A;  1NEB A;  4BCF B;  1OX8 A;  4J6Y A;  4RMO A;  3OS2 A;  1S72 T;  4J9D A;  1TU0 B;  2RJC A;  4PJO F;  4C8Q G;  2YRD A;  3M53 A;  4PJM A;  2WSC E;  4J83 A;  2X9H A;  3MO8 A;  4M7D F;  2RA2 A;  3NTK A;  1MMN A;  4BCJ B;  5CVI A;  3NFC A;  2IG0 A;  1D1C A;  5CR2 A;  1P5E B;  3P8B B;  2RK2 A;  3A8H B;  2A36 A;  1NJI U;  2KRO A;  3CCV T;  3EG3 A;  4M78 F;  2P0P A;  4VUB A;  3PIP A;  1M5Q 1;  1B07 A;  2RQT A;  3H4C A;  1GBQ A;  3BFM A;  3PVL A;  1PD1 A;  1YFN A;  4KH0 B;  4F6U B;  1VQ8 T;  1B3Q A;  4E7H A;  3SB2 A;  1SPK A;  3WVE B;  3OYD A;  2DTH A;  1X01 A;  1MV0 B;  2KRS A;  1SG5 A;  2PHG A;  2ENM A;  1BU1 A;  1W4S A;  3CC7 T;  2DL3 A;  2DKG A;  2FPD A;  2W99 A;  4F6W B;  4ZNX A;  3OYE A;  1UUE A;  2GTJ A;  1NZ9 A;  2DBM A;  5HK0 A;  2QA4 T;  4E7K A;  1KK7 A;  4D8K A;  2F1L A;  1OU9 A;  1YIJ T;  2EYQ A;  1QW1 A;  3E19 A;  1YJN Q;  2KE9 A;  3CCS Q;  2P4T A;  2FEI A;  3L2W A;  2ZAE A;  4IUT A;  1U5S A;  1MND A;  4J5Y A;  3JCM P;  2KAF A;  4JJD A;  5KYX A;  2L3S A;  2QQB A;  1KXU A;  1WYX A;  3CPW A;  5J3B A;  4XU2 A;  5HBE B;  2QG9 B;  2E41 A;  1WQW A;  3M55 A;  1UJY A;  2FYK A;  5LJ3 d;  1T3S A;  1WZO A;  2CS7 A;  2YRC A;  3M4Y A;  1ABQ A;  2DIG A;  4GLM A;  3OB9 A;  4PJN A;  1BK2 A;  3OA6 A;  1FKM A;  2HNI A;  2DVE A;  1AIS B;  4BCM B;  1M8V A;  3A8G B;  3G4S T;  3C94 A;  3AHU A;  2EJG A;  2OTL T;  3QKJ A;  1XTD A;  4V2S A;  4IUP A;  4M7D E;  1A0N B;  3QWL A;  2RF0 A;  2EYW A;  2A3L A;  3M4G A;  3P8H A;  5GAM h;  8ATC B;  3PTA A;  4BI8 B;  1ENW A;  2QEX Q;  3NMZ C;  2M1H A;  3HFO A;  3SD4 A;  2VXF A;  2I2L A;  4L5G A;  4M78 E;  4M75 G;  2DA9 A;  2RK1 A;  4E7J A;  2ZPH B;  1M1F A;  5FU7 B;  4PK4 A;  4XTW A;  1Q81 C;  3CCE Q;  2HL3 A;  2BTT A;  4ZGE B;  2VKN A;  1YJ9 A;  5CKH A;  2DXU A;  1IZ6 A;  2YUO A;  3EAE A;  5ECA A;  1KQS A;  5LJ5 h;  3HZJ A;  1N8R R;  5FRN A;  4WF2 A;  2DX1 A;  1VQL A;  1LCK A;  2B86 A;  4JRP A;  1M1K U;  3JAM E;  4Y72 B;  2ZPB B;  1K4U S;  2BZ8 A;  2DFU A;  4JX6 A;  3CCJ A;  2GQI A;  2CT3 A;  1QVP A;  5A2Q E;  2FRW A;  5CYI B;  3M0P A;  4FX3 B;  4OVA A;  2DL4 A;  1VQ6 A;  1V29 B;  2GNC A;  2F5T X;  3G6E Q;  3DL1 A;  2F2X A;  1YIT A;  2K3X A;  4JJN K;  2DL8 A;  3QII A;  2QXF A;  3F70 A;  1VQ4 T;  3I56 T;  3VYG B;  1D3B B;  2NYS A;  5CCA A;  1Q82 U;  2XDD A;  1H3Z A;  3F5X B;  1PNJ A;  1PC0 A;  2DD4 A;  4FIB A;  1JXO A;  1UGV A;  1PKT A;  3QXE B;  1BCM A;  1Q81 U;  4II1 A;  4YC3 B;  4LD6 A;  2WHB B;  3PVQ A;  1D09 B;  3EG0 A;  3MJX A;  1OZ2 A;  3BHT B;  2YXY A;  2GBQ A;  4AFQ C;  2R58 A;  1WHH A;  1S1N A;  3C95 A;  4A54 A;  4E2F B;  1NYG A;  1Q95 G;  5EFQ B;  4C92 G;  1RAH B;  4Z89 A;  1O9K B;  3QDF A;  2M0O A;  5J39 A;  2F5K A;  2NUP B;  2C0I A;  3OYB A;  1VQK T;  4LDY A;  2R5M A;  2K3Y A;  2DBK A;  1VQN Q;  2F2V A;  1F5Q B;  1D0X A;  3JV3 A;  1YI2 A;  3X24 B;  1ZA1 B;  3BHU B;  1NPP A;  1NYF A;  3JCM J;  2EJF A;  2EWN A;  4OB0 B;  2OJ2 A;  1UTI A;  2VGN A;  5IDN B;  3QYH B;  3SEM A;  3EOC B;  2LX7 A;  2XK0 A;  4RG8 A;  4PFP A;  4EOJ B;  5KCH A;  1WQ7 A;  4BCI B;  3JB9 D;  3VU3 C;  1TD6 A;  3CCS A;  4XAX B;  5AT1 B;  3GOX A;  3MEA A;  3M54 A;  2LDM A;  1UGP B;  3ZFJ A;  2EYY A;  2WXV B;  1K9A A;  2MPX C;  4ELZ C;  2F2W A;  2YDL A;  3OMC A;  2WEV B;  3MP8 A;  2MOX A;  1ZBJ A;  2PU9 B;  4AFS C;  5LJ3 e;  4MDW A;  4PLL A;  3FIF A;  2CT4 A;  3I55 Q;  2DJZ A;  1UNH D;  1R8O B;  3CMA T;  4DOV A;  5GAM d;  2L3Q A;  4F7U F;  1YHQ T;  1H4L D;  2RJD A;  1SRL A;  3TN8 B;  2KQW A;  4CXA B;  2QTV A;  2ATC B;  3JB9 F;  1BIA A;  2GTO A;  4LUE A;  4DEX A;  4FYV B;  2KI7 A;  3LW5 E;  1NLP C;  4UN0 A;  1M9S A;  2WIP B;  2QAZ A;  4LE9 A;  3L2U A;  1VQ7 Q;  1GBR A;  1JO8 A;  2UUE B;  1C0M A;  2Z0W A;  4OB2 B;  3CBP A;  2W9F A;  2QEX A;  4C8Q A;  2YSQ A;  2RO0 A;  1H25 B;  2W96 A;  3G71 T;  1TXQ A;  1YJW Q;  5GAN g;  2HAX A;  4II5 B;  4I3Z B;  4BB7 A;  2QFZ A;  2HQX A;  1AHJ B;  3KXT A;  1TUD A;  1X6B A;  1GUX B;  2YUN A;  5IAY A;  4ROC A;  5LJ3 f;  2QDY B;  3NDQ A;  1GY3 B;  2C5X B;  3BG9 A;  4YOS A;  1G3Y A;  4M77 B;  3LGF A;  1NG2 A;  3EG9 B;  2QDL A;  3TSW A;  3TCJ A;  4MZM A;  4ORZ A;  3EH1 A;  3MET A;  1SF9 A;  3GIB A;  2E6Z A;  3HKS A;  1WHL A;  5A0D A;  2DNU A;  4BCK B;  2JN0 A;  4M75 C;  1JRI A;  3NHN A;  3OYJ A;  2CZ1 B;  5DLO A;  3BLQ B;  3UA6 A;  3H0I A;  2NUT A;  1QCO A;  2E1H A;  2LQN A;  3I9Q A;  3EGU A;  3E9F A;  2KNB B;  1TUC A;  2H8H A;  2D1X A;  2CP3 A;  4C0D C;  2Y4Y A;  3CPW S;  5FWC A;  2QI2 A;  2VB6 A;  1G5V A;  3FLG A;  1IHW A;  2JOY A;  2ED1 A;  4QKU A;  1C1A A;  3OMG A;  5I2M A;  2JT4 A;  2X4X A;  5FGK B;  2YHT A;  1YN8 A;  2CYZ B;  4TVR A;  3MEW A;  4J9C A;  4F7U E;  4ZGJ B;  4M7A A;  3RGF B;  5KYU A;  1JQQ A;  4A4H A;  4B9X A;  4M77 C;  4AG1 C;  2P0Q A;  4JPB W;  2JS2 A;  1VIN A;  3PFS A;  4J9F A;  2UZL B;  2AKK A;  3A8M B;  2BZY A;  1NBE B;  2CP7 A;  1TSF A;  4F16 A;  4FT2 A;  2V22 B;  4BCN B;  3CCR Q;  4FU6 A;  3EH2 A;  3S3M A;  2F2C A;  4A63 B;  4BUG A;  3NGP A;  3CQT A;  2COW A;  3GNF B;  2DZC A;  3CME T;  5IXF A;  4NL2 A;  1MNE A;  1NJI R;  3H6Z A;  4EOK B;  2X35 A;  5GMK l;  1KQS S;  3L2Q A;  5C6S A;  1ABO A;  3VS5 A;  3MIA B;  4N0A C;  5ICP B;  1K9M C;  2DJQ A;  1GRI A;  2LCL A;  1OGU B;  4KT0 E;  2HKN A;  1FIN B;  1H24 B;  1XJW B;  5GAN d;  3RKW A;  1VQ5 A;  2FRY A;  2EGC A;  4HCZ A;  1N6A A;  2YLC A;  2JZ2 A;  3TU4 K;  2VGM A;  1Y57 A;  2UZD B;  2M16 A;  3MCA B;  4PJJ A;  4PJO B;  4F6S B;  2DXB A;  4CC3 A;  2KGT A;  1UFF A;  4F7S B;  1HYO A;  4M7D B;  2QQR A;  5GMK i;  2X3X D;  3QDR B;  4GBQ A;  2HQH A;  3VKH A;  3M03 A;  1CKB A;  4BY1 X;  1RL2 A;  3SWN B;  2VV5 A;  5CO7 A;  4M78 B;  2K2V A;  4OGE A;  2D0Q B;  2IW8 B;  5CK9 A;  2O01 E;  1OOT A;  1PD0 A;  2DRM A;  2P0K A;  2FO0 A;  2CP5 A;  3EG2 A;  3EID B;  2O4X A;  2JM9 A;  3I5S A;  2YRV A;  3CCQ Q;  5I21 A;  1I8F A;  1M3A A;  4ZN3 A;  3CC2 T;  3LH0 A;  1K9M U;  1Y96 B;  4JLG A;  4A4E A;  5LJ3 h;  2VC8 A;  2KR6 A;  3HO8 A;  1GCQ A;  2I0N A;  1FMW A;  3M59 A;  5GAM f;  5A0G A;  2B8A A;  4OB1 B;  4EOL B;  3RR6 A;  2CCI B;  2D9T A;  2H3J A;  2RHY A;  2CZ6 B;  3FJP A;  1XO2 A;  1JU5 C;  3PO3 S;  4C92 A;  1UG1 A;  4EPC A;  1KQ2 A;  1I5O B;  2CZ7 B;  1YJ9 Q;  2DER A;  1MGQ A;  2UZE B;  4AKI A;  2FL7 A;  1D0Z A;  2KT1 A;  3ZEH A;  3JCM W;  1VIF A;  4N4G A;  5CKB A;  3EFS A;  5KH6 A;  1VQL Q;  4M7D C;  3VUB A;  1YJN T;  2E65 A;  3TNI B;  1M2V B;  1O9S A;  2W0Z A;  3CCS T;  1W2B P;  1W70 A;  3SWN C;  1ZQ1 A;  1BI3 A;  3CCJ Q;  2PK9 B;  4F7J B;  4M78 C;  5EC7 A;  1TS9 A;  2I53 A;  2ESW A;  3PGG A;  5KYW A;  4RTZ A;  2EUF A;  3TQ7 P;  1SSH A;  1X6G A;  4BAC A;  1VQ6 Q;  4QQD A;  1OIY B;  3MY5 B;  2ROL A;  4E7I A;  3OYL A;  1UJ0 A;  1T0H A;  3X20 B;  4FL6 A;  1VQP A;  3MP1 A;  1YIT Q;  2RQW A;  2BIV A;  4OMF B;  4F7N B;  3MP6 A;  1X43 A;  2MCN A;  2RNA A;  4JJC A;  1PSE A;  4AT1 B;  3RUX A;  1N27 A;  9ATC B;  2M0Y A;  2WSF E;  1M27 C;  2C6T B;  3L2R A;  1NLO C;  3V8J A;  2R57 A;  2DXC B;  4FM4 B;  1G3W A;  1IXD A;  1U8R A;  1V76 A;  1OUL A;  2MK5 A;  1WHK A;  1WNL A;  2QF7 A;  1M1K R;  1QCN A;  3EG1 A;  4ZGD B;  1WHJ A;  2DTI A;  4EC8 B;  1PCX A;  2LZ6 B;  2E6N A;  2LNV A;  2QEX T;  3CCR A;  3M56 A;  4DBR A;  3OW2 P;  1PKS A;  1VQO A;  1E6G A;  1K0X A;  1KD1 C;  3EGX A;  2A0F B;  1N5Z A;  1YI2 Q;  1Q82 R;  5L8R E;  3CCU Q;  3LGL A;  2CJM B;  2HD0 A;  4JDS A;  4RTU A;  1BU2 A;  1QP3 A;  4K11 A;  4NS5 A;  4BY7 X;  4IKF A;  1QWF A;  3CCE T;  4ME7 A;  1NPR A;  2D8J A;  1ZSZ A;  4CC4 B;  1IB8 A;  3KHI A;  1PG5 B;  3VS3 A;  4MML A;  4PJL A;  4RTW A;  4E6R A;  2J05 A;  5GAN e;  2LT1 A;  4OGC A;  4C0F A;  2X4W A;  4EMK A;  3OSS C;  3BY7 A;  3X26 B;  4B6M A;  2JW4 A;  2BPM B;  5L2W B;  1QMC A;  2RD1 A;  3QZ9 B;  2CH4 A;  5GAN 2;  1P92 A;  1ACM B;  3RBB B;  2HL5 C;  4JRK A;  1QKX