3WW9A

Crystal structure of the computationally designed pizza6 protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
251
structure length
251
Chain Sequence
SNTQTVLPFTGLNTPNGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPNGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPNGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPNGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPNGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPNGVAVDSAGTVYVTDHGNNRVVKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design of a self-assembling symmetrical beta-propeller protein.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords pizza6 protein
total genus 47
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2014-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 3ww9A00
4O5TA 3E5ZA 2G8SA 2HQSA 3U0SA 3S94A 2IVZA 3SOBB 3WWAA 3S8ZA 1CVMA 2IAUA 3IAXA 3HRPA 2IAQA 2POOA 2IAXA 1CRZA 4JMLA 3Q6PA 3SOVA 2GVUA 5D9DA 1IJQA 3G4EA 1CRUA 1N7DA 2IAWA 4R40A 4DG6A 3Q6TA 4GNCA 1C9UA 2P4OA 2ISMA 3V1SA 3DR2A 1RWLA 2IATA 4Q1UA 3AMSA 3V65B 3SREA 2V91A 1E1AA 3SOQA 1RWIA 3A9GA 2IASA 5D9CA 3A9HA 3KGGA 3S8VA 5FWWA 5D9BA 5GX3A 4GNBA 2DG0A 2IAPA 1PJXA 2GHSA 4IYGA 3SRGA 1POOA 2DSOA 3O4PA 5GX2A 3TC9A 2IAOA 1QLGA 1QBIA 4HHQA 2DG1A 2FPCA 2IAVA 3WW9A 2VAQA 1CQ1A 1V04A 2GVWA 3S2KA 3FVZA 4HHOA 4GNAA 4HW6A 4ZLRA 2FP9A 3BYCA 2GVXA 4A0PA 3LI4A 2FPBA 3V64C 3G4HA 5GTQA 2IARA 4GN7A 2W8BB 3HLIA 3P5BL 5EX7A 5GX5A 1H6LA 3LI3A 2FP8A 2GVVA 3LI5A 4GN8A 1C5KA 5GX1A 1Q7FA 2W8BA 3I1CA 1NPEA 3Q6KA 4GN9A 4O5SA 4PWZA 2OJHA 5GX4A 3KYAA 3AMRA 2QE8A 3DASA 3HLHA 4IMBA 3FW0A
chains in the Genus database with same CATH superfamily
3E5ZA 1DIMA 2IVZA 4MX0A 5FNSA 4ASCA 4WA3A 3IAXA 4GZXA 2IAXA 1IUBA 3Q6PA 3SOVA 1IJQA 4AGTA 3CL0A 4MZAA 2VVZA 3G4EA 2SILA 4FOVA 4X6KA 1EURA 2F26A 1INFA 4YW3A 3Q6TA 2XZIA 1C9UA 1V0FA 4XJ8A 2P4OA 5HUMA 4CPOA 2QWEA 4K1IA 4IFNX 3V65B 3II7A 4G3NA 4H53A 1S0IA 2B8HA 1X2RA 4MC7A 4FPFA 2IASA 1NMAN 2QWJA 1MS3A 4M4UA 2VWDA 4FPGA 3WN7A 1MWEA 