3WX0A

The crystal structure of d-lactate dehydrogenase from escherichia coli
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
320
structure length
303
Chain Sequence
b'KLAVYSTKQYDKKYLQQVNESFGFELEFFDFLLTEKTAKTANGCEAVCIFVNDDGSRPVLEELKKHGVKYIALRCAGFNNVDLDAAKELGLKVVRVPAYDPEAVAEHAIGMMMTLNRRIHRAYQRTRDANFSLEGLTGFTMYGKTAGVIGTGKIGVAMLRILKGFGMRLLAFDPYPSAAALELGVEYVDLPTLFSESDVISLHCPLTPENYHLLNEAAFDQMKNGVMIVNTSRGALIDSQAAIEALKNQKIGSLGMDVYEDVFRRLSACHNVLFTGHQAFLTAEALTSISQTTLQNLSNLEKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
molecule tags Oxidoreductase
source organism Escherichia coli bl21(de3)
publication title Allosteric D-lactate dehydrogenases from three Gram-negative bacteria
rcsb
total genus 100
structure length 303
sequence length 320
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.28: D-lactate dehydrogenase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wx0A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wx0A01
3AY7A 1YBVA 4MVJA 3IKTA 2I3GA 3FTNA 3VH2A 2P4HX 4AJKA 1R12A 4NIMA 3JQEA 3L4BC 2Q1SA 1EK6A 1P9LA 4NQZA 4U6SA 3NUGA 1I33A 1N9GA 1NHGA 1GQQA 4ZA2A 1I30A 4CQLA 2J6IA 2BELA 1HLPA 1HETA 1XQ1A 3BMCB 4LVCA 1HL3A 4E32A 3UN1A 2FRDA 2BH9A 1I32A 1PQPA 3VPXA 1SEPA 2YY7A 1WMBA 2B5WA 3OIGA 4MKXA 1YDEA 2EF1A 3NTQA 2R00A 4XIYA 5GY7A 5B37A 4EITA 3P19A 3H9UA 5EMHA 2EEZA 3ASVA 5I7SA 4XYEA 4B4VA 1DXYA 2DT5A 3FPCA 4J4BA 5A02A 1P77A 5L4LA 4A73A 1SOVA 5IAAA 4AICA 3CZMA 3VAZA 5L7WA 3S1LA 3U4CA 3GG9A 3QSGA 4IS3A 3FBTA 2VTEA 1SBYA 3A1NA 4PG4A 5BSHA 2WMDA 4NPCA 3JYNA 1YKFA 1ADGA 3AUSA 2PKQP 2Q46A 2WYUA 2EGHA 4MPDA 3JQAD 1RYDA 1OBFO 3OA2A 2ZYAA 4IUYA 3GEDA 3WFIA 1QG6A 4DXHA 3ADOA 1BRMA 4M87A 4KUEA 2ZQYA 1N7GA 4ND3A 3GPDG 4DIBA 4HNGA 1GL3A 5DBFA 2WSBA 4IQ8A 5B4TA 1BXGA 2X5OA 2OL4A 4II3A 5JCXA 4XR9A 2A4KA 2EG9A 4MVJI 4IS2A 2GN6A 2VHWA 5K6AC 1GPDG 4RZIA 2O3SA 3E5MA 4OM8A 1DRUA 2WD7B 4NHEA 3RUDA 4DUPA 3RKUA 1HEUA 3GGGA 1T26A 3WGQA 1M67A 3GNTA 4R1SA 3PWKA 5TIIA 1ZK4A 1EBUA 2GNAA 1B8UA 2VUUA 1OC4A 2Y1GA 3FSRA 4J7XA 3AU8A 2ZIZA 1GY8A 5BR7A 1CRWG 3WGYA 1PQUA 2X0RA 1DIBA 4FN4A 4WNIA 4MIOA 1YL6A 5BT9A 2WE8A 1A7AA 1HZZA 1PTJA 3BXXA 3E5RA 4WCFB 5TF4A 3HSKA 3X2EA 3Q3CA 1P33A 1ORRA 1PJ2A 2Z95A 3EAGA 3F4BA 1IYZA 4BV9A 3DZFA 3OJLA 4YVFA 4FW8A 4NBUA 2UDPA 3KYDB 4R9RA 1UP7A 2P68A 2Y67A 3E82A 1K6JA 4CM6A 5L9AA 1UR5A 2FN7A 1KEWA 4L73A 3AI1A 2AW5A 2EIHA 2VT2A 3OH8A 3PYLA 2WE7A 3OEWA 2QRKA 3PQFA 1Z7BA 4DPKA 1YGYA 1VJTA 2Q4EA 4ZQEA 1C14A 1BMDA 2FPPA 3CSDA 4IBOA 4IJWA 4BO1A 5AXBA 4M86A 1VM6A 2ZCVA 5AOVA 4J0EA 4CLOA 5F5LA 1NAIA 4CM9A 2PD3A 2Q45A 1T24A 2X86A 2C20A 4IINA 3ZHXA 3ZWOA 4DQXA 1QR6A 1WWKA 1GZ3A 4RLHA 3W8DA 4NJMB 3WQQA 4D45A 2PKQO 3GEMA 4LMPA 5A9RA 3I5MA 4DIOA 3QVTA 4TVOA 2EW2A 4FGSA 1E1LA 5A3VA 3PHIA 3DMYA 1KOLA 1IUKA 1I24A 3V1TC 5DP2A 5CEFA 2AEJA 4RPLA 4RVDA 1B2LA 3LF2A 1YBMA 2PZLA 3F47A 5G0SA 5GZ1A 1E3EA 4MKZA 4WE3A 5U4QA 1ONNA 4QUKA 1PZFA 4YJFB 3D4PA 3UH1A 3W4IA 1O95A 1YBAA 4E0BA 5L4NA 2NADA 3HNPA 1ARZA 5CPBA 2HDHA 4DWVA 2YQ5A 3AY6A 2Q2VA 1UZNA 4R9SA 4IZHA 4FSHA 1N5DA 3C1AA 3ANMA 3OICA 3WGGA 4K9DA 1YL5A 2X8LA 4FD3A 3DHEA 3AU9A 3ZV6A 1TLTA 2VWQA 2HMTA 1V9LA 4NZ9A 4PRLA 4WNCA 2EERA 5JYDA 4TVBA 3HHPA 2AE1A 4C4OA 1CWUA 3RC9A 2O3JA 1TVEA 8ADHA 3FD8A 2B83A 3F6YA 3Q2KA 5DP1A 3VC7A 2BI7A 3JTMA 4ZHSA 1RM5A 4L4SA 2PGLA 2X0IA 4J90A 5GZ6A 2EJWA 1FJHA 1HE4A 4WEOA 4L4RA 4YBZA 1DRWA 3ZWBA 3ZU2A 2AA3A 4OQYA 3QWFA 4BGUA 3OBBA 4A03A 5BSGA 1SB8A 3P7MA 3PXXA 3WYEA 1Y81A 4PIVA 4L9RA 4GH5A 1LC3A 3L07A 3JYLA 2AG8A 1GQYA 4DLBA 3KSZO 2VZ0A 1HDXA 1QP8A 3HB5X 3OSUA 3ZH2A 3Q1LA 3HUDA 4AJNA 2CUKA 5K9ZA 1N1EA 3QIVA 2EV9A 3GVPA 5EPOA 3K2EA 4FFOA 1MG5A 3KVOA 3STHA 5JC1A 5G0UA 3OJEA 1TA4A 4R5MA 5HRUA 3VH4A 4ZQGA 4MVJM 2POQX 4JBHA 3BMQB 2AQHA 5FI5A 1HSOA 9LDTA 2O3TA 3VTZA 4DIFA 5U9CA 2YFHA 4XX0A 4YT2A 1NWHA 3WSVA 2PV7A 3HJAA 4PLWA 1E7QA 2HJRA 3AUUA 2YJZA 4NG5A 1DC6A 2B36A 1E7WA 2DBRA 2WWRA 3BHMA 4E2YA 1ENYA 3OECA 4XB2A 1QLJA 3O26A 5CDSA 3R1IA 3QVOA 2QG4A 4RF5A 3NRCA 1N7HA 2G0TA 1PJCA 4FGWA 3H9JA 4FPXA 1ONOA 1Z74A 2J5QA 5HM8A 1TT7A 1O89A 1E7YA 4IQ0A 2I66A 3K9QO 2D2IA 3E9MA 1EUCA 1PQWA 4YQZA 4RJTA 3JQ8A 4CM4B 1LSOA 1NWCA 1XIVA 3GFBA 3GH3A 1UDBA 3LLSA 1WAMA 2HRZA 2RBEA 1ADFA 2Z1MA 5IDQA 1E3JA 1XU9A 2VRCA 1A4UA 4XYGA 1H9AA 1NXQA 4YRDA 5F1OA 1PIWA 4XQCA 3RBVA 2OUIA 3D64A 1XDWA 5HS4A 3ANNA 1CETA 3AOEC 1QYDA 2Y1OA 3RJ9A 3QWIA 4E2ZA 3ZWPA 3DZHA 2JFGA 3F1LA 3F5QA 5IZCA 3FNGA 3K92A 3DB2A 5GMOA 3WJAA 4LCJA 4IDFA 4R3WA 4F45A 1KY4A 2AXQA 2OP0A 3QRWA 1T4BA 1A71A 4F3YA 1R0KA 3M1AA 3AOGA 1YB5A 2O4CA 1V3VA 2GO1A 1KEUA 3H5RA 4ID9A 5ICMA 4TRMA 1GTMA 3QLJA 3VKUA 4ILKA 4RQTA 1LLQA 3RUCA 4JP2A 4W9NC 2EKPA 3GRKA 1U1IA 1WP4A 3P2YA 4GKBA 3RC7A 1O5IA 2GN9A 4PLYA 5JMWA 3RUIA 2JCYA 1A72A 3WB9A 3NJ4A 4NK4A 5A9SB 1LLUA 4B4UA 4BNXA 1NAHA 3ZWXA 4D43A 3G1TA 3OETA 5KJ1A 5ER6A 2Y0DA 5DOVA 2EP7A 1MP0A 4CMCA 3ZHZA 3K96A 1MC5A 3FNEA 1NP3A 4WGGA 1LUAA 1WW8A 2CY0A 2DQ4A 1HRDA 1KIFA 5G4KB 3Q0EA 2B69A 1LLCA 2EXXA 1I3LA 4GVLA 1J6UA 4A7PA 1LX6A 2IYPA 5BQFA 1YE3A 3A14A 4MIYA 4CM5A 4ZJUA 1IHYA 4IM7A 4RORA 3RFVA 2YV1A 3PQDA 4IJUA 4ND4A 1H6AA 1O6ZA 1FDUA 1LQUA 