A;  3MPU B;  3G6E T;  1H64 1;  4JRQ A;  4KUD K;  3ZL7 C;  5HY6 A;  5IHY A;  4XTY A;  1RAA B;  2JXB A;  2E3I A;  3VS6 A;  1KD1 U;  3QBY A;  1W98 B;  3TRE A;  5HBH B;  2EJ9 A;  4FYX B;  1AZE A;  1TWB A;  4RKU E;  1RAC B;  2DF6 A;  3PNW C;  2V8I A;  2QDJ A;  4EOS B;  2X4J A;  3CCQ A;  5HVY B;  3LLR A;  1X2Q A;  4BE1 A;  4HVV A;  3OS5 A;  4PJO E;  4YOZ A;  2VAS A;  5KYY B;  5GJW B;  2XD0 A;  1IRX A;  4AG2 C;  5DQV A;  2JTE A;  2LJ3 A;  5GAN f;  2XDB A;  3EFO A;  4Y91 A;  2K5F A;  2VUB A;  3QZ5 B;  1AD5 A;  2LNH B;  4IUV A;  5GJV B;  3REB B;  1XNI A;  2CH4 W;  2ZGW A;  2YUP A;  3JSC A;  5D6X A;  4BCH B;  1VQN T;  3JCM g;  2DD5 B;  4EMH A;  4MZT A;  1WJQ A;  4BCO B;  2WPA B;  2JJ9 A;  3OYK A;  3EJ1 B;  2KBT A;  4D8D A;  3DOG B;  2JGZ B;  3N5B B;  5DQW A;  4BD3 A;  2PNI A;  4XTV A;  1U06 A;  4DA4 A;  2VYT A;  3QO3 A;  2JTF A;  3OYC A;  2EBP A;  1FVV B;  3FB9 A;  2LQ8 A;  1CKA A;  2E70 A;  2IVX A;  3PT9 A;  5IN1 A;  4OMO A;  1ZP2 A;  1QVG P;  2LQW A;  4CRI A;  2EAY A;  3GP8 A;  2KEA A;  4JS5 A;  3CEY A;  1BCO A;  1H3H A;  4Z8A A;  4NL3 A;  1FWZ A;  1JOW A;  2BUD A;  3G1J A;  2LP5 A;  4M77 G;  1OL2 B;  5LJ5 g;  5GMK e;  4F7U B;  3H41 A;  3I55 T;  1U1S A;  3O8V A;  1V1C A;  3VS2 A;  2RPN A;  2XHC A;  4DQ2 A;  2JTM A;  4MFD A;  1G3T A;  1NM7 A;  4OMN A;  4E7L A;  5KE3 A;  2QTX A;  2G9X B;  2JMC A;  3CC4 T;  1UEB A;  5LJ5 j;  2NUZ A;  2D6F A;  5GAO p;  2J7I A;  1BI0 A;  1JBM A;  7AT1 B;  3QHR B;  4QSH A;  5FU7 C;  1LJO A;  2MI6 A;  2RM4 A;  2ZZD B;  1RAB B;  1VQ7 T;  3JCM X;  3NPF A;  4DBH A;  3A5Z B;  3CBO A;  3M0R A;  5IHN A;  1K76 A;  1AWO A;  4C8Q D;  2WFY B;  2W2H A;  1YJW T;  4ROE A;  3MEV A;  4RG2 A;  3CCU A;  4FSS A;  4LDV A;  2KMG A;  1BI1 A;  2GF7 A;  1WFW A;  1ZLM A;  3JRZ A;  2E64 A;  3QWY A;  3L42 A;  2C4G B;  2K4Y A;  1B34 B;  5BNJ B;  3MKD A;  2VXE A;  4PFO A;  4HT9 A;  1ZBX A;  4CFU D;  2PTK A;  1H92 A;  3VKI A;  4F04 B;  5HCK A;  2J06 A;  4BDZ A;  2C0O A;  3I5R A;  1LVK A;  1Y07 A;  4M7A B;  4C8Q F;  3CPF A;  1D1B A;  2AIR B;  2QQA A;  4N4H A;  2G6F X;  3C0C A;  2BZX A;  2PMI B;  4A4K A;  4MFE A;  1SHF A;  1VQ9 Q;  3UT1 A;  4O6J A;  1GXI E;  1O75 A;  3G7Z A;  1VQ5 Q;  4Z6Y A;  3U23 A;  3TVT A;  4LUD A;  1S72 A;  2EPD A;  2AZS A;  2YT6 A;  4Z02 A;  4L6V 5;  4AI6 A;  2IVW A;  1AOJ A;  5ACB A;  5CAI A;  6AT1 B;  1HXD A;  2COZ A;  2DE0 X;  4PKC C;  3DTO A;  4LOC A;  1TG0 A;  2V1Q A;  2L8D A;  1WIE A;  4OMM A;  2QQ9 A;  1JST B;  3CXC P;  3BG5 A;  3X25 B;  3POM A;  4A4G A;  1NEG A;  3PMI A;  5KCO A;  5GAN h;  3JCM Q;  1IGU A;  3CBM A;  5FW9 A;  3S6W A;  1FX7 A;  2DZ9 A;  2GQV A;  4CFV B;  3JCM b;  3V8K A;  1KIK A;  4J9I A;  4FW2 A;  1H1P B;  2PJQ A;  1ZSG A;  2NLU A;  4PJO G;  1QLY A;  4M7A D;  2FG0 A;  1KHC A;  4R55 A;  1E7P A;  4M7D G;  2YUQ A;  3OYH A;  2C5O B;  5FU6 B;  3M9Q A;  3M57 A;  2CSQ A;  4XU3 A;  1M4Z A;  1WHM A;  4M78 G;  2E4H A;  2KMT A;  2M51 A;  3CC7 A;  1OYX A;  4EOM B;  3ULR B;  3VV0 A;  1K73 C;  1WPY A;  2R5A A;  3CCR T;  1RAF B;  4LN2 A;  2DXT A;  4FYW B;  1OV3 A;  5C0M A;  4LDX A;  1VQM Q;  3VYG A;  1D3B A;  5D7U A;  4BCQ D;  3OYY A;  3V7S A;  1AWW A;  2LTO A;  4J9E A;  4JJB A;  4GY5 A;  1YIJ A;  3OYF A;  2OTJ Q;  3K7A M;  1G2B A;  5LMK B;  4C0G A;  2PQW A;  3BW1 A;  4ANJ A;  1RAI B;  2EQU A;  1QVF P;  4M7A F;  2AK5 A;  2HDA A;  4CFM B;  2KXD A;  5LL6 S;  2E12 A;  5HBJ B;  2DLP A;  4X9C A;  4EDU A;  3H9N A;  1E9H B;  1WXB A;  3UPU A;  5GAO l;  3ER0 A;  5L23 A;  1K9M R;  4IUR A;  3EHR A;  1SKU B;  1K1Z A;  1O9K A;  1M90 C;  2LW4 A;  1VQP Q;  1G83 A;  1G8X A;  3HL8 A;  1Q86 C;  2C06 A;  1GH6 B;  3VS1 A;  4Z88 A;  4QVC A;  1UHC A;  2K57 A;  4C8Q E;  1D3U B;  1W2B A;  1K73 U;  3FJ5 A;  2FHD A;  2Y90 A;  4RTT A;  3UWN A;  1UGQ B;  3RER A;  2XMF A;  2KRM A;  4HNU A;  4OMQ A;  4ZTJ A;  1M2O A;  2O9V A;  1WX6 A;  3QYB A;  1MMG A;  5FWB A;  5GAO r;  3G4S A;  