5D9BA 2W38A 1A4QA 2DG0A 2XZJA 2HT7A 3B69A 1W1XA 3TI3A 4YY8A 3TC9A 4MZEA 4K3YA 1ZGKA 4K1KA 1L7FA 4XJUA 3ALWA 2FPCA 2QWGA 2F28A 4YZ5A 2SLIA 2YDPA 2ZB6A 4XE9A 3WDZA 1V04A 1N1SA 5HX0A 2HTRA 1W0OA 2HU0A 2X9MA 1Z4XA 2VK5A 3FVZA 5F9TA 1VCJA 2BF6A 2AEQA 2VW0A 3BYCA 4A0PA 4HZYA 3LI4A 4B7QA 2H2NA 1KITA 2VK7A 1WP5A 4GN7A 4YZ2A 1MS8A 4KS4A 2ZB5A 5FZJA 1F8CA 4FOQA 1W21A 5FNUA 5GX5A 4I00A 1H6LA 1OFZA 1WCQA 1INGA 5HUKA 4FP3A 1V3EA 1C5KA 3K39A 2W5NA 2W8BA 3TIAA 3I1CA 3CYEA 1NPEA 4FPYA 4GZQA 4PWZA 2QWHA 1X2JA 4D4UA 4MWXA 3BEQA 2QWBA 4GZSA 4IMBA 1RWIA 2F12A 3CL2A 3U0SA 1N1TA 4WA4A 3WWAA 1NCCN 4FP2A 2YA4A 4CPZA 4CPMA 2F11A 4FOYA 4FPEA 2YA6A 4JMLA 2GVUA 1Z4YA 4DGRA 1CRUA 1N7DA 4H52A 4DG6A 2QWAA 1XOGA 4WEFA 2H2UA 3TI6A 4QN3A 3DR2A 2AEPA 2IATA 4Q1UA 1MR5A 4FJ6A 4UF7A 4B7MA 4YW4A 1NSCA 1W8OA 4XIKA 4KS1A 4NN9A 1V0ZA 3UC1A 4XMAA 3K36A 3K3AA 2C4AA 3NO0A 3KGGA 3L6VA 2HTYA 4KS5A 2QWCA 1INWA 4L7DA 2BATA 3A71A 3NN9A 2IAPA 5EO8A 3SRGA 1POOA 1V3CA 3O4PA 5GX2A 4IFLX 2A75A 2FHRA 1MS0A 4M4VA 5CGJA 2Z32A 2DG1A 2F10A 2IAVA 2QWKA 2VAQA 5B2CA 3TIBA 1NN2A 4CSDA 4XHXA 5FZNA 2GVWA 4GJTA 4HHOA 4D52B 4MWUA 4YZ4A 4ZLRA 2YA8A 4FVKA 2FP9A 3V64C 3NSSA 4X47A 3ALXA 4GZPA 1BJIA 4GDIA 2RKCA 3HLIA 3T1EA 1SO7A 2HU4A 2XZKA 1EUTA 4AHAA 1Q7FA 4X49A 4NCSA 4ZGCA 3Q6KA 1SUUA 4B7JA 1EUUA 4N1BA 1USRA 3JU4A 4J9TA 3KYAA 3AMRA 1NNBA 3HLHA 5GTQA 3SILA 2C4LA 4M3MA 2VSMA 2F29A 2G8SA 2HQSA 3O9KA 3SOBB 4BBWA 2HT8A 1N1VA 1NNAA 3OPZA 1INHA 5FNTA 2IAQA 4MWRA 1W20A 4B7NA 4FPOB 4D52A 4Q6KA 2QWFA 4YW5A 5D9DA 4MWJA 4QN4A 2IAWA 4XJWA 4XIOA 3SANA 3O9JA 2VK6A 4MWWA 3VNHA 1INYA 3A72A 2ISMA 3GVJA 1IVDA 5F72C 2VPJA 4XMBA 1W8NA 2VW2A 3H73A 1B9SA 3SREA 3SOQA 1E1AA 1N6DA 4XJRA 4IFJA 3GVKA 4FZHA 2YA7A 5NN9A 2AGSA 4JF7A 5FNRA 3A9HA 4QN7A 4XILA 1F8BA 2BERA 1L7GA 1E8TA 1PJXA 2GHSA 4FPLA 4CH9A 3TI4A 1B9VA 1F8DA 1USXA 4UOUA 1B9TA 1MS5A 4KS2A 2W5OA 4X4AA 1V0EA 4MJUA 4AGIA 3D12A 3WW9A 1CQ1A 1IVGA 3S2KA 1A4GA 1N1YA 1S0JA 4MWYA 4XYXA 1IUCA 3INBA 4CPNA 4L7BA 3D11A 4XMIA 3G4HA 1NCDN 5FNQA 2IARA 2W8BB 2ZWAA 3H71A 