3TQHA 4GPD1 2EJVA 3EVNA 5C37A 3GY0A 3QVXA 3VDRA 3UCEA 1ZSYA 3FNHA 2GYYA 3C8MA 5IDXA 4DRYA 2GPTA 3O03A 1WPQA 4MVJG 2VCYA 2HMWA 1VL0A 1MG0A 2GCGA 3AM4A 2GRAA 1DC5A 4XQ9A 5JAZA 1RPNA 4I5EA 4YDRA 1CJCA 3UW3A 4CMAA 2C29D 4FOOA 4JIGA 2CDCA 4IDBA 2Q1WA 4YJFA 4QTZA 3RBXA 1NR7A 3B20A 4U7WA 4EYEA 4W82A 4D7AA 1ULSA 5JXWA 3WLFA 1IL0A 3TZ6A 3MOIA 2Q1TA 4KQWA 4BMVA 4WLOA 1QLHA 4IXTA 3I83A 4Y9DA 2ZB3A 2FOIA 2PD6A 4DREA 3UUWA 4ND5A 4BO0A 3DZGA 2NV6A 5JPIA 1EMDA 4AVYA 4CM3A 1PJQA 2G5CA 4NJMA 1GUFA 1JAXA 1MGOA 3GVCA 2PY6A 1MFZA 1PS8A 1H94A 1PGOA 1EZ4A 2PTGA 4P4LA 5DULA 3PYXA 3OJFA 3X2FA 1OZAA 2BGMA 3I1JA 1QMGA 2GF2A 3ASUA 3H8VA 1Y5RA 3GFGA 1VC2A 1Y9EA 2FWMX 1JW9B 3DQPA 4O63O 2P2SA 4Y6RA 3VVCA 2W90A 1UXGA 4OL9A 5I8WA 2NVWA 2TMDA 1LSSA 1BDMA 3JD3A 4WJZA 3V1UA 3ZGYA 3TFOA 1S6YA 1KYQA 1ULUA 2CD9A 2PFGA 2X4GA 3W4KA 1K0UA 1P3DA 2J5RA 2O2SA 4RCVA 4OHUA 5I9LA 2GERA 1V3TA 1RKXA 1WDLA 2DU8A 1GEEA 1K6IA 3AOEA 3F1KA 4MIEA 1DJQA 1YL7A 3H5AA 3HDHA 2PD4A 1F06A 4W7IA 4YWJA 4RVFA 3E6AA 2IZ0A 4K6FA 3TSCA 5IZ4A 4RVGA 3W8FA 4JGBA 1E1NA 4Z0HO 3H9EO 5BSFA 2YHUA 4FS3A 3WWYA 1KVSA 4DC0A 1BHSA 4ZD6A 4CQMA 4OO3A 4RPHA 2X5KO 4W6ZA 4AJOA 4D0RA 1ISMA 4WCFA 3LLVA 2Z5LA 4PLZA 1KBZA 5B4VA 2ZATA 1H0KA 1AN9A 1YONA 4R3NA 2WYWA 5CHEA 3S55A 1E3LA 3C85A 3OIFA 1ISHA 3WBBA 1LDMA 2H5LA 5G0TA 4CM8B 5KIAA 5IF3A 1WXDA 3CPSA 1LTHR 1ISFA 3OHSX 5ENDA 1ZH8A 5F3RA 4YAKA 2WJPA 2WD7A 3OQ6A 2CSUA 4BNJA 2C2XA 3LT0A 1LA2A 4QX6A 3JYPA 4LRSB 1GZ4A 1C1DA 2VNAA 2ZK7A 4N5LA 3GDGA 4OXKA 4CJXA 3O8QA 4GMFA 4JLWA 3HDYA 1X0VA 4W7HA 4OKNA 2YZ7A 2B4QA 1HKUA 4XIJA 4GWKA 1UXJA 3T4XA 1I5RA 4D79A 3PP8A 1F12A 4II2A 1B3RA 4PN3A 1C1XB 5I9MA 3JQFA 4TZKA 1A5ZA 5F5NA 3CMMA 5CG2A 1R4NA 4EGFA 2IZ1A 3LC7O 4FFLA 1FDTA 4RDHA 2JFHA 1TEHA 1U3TA 3MJEA 4E31A 4CUZA 4YTEA 2CFCA 2H6EA 3AFMA 3JD2A 3KHUA 3L0DA 1U7TA 4Q3EA 3UGKA 3UKOA 1B0AA 2NU6A 5L53A 4FFMA 1YVEI 4WLVA 1LQTA 3FI9A 2A92A 3SC4A 3QHAA 3TRIA 2D5CA 5G4LA 1C0KA 2P5UA 3JYQA 1KVRA 1R4MB 3ZU3A 5CG1A 4H3VA 4WLUA 1BGVA 3KOUA 4GAEA 3A9WA 3FBGA 4RVHA 3TN7A 1DIAA 4AJLA 4CM1A 2JAPA 3DMTA 2X22A 4M8SA 4UREA 2HSDA 3P5SA 1KVUA 5IXYA 2XAAA 1VE9A 3OFSA 4OOEA 3ZWWA 2YYYA 5GZ3A 2NUAA 2NM0A 4HWKA 4Q3CA 3PK0A 1IOLA 2VRCD 2HK9A 1N9GB 4UEJA 4XGKA 4P4NA 2X9NA 1GAEO 4IGEA 5TRTA 5TGDA 2HQ1A 3EC7A 3GOHA 2VWPA 1B8VA 1KERA 4G2NA 3RIHA 4AJJA 4CODB 2VQ3A 2WDZA 2DLDA 3JCZA 3W8EA 1QORA 1K6XA 4Y6PA 3TL3A 5DN9A 1HZJA 1P1KA 3C1OA 2UYYA 1HDGO 3JD4A 3WFJA 3DFUA 4CM7A 1D1TA 2PLAA 2VNSA 1UZLA 2FP4A 1I36A 7ADHA 1PSDA 3KO8A 1F8FA 2YW9A 4K1LA 1Z7EA 1SPXA 3TNLA 3FN4A 4OXNA 1UJMA 4Q3NA 4BMSA 5JW6A 2GLXA 4INAA 1N92A 3JQFC 1IY8A 3I9KA 3BTUA 3O8QB 5EJ2A 4F6CA 4BHTA 2P9EA 3M6IA 5JCJD 4LN1A 4O1MA 5A3JA 3DTTA 4TRJA 3CEAA 3MJVA 5IZCC 4D3DA 2W98A 2I6TA 3ORFA 5KOIA 1VSVA 1LU9A 1Y7TA 3PLNA 1YH3A 2GZ1A 3AI3A 3FR7A 2I65A 4YR9A 2JKVA 3RC2A 3TZQA 1T1RA 3LVFO 4UEOA 1CQIA 3R6DA 1VPDA 3HQ4O 4YAIA 3B6ZA 3PWSA 5KVSA 1A7KA 2NQ8A 2O3RA 2J3KA 1NHWA 1RJWA 2E49A 3V5NA 3JQAB 1U3VA 3DEYX 2W2LA 3H5NA 3RUEA 1V3UA 5H82A 3GZNB 3ZWNA 5L3ZA 4CLHA 2QRJA 3SJ7A 3SEFA 2QZ9A 4KZPA 3ROQA 1X1TA 5L4SA 1VLLA 4CR8A 1SCUA 3PDUA 1LRJA 3PGJA 1EE2A 4CQMB 1LDGA 4I5GA 5H83A 4CQMD 3HADA 1WVGA 5ADHA 1ZK3A 1DO8A 4DQVA 3QJ5A 4R51A 1IHXA 3LZ6A 4MINA 4MKRA 5DDIP 1ADBA 2FPGA 3IOYA 4FFRA 5L40A 3I23A 2C7GA 3I9NA 3QE3A 1FK8A 1VKNA 1ZK0A 1HF3A 4EDFA 5I9NA 1KEPA 2NACA 2VHZA 1PS9A 1VKOA 2YQ4A 4JK3A 3L6DA 4BNZA 1EFLA 2PH3A 1JN0A 4PLHA 1E77A 1Y8QB 2VTDA 1QKIA 4JP3A 4RVSA 4XA8A 4XGNA 3RFTA 2DTEA 2E6UX 1BXKA 1LLDA 5B4UA 3CINA 3RVDA 3ONFA 4U6QA 6LDHA 4LCEA 5G2OA 1XYGA 2VYNA 3BHIA 3H4VA 1PGNA 4MOWA 3GHHA 1GCUA 5CP8A 5BNIA 2WD8A 7MDHA 3SBOA 2GDZA 3IQDB 5DZSA 2QHXA 3PLRA 1H9BA 4ND2A 2XF8A 2A9FA 1QXSA 3GA0A 4J1SA 2YUTA 4XD2A 4EZBA 1GCOA 2UV8A 4J4HA 1DB3A 1Y8RB 2PZJA 4FB5A 1GR0A 1Q0HA 1Y5MA 4IIVA 2R6JA 1MXFA 3PIIA 5HBRA 2NQTA 2ZTUA 5LCXA 4LMRA 3ZI0A 1UDAA 4YYZA 3BYZA 1YB1A 2DBZA 3DBLB 4Q3BA 5BSEA 3VZPA 1G0OA 1M75A 4BNTA 3D4OA 3M2TA 4IDEA 1HYHA 3E03A 3NYWA 2DUUA 3ETDA 3DZJA 2HU2A 3R3SA 2BRUA 3I4CA 4ONEA 1LC0A 2I67A 2VWGA 4MDHA 2D4AA 4B3IA 1Q2XA 1PJ4A 1ZMOA 4BO6A 4HADA 3H3JA 4M55A 3VPFA 1UH5A 1HE3A 3KV3O 4UVHA 4XJTA 2JAHA 3GAFA 1YQXA 1L7EA 4HKTA 1GADO 3WWZA 1I01A 1SO8A 1EK5A 4I08A 3O4RA 2OO5A 3GZ4A 1LJ8A 4WECA 4NBTA 1W73A 4XKJA 4BNLA 4E13A 5C7IO 4HP8A 3WS7A 1EEHA 1I2ZA 4RQUA 2D3TA 4UVGA 3S2EA 2Q49A 2PNFA 2J8ZA 2D0IA 1Q1NA 4QSMA 4ZRMA 5EINA 1NPDA 3RUHA 3TZCA 5CFZA 1NASA 1XR3A 2HRBA 4KUHA 1M2WA 2NVUB 1P1IA 4JJGA 4QEDA 2F00A 3ST7A 2DC1A 1NPYA 1UAYA 1C3VA 3JV7A 1XHLA 2CNBA 1ZVMA 1YWGO 3IS3A 1OFGA 1ENPA 1ZMTA 1C0IA 2VZ9A 3I9MA 2FR8A 3EGOA 4GGOA 5LDHA 1H6DA 4EBFA 1GZ6A 1VL6A 3NGXA 3DOJA 4NBVA 5J23A 1PZHA 1ZEJA 2FSVA 3DAGA 4XR4A 3U0BA 1MUUA 1ZZEA 1BDBA 4RL6A 1ZFNA 2X1HA 3C7AA 2DFDA 3ICPA 4W4TA 4MP8A 4RO0A 5DCWA 2OP1A 3AI2A 1ZSNA 1QYWA 3U4HA 4CV0A 3KYBA 3H3FA 5TQVA 4BKOA 3DZIA 2WTBA 1IPEA 3NV9A 1MA0A 3JQGB 1IPFA 1LDYA 4Z0PA 4Z3KA 4N54A 1BW9A 1OI7A 3VZQA 2PK3A 4NNJA 4M54A 1P0FA 3E48A 5ITWA 4DLLA 1CERA 4DYDA 4ALMA 4FDAA 4Y98A 4HXYA 5COAA 4PG8A 4YXFA 3SC6A 1EQUA 1HYEA 4YAJA 4E30A 2BGKA 3EVTA 4Z3DA 4F6LA 4XEHA 1WLYA 4PZEA 3WGHA 1GV0A 4D3SA 4FCCA 