2CZ0 B;  1TH7 A;  4EON B;  2VWF A;  1QQJ A;  1VYW B;  3BLH B;  3E2U A;  3E1S A;  4JZ3 A;  2EGA A;  4C5I A;  2OTL A;  1JJ2 P;  1N9S A;  2D8H A;  2DO3 A;  1UE9 A;  1KC8 C;  3CCQ T;  4BE0 A;  2AZV A;  4N4I A;  3R6N A;  4LXC A;  2HSE B;  2QYZ A;  4DOW A;  1FMV A;  1UNL D;  2OAU A;  2QGF B;  3OS1 A;  2WMB B;  1Y7X A;  3JB9 I;  4HCK A;  5GMK h;  2JM8 A;  4HT8 A;  5GAN 3;  1URC B;  1VQO Q;  3OBW A;  3GBQ A;  2HKQ B;  2LCC A;  1MHN A;  1M90 U;  3WVD B;  3RNJ A;  4ELJ A;  3SDZ A;  4J9G A;  1I5L A;  4RTV A;  1H1S B;  3H0F A;  4MDX A;  1Q86 U;  2SEM A;  2YLB A;  3QWX X;  4QQ6 A;  2PVD B;  4WTO B;  3UAT A;  2OX7 A;  3GTM S;  3LX7 A;  4M6V A;  4C92 D;  4HCB A;  4OF1 A;  2QAS A;  1OKW B;  3BG3 A;  4ZN1 A;  2RI3 A;  3OW2 A;  4X9D A;  1YJ9 T;  3BE3 A;  2EKH A;  4LDU A;  4M75 A;  1C6V X;  4HA8 A;  3MI9 B;  4FW1 A;  5GAO n;  1LPL A;  2C0T A;  3CD6 Q;  4IMY B;  1VQ9 A;  2J6K A;  1VQL T;  2J6F A;  4PNO A;  3A8O B;  1UNG D;  2KYM A;  3JCM e;  1KC8 U;  3CCJ T;  3HBL A;  3UA7 A;  2LQK A;  2V26 A;  4OMP A;  4ATO A;  2F69 A;  3CCM Q;  2KY9 A;  3FEO A;  2DVJ A;  2OAW A;  4A53 A;  1VQ4 A;  1VQ6 T;  3I56 A;  2E5K A;  4EOR B;  3NTH A;  1YIT T;  2HQE A;  1AEY A;  2IW9 B;  4BDY A;  4M7A E;  4Y92 A;  2LCS A;  1H1Q B;  2PVO B;  2KR3 A;  3KFV A;  4C92 F;  3QUI A;  1GUX A;  3OYM A;  4RTX A;  1PWT A;  3FC3 A;  5HQ0 B;  2Y4X A;  1EX4 A;  2HCK A;  1HK9 A;  1AZG B;  2ZPG B;  1BI2 A;  5D6Y A;  2ED0 A;  2BE7 D;  1OKV B;  4ESR A;  3SFM A;  1SEM A;  1RAG B;  3HPW A;  2QGS A;  5D6W A;  2JS0 A;  1WXU A;  1PRL C;  4M77 A;  1XOV A;  4EMK B;  1W1F A;  2H3E B;  3ZBD A;  1WGS A;  4KRT A;  2CKK A;  5IHI A;  2L2P A;  2EGE A;  2KYB A;  4G6L B;  5KYX B;  1Q7Y C;  1VQK A;  4KH1 B;  4IUU A;  2HSP A;  4HVW A;  3JCM c;  1MUZ A;  2CUD A;  3URG A;  2KRN A;  1ZX6 A;  1VQM A;  1JSU B;  1KSW A;  1VYV A;  1YI2 T;  1T3L A;  3DKM A;  1MMD A;  3CCU T;  1KD1 R;  3DB3 A;  2AHJ B;  2RB6 A;  4KGX B;  2OTJ A;  1YBY A;  4PJO C;  5IDP B;  3LQ5 B;  5IH2 A;  1I0C A;  4YTL A;  5LJ3 g;  1G3N C;  2MMP A;  5EJC A;  1UHF A;  1M8M A;  4N0A A;  2DEQ A;  3RMQ A;  5I5Z B;  5DY9 A;  2AT1 B;  2XI9 A;  3D7S B;  4KBM B;  1D1A A;  3QJY A;  2WIH B;  2V8J A;  2ROT A;  2KXC A;  5LJ3 j;  1M3C A;  5GMK m;  3JB9 H;  1C9B A;  3A8L B;  3I35 A;  4XU1 A;  4J7I A;  1FMK A;  1VIE A;  1RLQ C;  1D0Y A;  3OYG A;  3CMA A;  2AKL A;  1Q7Y U;  3EGD A;  3VRZ A;  4DBF A;  5IF1 B;  4KGZ B;  3PE0 A;  3M0Q A;  4AFZ C;  2O2O A;  1EFN A;  1RUW A;  1QVG A;  2K7A A;  1PHT A;  3L2V A;  4CC7 A;  3WXM B;  1PSF A;  2WSE E;  1ZUY A;  4JS4 A;  1M30 A;  2BKZ B;  2V1R A;  2ZPF B;  1E6H A;  4FSX A;  3R6O A;  3RKY A;  1QWE A;  2WJ9 A;  4CI0 C;  2DPP B;  3FDR A;  2WMA B;  2PK2 A;  3S3O A;  5IXB A;  2MF2 A;  3H8Z A;  4RUG A;  4F7L B;  4E7S A;  4F7U G;  2BS3 A;  3G71 A;  4C92 E;  2O9S A;  3JB9 G;  2XU8 A;  4ELL A;  1UEC A;  2RJF A;  3CC2 Q;  2LMJ A;  2FVU A;  1FYN A;  3L1A A;  1QLB A;  4RTY A;  1GFD A;  2DD4 B;  2SRC A;  1B7T A;  2RJE A;  4OP0 A;  1H27 B;  1Q81 R;  4HL4 A;  4PJO A;  2DYB A;  5GAN 8;  3HHT B;  2HBP A;  2LJ1 A;  4EMG A;  4M7D A;  3CD6 A;  4EOQ B;  2K2M A;  1WJR A;  4R0K A;  3HP9 A;  5CKF A;  4EIK A;  4L59 A;  3QPH A;  3SWN A;  4KGV B;  1CSK A;  2M02 A;  4M78 A;  2RMO A;  3OS0 A;  2NWM A;  1KG1 A;  4EOI B;  1RAD B;  3LH5 A;  3CCL Q;  2HMA A;  5GAN 5;  2DEU A;  3CCM A;  2KDS A;  4CFW B;  4DBQ A;  1VYT A;  3RMS A;  1K8A C;  2E5Q A;  3QHW B;  1KHI A;  3J80 E;  4FCY A;  4BI3 A;  1NE8 A;  3JB9 J;  1Y96 A;  1S72 Q;  2K5L A;  2WAC A;  1JKW A;  3VS4 A;  2EQK A;  3QHS A;  2X1N B;  5CQX A;  2VVK A;  2W9Z A;  4M7A G;  1W2B S;  1MV3 A;  1OZ3 A;  4IUQ A;  2DMO A;  4LD9 K;  3CCV Q;  5KE2 A;  4XU0 A;  2DTO A;  1F1B B;  2K5I A;  2EFI A;  3DDQ B;  3OBY A;  4PFZ A;  1HJD A;  1M1K C;  3HRU A;  3X28 B;  3JCM h;  1OEB A;  2DIL A;  3CXC A;  1VQ8 Q;  3VUZ A;  1M2V A;  4OB3 B;  3OYA A;  3IQL A;  1K8A U;  5FLX E;  