4K1JA 3GVLA 2F24A 2W20A 3LI3A 2FP8A 3CKZA 4GN8A 4SLIA 5GX1A 4FOWA 2AH2A 4FPHA 5JYYA 4O5SA 4YZ1A 2F27A 2VW1A 1IVCA 4HZXA 3H72A 2XCYA 1Z4VA 4IN4A 3SALA 4NC5A 1XOEA 1VCUA 4CPLA 2ZW9A 1S18A 2SIMA 4B7RA 4O5TA 2HTQA 1NSDA 3K38A 3S94A 4C1YB 1V3DA 3S8ZA 1CVMA 2IAUA 2F0ZA 3ZGCA 3HRPA 2POOA 4GZOA 2QWDA 4WEGA 1MZ5A 1NSBA 1CRZA 2JKBA 1U6DX 3TI8A 5B2DA 7NN9A 4MWQA 4FPKA 4D52C 4R40A 2WOZA 1W0PA 3ADEA 4GNCA 1S1DA 4IQKA 2YA5A 4HZZA 3TI5A 1V2IA 2HTVA 3ZGDA 2FLUX 3V1SA 1NCBN 1IVFA 1DILA 4M4NA 2YDTA 1RWLA 4CPYA 3AMSA 3VNGA 1Z50A 1F8EA 4FPJA 4HZVA 2HTUA 1MS9A 2V91A 1SLLA 2F13A 1NNCA 2VSKA 3A9GA 3H6JA 3W09A 5D9CA 4D8SA 1NMCA 3S8VA 1INVA 5FWWA 1Z4WA 1N6EA 2CMLA 4YW1A 5GX3A 4GNBA 1SLIA 1WCSA 3TICA 4XJ9A 4IYGA 4XHBA 4GDJA 2DSOA 4C1YA 2F25A 1IVEA 2QWIA 1EUSA 1NCAN 2IAOA 1QLGA 1QBIA 1INXA 4HHQA 2DYHA 1ZI0A 4L7CA 4GZWA 1K32A 2HTWA 3B7EA 4K1HA 5M1ZA 2BZDA 1N6FA 5EO7A 4GNAA 4QNPA 4FPCA 4HW6A 4XJAA 4GEZA 4FQ4A 4YZ3A 2GVXA 4MJVA 2FPBA 4HZWA 4QN6A 1A14N 4WA5A 4MWLA 1IVBA 1NMBN 4XJQA 1MS4A 3SLIA 5HUGA 1MS1A 2XN4A 3K37A 5H47A 3P5BL 1E8UA 4CHBA 5EX7A 4KS3A 5HUNA 3PJQA 1L7HA 4QN5A 2GVVA 3LI5A 4XOGA 4ZY3A 2HT5A 1MZ6A 4GN9A 4YW2A 4AH4A 4XJZA 2OJHA 4GB1A 1E8VA 5GX4A 1V3BA 4GZTA 2QE8A 4HIZA 4MWVA 3DASA 2ZZKA 1SNTA 3FW0A 1Z4ZA 6NN9A
chains in the Genus database with same CATH topology
4O5TA 3E5ZA 2G8SA 2HQSA 3U0SA 3S94A 2IVZA 3SOBB 3WWAA 3S8ZA 1CVMA 2IAUA 3IAXA 3HRPA 2IAQA 2POOA 2IAXA 1CRZA 4JMLA 3Q6PA 3SOVA 2GVUA 5D9DA 1IJQA 3G4EA 1CRUA 1N7DA 2IAWA 4R40A 4DG6A 3Q6TA 4GNCA 1C9UA 2P4OA 2ISMA 3V1SA 3DR2A 1RWLA 2IATA 4Q1UA 3AMSA 3V65B 3SREA 2V91A 1E1AA 3SOQA 1RWIA 3A9GA 2IASA 5D9CA 3A9HA 3KGGA 3S8VA 5FWWA 5D9BA 5GX3A 4GNBA 2DG0A 2IAPA 1PJXA 2GHSA 4IYGA 3SRGA 1POOA 2DSOA 3O4PA 5GX2A 3TC9A 2IAOA 1QLGA 1QBIA 4HHQA 2DG1A 2FPCA 2IAVA 3WW9A 2VAQA 1CQ1A 1V04A 2GVWA 3S2KA 3FVZA 4HHOA 4GNAA 4HW6A 4ZLRA 2FP9A 3BYCA 2GVXA 4A0PA 3LI4A 2FPBA 3V64C 3G4HA 5GTQA 2IARA 4GN7A 2W8BB 3HLIA 3P5BL 5EX7A 5GX5A 1H6LA 3LI3A 2FP8A 2GVVA 3LI5A 4GN8A 1C5KA 5GX1A 1Q7FA 2W8BA 3I1CA 1NPEA 3Q6KA 