5KJFA 4BKRA 4E21A 1IB6A 2IXBA 2FSSA 4CMIA 5I7EA 1A9YA 5A5EA 2O4UX 4PCVA 1BSVA 4GSLA 2AEFA 5B12A 3WYCA 1OC2A 3ON5A 4PVCA 3SLKA 3HN7A 5ES3A 3LSYA 3C7DB 3JQ8B 2E37A 4J3FA 4CM4A 4A2CA 4Z9YA 3K30A 4J91A 2E4AA 3FF4A 1ADCA 3E9NA 4DLAA 4B4OA 5JCJA 1P1JA 2C5AA 2XXBA 3B70A 4IZIA 4UVIA 3GGOA 2NVBA 4B7UA 2VHVA 3LC1O 1AXEA 5G0VA 3AY3A 2HO5A 3KB6A 5KVQA 3IUSA 4IXWA 1WNTA 1Q0LA 1HYGA 4D41A 4DMLA 1DFHA 1LXCA 3K31A 2BGLA 1PS0A 5KJEA 4E4YA 5EL0A 5A1TA 3DTYA 2C82A 1SNYA 4R41A 3TDKA 5A5FA 3INRA 3VPHA 3I9JA 4O6VA 1C1DB 2A35A 5JC8A 3MJSA 4PVDA 3NTRA 1KC3A 4CMHA 1ID1A 1UAGA 2PKRA 1XU7A 4J7UA 1OMOA 2OXIA 2GZ3A 1ZNQO 1R6DA 1GFSA 5JDCA 1X15A 3KYCB 3ZNQA 4CM8A 4IPTA 1O8CA 1WDKA 4Q39A 3TZKA 1E5LA 4K6CA 2HJSA 3WQRA 4OOFA 4JXKA 4BNMA 1LDBA 2B37A 3I4FA 3NJ8A 4IJKA 2IRWA 1VRWA 4BOYA 5AQ1A 5MDHA 5I7FA 1I3MA 2BD0A 4P38A 3KLMX 2GGSA 4UUMA 1U5CA 4CMBA 3ZCXA 1L7DA 1D3AA 3UXYA 2FY8A 1IE3A 5EQFA 1RM0A 4BNHA 2VUSA 3Q2IA 1N8KA 4TZTA 5FF9A 3NKLA 4BMNA 4DGSA 2EW8A 2JJYA 4GX1A 2QIOA 3L6OO 3H2ZA 4IJVA 5IJZA 3AJRA 3P2OA 2Y93A 3D3EA 2O2YA 1MFPA 3EK2A 4Q3DA 4U8GA 3MCVA 3FWZA 3KZVA 3G17A 4L8VA 3FNFA 3UOGA 1Z73A 1R15A 1M6WA 3L4BA 3VOSA 4BO8A 3V8BA 1PGPA 3WICA 1P31A 5JO9A 3IDSA 5KKCA 3B1JA 1Y9AA 1ZXLA 3LT1A 5JBIA 2CVZA 3GDOA 1O94A 4GX5A 5A9TA 3S8MA 1DHTA 2X0JA 4YT5A 5A05A 4OYRA 4RPKA 3H6KA 5JDCC 4EUEA 2ZYDA 3HN2A 1DJNA 1WMAA 2WM3A 3PTZA 4LW8A 4WOKA 3V1YA 1T25A 3CMCO 4YCAA 4ZU3A 1HDZA 4XGIA 5TLSA 3U3XA 2ZTVA 3D3WB 4PZDA 2EKQA 2W8ZA 3BMNB 3I3OA 1LEHA 3NGLA 4QO8A 4WCDA 1J0XO 2DPHA 4FQ8A 2IZZA 2R00C 1KS9A 3C24A 3T4EA 1U8XX 4CL3A 4GI2A 2HKIA 1PJLA 4NFYA 1DC4A 4OAQA 2CDAA 3DBRA 1ENZA 1NFRA 4Y8VA 4YJGA 1PZGA 1JTVA 3MWEB 2OHXA 1MXHA 3G1UA 3ZW9A 5JS6A 4BO3A 3NT5A 4HNHA 5JNLA 4BNIA 4B79A 1ZK2A 2BKAA 3WIEA 4G81A 2ZB7A 4NI5A 4GBJA 1V8BA 3D4NA 2Y1CA 3KYDA 4CR6A 3W6ZA 1WZEA 3JQ9A 4IMRA 1NQ5A 3IJPA 1QYVA 5ICSA 4EJ6A 3WG9A 3RAJA 4OJNA 3WDSA 3AWDA 3WSWA 4CM9D 3DONA 2RAFA 1T2FA 3ZN2A 2P4QA 3HWRA 5G0WA 2D1YA 3JQ9C 4PZCA 1E1MA 1P44A 2EKLA 1EE9A 2Y1DA 3U62A 3EUWA 2OBYA 1FF9A 1TXGA 2CVQA 3K73O 4QXMA 4PG5A 3Q9UA 3SJUA 4PRKA 1UDCA 5JDIA 5BNTA 3M2PA 4PLCA 5TT1A 4R69A 4L76A 4BL5A 4ZGWA 3KYCA 4TRRA 3N58A 3DR3A 3OQBA 3HDJA 3CIFA 3WMWA 1EQ2A 3NAQA 1K2WA 3ITKA 4DBVO 2G76A 4ESOA 2RCYA 4OMUA 3PDJA 2JHFA 4DBZA 4XYBA 1U4SA 3I9OA 4Z9XA 2DPGA 2VOEA 3RI3A 4FJ1A 1BXGB 4OXYA 5I7VA 1E6UA 1S7CA 3GHYA 4XZ3A 4HFRA 3C3XA 4B7CA 1GEGA 4B4WA 2RH4A 4E33A 1Q0QA 4EW6A 3GG2A 5KVCA 3DOCA 4WCFC 1V0JA 4BB6A 5B1YA 1XA0A 1HDCA 1Y6JA 3F9IA 1FDSA 4K26A 3WGIA 5T8KC 4A0SA 4Z0TA 1XG5A 4MJLA 1ZKMA 3U4DA 3IAHA 5EN4A 1E3WB 2C54A 4IDDA 4J0FA 2Q3EA 3RKRA 3UF0A 3UAGA 1GU7A 4YRBA 1DIHA 2C59A 4G5HA 1FDVA 4OGWA 5C5IA 2GN4A 2P9CA 2Q4BA 2WEKA 1NVMB 1GQ2A 3EY4A 2B4TO 2C0CA 5TNXA 1X14A 4ROSA 4G65A 3SVTA 3KTDA 2VHXA 2AQKA 3IIEA 3JD1A 3WBFA 1NTOA 5CAEA 2O3UA 2DM6A 1P74A 2GD1O 4NMHA 4PLGA 4UAGA 1Z82A 3PHJA 4KTVE 4CV2A 2RH8A 4CMGA 5A4DA 4AJIA 2UUOA 4GSKA 4O0LA 1JVSA 4HBGA 3BMQA 3K6JA 4EI2A 4RGBA 4PLTA 3CE6A 4L4XA 3EZYA 5DCYA 2ZYGA 1YOVA 4J9UE 1AHIA 1AGNA 3RFXA 1BW9B 3ZHYA 4E5PA 1U3WA 3DWFA 1BXZA 1JDJA 3JQGA 4WLFA 2ZQZA 3ZZNA 5KTKA 4UVDA 4GMGA 1LI4A 2IDZA 4AJHA 4DC1A 1FDWA 4XQEA 4KWHA 3JQ6A 1ZJZA 3TPCA 3H9QA 1BWSA 1LDNA 2V6FA 3PEFA 8LDHA 1QV7A 3WR5A 2XPCA 3HDQA 2YHIA 1NM5A 4D0SA 3H7AA 4AFNA 4AJ1A 3RU7A 3IMFA 2P9GA 1L1FA 1F14A 4BKQA 3ZNOA 4J2OA 4RV9A 1W4ZA 2C2YA 3ADPA 4BB5A 2I3AA 3NEPX 2DAPA 1RM4A 4YA6A 3PRJA 5U1PA 1VL8A 3F3SA 4HFNA 3PJEA 2HAEA 1H6CA 4ALKA 5JSFA 1KEVA 4YB8A 3U9LA 4EJMA 2NVUA 1W8DA 2W2KB 5DBIA 4GLOA 3U49A 3QY9A 2CMDA 4J7CA 2PWZA 3GQVA 5T57A 2TMGA 4BQRA 2AQIA 3ZU4A 2Y0EA 5IG2A 4EUHA 4Z6KA 4PG6A 1I8TA 3D1LA 1DBVO 1F8GA 2DKNA 1BVRA 2V6MA 4LSWA 4DMMA 4O59O 3L9WA 1Q7BA 3BMOB 4W99A 4WK6A 4AJEA 3PWZA 2OORA 1U2DA 5LC1A 4FJ0A 1EVYA 3ZWMA 3ZHBA 3QWHA 2BLLA 4L0QA 3ROPA 2YV3A 2Q50A 1DC3A 2DBQA 4PG7A 3DMTC 4R1UA 4DTIA 3ZWYA 2VYVA 3U09A 3VZRA 2NTVA 4FC7A 3E8XA 3T7CA 4I5FA 4XDYA 3ZV3A 4YPOA 4WKGA 5T67A 3AM5A 2JCXA 2O50A 2DBVO 4NBRA 4A26A 3RBZA 3ZW8A 2BHLA 1AXGA 3B1FA 5FYDA 1OAAA 1I3NA 1PR3A 3IP1A 5JMPA 3WOHA 2HUNA 5KWEA 1YXMA 4ALIA 4IQGA 4CUJA 1FXSA 5ENVA 1JA9A 5FI3A 1H2HA 5MGBA 1E92A 1GUZA 3UVEA 4H16A 2UVDA 1PZEA 3COSA 4R5HA 3GNSA 2JD1A 2BMAA 1H5QA 2ILTA 4TWRA 1T2CA 1LSUA 2YV2A 5A03A 3KSUA 2D8AA 2H9IA 5HS6A 4IMPA 3KEQA 3TFQA 4CLOB 3PFFA 4NDNE 5ITVA 3R3JA 1LBEA 3AW9A 3GF4A 3E18A 1U5AA 3ZV5A 3HE3A 1TB4A 3CH6A 1XSEA 3PJFA 1J49A 4EEXA 4GGPA 2EWMA 5JE8A 3DC2A 1I0ZA 3DBVO 4PLFA 3H2SA 2G17A 4ZVVA 2NU8A 2XXJA 4I1IA 2X9GA 4D46A 3EZLA 4GLLA 4DPMA 3JQBC 2JD2A 2VN8A 4XJSA 3EMKA 2I5PO 1M66A 4KUGA 4UEKA 3K2BA 5L7YA 2AQ8A 1U3UA 1UP6A 1ISGA 3BMOA 1NVGA 4XCVA 4FFPA 2YDXA 1B16A 1YJQA 3GC6A 3KM0A 4R1NA 3ETEA 3PI7A 1H6BA 2Y99A 4IDCA 4BGVA 3LT4A 3ZWCA 1BTOA 1IULA 1R0LA 3DAPA 3LC2O 4OSPA 5KJCA 2X0NA 1EUZA 2JFFA 4B3HA 3D5QA 2NTJA 3JQAA 4ND1A 1PU2A 3RQSA 1E7SA 4JBIA 2CF5A 1EVJA 2W2KA 4PGFA 3DHNA 4Z9FA 3PHHA 5DOZA 2ET6A 1F0YA 4QT0A 4RF3A 4BO7A 2VWHA 3CTMA 4Q9NA 4CLRA 3DDNA 3N7UA 2FHSA 2PZMA 2HK8A 1CF2O 3GPIA 4MP6A 5JY6A 5KJ6A 4ZQFA 2HMUA 5TJHA 3NX4A 9LDBA 4FIZA 4HX5A 4WLNA 5CEEA 4PFJA 1O9BA 2B5VA 4TKMA 4I5DA 3OIDA 4YJHA 3BTOA 