3HRT A;  2PUO B;  3C12 A;  2P4R A;  4PLI A;  2KT8 A;  2P84 A;  5CQY A;  1Q82 C;  2HBW A;  3CC7 Q;  3V7R A;  2IPO B;  1U3O A;  1ZUU A;  5GAM g;  1AD6 A;  4CRL B;  3DLM A;  4OGR B;  3E9G A;  3O0G D;  1ZUK A;  3CME A;  1N4M A;  2QA4 Q;  2RHZ A;  4XQ3 A;  1OQK A;  2LVM A;  5GAN 4;  1X69 A;  4C8Q B;  1PRM C;  2RHX A;  3OW2 S;  1YIJ Q;  3M5A A;  5GAM j;  1BKB A;  1H8K A;  2XID A;  2KK4 A;  1OI1 A;  2QK0 A;  5KYN A;  1Y0M A;  3DB4 A;  4WCI A;  2ZPI B;  1X27 A;  5I2S A;  2DXC A;  1YCY A;  2RHI A;  3L2Z A;  2CP0 A;  4C5H A;  2X3W D;  5IHK A;  1BYM A;  4BCM D;  5AYF A;  1WJS A;  2K6D A;  3FRN A;  1VQ9 T;  2CRE A;  2PUK B;  4JRI A;  4RCB A;  1VQ5 T;  2FPF A;  1ZHI A;  4EC9 B;  3UF4 A;  2IIM A;  5FRM A;  2RQU A;  2D0N A;  1QVF A;  3VJP A;  4X1V A;  2JVV A;  4CC2 A;  2L0A A;  4PL6 A;  4X34 A;  2XKO C;  4LDW A;  4CFU B;  1AT1 B;  3VKG A;  4P5N A;  4BBR M;  2ABL A;  1R77 A;  2EQJ A;  4HNV A;  1WXT A;  2CGH A;  5CKE A;  3TW7 A;  3C4S A;  1SRM A;  2HZY A;  2C5V B;  4J6W A;  4FT4 A;  4QT7 A;  3G4S Q;  4GLK A;  2EIF A;  3BDU A;  3HRS A;  5LQF B;  1JXM A;  3TW6 A;  4J9B A;  3LWI A;  1HSQ A;  2OTL Q;  2R7G A;  1LOJ A;  1I4K 1;  3CC2 A;  1TOV A;  2NUT B;  1RAE B;  2JUF A;  3QJ6 A;  3G33 B;  2EW3 A;  4NOY A;  2ZPE B;  3M0U A;  1MMA A;  4C8Q C;  2C5N B;  1J3T A;  4CFN B;  4KUI A;  4M4Z A;  4KRD B;  4BBS M;  1PM3 A;  1JJ2 A;  2DRK A;  5GAN 6;  5GAO q;  1GCP A;  1Z9Q A;  2FPE A;  2G3R A;  1M1G A;  1TTH B;  2DK3 A;  2LC4 A;  4F17 A;  1K73 R;  4NST B;  2DAQ A;  3Q1J A;  2K79 A;  4JLI A;  4J7F A;  2YWW A;  4QVZ A;  1VQM T;  1SSF A;  2QGG A;  1N8R C;  1IHV A;  2EKO A;  1WDX A;  3VS0 A;  4Q5W A;  5HK3 A;  4IIO A;  3CCL A;  4BCG B;  2HEQ A;  4RCC A;  5KYU B;  1IO6 A;  2OTJ T;  2A7Y A;  1VA7 A;  4XTU A;  1YJN A;  2PZ1 A;  3CPW P;  3T9N A;  5KYY A;  5EG2 A;  1VUB A;  3QG1 A;  1GL5 A;  2JMA A;  2RQR A;  1AVZ C;  1H1R B;  3JCM d;  1UGR B;  3OQ5 A;  2LRQ A;  2RI2 A;  3V8L A;  4UC4 A;  1VQ4 Q;  2L3P A;  3I56 Q;  4BCQ B;  1M90 R;  1VQP T;  1G3S A;  1TFB A;  1Q86 R;  1ARK A;  3CCV A;  1QVG S;  2X4Y A;  2DD5 A;  4F14 A;  4OML A;  2QQ8 A;  1VOM A;  4D6W A;  4M75 B;  2GFA A;  3BDL A;  3CC4 Q;  3ASK A;  3QYG B;  1M3B A;  1N8R U;  1YCS B;  3OSV A;  3MHX A;  3DJB A;  5GAN 7;  1JEG A;  1VQ8 A;  3TSZ A;  2DL5 A;  1EIF A;  1OPK A;  3A1P A;  4HVU A;  2XIC A;  3TNH B;  2CSI A;  2FZC B;  2A08 A;  3MY1 B;  4ELY C;  1KC8 R;  3M0T A;  2UZB B;  1DJ7 B;  2DXB B;  2E10 A;  4J9H A;  5LJ5 d;  2O31 A;  1OX9 A;  1TUG B;  2FZK B;  2GCX A;  4C0D B;  2EYZ A;  1VQK Q;  4M7A C;  4ZTF A;  1JB0 E;  4LNP A;  3VRY A;  2KVQ G;  2JNG A;  5CEI B;  3V7C A;  1KQS P;  1VOL A;  4C5G A;  1VQO T;  2G77 A;  4ROD A;  4JX4 A;  2A28 A;  4MIM A;  3RKX A;  4KUL A;  1KJW A;  2QA4 A;  3S3N A;  4F7U A;  3CCE A;  2DL7 A;  3RDV A;  3DLL A;  1QKW A;  2MWP A;  5GAN j;  2O88 A;  2EVR A;  3DDP B;  2O4X B;  1R0B G;  1UGS B;  1RI9 A;  3P8D A;  2IN3 A;  1KFZ A;  4M75 D;  1YWP A;  4HXJ A;  1X6O A;  5M9O A;  3EHQ A;  3GPL A;  3CD6 T;  1Y71 A;  2M9U A;  3HSB A;  1K0S A;  4HLQ A;  1UB4 A;  2IW6 B;  2ZZD A;  4DEY A;  3INZ A;  3HTR A;  2K3B A;  3ME9 A;  5DLQ E;  1I1J A;  1QMZ B;  1WI7 A;  3G6E A;  2NUP A;  3LWH A;  3CCM T;  3OYN A;  3CMA Q;  4FYY B;  1KQ1 A;  2ZCF B;  2COY A;  5FRO A;  4C92 B;  1YHQ Q;  2DYI A;  2MWO A;  5FU6 C;  4MZP A;  4C5E A;  4HCC A;  4HNT A;  1Z9Z A;  4AKH A;  5I22 A;  4HKE A;  4M75 F;  2RH2 A;  1B34 A;  4E47 A;  4BY6 B;  2CUB A;  2EYX A;  5J26 A;  4B9W A;  4AMC A;  4M77 D;  3NTI A;  3B57 A;  4QVD A;  1GFC A;  3GF5 A;  2DET A;  2I40 B;  1BBZ A;  3M0S A;  3RES A;  1T0J A;  5KYW B;  3GLX A;  1OIU B;  1WHG A;  3G71 Q;  5I11 A;  4EOO B;  4J6X A;  2V8K A;  4NC6 A;  4CFX B;  4XK8 E;  3J81 E;  2BS4 A;  3EFR A;  4E7Z A;  4J8O A;  3GNG A;  3EGD B;  3CXC S;  3BHV B;  3THK A;  1VQN A;  2RI5 A;  2X51 A;  1Q7Y R;  1H26 B;  4Y28 E;  2L89 A;  4BXX X;  4BE2 A;  2OI3 A;  