4GN9A 4O5SA 4PWZA 2OJHA 5GX4A 3KYAA 3AMRA 2QE8A 3DASA 3HLHA 4IMBA 3FW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5T A;  3E5Z A;  2G8S A;  2HQS A;  3U0S A;  3S94 A;  2IVZ A;  3SOB B;  3WWA A;  3S8Z A;  1CVM A;  2IAU A;  3IAX A;  3HRP A;  2IAQ A;  2POO A;  2IAX A;  1CRZ A;  4JML A;  3Q6P A;  3SOV A;  2GVU A;  5D9D A;  1IJQ A;  3G4E A;  1CRU A;  1N7D A;  2IAW A;  4R40 A;  4DG6 A;  3Q6T A;  4GNC A;  1C9U A;  2P4O A;  2ISM A;  3V1S A;  3DR2 A;  1RWL A;  2IAT A;  4Q1U A;  3AMS A;  3V65 B;  3SRE A;  2V91 A;  1E1A A;  3SOQ A;  1RWI A;  3A9G A;  2IAS A;  5D9C A;  3A9H A;  3KGG A;  3S8V A;  5FWW A;  5D9B A;  5GX3 A;  4GNB A;  2DG0 A;  2IAP A;  1PJX A;  2GHS A;  4IYG A;  3SRG A;  1POO A;  2DSO A;  3O4P A;  5GX2 A;  3TC9 A;  2IAO A;  1QLG A;  1QBI A;  4HHQ A;  2DG1 A;  2FPC A;  2IAV A;  3WW9 A;  2VAQ A;  1CQ1 A;  1V04 A;  2GVW A;  3S2K A;  3FVZ A;  4HHO A;  4GNA A;  4HW6 A;  4ZLR A;  2FP9 A;  3BYC A;  2GVX A;  4A0P A;  3LI4 A;  2FPB A;  3V64 C;  3G4H A;  5GTQ A;  2IAR A;  4GN7 A;  2W8B B;  3HLI A;  3P5B L;  5EX7 A;  5GX5 A;  1H6L A;  3LI3 A;  2FP8 A;  2GVV A;  3LI5 A;  4GN8 A;  1C5K A;  5GX1 A;  1Q7F A;  2W8B A;  3I1C A;  1NPE A;  3Q6K A;  4GN9 A;  4O5S A;  4PWZ A;  2OJH A;  5GX4 A;  3KYA A;  3AMR A;  2QE8 A;  3DAS A;  3HLH A;  4IMB A;  3FW0 A; 
#chains in the Genus database with same CATH topology
 3E5Z A;  1DIM A;  2IVZ A;  4MX0 A;  5FNS A;  4ASC A;  4WA3 A;  3IAX A;  4GZX A;  2IAX A;  1IUB A;  3Q6P A;  3SOV A;  1IJQ A;  4AGT A;  3CL0 A;  4MZA A;  2VVZ A;  3G4E A;  2SIL A;  4FOV A;  4X6K A;  1EUR A;  2F26 A;  1INF A;  4YW3 A;  3Q6T A;  2XZI A;  1C9U A;  1V0F A;  4XJ8 A;  2P4O A;  5HUM A;  4CPO A;  2QWE A;  4K1I A;  4IFN X;  3V65 B;  3II7 A;  4G3N A;  4H53 A;  1S0I A;  2B8H A;  1X2R A;  4MC7 A;  4FPF A;  2IAS A;  1NMA N;  2QWJ A;  1MS3 A;  4M4U A;  2VWD A;  4FPG A;  3WN7 A;  1MWE A;  5D9B A;  2W38 A;  1A4Q A;  2DG0 A;  2XZJ A;  2HT7 A;  3B69 A;  1W1X A;  3TI3 A;  4YY8 A;  3TC9 A;  4MZE A;  4K3Y A;  1ZGK A;  4K1K A;  