3D5TA 4IY1A 2UUPA 2O23A 1DLIA 1M76A 3ULKA 2E82A 3KRTA 2PR2A 1ZUD1 1J4AA 4YQYA 2D59A 2OBNA 4JROA 3IP3A 4HV4A 1DRVA 5AXCA 2NLOA 5KKAA 2DUWA 3G3EA 6ADHA 4GQAA 2LDBA 1JKJA 1JWBB 1ISIA 4D3FA 3TL2A 4I8XA 4J16A 1YOVB 4RDIA 1ZCJA 4GL4A 4MP3A 1UXIA 4EEZA 1YO6A 4TSKA 3WGOA 4YEDA 3KETA 1ZEMA 1QYXA 1UZMA 1XWFA 2V7PA 2VOJA 4BO9A 3V2UA 2O3QA 2VRBA 2J3JA 1XELA 1AUPA 3JSAA 3WNVA 2PZKA 1IZ0A 2GASA 3L77A 4W9NA 2BFMA 4YACA 4ZQBA 1ZIDA 3R0IA 5L95A 3WMXA 1DDOA 4ALLA 3DXFA 4X54A 2G82A 3DZBA 1XKQA 3MEQA 3OEYA 4AJ4A 1LRLA 3BMCA 3K8ZA 1DFGA 3O9ZA 1VJ1A 2Q2WA 3IKVA 1U8FO 1XQ6A 3INTA 2ZTLA 1DAOA 4LGVA 5AXDA 1E7RA 2I76A 3UHAA 4CQLB 1R4MA 1NQTA 4HUJA 5K6AA 1KVQA 1UXKA 4BGEA 2EHDA 3E9QA 2FPIA 2B0JA 3DO5A 2PGDA 3JYOA 1B3BA 1JU9A 3TJRA 1X1EA 2Q99A 2E48A 2WYVA 1E3WA 3ZNNA 2YFQA 1Z75A 1YJ8A 1MV8A 2OOSA 4CLXA 1PL6A 4WOJA 1CDOA 2BF7A 1OOEA 4DPLA 3DZKA 2AG5A 3WIDA 1R4NB 1EVZA 5FWNA 3GN1A 4GX2A 4TRNA 4BGIA 1C1XA 1T2AA 2JHGA 4B3JA 4Y6SA 4E5NA 4QECA 2OGUA 1H2BA 3DAFA 1PEDA 4N5NA 1UUFA 4LISA 2SCUA 1SAYA 2YDYA 1U7HA 5AXAA 4TQGA 4WEQA 2GUGA 1NR1A 4QQRA 1LRKA 1G6KA 3G49A 1U4OA 3BTSA 1E3IA 1D4FA 4K28A 1KC1A 3KXDA 2QW8A 3QVWA 4E2XA 2PA3A 3JD0A 3OP4A 4AJ2A 3A4VA 4KTTE 2AE2A 3DFZA 2CDBA 3QWAA 1HDYA 1N1GA 3SXPA 1HSZA 1VI2A 2NNLD 3RCBA 3BIOA 3DL2A 3ENKA 2CVOA 1G0NA 1TT5B 1QV6A 2JL1A 1SOWA 3DBHB 3D0OA 4TROA 4ZQHA 3E1KA 4R16A 3WYBA 3IUPA 2HCTA 3U4IA 3PHGA 1CEQA 1U9JA 2HLPA 1YQDA 2IE0A 1HWYA 4RF2A 4U0KA 5DBGA 3U5TA 2A94A 1HLDA 4URFA 3NDIA 4KWIA 2VZ8A 5THKA 3JQ7B 4CV3A 2O7QA 3SLGA 3RD5A 4OSOA 4RF4A 1JWAB 1SZJG 1ZXBA 3TF5A 5IN5A 4BKPA 3LT2A 4YT4A 4F46A 3WX0A 1B26A 2B35A 2V6GA 2C7VA 3ZNPA 5KVVA 4BNWA 4KMSA 3ICCA 3MTGA 5EESA 1V6AA 2BFPA 1FMCA 1PJBA 3H9GA 1BVUA 3GUCA 3W6UA 4MVJF 2V65A 1Z45A 5K0ZA 3QV1A 5T6BA 4YJGB 4Q3AA 1GD1O 3DBRB 5A06A 1EVIA 5JFOA 1LSJA 4D44A 4C7KA 1DIGA 5IFLA 2D5AA 1D1SA 3LK7A 4E5YA 4AJPA 4DL9A 4H15A 2FZEA 3BZUA 3VZSA 2H63A 4B8WA 3I9LA 3BMNA 3GK3A 3F4LA 3D3WA 1B14A 2X6TA 4WASA 2ZB4A 4JBGA 3WGZA 3WJ7A 4I9UA 5KCZA 4KOAA 1MX3A 4MVJP 4WPGA 4ALNA 2AMFA 5FFFA 4HFJA 4S1VA 4DYVA 3ROMA 2Y1FA 3PPIA 3FPLA 3WTCA 1YQGA 1ENOA 3PQEA 4OIMA 3VKVA 3GVHA 2JD0A 3HB4X 3I52A 3I6QA 4M89A 4DA9A 4XB1A 1JKFA 3UFXA 2QYTA 4XRRA 2BI8A 2Z1NA 3C7CB 3G79A 1PJTA 3DOOA 4R68A 1ZO8A 2GSDA 1RM3A 2J3HA 1X13A 3GLQA 2GR9A 2NU7A 1R66A 2X58A 4PLPA 4B7XA 3PVZA 1HT0A 1CYDA 3PYMA 1P1HA 4XQGA 4CUKA 4FBGA 3KBOA 1RWBA 1GUYA 2UAGA 1A9ZA 5JO0A 1SB9A 3FTPA 4R54A 4AL4A 1VSUA 3O38A 5TT0A 1EDZA 1DFIA 3RSHA 1HE5A 3G0OA 5T64A 1P1RA 3AUAA 4FR5A 5DNAA 3L9XA 5JYEA 2Q2QA 2NU9A 3OA0A 2FR0A 2ZB8A 5CDUA 3ITDA 3VDQA 3BTVA 1HE2A 3QQPA 1WDMA 4CLEA 3QVSA 2DFVA 3INGA 1SMKA 2J3IA 5L51A 5CDGA 5IDWA 1N2SA 1NFFA 3WLEA 3KSDO 1MC4A 4KDEA 3MTJA 4RLSA 3VVBA 4EJ0A 5ILGA 4NU5A 2FZWA 1JQBA 5G4KA 5TX7A 2IEBA 3GVIA 4FFNA 1PJSA 1Q7CA 2DTDA 2ZCUA 3VH1A 1PL7A 3WQSB 5COQA 3OQ1A 4BO4A 1PR9A 3FRJA 3JQ7A 4P22A 5DCUA 3OJ0A 1EDOA 3VTFA 5T8KA 1R37A 4NR0A 5A9SA 5KNLA 1E7MA 1VJ0A 2O7SA 4NH4A 4RPGA 2BFAA 3DBHA 3EDMA 1I2CA 5TSDA 1QYCA 2BFOA 3LYLA 3NTOA 1X7HA 3RASA 1BG6A 2LDXA 2VUTA 1A4IA 4GX0A 5HA5A 2P91A 3MZ0A 1LNQA 3OM9A 2X7HA 2C5EA 4BVAA 5AVOA 3GGPA 1PL8A 1XGKA 4CMJA 3RJ5A 3S2IA 4BIIA 1E5QA 5C3MA 1ZSVA 3KUXA 3BHJA 3ZDFA 2PH5A 4GVXA 4JNKA 1A27A 1QRRA 1JKIA 4ITUA 2V6BA 2R2GA 3OMLA 2HMVA 3FHLA 3RU9A 1T1SA 1NX6A 3GUYA 1AHHA 3HG7A 1D7OA 4E3ZA 1EFKA 1EUDA 4RPJA 2Y66A 1ZJYA 3QA9A 1DOHA 3CUKA 4IDAA 3B1KA 4OQZA 3RUFA 3V2HA 1GDHA 4J4TA 4ZN6A 1EBFA 1T4DA 1O0SA 4A10A 1M6HA 1CQJA 3PJGA 1Z6ZA 5CEJA 2J5KA 2H1SA 3SX2A 2I9PA 3FWNA 3L4SO 4U5QA 1U2GA 3AFNA 2X5JO 1ZBQA 3JQBA 4ZICA 4HY3A 4EUFA 3PFWO 4E2WA 3ONDA 2IXAA 2VYND 4RZHA 4YAEA 4BNFA 4RVUA 4CPDA 4N5MA 2JCVA 4LSMA 4E5KA 1GYRA 5L7TA 1CIVA 3VH3A 3Q9NA 3OF2A 1NYTA 4YRAA 4R4JA 3GEGA 1GV1A 1GYQA 2DTXA 4CMIB 5C7LO 1H93A 1PWZA 4J6FA 2B4RO 3UCFA 4JCOA 2C07A 3TOXA 3PHLA 3TOZA 3IJRA 4YT8A 4ALJA 5ER9A 2Y05A 4DVJA 1DEHA 1WZIA 4LK3A 5TS3A 4KP7A 1NBOA 3LU1A 4J1TA 4BO5A 1X0XA 2ZTMA 1K5HA 1DLJA 3N74A 3PIDA 4GKVA 4ZRNA 2HMSA 5JAQA 4BV8A 5CDTA 4CMEC 1GPJA 1AE1A 5AYVA 3JQCA 3WTBA 2O48X 4NFSA 3ZV4A 4R1TA 4P8RA 4DQUA 3ONEA 1P1FA 4CMEA 4QO7A 3MOGA 3OJOA 1E3SA 4I9NA 1G1AA 1R16A 1ZW1A 4N18A 5DF1A 5CPFA 1R0SA 1SEVA 4XYLA 4E6PA 3MJTA 2VT3A 3V2GA 4MVJH 4B8ZA 4YJHB 5F21A 3ENNA 2VHYA 1MLDA 4J9VA 1NNUA 2AHRA 3F46A 2Y0CA 3EYWA 3S2GA 1SC6A 1HTBA 5LDGA 2QQ5A 1K89A 1B7GO 3BA1A 3I6IA 3Q6IA 4J43A 4YJDA 1JLLA 1ML3A 2RHRA 1YB4A 2PGJA 1ZK1A 1Q7GA 2AEMA 2OZPA 2W4QA 3EW7A 3GN2A 2RHCA 3GR6A 4LRTB 4NK5A 4TMFA 5JLAA 4BNGA 5EIOA 1Y1PA 4PLVA 4UVEA 5HWSA 4FJ2A 4MVJD 3A06A 4CLRB 5EERA 4P4GA 3HFSA 1YDWA 1PX0A 1XCBA 2QYSA 4FC6A 2DVMA 2Y68A 4S3MA 3AK4A 1YS4A 3GVXA 1W0CA 5IDYA 5T5QA 4OH1A 3EHEA 1E0DA 4KDFA 3A28A 3ANLA 4NJOA 5IN4A 2QRLA 5JY1A 1I3KA 5ILOA 2VYVD 4CV1A 3AUTA 4HFMA 3MJCA 4XWYA 2EP5A 4J1QA 4CR7A 1NPTO 5IXSA 3QP9A 4BNKA 3FR8A 3Q11A 1DSSG 4E12A 4NU6A 4C7JA 4XRGA 4CL8A 1T2EA 5HTOA 5TJ9A 4BNYA 2X9VA 1UXHA 3LDHA 5L45A 4BQPA 3ZWAA 4R01A 4UULA 5JAMA 4IGFA 3ROKA 4N7RA 4BUCA 3DBLA 1X7DA 1E1KA 1KY5A 3QWBA 4UUOA 1PJ3A 4BNNA 1JVBA 3LF1A 2ZJ1A 3NT4A 4JX8A 4J2HA 1Y8RA 3VHRA 1DHRA 1HXHA 3PZRA 4H7PA 5TC4A 3NDRA 3DHYA 