4A4F A;  2MYS A;  4AFU C;  1GCQ C;  4XTZ A;  5HKC A;  4JX5 A;  3PIO A;  4QQG A;  1QCF A;  3RIR A;  2RQV A;  2LX9 A;  2EQM A;  1BIB A;  2ECZ A;  5CIU A;  4BCP B;  4M77 F;  2L3R A;  1OU8 A;  3AT1 B;  1AWJ A;  4C92 C;  5IT9 E;  2CP6 A;  2B9R A;  1FXX A;  3OYI A;  1E7O A;  3JCM V;  3SHW A;  1PKD B;  2W10 A;  3TNW B;  3VYH B;  2DIQ A;  2BKD N;  5GMK j;  3EGX B;  2RN8 A;  3KBG A;  5GAM e;  1OI9 B;  5CKD A;  2E3H A;  3I55 A;  4AKG A;  4BY6 C;  3J7A F;  1N9R A;  5GAO m;  1WLP B;  3OY9 A;  1H28 B;  2FB7 A;  1ZA2 B;  4TTH A;  2BS2 A;  1QVF S;  1ZSZ B;  2BE9 B;  3CC4 A;  3MEU A;  3LYI A;  2DME A;  4JZ4 A;  4OR5 B;  4BCN D;  1SHG A;  3EG9 A;  2XDP A;  3QYE A;  1VQ7 A;  1YP5 A;  1EZZ B;  5LJ5 e;  4JUV A; 
#chains in the Genus database with same CATH homology
 2ZZD B;  1LNX A;  1VQ7 T;  1XQH A;  4M78 A;  3JCM X;  2E6Z A;  3HKS A;  5A0D A;  3OS0 A;  1KG1 A;  2RHU A;  5DM7 R;  5GAN 5;  3A5Z B;  2JN0 A;  3CBO A;  3CCM A;  4M75 C;  1JRI A;  2GFU A;  3KUF A;  1I81 A;  2KDS A;  3OYJ A;  4C8Q D;  1YJW A;  2CZ1 B;  5DLO A;  3RMS A;  3HFN A;  1YJW T;  3JCM f;  1K8A C;  2E5Q A;  1RI0 A;  2QQS A;  1KHI A;  3J80 E;  3MEV A;  4RG2 A;  3CCU A;  4M75 E;  4BI3 A;  2KSS A;  2XG8 D;  1NE8 A;  2E1H A;  3QSU A;  1X75 C;  3E9F A;  4LDV A;  4XTX A;  3JB9 J;  2KMG A;  1Y96 A;  1YIT T;  2K5L A;  2WAC A;  1IRE B;  1BI1 A;  2LT4 A;  2GF7 A;  2MAM A;  2EQK A;  3QHS A;  3JRZ A;  2E64 A;  1JJ2 S;  3L42 A;  4C0D C;  2Y4Y A;  3CPW S;  2QI2 A;  4R56 A;  5CQX A;  2K4Y A;  3PMT A;  1B34 B;  4PJO D;  1G5V A;  4M7A G;  2L5Q A;  1W2B S;  3FLG A;  4BI4 A;  2VXE A;  1OZ3 A;  4QW2 A;  2PVG B;  4IUQ A;  1NJI C;  4HT9 A;  4M7D D;  2JOY A;  4LD9 K;  5A0L A;  1ZBX A;  5KE2 A;  4XU0 A;  3OMG A;  5I2M A;  3VKI A;  2DTO A;  2X4X A;  2YHT A;  2K5I A;  2EFI A;  4BDZ A;  3OBY A;  2CYZ B;  4C0Z A;  3HB9 A;  1M1K C;  4TVR A;  3MEW A;  3HRU A;  1Y07 A;  4M78 D;  4MMK A;  4M7A B;  4C8Q F;  3TEE A;  4F7U E;  3X28 B;  4ZGJ B;  3CPF A;  4M7A A;  2QQA A;  4N4H A;  3CCL T;  3JCM h;  3M58 A;  4A4H A;  4A4K A;  4B9X A;  4M77 C;  4O5V A;  4MFE A;  5LJ5 f;  4EMK C;  3CXC A;  2P0Q A;  3UT1 A;  4O6J A;  1GXI E;  1O75 A;  3G7Z A;  3VUZ A;  4OB3 B;  1U1T A;  3PFS A;  1QP2 A;  1YHQ A;  3UDC A;  4Z6Y A;  3OYA A;  3A8M B;  1K8A U;  4M77 E;  5FLX E;  3HRT A;  1S72 A;  2PUO B;  3C12 A;  4PLI A;  4J6Y A;  4FT2 A;  4RMO A;  3OS2 A;  1S72 T;  4Z02 A;  4L6V 5;  4AI6 A;  5CQY A;  1Q82 C;  2RJC A;  2IVW A;  4PJO F;  3V7R A;  4C8Q G;  4FU6 A;  5GAM g;  5CAI A;  1HXD A;  3S3M A;  4PKC C;  3M53 A;  4LOC A;  2WSC E;  4J83 A;  4BUG A;  3DLM A;  3MO8 A;  3E9G A;  4M7D F;  2RA2 A;  3GNF B;  3CME A;  2L8D A;  2DZC A;  3NTK A;  5CVI A;  2QQ9 A;  3NFC A;  2IG0 A;  5CR2 A;  3BG5 A;  3X25 B;  2RHZ A;  3P8B B;  3OW2 S;  4A4G A;  4XQ3 A;  3CME T;  2RK2 A;  3A8H B;  3PMI A;  5KCO A;  2LVM A;  4NL2 A;  5GAN h;  5GAN 4;  1NJI U;  3JCM Q;  3CBM A;  3H6Z A;  3S6W A;  4C8Q B;  3CCV T;  2RHX A;  1FX7 A;  2DZ9 A;  2GQV A;  2P0P A;  2X35 A;  3M5A A;  1BKB A;  4M78 F;  5GMK l;  2XID A;  2KK4 A;  4VUB A;  3V8K A;  1OI1 A;  3JCM b;  3L2Q A;  1KQS S;  5C6S A;  3PIP A;  1M5Q 1;  3DB4 A;  2ZPI B;  2NLU A;  4PJO G;  5I2S A;  2DXC A;  1YCY A;  4N0A C;  2RHI A;  1K9M C;  3L2Z A;  4C5H A;  3H4C A;  4M7A D;  4R55 A;  1KHC A;  1BYM A;  2LCL A;  3BFM A;  1E7P A;  4KT0 E;  5AYF A;  1WJS A;  4M7D G;  5GAN d;  3OYH A;  3RKW A;  1VQ5 A;  3FRN A;  1VQ9 T;  5FU6 B;  2PUK B;  3M9Q A;  4JRI A;  1VQ8 T;  4HCZ A;  4RCB A;  3M57 A;  1N6A A;  1VQ5 T;  4E7H A;  2YLC A;  1ZHI A;  2JZ2 A;  3TU4 K;  2VGM A;  4XU3 A;  3SB2 A;  5FRM A;  2M16 A;  1M4Z A;  3MCA B;  3WVE B;  3OYD A;  4PJO B;  2DXB A;  4M78 G;  1QVF A;  2DTH A;  3VJP A;  1X01 A;  2KMT A;  3CC7 A;  2JVV A;  1OYX A;  1K73 C;  3VV0 A;  4M7D B;  1WPY A;  2QQR A;  4PL6 A;  4X34 A;  3CC7 T;  1W4S A;  2XKO C;  4LDW A;  2R5A A;  5GMK i;  3CCR T;  2DXT A;  3QDR