1L7F A;  4XJU A;  3ALW A;  2FPC A;  2QWG A;  2F28 A;  4YZ5 A;  2SLI A;  2YDP A;  2ZB6 A;  4XE9 A;  3WDZ A;  1V04 A;  1N1S A;  5HX0 A;  2HTR A;  1W0O A;  2HU0 A;  2X9M A;  1Z4X A;  2VK5 A;  3FVZ A;  5F9T A;  1VCJ A;  2BF6 A;  2AEQ A;  2VW0 A;  3BYC A;  4A0P A;  4HZY A;  3LI4 A;  4B7Q A;  2H2N A;  1KIT A;  2VK7 A;  1WP5 A;  4GN7 A;  4YZ2 A;  1MS8 A;  4KS4 A;  2ZB5 A;  5FZJ A;  1F8C A;  4FOQ A;  1W21 A;  5FNU A;  5GX5 A;  4I00 A;  1H6L A;  1OFZ A;  1WCQ A;  1ING A;  5HUK A;  4FP3 A;  1V3E A;  1C5K A;  3K39 A;  2W5N A;  2W8B A;  3TIA A;  3I1C A;  3CYE A;  1NPE A;  4FPY A;  4GZQ A;  4PWZ A;  2QWH A;  1X2J A;  4D4U A;  4MWX A;  3BEQ A;  2QWB A;  4GZS A;  4IMB A;  1RWI A;  2F12 A;  3CL2 A;  3U0S A;  1N1T A;  4WA4 A;  3WWA A;  1NCC N;  4FP2 A;  2YA4 A;  4CPZ A;  4CPM A;  2F11 A;  4FOY A;  4FPE A;  2YA6 A;  4JML A;  2GVU A;  1Z4Y A;  4DGR A;  1CRU A;  1N7D A;  4H52 A;  4DG6 A;  2QWA A;  1XOG A;  4WEF A;  2H2U A;  3TI6 A;  4QN3 A;  3DR2 A;  2AEP A;  2IAT A;  4Q1U A;  1MR5 A;  4FJ6 A;  4UF7 A;  4B7M A;  4YW4 A;  1NSC A;  1W8O A;  4XIK A;  4KS1 A;  4NN9 A;  1V0Z A;  3UC1 A;  4XMA A;  3K36 A;  3K3A A;  2C4A A;  3NO0 A;  3KGG A;  3L6V A;  2HTY A;  4KS5 A;  2QWC A;  1INW A;  4L7D A;  2BAT A;  3A71 A;  3NN9 A;  2IAP A;  5EO8 A;  3SRG A;  1POO A;  1V3C A;  3O4P A;  5GX2 A;  4IFL X;  2A75 A;  2FHR A;  1MS0 A;  4M4V A;  5CGJ A;  2Z32 A;  2DG1 A;  2F10 A;  2IAV A;  2QWK A;  2VAQ A;  5B2C A;  3TIB A;  1NN2 A;  4CSD A;  4XHX A;  5FZN A;  2GVW A;  4GJT A;  4HHO A;  4D52 B;  4MWU A;  4YZ4 A;  4ZLR A;  2YA8 A;  4FVK A;  2FP9 A;  3V64 C;  3NSS A;  4X47 A;  3ALX A;  4GZP A;  1BJI A;  4GDI A;  2RKC A;  3HLI A;  3T1E A;  1SO7 A;  2HU4 A;  2XZK A;  1EUT A;  4AHA A;  1Q7F A;  4X49 A;  4NCS A;  4ZGC A;  3Q6K A;  1SUU A;  4B7J A;  1EUU A;  4N1B A;  1USR A;  3JU4 A;  4J9T A;  3KYA A;  3AMR A;  1NNB A;  3HLH A;  5GTQ A;  3SIL A;  2C4L A;  4M3M A;  2VSM A;  2F29 A;  2G8S A;  2HQS A;  3O9K A;  3SOB B;  4BBW A;  2HT8 A;  1N1V A;  1NNA A;  3OPZ A;  1INH A;  