2Q1UA 4IDGA 1B15A 1E6EA 3GDFA 4Y67A 1NQOA 5COBA 2CZCA 3WXBA 2QX7A 4I9HA 3WGTA 3K5PA 5I8ZA 3TWOA 1B8PA 1ONPA 4QFCA 4WUVA 3GNQA 2EGGA 2F1KA 4NBWA 4JJFA 3S2FA 1NFQA 2NTNA 2FR1A 5JAIA 3WNQA 1XEAA 4IIUA 2G1UA 4M49A 4AG3A 1Y8QA 4MO2A 4A27A 2ZKLA 4BNVA 3HZZA 2NWQA 4KQXA 3ZWVA 1E6WA 4D42A 1T2DA 3H65A 4NFHA 3IL2A 3GT0A 4BNUA 4A5OA 1RYEA 3CZRA 4BS9A 1GYPA 3JQDA 4JJIA 3D7LA 5EQDA 3RC1A 1KVTA 3RROA 3BAZA 3NDJA 2NSDA 1J5PA 1HDOA 1I2BA 3W4JA 3VPGA 5JDIC 4BO2A 1KETA 4MVJE 4JQCA 1K3TA 1F17A 1DPGA 3TZHA 3ABIA 3F5SA 4L74A 3IC5A 4UUPA 2CF6A 2HK7A 3GZNA 1MB4A 3LQFA 1NVTA 1JAYA 1XLTA 3C1TA 2X23A 4OKIA 5FEUA 1DAPA 4E5MA 2XOXA 4CMKA 4WLEA 3MJ4A 1UP4A 4U0JA 4YAGA 3MWDB 1TT5A 3KLPX 3KEOA 4XYMA 3M1LA 1X7GA 1V35A 3PZBA 2ZJ0A 5BNFA 2I99A 4XDZA 3ZU5A 3GRPA 1W6UA 4TKLA 1P0CA 3FCOA 2Y1EA 1YRLA 5DT9A 3UCXA 1I10A 1PGQA 5CDYA 1U28A 2P5YA 4QFDA 1LDEA 3PJDA 3AM3A 3GMSA 2OMEA 4JN6B 2IODA 4UUNA 4BKUA 1QSGA 2YHIB 5A04A 1C0PA 3GAZA 3CXRA 4M1QA 2IEDA 2QZZA 1IZ9A 3CKYA 4CLDA 1D8AA 2RIRA 3L6EA 3VPSA 5H81A 1ISJA 1P45A 3HFGA 3W1VA 2W2LD 2OFPA 3GMDA 3PGXA 5F1KA 3UICA 4J49A 4GWGA 4O5OA 1HDRA 3ETGA 3QW2A 3RUAA 5C7OO 5THQA 2IYOA 2FMUA 4L75A 1C0LA 1PGJA 1NQAO 4LVUA 2GN8A 1TI7A 3RWBA 4FOSA 4J1NA 3T7EA 5F1PA 3NT2A 2GZ2A 1DIRA 1PWXA
chains in the Genus database with same CATH superfamily
4ZU1X 1A5SB 3FTNA 2HXYA 3KE9A 4F5WA 1PSZA 3ND5A 1R12A 3JQEA 3D6VA 5IJ9B 5CNIA 1RW4A 4KO8A 1P9LA 2UVPB 3LAWA 1E62A 1C9NA 1KDTA 3M5WA 1I33A 4S0ZA 4RHFA 5AJZA 4TGLA 2D54A 3PFBA 2O5EA 4WZAE 1HLPA 2WICA 1QO0A 3A6HA 3KPVA 3RTDA 3UJAA 1S7GA 3DUWA 1CW2B 1VYUA 1ZY2A 2FPUA 4ZOLF 4RGYA 5IABA 4G1BA 3FTFA 1V1RA 5EQJB 3S3TA 1JQKA 5TQ2B 4MIKA 3UN1A 1WW3A 3LD9A 5KOHB 3FPFA 2BH9A 4LV5B 4BP3A 1SEPA 2YY7A 1L7OA 2W83A 4MKXA 3T6KA 5KYGA 4G86A 1ESDA 3VUFA 4TTVA 3L79A 5GY7A 2DQKA 5T7BA 1ZLYA 2EEZA 3ASVA 3DVAA 3E61A 1UM9A 3MQFA 1P8JA 2DT5A 3FPCA 1YFKA 1ZM4A 5ITZB 1NOIA 4ER5A 3OFJA 2I4IA 4CW7A 3CUSA 3DEHA 4JASB 1UPCA 1E2HA 1XJ0A 3RREA 2W8BA 1R10A 3BRWA 1SXGA 3QF4A 3KX2A 4AF7A 4KO1S 3EPHA 4JLBA 5J2UA 1T6YA 3U4CA 1X38A 1E2NA 4BFYA 2JAOA 5M04A 1SBYA 1Z5WA 3QELB 4WBNF 2J0VA 1NBHA 3IR7A 4DF3A 4NPCA 5B1EA 3N2ZB 4INPA 4YUAA 9GPBA 1DCTA 1DAGA 3FCCA 1ADGA 2XUFA 2X19A 4N41A 3G0CA 3L41A 5EYPA 4AW9A 4R9NA 2JBAB 4W8HA 1RYDA 1OBFO 4OU4A 3PX2A 2ZZNA 2RKWA 3V4ZA 1KAEA 4GOND 1Z22A 1UBSB 3DLPX 3ADOA 4Q93A 3EQ7A 2NO9A 3RSLA 1HG0A 2WINI 2AFIB 2QLFA 3GLUA 4DJAA 1M0EA 4EHLA 1O87A 2R6HA 3L7KA 3ZIAA 3Q9SA 4JITA 1GL3A 1I51A 5JCXA 2FUCA 1QZZA 2A4KA 3FG9A 2G0AA 1W47A 2K2WA 3C3MA 2IHJA 1RTTA 3LQ1A 4KJZA 4O4HF 1HEYA 4ZV9A 1GPDG 4RZIA 2O3SA 2G4LA 3E5MA 1DRUA 1KTVA 4PIPA 3NWBA 3HVRA 1JIJA 2XHZA 1QO9A 3EPLA 3CNQS 1P9NA 2WDPA 4U9IS 1T0BA 1CUCA 3D2BA 3ZZUA 3GGGA 1P80A 1I1OA 3BSSA 4G25A 1E2LA 1QIKA 3PBKA 4G0OA 5JQGB 1K8ZB 4ENVA 4F3TA 2WF5A 3DLAA 3GNTA 4FKZA 4R1SA 1C30B 3BCRA 1P5FA 3K0HA 3CRMA 3R5KA 4EY3A 4KH1A 1OC4A 1WHTB 5BR7A 1DXQA 3C3BA 1W30A 1Y42X 2FFJA 2X0RA 3F6RA 4M6WA 4WL0A 5LQSA 4B9AA 4MIOA 4D4HA 3OQNA 1N5MA 2P6PA 3N0TA 1M7HA 3R5FA 3E5RA 1D2MA 1CQPA 2KWIA 2XDQB 3H99A 2JFWA 4GPAA 4WHMA 5A62A 1UBFA 4QNMA 2VJQA 4KXLA 2QVXX 3Q5DA 3K6SB 3GMIA 4BV9A 4DEVA 3HP7A 5ED4A 1ZICA 1N0WA 4Q9IA 5EXSA 1VJRA 4NG4A 1FU4A 4RD6A 1MVLA 5K0NA 5LN1A 3TDMA 1YJXA 3QEMB 3QYFA 1S02A 4Y9TA 4NBUA 1O6BA 1YVRA 1F9AA 4R9RA 5KQSA 1AT1A 5DXAA 5E6UA 3G7SA 2ZBQA 1K6JA 3AERA 4CKZA 1PUXA 2NX2A 2UVQA 2WTAA 3GFFA 4XXHA 1L5HA 4IJ6A 1KEWA 1VMEA 4L73A 5FB3A 2JI4A 2VUHB 3AI1A 2XJ9A 5LP6A 1PNOA 2EIHA 2R1TA 2G71A 4ABYA 1CNMA 1DWUA 3OEWA 2QRKA 3BWYA 3F90A 3L0BA 3PQFA 4QLAA 1YI1A 3ACDA 3MVEA 4KYTA 3UXMA 2DWQA 3V55A 4QVIA 3GU3A 1WV0A 1DZ3A 1RRFA 5HKKD 2LXNA 5HQ3A 1GAJA 2FPPA 4FFDA 4FMDB 4GG1A 1JT9A 5EZYB 1KORA 2ZCVA 4HZUB 4C7OA 1Z5OA 5AOVA 1SOUA 1HC7A 3NHMA 1Y9JA 1R5JA 3UWKA 4TXHA 5HFJA 3OLCX 2PD3A 3L18A 4IINA 2C20A 3ZWOA 4L7VA 4TQUS 1M6YA 3IILA 4JODA 4AY4A 1N2CA 3IIKA 3WNCA 4YXWA 3DE6X 4JI1B 4D45A 1H65A 4GRAA 2FSHA 2ZTSA 2CJYA 1W6RA 1WHSA 3QVTA 1T6XA 4S1TA 3DKPA 1H5NA 4TVOA 3AVVA 3K70B 2ZE6A 1KI9A 4ZCSA 1T5OA 4F97A 4TYQA 1NN5A 1I5OA 1IEXA 1DBPA 1I24A 2WMYA 1HEIA 5DP2A 5CEFA 2BYTA 2PZLA 1FC0A 2V5AA 5GZ1A 1SKYB 4LZPA 3EMVA 4MKZA 3OKCA 5LZ7A 3ZXIA 2AKYA 3EDRA 1PZFA 4JYPA 1FP7A 2C2ZA 1K1EA 1KO5A 3I5UA 4TTAA 2ZBUA 5LP6F 1UKBA 2QVZX 4EVQA 3W4IA 1S2IA 3LA8A 1IDN1 5C18A 4LF6B 1VBMA 3K2QA 3IUJA 3O1HB 4BDTA 3PDHA 1JHQA 2AFVA 3HNPA 3AJ8A 4K3UA 4LC0A 3KB1A 3H2IA 4XH9B 1IOWA 2Q5LA 2BKEA 5D7BA 2E4UA 4Q3KA 2VTBA 1A9OA 2XQIA 3I0NA 1UZNA 4IZHA 3EOBI 3AMVA 3HR8A 2B30A 5GJCA 2XXAB 3WGGA 2UUBB 3C6KA 3GH1A 4FD3A 2J0UB 5CK5A 3T06B 2VJCA 3CNHA 3S28A 2IBSA 2H0RA 1UEJA 2H1CA 1H23A 3GLIB 1GRQA 3D31A 3IP7A 2VXYA 2QMQA 5K8LA 3D59A 5IYZA 4C4OA 4C0JA 3RC9A 1OT5A 3LWNA 3W90A 2O3JA 1W2HA 1NBMD 2HWXA 3WLNA 3BREA 1K7EB 3OPQA 4KQCA 1R0WA 3Q2KA 1W5EA 2D1SA 2ODAA 3JTMA 2ZWVA 4ZHSA 5D3QA 1J2YA 3CZPA 4J90A 1KQFA 2FN4A 3X44A 3LX4A 1ZISA 1JBQA 2EJWA 1G8GA 1FJHA 2A8YA 4C29A 1IM8A 4GNRA 4QGFA 4WEOA 4YECA 1G7SA 1DRWA 1UT6A 1ZA1A 4BVGA 2DR0A 4OQYA 4EB8A 2XT0A 2YWXA 4MRRA 3P7MA 1K5DA 1I6MA 5F5XA 2DQYA 2WD9A 3LWZA 2GSWA 2I33A 4MWEA 4UPVA 4KODA 3UG6A 1TZBA 4JLVA 3SJCA 3TIVA 2XRFA 5AQEA 3B2NA 