B;  3VKG A;  4P5N A;  2DKG A;  5C0M A;  4BBR M;  4LDX A;  3VKH A;  3VYG A;  1D3B A;  1RL2 A;  2EQJ A;  3OYY A;  3SWN B;  4HNV A;  3OYE A;  3V7S A;  2CGH A;  5CKE A;  2VV5 A;  5CO7 A;  3TW7 A;  3C4S A;  1NZ9 A;  4M78 B;  5HK0 A;  2LTO A;  2QA4 T;  4E7K A;  2K2V A;  4OGE A;  4GY5 A;  2D0Q B;  4FT4 A;  4J6W A;  3OYF A;  1YIJ A;  5CK9 A;  4GLK A;  4C0G A;  2EIF A;  2O01 E;  2PQW A;  3BW1 A;  3QPH A;  1YIJ T;  2EYQ A;  2P0K A;  3BDU A;  2EQU A;  3HRS A;  1QW1 A;  3E19 A;  4M7A F;  3TW6 A;  2O4X A;  3LWI A;  1LOJ A;  2YRV A;  1I4K 1;  3CC2 A;  2P4T A;  5LL6 S;  2E12 A;  5I21 A;  3L2W A;  1I8F A;  4ZN3 A;  4X9C A;  4EDU A;  3CC2 T;  2JUF A;  3LH0 A;  3QJ6 A;  3UPU A;  5GAO l;  1K9M U;  3ER0 A;  1Y96 B;  4JLG A;  4NOY A;  5LJ3 h;  4A4E A;  2VC8 A;  4IUR A;  2ZPE B;  2KR6 A;  3HO8 A;  4IUT A;  4C8Q C;  3M59 A;  1M90 C;  4J5Y A;  3JCM P;  2KAF A;  5GAM f;  5A0G A;  2B8A A;  4KUI A;  4BBS M;  4OB1 B;  2QQB A;  1JJ2 A;  5GAN 6;  3HL8 A;  2D9T A;  3CPW A;  5J3B A;  4XU2 A;  5GAO q;  1Q86 C;  2H3J A;  2C06 A;  2E41 A;  1WQW A;  2RHY A;  3M55 A;  2CZ6 B;  2FYK A;  2K57 A;  3FJP A;  2G3R A;  4C8Q E;  4QVC A;  1W2B A;  1M1G A;  2DK3 A;  2LC4 A;  1K73 U;  5LJ3 d;  2FHD A;  2DAQ A;  2CS7 A;  2Y90 A;  3Q1J A;  1UGQ B;  3UWN A;  3RER A;  4JLI A;  4C92 A;  3M4Y A;  4HNU A;  4EPC A;  4J7F A;  4QVZ A;  4ZTJ A;  1VQM T;  1SSF A;  1KQ2 A;  2DIG A;  1N8R C;  2CZ7 B;  2EKO A;  3OB9 A;  3QYB A;  4Q5W A;  1MGQ A;  3OA6 A;  5HK3 A;  1FKM A;  2CZ0 B;  1TH7 A;  2HNI A;  3G4S A;  2DVE A;  5GAO r;  4AKI A;  3CCL A;  4RCC A;  2FL7 A;  1M8V A;  2OTJ T;  2A7Y A;  3A8G B;  3ZEH A;  3G4S T;  1VIF A;  3JCM W;  4N4G A;  4XTU A;  3E1S A;  3EFS A;  5CKB A;  5KH6 A;  1YJN A;  4M7D C;  4C5I A;  2OTL A;  1N9S A;  3C94 A;  2DO3 A;  3AHU A;  3VUB A;  1YJN T;  2E65 A;  2EJG A;  1O9S A;  3T9N A;  1KC8 C;  2OTL T;  3CCQ T;  4BE0 A;  4N4I A;  3CCS T;  3QKJ A;  1XTD A;  3SWN C;  1ZQ1 A;  1BI3 A;  4V2S A;  4IUP A;  4DOW A;  4M7D E;  5EG2 A;  1VUB A;  3QWL A;  3QG1 A;  4M78 C;  2A3L A;  3M4G A;  3P8H A;  2OAU A;  5GAM h;  3PGG A;  3OS1 A;  3PTA A;  1Y7X A;  4BI8 B;  3JCM d;  3JB9 I;  1UGR B;  2M1H A;  3OQ5 A;  4BAC A;  2LRQ A;  3HFO A;  4QQD A;  3SD4 A;  5GMK h;  2VXF A;  2RI2 A;  2I2L A;  4L5G A;  3V8L A;  5GAN 3;  3OYL A;  4E7I A;  3X20 B;  4FL6 A;  4UC4 A;  3OBW A;  1VQP A;  4M78 E;  3MP1 A;  2LCC A;  4M75 G;  2BIV A;  1MHN A;  4OMF B;  3WVD B;  2RK1 A;  4ELJ A;  3SDZ A;  1VQP T;  1M90 U;  1G3S A;  2ZPH B;  4E7J A;  1I5L A;  3MP6 A;  1M1F A;  5FU7 B;  4MDX A;  1Q86 U;  4XTW A;  1Q81 C;  2YLB A;  3CCV A;  4QQ6 A;  1PSE A;  2X4Y A;  3RUX A;  2PVD B;  1QVG S;  1N27 A;  2DD5 A;  3LX7 A;  4ZGE B;  4M6V A;  2WSF E;  4C92 D;  1YJ9 A;  4HCB A;  2QQ8 A;  4OF1 A;  5CKH A;  3L2R A;  2DXU A;  1IZ6 A;  3V8J A;  3BG3 A;  4D6W A;  2RI3 A;  3EAE A;  2GFA A;  3BDL A;  4M75 B;  4X9D A;  3ASK A;  4ZN1 A;  3OW2 A;  2R57 A;  2DXC B;  4FM4 B;  1G3W A;  4LDU A;  3QYG B;  4HA8 A;  4M75 A;  3HZJ A;  5LJ5 h;  1U8R A;  1N8R U;  5GAO n;  4WF2 A;  3OSV A;  1VQL A;  5FRN A;  1WNL A;  2QF7 A;  3MHX A;  4JRP A;  1M1K U;  3JAM E;  1VQ9 A;  5GAN 7;  1VQL T;  2ZPB B;  1VQ8 A;  4PNO A;  3A8O B;  1EIF A;  3CCJ A;  4JX6 A;  2XIC A;  3JCM e;  1QVP A;  4ELY C;  1KC8 U;  5A2Q E;  3CCJ T;  3HBL A;  4ZGD B;  1DJ7 B;  2DTI A;  2DXB B;  2E10 A;  2LQK A;  5LJ5 d;  4OVA A;  2GCX A;  4C0D B;  1VQ6 A;  1V29 B;  2E6N A;  2F69 A;  1JB0 E;  5GAM j;  4ZTF A;  4ATO A;  2LNV A;  4M7A C;  2KY9 A;  3FEO A;  2QEX T;  3CCR A;  2F5T X;  2KVQ G;  3M56 A;  4A53 A;  1VQ4 A;  1VQO A;  3I56 A;  2JNG A;  1VQ6 T;  3DL1 A;  1YIT A;  2K3X A;  3V7C A;  3QII A;  4JJN K;  1KD1 C;  2QXF A;  4C5G A;  3F70 A;  3NTH A;  1VQ4 T;  1VQO T;  3I56 T;  3VYG B;  1D3B B;  1Q82 U;  2G77 A;  5CCA A;  2HQE A;  5L8R E;  4JX4 A;  2XDD A;  4BDY A;  4MIM A;  2HD0 A;  3LGL A;  3RKX A;  4M7A E;  4KUL A;  4JDS A;  2QA4 