5FNT A;  2IAQ A;  4MWR A;  1W20 A;  4B7N A;  4FPO B;  4D52 A;  4Q6K A;  2QWF A;  4YW5 A;  5D9D A;  4MWJ A;  4QN4 A;  2IAW A;  4XJW A;  4XIO A;  3SAN A;  3O9J A;  2VK6 A;  4MWW A;  3VNH A;  1INY A;  3A72 A;  2ISM A;  3GVJ A;  1IVD A;  5F72 C;  2VPJ A;  4XMB A;  1W8N A;  2VW2 A;  3H73 A;  1B9S A;  3SRE A;  3SOQ A;  1E1A A;  1N6D A;  4XJR A;  4IFJ A;  3GVK A;  4FZH A;  2YA7 A;  5NN9 A;  2AGS A;  4JF7 A;  5FNR A;  3A9H A;  4QN7 A;  4XIL A;  1F8B A;  2BER A;  1L7G A;  1E8T A;  1PJX A;  2GHS A;  4FPL A;  4CH9 A;  3TI4 A;  1B9V A;  1F8D A;  1USX A;  4UOU A;  1B9T A;  1MS5 A;  4KS2 A;  2W5O A;  4X4A A;  1V0E A;  4MJU A;  4AGI A;  3D12 A;  3WW9 A;  1CQ1 A;  1IVG A;  3S2K A;  1A4G A;  1N1Y A;  1S0J A;  4MWY A;  4XYX A;  1IUC A;  3INB A;  4CPN A;  4L7B A;  3D11 A;  4XMI A;  3G4H A;  1NCD N;  5FNQ A;  2IAR A;  2W8B B;  2ZWA A;  3H71 A;  4K1J A;  3GVL A;  2F24 A;  2W20 A;  3LI3 A;  2FP8 A;  3CKZ A;  4GN8 A;  4SLI A;  5GX1 A;  4FOW A;  2AH2 A;  4FPH A;  5JYY A;  4O5S A;  4YZ1 A;  2F27 A;  2VW1 A;  1IVC A;  4HZX A;  3H72 A;  2XCY A;  1Z4V A;  4IN4 A;  3SAL A;  4NC5 A;  1XOE A;  1VCU A;  4CPL A;  2ZW9 A;  1S18 A;  2SIM A;  4B7R A;  4O5T A;  2HTQ A;  1NSD A;  3K38 A;  3S94 A;  4C1Y B;  1V3D A;  3S8Z A;  1CVM A;  2IAU A;  2F0Z A;  3ZGC A;  3HRP A;  2POO A;  4GZO A;  2QWD A;  4WEG A;  1MZ5 A;  1NSB A;  1CRZ A;  2JKB A;  1U6D X;  3TI8 A;  5B2D A;  7NN9 A;  4MWQ A;  4FPK A;  4D52 C;  4R40 A;  2WOZ A;  1W0P A;  3ADE A;  4GNC A;  1S1D A;  4IQK A;  2YA5 A;  4HZZ A;  3TI5 A;  1V2I A;  2HTV A;  3ZGD A;  2FLU X;  3V1S A;  1NCB N;  1IVF A;  1DIL A;  4M4N A;  2YDT A;  1RWL A;  4CPY A;  3AMS A;  3VNG A;  1Z50 A;  1F8E A;  4FPJ A;  4HZV A;  2HTU A;  1MS9 A;  2V91 A;  1SLL A;  2F13 A;  1NNC A;  2VSK A;  3A9G A;  3H6J A;  3W09 A;  5D9C A;  4D8S A;  1NMC A;  3S8V A;  1INV A;  5FWW A;  1Z4W A;  1N6E A;  2CML A;  4YW1 A;  5GX3 A;  4GNB A;  1SLI A;  1WCS A;  3TIC A;  4XJ9 A;  4IYG A;  4XHB A;  4GDJ A;  2DSO A;  4C1Y A;  2F25 A;  1IVE A;  2QWI A;  1EUS A;  