4PAOA 1GQYA 1PFUA 3A9CA 3KSZO 1QR2A 2QYHA 1KF0A 3BWEA 3OPYB 4MYHA 3SBDA 5K03A 3SEQA 1QP8A 2Z04A 4YRIA 1K4YA 4C20A 4RPIA 1UOEA 4D9FA 3HUDA 5AKEA 2X41A 1E3QA 2CUKA 3BILA 4K9RA 1JIIA 2PL9A 2ZSAA 4QDOA 4AJNA 5L3QA 3GVPA 1TVKA 1NVXQ 2VC2B 4KAXA 1D04A 5YASA 2GD0A 3N8NA 1L7BA 4CTJA 2YNMC 1G64A 1MG5A 2XNKA 3KVOA 4F4JA 4I4TB 4EVIA 1TA4A 3H8SA 4X41A 5HRUA 1FY2A 2WKSA 3AH8A 4J75A 4ZQGA 3DVRX 1TK2A 1Z34A 1SCNE 1FYWA 1CUHA 2HNKA 3C1UA 2XZPA 1UKEA 3OIVA 1QVAA 1U4NA 1X7XB 2F1IA 4PRZA 1MAHA 5HIJA 3VNAA 5H4GA 3F8SA 2GNPA 2E7ZA 2OO3A 5FV4A 1C41A 2QAGA 4TTQA 5BMOA 1KOFA 2YFHA 4YT2A 5IJ0B 3WSVA 1JAIA 3D0KA 1ZLXA 1NW3A 1RBYA 1E7QA 4PBRA 1YQEA 3AUUA 2YJZA 3L82B 4FNAA 3VHXA 4BBPA 1E7WA 1V96A 4P6VF 2WWRA 3K4PA 3BHMA 1PG0A 1ZM3A 4CG3A 3A26A 1Q50A 1ENYA 4JS0A 3BD8A 5A7HA 5CDSA 2QUAA 4CEHA 3HFRA 1FVXA 4C0KA 1YKSA 3QVOA 2Z2YA 1BN7A 1M5UA 2CZQA 2J08A 3NRCA 4YASA 3X1KA 4BAZA 4EG4A 2C2HA 1PJCA 1RI5A 1TM7E 3CJTA 4Q3LA 5AHXA 5KTSA 1UFQA 1E7YA 1NVBA 1YB7A 2RGYA 2W2TA 1EUCA 1P6XA 1G291 1Z8NA 5HF5A 2KE5A 1Z18A 2OB2A 3G5TA 4EW1A 2FN3A 2G8LA 3B6KA 3QUBA 4HNAB 1E2MA 1XIVA 3GH3A 4QDKA 1YU6A 1YZ3A 2HRZA 2PCLA 4LOIA 3UJ9A 1SG6A 4IYRA 1ADFA 4X8OA 3RSSA 1UIRA 1ETHA 4R7TA 4LY6A 4U3JA 4UU0A 3THRA 4BN0A 1XU9A 1FJXA 1A4UA 2SKDA 4RW0A 1NXQA 3S70A 2O8DB 4YMSA 5KYUB 3VKHA 1L1QA 4UBJA 2PQ0A 1KDYA 3H8WA 4XQCA 1MORA 1HORA 5E1DA 1EHIA 3V4PB 1W34A 5BNWA 2OUIA 3HABA 4NEHB 1XDWA 2O6HA 4U8HA 2AN9A 3REFA 3AOEC 2FE1A 4GICA 1QYDA 3EFOA 1IY1A 3RJ9A 5JMTA 3QWIA 1UFRA 2DYKA 4E2ZA 3U61B 1G9TA 3JPWA 4CDNA 3U3OA 3CNLA 3H87A 4UE3S 3TQFA 5GJWC 1OYVA 5HZKA 1JF8A 2GO7A 2RFLA 3HJUA 4J0DA 2VZEA 3BGDA 4LCJA 1WM1A 2PRKA 3TTWA 1KY4A 3QRWA 4F45A 5GVRA 3E15A 5CT8A 3IR6A 4F3YA 3M1AA 2WG1A 3EVBA 1YB5A 1ZVKA 2MHCA 4CF7A 2N46A 3H5RA 2YYSA 1PK9A 2W37A 3CEHA 2FETA 1KO8A 2VDQB 3HKBB 4LPSA 5ALWA 3U7EB 5ICMA 4E94A 3VKUA 1RRPA 1DO0A 3HGMA 2PX6A 1L8OA 2N1MA 2INGX 3EWNA 3ZE8A 3G2LA 4V24A 4W9NC 1QIMA 2I62A 3F6PA 5G1PA 4CNBA 2EKPA 3PGLA 4OF4A 3TZBA 5KX5A 4JNCA 1SC3A 4RFLA 3UKJA 2ZBVA 1ILEA 1WP4A 1XCPA 2WQZA 3P2YA 1Z38A 3RC7A 2DY1A 2ON6A 4ZCPA 1KMNA 1UM8A 1U0JA 5JMWA 3UUFA 1JFLA 1WR8A 4HB3A 4BFZA 4YCLA 2RJNA 1B41A 1WQ4A 3NJ4A 4NCXA 4Q9HA 2V97A 5HRAA 3HY4A 1A2QA 2IITA 4D8XA 2BZGA 3MIZA 3ORQA 3QOWA 1H2XA 4PINA 5TPZD 4BQQA 3ZWXA 1FFYA 1I3OA 2RHJA 2PWBA 3H11A 5ALEA 5TQ0B 2VHJA 1AUXA 5ER6A 2NQ2C 2Y0DA 5DOVA 4X91A 5SYAA 1H1TA 1KL7A 4CMCA 2PUEA 3ORYA 2J7PA 2WWWA 3B1XA 4LXQA 4WX2B 1LUAA 1WW8A 1MOSA 4BQEA 2DQ4A 1BD4A 4NYMR 2RHOA 4IH1A 4I4TF 2EXXA 1Y1TA 3MS4A 1Z63A 2JFBA 3KL2A 4A7PA 3HR4A 1EWTA 1T5HX 2LW7A 1A8UA 1NBMA 2WVJA 3ZY3A 4B87A 4CM5A 6Q21A 2CV1A 1J24A 2Q28A 4RORA 1R5NA 5JVDB 1MQSA 2YV1A 3DYIA 6ABPA 3WA7A 3CCCA 3KZ1E 1H6AA 3K5WA 4XJVA 1FDUA 3A05A 1LQUA 2AOWA 4OBBA 4LECA 1OD6A 3RSFA 4MCIA 2QPAA 3I30X 1E1CA 1PYOA 1UWLA 2J0UA 3PCTA 3QE2A 4GZMA 1V95A 3PQ8A 4XOIA 3RH0A 3ZBPA 4B73A 3RNOA 4MQEA 3SNHA 2XGSA 3KKEA 1WXEA 3FNHA 2C57A 3BX1A 4G1MB 3OE1A 3OZIA 4BFTA 5IDXA 1O03A 2YIMA 2GPTA 1XP8A 2FEPA 3O03A 4DRZA 2YJ3A 2GCGA 1K2VN 1MG0A 3AINA 1VSBA 2GRAA 1FZQA 1QO7A 1K7XB 1RPNA 2D0DA 4G97A 4KAJA 2ZRBA 4W9MC 1NKTA 2AFHB 3VR5D 3GBSA 2A86A 4JIGA 1GPLA 1Q74A 2CDCA 2Q5JA 3G2OA 3CEMA 4IJ5A 4MKFA 2Z1DA 1H8HA 4PXYA 4BVBA 1NR7A 3ADKA 3OM0A 5ALMA 6CHYA 4KO2S 4ZAYA 4QJ5A 5ADVA 2MDTA 2VSXA 1H1LA 3OKFA 4D7AA 5JXWA 3DB1A 3MOIA 2Q1TA 3LOQA 2FQQA 4PXSA 4KQWA 1K8XB 1QLHA 2VDPB 1IQUA 4LZNA 1F4PA 3RBAA 5LKRA 3IXMA 4EAAA 1ND6A 3W5UA 2R9VA 3BFXA 1F6WA 4H1UA 1X74A 2AYYA 3UUWA 1C3XA 4AVYA 4BO0A 1EMDA 1U1FA 5B57C 1Y5NA 1T4CA 2XECA 3H19A 3KQSA 1D8TA 1AF7A 2GARA 4HGNA 1JAXA 4IDOA 1MFZA 2WM9B 2YN4A 4R9UC 5CW2A 2ZSIA 3G2KA 4G1CA 4J3JA 1EZ4A 5KTNA 4K9SA 5IF9A 2CCKA 5DULA 1ZL0A 1G63A 3X2FA 2WAOA 3U7QB 2A6PA 3V33A 1QMGA 2GF2A 4OAPA 5TR9A 2BKVA 2I1VB 3WGMA 2DLCX 4F8JA 1W0KD 1CB0A 5IBQA 2R6AA 4O63O 2PG3A 2P9BA 1GKKA 1LKZA 1UXGA 2YN2A 3HFJA 5I8WA 1CU1A 5K3FA 1U63A 2TMDA 1LSSA 1KZ1A 1RXUA 4LJ7A 1XN1A 2L42A 4IEEA 2CD9A 2J9FB 2IU3A 5J4VA 3IODA 2X4GA 2YNMA 2XD9A 2F43A 3W4KA 2J5RA 4W5TA 3KXKA 4HSEA 5TS2A 5I9LA 2X5NA 1L5HB 4IO1A 1RKXA 2Z2IA 1J06A 4RENA 3LKVA 4KQJA 5FA8A 3V8NA 2QMZA 3AR2A 4QSHA 5E6UB 3VPBA 4FTWA 5LB4A 3OWXA 4MIEA 3W8NA 1YL7A 3H5AA 3HDHA 2PD4A 1F06A 3OTQA 2OCAA 4W7IA 3A4LA 3E6AA 2IZ0A 3QEMA 4HNVA 5IZ4A 1YFJA 1E1NA 4I4CA 1LZLA 4QFBA 4KNYA 3H84A 3PV0A 4L6AA 3STUA 3WWYA 2VP3A 1KVSA 4Y2RA 3AEQB 2HH9A 4ZD6A 3TL6A 4F6RB 3QLVA 1AUOA 4W6ZA 4OQLA 4AJOA 1ISMA 3DDOA 3PX7A 2ZUEA 4G4GA 1DINA 4TL7A 2HEGA 1TU4A 2Z5LA 1WP9A 2AZMA 3HI4A 4LJ4A 4B3FX 3L0ZA 3G89A 4IIEA 2ARKA 1H0KA 4OJTA 1QP7A 1QRDA 4G5YA 1U7ZA 2C1EA 2EG5A 2F3RA 2CC2A 2XDWA 3LCVB 4KQ6A 4R3NA 2GN1A 3IA2A 4MWGA 1E3LA 3VMFA 5LD2C 2O8EB 1LDMA 3P2IA 4V39A 5AKZA 1CUZA 1VCOA 1J25A 3AV3A 3K9CA 3Q8XB 4KIJA 5E4TA 1YJCA 3G2PA 1YF3A 1QAOA 4GOLD 1FUIA 4U2FA 2Q7DA 4H6WA 2WJPA 4UHFA 2CSUA 1QH1B 2ZBGA 3W2GA 2R68A 3M6UA 4LRSB 4G3XA 4NPHA 4YV7A 2XOKA 4C0BA 2GILA 3C45A 3LCRA 4JLWA 3FI0A 3N2GA 4YRQA 3HDYA 3IAFA 4ETWA 4R7ZA 1VMDA 2PDAA 4OKNA 2YZ7A 4OM7A 3SHOA 1CEEA 1IY9A 3T5CA 4UUBA 3DMGA 4XIJA 5AJXA 4DV1B 4F96A 3PGVA 3IR5A 3T4XA 3OC6A 4D79A 5B2ZA 5JHGB 1C9JA 4II2A 1JR3D 1O54A 