A;  3S3N A;  1H3Z A;  1QP3 A;  4F7U A;  3CCE A;  4NS5 A;  2PVO B;  4C92 F;  3DLL A;  2MWP A;  4IKF A;  2DD4 A;  3QUI A;  4FIB A;  3OYM A;  4ME7 A;  3CCE T;  5GAN j;  3QXE B;  1NPR A;  2Y4X A;  3FC3 A;  1Q81 U;  4II1 A;  3GIB A;  1HK9 A;  1BI2 A;  4LD6 A;  2ZPG B;  5D6Y A;  2O4X B;  3KHI A;  3SFM A;  1UGS B;  4MML A;  5GAN e;  3HPW A;  3P8D A;  5D6W A;  2LT1 A;  4M75 D;  4M77 A;  1XOV A;  1OZ2 A;  4OGC A;  4EMK B;  1X6O A;  2X4W A;  4C0F A;  1YJ9 T;  4EMK A;  5M9O A;  3OSS C;  3BY7 A;  3ZBD A;  3GPL A;  3CD6 T;  1WGS A;  2CKK A;  2R58 A;  3C95 A;  1Y71 A;  2M9U A;  4A54 A;  3HSB A;  3X26 B;  4HLQ A;  4C92 G;  1UB4 A;  2ZZD A;  3INZ A;  2RD1 A;  2M0O A;  3QZ9 B;  3ME9 A;  5J39 A;  1Q7Y C;  1VQK A;  5DLQ E;  2F5K A;  4IUU A;  5GAN 2;  1P92 A;  3OYB A;  3G6E A;  4LDY A;  3JCM c;  3LWH A;  1VQK T;  3CCM T;  2R5M A;  3OYN A;  2K3Y A;  4JRK A;  1KQ1 A;  2ZCF B;  3G6E T;  3URG A;  1YI2 A;  3X24 B;  1H64 1;  4JRQ A;  4KUD K;  1NPP A;  5HY6 A;  4XTY A;  5FRO A;  4C92 B;  1VQM A;  3JCM J;  2MWO A;  2EJF A;  1YI2 T;  2EWN A;  4OB0 B;  3DKM A;  5FU6 C;  1KD1 U;  3QBY A;  3CCU T;  3DB3 A;  3TRE A;  2VGN A;  4MZP A;  3QYH B;  2EJ9 A;  2AHJ B;  2RB6 A;  4C5E A;  4HCC A;  4HNT A;  2OTJ A;  1YBY A;  4PJO C;  4RG8 A;  2XK0 A;  4RKU E;  4AKH A;  3PNW C;  4YTL A;  5KCH A;  5LJ3 g;  1WQ7 A;  2V8I A;  2QDJ A;  5EJC A;  2MMP A;  3JB9 D;  1KQS A;  4HKE A;  4M75 F;  3VU3 C;  2RH2 A;  2X4J A;  4N0A A;  3CCQ A;  1B34 A;  3LLR A;  3CCS A;  4BE1 A;  4XAX B;  2DEQ A;  3GOX A;  3OS5 A;  3RMQ A;  4E47 A;  4PJO E;  4BY6 B;  3MEA A;  3M54 A;  5DY9 A;  5J26 A;  4B9W A;  4M77 D;  2LDM A;  3NTI A;  1UGP B;  2XI9 A;  3GF5 A;  4KBM B;  3ZFJ A;  3QJY A;  4QVD A;  2XD0 A;  3RES A;  2V8J A;  3GLX A;  4ELZ C;  5LJ3 j;  3OMC A;  3MP8 A;  4J6X A;  2V8K A;  3A8L B;  5GMK m;  5GAN f;  2XDB A;  4Y91 A;  4NC6 A;  3JB9 H;  4XK8 E;  4J7I A;  4XU1 A;  1VIE A;  2BS4 A;  2PU9 B;  2K5F A;  3J81 E;  2VUB A;  3EFR A;  5LJ3 e;  4J8O A;  3QZ5 B;  3GNG A;  3OYG A;  4MDW A;  4PLL A;  4IUV A;  3CXC S;  3CMA A;  1VQN A;  1Q7Y U;  2RI5 A;  3FIF A;  1XNI A;  2ZGW A;  4Y28 E;  2DJZ A;  2L89 A;  3JSC A;  1R8O B;  5D6X A;  3CMA T;  1VQN T;  3JCM g;  4DOV A;  5GAM d;  4BE2 A;  2DD5 B;  4EMH A;  4A4F A;  4MZT A;  1WJQ A;  4F7U F;  1YHQ T;  1QVG A;  2RJD A;  3L2V A;  4XTZ A;  2KQW A;  5HKC A;  3WXM B;  4JX5 A;  1PSF A;  2WSE E;  3PIO A;  4QQG A;  3OYK A;  4JS4 A;  3JB9 F;  3RIR A;  1BIA A;  2LX9 A;  2EQM A;  2ZPF B;  1BIB A;  3R6O A;  4FSX A;  3RKY A;  3N5B B;  3LW5 E;  5CIU A;  4BD3 A;  4XTV A;  2WJ9 A;  1M9S A;  4M77 F;  4CI0 C;  4DA4 A;  2L3R A;  2DPP B;  2JTF A;  2VYT A;  3FDR A;  3QO3 A;  3OYC A;  3L2U A;  4C92 C;  3FB9 A;  2LQ8 A;  3S3O A;  5IT9 E;  2MF2 A;  3H8Z A;  2E70 A;  1FXX A;  4F7U G;  3OYI A;  4OB2 B;  2BS3 A;  3G71 A;  3PT9 A;  3CBP A;  5IN1 A;  2QEX A;  4C8Q A;  2RO0 A;  3JCM V;  4C92 E;  4CRI A;  3G71 T;  2EAY A;  3GP8 A;  4JS5 A;  3CEY A;  5GAN g;  3JB9 G;  2HAX A;  3VYH B;  2DIQ A;  1FWZ A;  2BKD N;  2XU8 A;  4BB7 A;  2QFZ A;  5GMK j;  2BUD A;  3KBG A;  4NL3 A;  2HQX A;  5GAM e;  2RJF A;  1AHJ B;  5CKD A;  3I55 A;  3KXT A;  4AKG A;  4BY6 C;  3J7A F;  4M77 G;  2FVU A;  1N9R A;  5LJ5 g;  3L1A A;  5GMK e;  4F7U B;  4HT8 A;  1QLB A;  5GAO m;  3I55 T;  1U1S A;  3OY9 A;  3O8V A;  2FB7 A;  2DD4 B;  2BS2 A;  2XHC A;  5IAY A;  1QVF S;  2RJE A;  5LJ3 f;  2QDY B;  2JTM A;  4MFD A;  1G3T A;  4OP0 A;  4DQ2 A;  4E7L A;  4HL4 A;  4PJO A;  3CC4 A;  5GAN 8;  5KE3 A;  3BG9 A;  2QTX A;  3MEU A;  3LYI A;  3HHT B;  1G3Y A;  2HBP A;  3LGF A;  4M77 B;  1UEB A;  4EMG A;  5LJ5 j;  3CC4 T;  2D6F A;  3CD6 A;  4M7D A;  5GAO p;  5LJ5 e;  1WJR A;  1BI0 A;  1JBM A;  5CKF A;  3HP9 A;  3TCJ A;  4MZM A;  2XDP A;  3QYE A;  4QSH A;  5FU7 C;  4L59 A;  1VQ7 A;  1LJO A;  3MET A;  2MI6 A;  2RM4 A;  3SWN A;  4JUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...