1NCA N;  2IAO A;  1QLG A;  1QBI A;  1INX A;  4HHQ A;  2DYH A;  1ZI0 A;  4L7C A;  4GZW A;  1K32 A;  2HTW A;  3B7E A;  4K1H A;  5M1Z A;  2BZD A;  1N6F A;  5EO7 A;  4GNA A;  4QNP A;  4FPC A;  4HW6 A;  4XJA A;  4GEZ A;  4FQ4 A;  4YZ3 A;  2GVX A;  4MJV A;  2FPB A;  4HZW A;  4QN6 A;  1A14 N;  4WA5 A;  4MWL A;  1IVB A;  1NMB N;  4XJQ A;  1MS4 A;  3SLI A;  5HUG A;  1MS1 A;  2XN4 A;  3K37 A;  5H47 A;  3P5B L;  1E8U A;  4CHB A;  5EX7 A;  4KS3 A;  5HUN A;  3PJQ A;  1L7H A;  4QN5 A;  2GVV A;  3LI5 A;  4XOG A;  4ZY3 A;  2HT5 A;  1MZ6 A;  4GN9 A;  4YW2 A;  4AH4 A;  4XJZ A;  2OJH A;  4GB1 A;  1E8V A;  5GX4 A;  1V3B A;  4GZT A;  2QE8 A;  4HIZ A;  4MWV A;  3DAS A;  2ZZK A;  1SNT A;  3FW0 A;  1Z4Z A;  6NN9 A; 
#chains in the Genus database with same CATH homology
 4O5T A;  3E5Z A;  2G8S A;  2HQS A;  3U0S A;  3S94 A;  2IVZ A;  3SOB B;  3WWA A;  3S8Z A;  1CVM A;  2IAU A;  3IAX A;  3HRP A;  2IAQ A;  2POO A;  2IAX A;  1CRZ A;  4JML A;  3Q6P A;  3SOV A;  2GVU A;  5D9D A;  1IJQ A;  3G4E A;  1CRU A;  1N7D A;  2IAW A;  4R40 A;  4DG6 A;  3Q6T A;  4GNC A;  1C9U A;  2P4O A;  2ISM A;  3V1S A;  3DR2 A;  1RWL A;  2IAT A;  4Q1U A;  3AMS A;  3V65 B;  3SRE A;  2V91 A;  1E1A A;  3SOQ A;  1RWI A;  3A9G A;  2IAS A;  5D9C A;  3A9H A;  3KGG A;  3S8V A;  5FWW A;  5D9B A;  5GX3 A;  4GNB A;  2DG0 A;  2IAP A;  1PJX A;  2GHS A;  4IYG A;  3SRG A;  1POO A;  2DSO A;  3O4P A;  5GX2 A;  3TC9 A;  2IAO A;  1QLG A;  1QBI A;  4HHQ A;  2DG1 A;  2FPC A;  2IAV A;  3WW9 A;  2VAQ A;  1CQ1 A;  1V04 A;  2GVW A;  3S2K A;  3FVZ A;  4HHO A;  4GNA A;  4HW6 A;  4ZLR A;  2FP9 A;  3BYC A;  2GVX A;  4A0P A;  3LI4 A;  2FPB A;  3V64 C;  3G4H A;  5GTQ A;  2IAR A;  4GN7 A;  2W8B B;  3HLI A;  3P5B L;  5EX7 A;  5GX5 A;  1H6L A;  3LI3 A;  2FP8 A;  2GVV A;  3LI5 A;  4GN8 A;  1C5K A;  5GX1 A;  1Q7F A;  2W8B A;  3I1C A;  1NPE A;  3Q6K A;  4GN9 A;  4O5S A;  4PWZ A;  2OJH A;  5GX4 A;  3KYA A;  3AMR A;  2QE8 A;  3DAS A;  3HLH A;  4IMB A;  3FW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...