3IULA 4O2AF 3J81A 3CJRA 1LB1B 5I7UA 4Q3OA 1MX1A 3MILA 3VOAA 3C74A 2PCJA 2XA1A 3A9VA 3S1AB 3WMGA 3RAFC 3VQTA 4L27A 1XMVA 4LTDA 2H9AA 2HSGA 4DKJA 4P82A 2VAMA 1TTQB 1TEHA 4R1LA 1LY1A 2BVNA 1I1NA 3OAAD 4E31A 4X45A 3KHUA 5FUWA 3L0DA 1XXHE 3L8GA 3OX4A 5FT9A 5G1OA 5KWSA 3UKOA 5THXA 1B0AA 3W2TA 5I3ZA 3DVAB 5ITZA 2A92A 2OD9A 4OBXA 3RSCA 4BYMA 3KQPA 2D5CA 3TRIA 5FNZA 2GRJA 2ZJ7A 4MNTA 3WIOA 1UK8A 2P5UA 2X4DA 1DDGA 1R4MB 3BKXA 3JYQA 3ZU3A 4NBKA 1XZQA 4GAEA 2NSHA 2HA0A 4LZLA 3JQQA 4PCAA 4Y7CA 4DV0B 4AJLA 2BM8A 4BZZA 3GLGE 1ZN9A 3DMTA 1EG7A 4RD1A 1QRAA 1KVUA 5IXYA 1BS1A 1C1YA 1ORHA 4MUGA 3HMKA 4QU8A 2QMOA 4EHAA 3CW9A 1M73E 3EFBA 4L5CA 4OOEA 4RKQA 4AJ9A 4YQFA 2NM0A 1ECJA 4TT3D 3W7VA 4AYWA 1G8FA 1N9GB 2HNAA 3QNUA 3I04A 2UVPA 2HBYA 2OHHA 1FIUA 1NX9A 1Y63A 4ZVSA 3FUWA 4O3MA 1U9CA 5JXHA 5E7QA 1CUGA 5AW1A 4AJJA 2JRLA 5EIHA 2QG6A 5KAPA 3D8NA 2O7NA 3KOXA 1C2YA 5ARDA 1F3LA 3TL3A 5AIBA 3NHLA 2FEMA 1P1KA 2HSJA 5KHOC 1HDGO 3QX8A 1W36B 3N0VA 3R76A 4CM7A 2PLAA 1OJ7A 4KRXA 5EWJA 5EKXA 4LF8B 2C4MA 4F11A 4PHHA 4A6XA 1P29A 5IVHA 3A1SA 1PSDA 2BM0A 2GLUA 2XVXA 3DGFC 1OXTA 2V54A 3KO8A 1Q0TA 1OBOA 1IN8A 4YCNA 2ATCA 1CUUA 1CS0A 1Z7EA 1ZHHA 2G25A 5CJPA 4Q3NA 1UJMA 3IVCA 4GM4A 4A2WA 2BKLA 4RWEA 2W6MA 3JQFC 3M34A 1YC2A 4BC0A 4F6CA 3FLMA 1PL0A 2WYHA 2P9EA 3M6IA 4AG5A 4BHTA 5JCJD 5B55A 2CXHA 1IWPB 2ZU6A 4X6UA 5KTPA 4IV5A 3DTTA 4TRJA 4IHJF 2C7BA 5IZCC 4MEAA 3LIPA 3WQHA 3ZQKA 4D3DA 4EY8A 1VSVA 2FVYA 2XMBA 1XNHA 4RZQA 2MSCB 4LI3X 1JXAA 2GYUA 2XLBA 2WTXA 2GZ1A 4R8VA 4WVLA 3KOYA 4XSVA 4YR9A 2JKVA 3SYKA 5CNJA 3TZQA 3T4UA 1CQIA 3ZVNA 3R6DA 1FFBA 1VPDA 3FVTA 1D5WA 3IHTA 4YUZA 5DISB 5KVSA 2NQ8A 4YAFA 1MHTA 5DBEX 3I72A 3EJWA 2J3KA 3KHTA 1RJWA 3A25A 1ZUIA 3DEYX 2W2LA 4FINA 3GZNB 3ZWNA 3OEEA 4FDLA 5DLPA 5L3ZA 5KWVA 1YRQA 2YC2C 3K4QA 1JDUA 4FQ5A 3SEFA 4KZPA 3SJ7A 4D9KA 5A7FA 1CF4A 1SCUA 4L28A 2R1VB 3T34A 1LRJA 4UTVA 1XAHA 2PX0A 3A6KA 3PGJA 1EE2A 4TWIA 5ALZA 4EYQA 4F6RA 2G7ZA 1P2VA 4RBNA 3TVYA 5LQCA 1WVGA 3MJFA 4MYDA 3R7SA 4ADSG 1ZK3A 4QICA 1P39A 4MWBA 1K4MA 2FW9A 3OLXA 4ZEXA 3LZ6A 4EK9A 1B8OA 4PHTA 3RARA 1IVSA 4FFRA 5CCXA 2ZRKA 3EIUA 4ZI2A 3N59A 4KN8A 1FLAA 2F8LA 1X1BA 3AF0A 3M9XA 2CJPA 1V9SA 5T3UA 4ZV7A 5I9NA 1JMKC 2HMAA 2H7CA 1VKOA 2H1WA 2VQSA 2YQ4A 1WRBA 1LPMA 1QG0A 1Y1LA 1DCKA 4BNZA 1JN0A 3PIRA 4XA8A 4RVSA 3SY8A 4HAWA 5I7HA 2TS1A 1PKXA 3E53A 2VP5A 4E07A 4A15A 5JJLA 5IJWA 5JZVA 1AQJA 3BXZA 4M60A 2I8CA 4G0QA 4O4JB 1E1DA 2R6FA 1OA1A 5B4UA 2PS9A 4GP9A 4K3VA 2XB2A 3GT3A 4R8SA 2Y2VA 1H05A 3GUVA 3MINB 4JJ4A 1PSWA 7REQB 1U6JA 2VYNA 3BHIA 4ITRC 4Y9RA 5HDBB 4D8TA 1JLKA 2ZRIA 1ZD1A 1OLSA 1S2DA 3A9TA 3ETNA 4MOWA 1GLVA 1V8FA 3X1ZA 3NMUF 2WD8A 1BKYA 2JFNA 3OZFA 3MT8A 4RE6A 2ZJAA 5DZSA 1Y3AA 3GA0A 1QXSA 3SDBA 1T4CB 4GT1A 2C0PA 3PXCX 1GCOA 4MR9A 3GPCA 3IP8A 1A9XA 4IFEA 1DB3A 1SXQA 4FB5A 5FWYB 3RHZA 1YDGA 1GR0A 4HWOA 1SU6A 1Y5MA 1Q3KA 3EXHC 1UEIA 4QJBA 3KVRA 4PQRA 2NQTA 2I2FA 2ZTUA 4MSUA 2AX4A 2I3DA 3V46A 1J2RA 4YLYA 3F8TA 3NASA 4QDTA 1MKYA 3LRPA 3NQ41 1H1LB 4M99A 3HYNA 4U2KA 4DHWA 5EJ6A 3SDZA 3Q7EA 3BK1A 1CCWA 3ZCSA 4WZZA 4QTYA 2Q7OE 2GXAA 2VTKA 3D9QX 1TKCA 5E3HA 1JHXA 1X7ZB 1WUHS 2IUFA 2BMJA 2R7MA 3E03A 1ML4A 4Y1FA 3U13A 1JDVA 3ZH9B 2ZPTX 5AUQA 4EB0A 3N75A 4OQFA 3OSZA 4B4DA 1YZVA 4NF2A 4ONEA 5CGZA 4DLRA 3A3KA 4NEGA 1LC0A 2ABWA 2QSZA 1BOFA 1JJFA 4MGEA 4MGZR 5FRDA 1RAEA 4BLTA 2HV8A 4FKBA 5EKSA 1PJ4A 1S1CA 3WKDA 4L8FA 4R6WA 2R7AA 1RYFA 4UVHA 1HE3A 3KV3O 3P20A 2A9JA 4H6PA 3B53X 4LG1A 4AS3A 2Q5CA 4EATA 1G8PA 2IZ5A 1CRLA 3CNBA 2O5CA 3PQ5A 4I1PA 5B7NA 5AOCA 2YZMA 1X80A 3LHDA 3QJGA 4I08A 2VXOA 1LJ8A 3ABQB 3FH0A 1W73A 4E13A 2QN2A 3IVGA 2X1MA 2J41A 3QEKA 1NMYA 4KXYA 2D3TA 2I2BA 4UVGA 1YZGA 5E0OA 3PNMA 3E9RA 1L5NA 4ZJYA 1Y9ZA 3KPJA 1PEYA 4ZRMA 5EINA 4N6GA 5JVDA 1FZTA 4AS1A 4AQDA 4DUGA 1E9AA 2FQWA 4E5UA 2XUPA 4ZYLA 4Q1CA 1YA8A 1ZCBA 4P5DA 1AQYA 1GGFA 2XX3A 3JV7A 1CY8A 1NG1A 1G2QA 1ZVMA 1YWGO 3DM5A 5KWIA 1OFGA 1JA1A 2GXQA 1JRLA 1C0IA 1ECFA 3D1VA 3BD9A 1W5BA 2FR8A 3EGOA 4GGOA 5GJVC 2ILVA 2P2CA 4EBFA 1VL6A 2ZBFA 3E22B 3EEFA 3G8DA 2ZYRA 3NGXA 4OXIA 3SSOA 1J07A 4NBVA 3ACBA 2OYCA 2JW5A 2WFLB 1ZEJA 1YS1X 2BEWA 5AVYA 4BMCA 1BDBA 2A88A 1RE0A 2JFQA 1GIAA 4RL6A 5DM60 4B74A 2GFHA 2DFDA 4W4TA 1JVNA 2IDMA 3GA7A 2JLZA 2CV0A 1I9CA 4YONB 3NG1A 4RGVA 4MB0A 1QGAA 2GM3A 4RS3A 3QMMA 4K1XA 5JS8A 2OP1A 3AI2A 1G5RA 5DLEA 4FT4A 2YBEA 4CV0A 1UPXA 1PZMA 5LMUB 3E7WA 1AM4D 4Q37A 1CR2A 1KU6A 3OY7A 3DNMA 3NV9A 5FJIA 3JQGB 1VL1A 1HI9A 1Y7LA 3DLIA 4Z3KA 2FX5A 1QQ6A 4N39A 3VZQA 4ZYTA 2K7FA 4FGKA 2Q2OA 1MOPA 4JMPA 5K3CA 2ONZA 1VG0B 3UJHA 1C50A 2DWPA 4DYDA 1DMRA 4FDAA 5COAA 1I1HA 1MOZA 1KYYA 3AR8A 2PBLA 1EQUA 1VOTA 3E3OA 3EVTA 1QQ7A 1XZCA 2LTAA 4GP7A 4RIFA 4Z3DA 4F6LA 1XCOA 1WLYA 5HTKA 5LQMA 3HCDA 4W63A 5CAEB 5J9FA 4E21A 1MAUA 1G60A 4JT9A 4MITA 2A5DA 2WHPA 3M5DA 5I7EA 1AO0A 1Q7RA 5FUQA 1NDHA 3CVYA 4CKEA 1H22A 5IHXA 1OX5A 221PA 3DEKA 1ORIA 3IQHX 3PXUA 1SXIA 2ISQA 2KSQA 2O4UX 3EIHA 3HU2A 1BSVA 4OI4A 3WB0A 4YFYA 4GSLA 2AEFA 1T3TA 1T8RA 3EMDA 1L5MA 4GPZA 4OFBA 1OC2A 1T1EA 5ALUA 3WWPA 3ON5A 3WYCA 3DOFA 1AZWA 3OQMA 1V43A 1IOZA 3FPSA 3H5TA 2E4VA 1B43A 3KE8A 3KXLA 3JQ8B 2E37A 2X8JB 3MTDA 4KH0A 3SMQA 1QQ5A 3ZZ1A 4CM4A 3K30A 2RAVA 5FOTA 4I8IA 2NU6B 3ZGZA 2O8CA 1ADCA 2H4HA 1AQUA 2OM6A 4B4OA 1LPSA 4PX9A 1P1JA 2HRQA 3A4NA 2C5AA 3EHDA 4IZ6A 2FZCA 3FPBA 4IZIA 3GGOA 4EHNA 1LGYA 4KR6A 3DC7A 5E9AA 4ATNA 2VHVA 3AEYA 3L0IB 3R9XA 2WJZB 3SEAA 2ONKA 1GGHA 1JE1A 2QX6A 2XDAA 2HO5A 2WHEA 3AY3A 4LZJA 3GLFE 1FE8A 1EWQA 1K5PA 3IUSA 2O8FA 1WNTA 3WLTA 4JB8A 4D41A 3VZCA 4LJYA 4O3FA 3KTAB 5FULA 4EG5A 2C4UA 2UYGA 2NO7A 1EFVA 2Z0MA 5J5AA 4KQ2A 4CN9A 1Z0KA 1QIIA 5EGNA 3C14C 3CWQA 3NVKI 5K8TA 3FMVA 3GAAA 1J90A 2WRZA 2OAQ1 2NZYA 5DJ5A 1FRVA 3INRA 5AVUA 1G4AE 3OCYA 2ZRMA 5IWAB 1C1DB 2ZAGA 2CN1A 3GLRA 5JC8A 3MJSA 1QB7A 1Z5GA 2Q9BA 5IVPA 4Y0NA 1ZYUA 4ZT4A 5A4IS 4Q4DA 4ZT2A 2APJA 2G07A 1BQEA 1XU7A 4J7UA 4WFKA 3T9FA 3DPUA 3RS0A 3GLKA 2DBYA 4B2YA 2SBTA 2VDVE 3HO6A 1R6DA 2Q4DA 3KSBC 1EDEA 1RWMA 4FEGA 5E6RB 2QTCA 1L1RA 5FWAA 3PU6A 4KW7A 2PT5A 1FYXA 1WDKA 4Q39A 1JTFA 1E5LA 4GOKA 1QTRA 4K6CA 3L7NA 2E1PA 1QO0D 5LNK6 5K4GA 2XE7A 2HJSA 4J0JA 1X1QA 3TIFA 4EB3A 2ZUBA 4RM2A 4OOFA 5ITSA 2NSYA 5KZMB 2ISCA 1D6MA 1XA3A 4M37A 3UMGA 2A4MA 1LDBA 3FX2A 5MDHA 1QOPB 2R65A 2WTNA 1VRWA 4K6KA 4H7IA 4P3PA 2VH2A 3EVZA 5EP1A 5HDQA 5I7FA 2BD0A 2XZLA 1TM4E 1SQ5A 1DWOA 2X9QA 5DYGA 4DIKA 1E6LA 3U7IA 1AD2A 4AZ0B 5B3KA 3KUUA 4CMBA 5LIPA 4ICIA 3ZCXA 1L7DA 3VPCA 4QGAA 5K4AA 3HJBA 5BMVB 2Q5FA 5HHTA 3ANYB 4QUJA 1RM0A 2RI6A 4LY3A 1N8KA 2G1PA 2KBEA 4AY6A 3E8SA 3NKLA 4DGSA 3OY2A 4ZOQI 1YZLA 1JU3A 4OUKX 2EW8A 4Y9SA 4C14A 1T8PA 2JJYA 2WJGA 3GZTB 3QVMA 5FNVA 3L8MA 2QIOA 4P4SB 1FJGB 1FTGA 1BMTA 5LLSA 4TXNA 3M82A 2HCRA 1AG9A 1HNWB 2W2QA 3PQ6A 2Y93A 4HHEA 4LXXA 4EIWA 1KZYC 3MQ4A 2O2YA 3EK2A 3OTWA 4OQPA 4U8GA 4QUIA 3MCVA 2NU9B 5JALA 3EVCA 1YOBA 3HRIA 3ZUGA 4DXAA 3G17A 5BQXA 5KTOA 1G8YA 2ZRCA 1POXA 1J0BA 2JFXA 4FFBA 2LCIA 3KUKA 2XYRA 3WICA 3KD3A 1RLJA 2H4XA 4JLNA 1M83A 4INOA 3TQOA 4B17A 1R4ZA 4DCJA 5JCZA 4DB4A 2QSYA 2XVAA 1Q11A 4TN5A 4ARAA 2Z4TA 1UFVA 2ZG6A 5E9WA 1SXPA 1OLXA 2ZWPA 1Y9AA 3RTBA 1JA0A 4OHRA 4ZC8A 3DULA 4EPRA 1S8AA 2OSBA 4GX5A 1XCJA 2QN6A 2RGGA 3WAJA 1PN3A 3RHFA 1Q1EA 1EX9A 5ALGA 1THZA 3G9UA 2ROQA 1W59A 3N2YA 5CLLA 3LY9A 4UUQA 5DASA 2D13A 3S8MA 4CT4B 5IKPA 2CLSA 4W5HA 3RFUA 3NEJA 5CLHA 2HQBA 4PHFA 4ZU6X 5HP4A 5K0LA 2DETA 1DJNA 4S05A 1P2GA 1U94A 4XUGB 1M6NA 2QLJA 1CRQA 2JGDA 4HMPA 4KN6A 1Z0FA 4OA8A 4YCAA 4I66A 1WKCA 1HDZA 2XWSA 1JQJC 3LDUA 3TLCA 4B4KA 5J47A 2XAUA 3RDPA 1VI5A 1WHSB 3QG1A 2QA5A 1ZNXA 2DERA 4PRYA 3WI7A 1LEHA 2XJ4A 1E4EA 1P1CA 3AFIA 1J0XO 4QO8A 2DPHA 4YCBA 4U39A 2IZZA 1DE0A 1KS9A 1OBVA 1TYZA 2VXBA 1GUBA 3AQIA 1MO3A 1RQ2A 4HZUA 2QTBA 2HKIA 2XKBA 4NFYA 5HIIA 1W87A 4W8OA 1YJAA 3E7XA 3PR2B 4C21A 5AVVA 5HQ3B 1OLUA 1ENZA 1MB2A 3TUIC 1UBGA 5EZQA 2F1OA 3HJCA 4H08A 2H4FA 3MWEB 1RQXA 4KIFA 2UZ3A 3ZW9A 2R1TB 5LL6P 3NT5A 2ZBRA 2YXDA 3NBZC 3NAMA 3T3IA 1U2EA 1SVWA 5KNCH 2ZB7A 4MS4B 2E21A 4R3UC 2ZVPX 1W7AA 3O21A 4B6QA 1NUPA 3CH5A 1NNEA 1MW9X 3I53A 3GPLA 4CR6A 4IG4A 3W6ZA 1WZEA 2BUBA 2D3WA 2QTGA 1NQ5A 2XKJE 1QYVA 3ECCA 3IJPA 3JQ9A 4QU5A 4AX8A 5ICSA 3KC2A 2V8OA 3L7DA 5AHWA 2K2QB 3RTEA 3WDSA 5F3WB 3N5CA 4MRVA 2QQFA 4DSUA 1T2FA 1NULA 4NL4H 2WSYB 2FN8A 1WEKA 5KTYA 3E7PA 1EHYA 1E1MA 1DPFA 2O7RA 2XYHA 3IRUA 1WCXA 5K8CA 3LOPA 3U4QB 3DUFB 3KQHA 1UKVY 2EX1A 2HFKA 3R7WA 2VJYA 3K73O 4QXMA 4PG5A 4OK5A 3SJUA 2H1OA 2VQEB 2GZRA 3BDIA 2G9NA 3GJXC 4URZR 5TT1A 4DCPA 3IV6A 3PEEA 4OLAA 4L95C 3IP6A 1JEOA 3CHYA 1XEFA 5D3MB 4W7SA 4MW4A 3DYVA 1V41E 2PLWA 3KYCA 3N58A 2A2ZA 4RZUA 3ZGVA 3QXGA 4FI3C 1OT3A 4Q5IA 2CLOB 4TLDA 1XVTA 1EQ2A 3NAQA 1K2WA 2JLCA 3ITKA 1AVTA 3DOUA 3WRVA 2J5XA 5I5GA 2OC9A 4X7PA 4F5DA 4ESOA 4DBZA 1G42A 1ZP6A 2O2EA 3I2GA 3PDJA 2W6OA 3FZNA 4IG9A 3ER6A 3I9OA 4TV8F 4XB6B 3IKJA 5C8YF 4DSAA 3I0MA 2VOEA 3I01M 1J8QA 16PKA 2J5BA 1NW9B 3B60A 1E6UA 1RYNA 3MMXA 4DEYA 3ZD7A 1FP1D 2O5VA 4XZ3A 3RVPA 3C3XA 1TJ5A 4EJSA 2OBBA 2RH4A 4DLUA 3V4OA 4EGSA 5KVCA 5JJBA 4KACA 2ZBDA 2FSGA 2IBTA 3MRXA 4TTPA 4QXOA 2UZ1B 4F60A 3LUKA 3KWFA 3NRBA 5EYPB 4BB6A 5B1YA 1NA5A 2IXEA 1QVWA 4XTCS 5T8KC 4A0SA 2M1ZA 3UK2A 1JG3A 3C4JA 1DO2A 3QX3A 1IONA 1NN1A 2J7KA 3JARB 1AS0A 3H4TA 3RVSA 1K3UB 3NANA 4PPFA 3QF4B 4OBWA 1YR7A 5REQB 5HIMA 1JPJA 1R0BA 4KNWA 1XWWA 1SXJE 2C54A 4MDEA 4IDDA 4J0FA 1FP6A 4IHJB 3KJFA 3UF0A 3UAGA 3KAQA 4AF6A 4B32A 1FL9A 3FVWA 1QHFA 2PLNA 4OGWA 2I6SA 5DCLA 5JISA 1FDIA 3EY4A 1LNSA 4BV2A 3KKOA 1L9XA 1ZU5A 4RFSA 4RESA 1YRWA 2P3QA 3L1JA 3MLBA 4U2EA 1RKVA 2VS1A 3SNKA 3B2QA 4EECA 4MYRA 3KTDA 1TO2E 1QZXA 3D8TA 2VHXA 1GGNA 4CG1A 4HNSA 3IIEA 4MEJA 1EQAA 3JD1A 4IKPA 3WJ1A 3O2SB 3JWJA 5BOSA 2DM6A 1HOTA 1P74A 3G7NA 3C5EA 4PLGA 5JAPA 3GIDA 3FB4A 4KTVE 4HUQA 2OCKA 3AKEA 1Z35A 2CXXA 3OZCA 4B6JA 4GSKA 4WZAA 2O05A 3HWSA 6NULA 1NVAA 4GLJA 3NCTA 4H3SA 3VVMA 3BMQA 1UC9A 3NC0C 3LYUA 2GVDC 1MMFB 3TW4A 1FMTA 4NICA 4QRHA 4PLTA 4L4XA 3EZYA 5AJTA 5DCYA 4YMLA 2AJBA 2F67A 3DEIA 3OCJA 5FOSA 1OIXA 4J9UE 4E5PA 4RMIA 1BW9B 1US8A 3RFXA 3WLQA 1U3WA 3DWFA 1BXZA 3ZHYA 2XA9A 4PSUA 2ZQZA 4WLFA 5KTKA 2J6CA 4GMGA 4D3XA 2XMQA 4D6XA 5JTTA 3C0KA 4BX3A 2IDZA 3EGCA 4AJHA 4QLBA 1OV4A 1SXJD 3HGTA 1IN5A 4YRCA 1R5BA 1ZJZA 1CRZA 3CYFA 2YVKA 1G6Q1 3G8BA 4DWOA 4JLDA 1OB5A 1D4ZA 4INZA 2P77A 1JWLA 5F51A 3PEFA 4PIMA 2FFQA