3WX0A

The crystal structure of d-lactate dehydrogenase from escherichia coli
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
320
structure length
303
Chain Sequence
KLAVYSTKQYDKKYLQQVNESFGFELEFFDFLLTEKTAKTANGCEAVCIFVNDDGSRPVLEELKKHGVKYIALRCAGFNNVDLDAAKELGLKVVRVPAYDPEAVAEHAIGMMMTLNRRIHRAYQRTRDANFSLEGLTGFTMYGKTAGVIGTGKIGVAMLRILKGFGMRLLAFDPYPSAAALELGVEYVDLPTLFSESDVISLHCPLTPENYHLLNEAAFDQMKNGVMIVNTSRGALIDSQAAIEALKNQKIGSLGMDVYEDVFRRLSACHNVLFTGHQAFLTAEALTSISQTTLQNLSNLEKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric D-lactate dehydrogenases from three Gram-negative bacteria
rcsb
source organism Escherichia coli bl21(de3)
molecule tags Oxidoreductase
molecule keywords D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
total genus 100
structure length 303
sequence length 320
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.28: D-lactate dehydrogenase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wx0A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wx0A01
4YCAA 3G3EA 4MVJD 1IPFA 2G1UA 1PZEA 3GHYA 1U7TA 4YVFA 4KUHA 4ZJUA 3PQFA 2C20A 1V0JA 4GVLA 1VJ1A 3DC2A 1JKIA 3EYWA 4II2A 4BB5A 3AU9A 2WYUA 3TFOA 3GFBA 4PLCA 4RQUA 1TVEA 3VC7A 4CLOA 1NR7A 4MP3A 2EERA 1WDKA 3L0DA 1SPXA 3CTMA 3K31A 2VTEA 4QO7A 3FCOA 4L75A 2IEBA 3E9MA 1HE4A 4CQMD 5JAIA 2VZ9A 3KEQA 3QIVA 2YJZA 1B3BA 3B1JA 1FXSA 3JQ9A 2G5CA 5I9MA 2OO5A 3IDSA 4E5MA 3ZWMA 1H2BA 5DZSA 1A7AA 2AEMA 2BRUA 3PYLA 4O59O 4IDEA 4EZBA 4BO1A 4L73A 4O1MA 4XQEA 4N7RA 4LN1A 1YQDA 1NVTA 1B26A 1HDGO 3QVWA 3I4FA 2X22A 3I9NA 4UULA 3GHHA 4MVJM 3E48A 3H6KA 1E1LA 1HL3A 3VOSA 1CETA 4YEDA 4CQLA 1SAYA 5KVVA 4GPD1 5KCZA 1YL6A 3JV7A 4ZHSA 5JAMA 3F1LA 4GQAA 4RV9A 3NT4A 1YKFA 4Z0TA 3AY7A 4WECA 4Z9XA 3BMCA 1MFZA 5EN4A 1X7HA 1LJ8A 5TNXA 3F4LA 5G0WA 3NDJA 3NDIA 1U8FO 2UYYA 4ND3A 2EGHA 3PWSA 4CV1A 5A9SA 1MC5A 1XGKA 4WCFB 2BI8A 1I5RA 3FBGA 3WB9A 1YO6A 1TXGA 1UXGA 3TJRA 1LDNA 1SB9A 3QWAA 1V8BA 1E3EA 2V6FA 1RJWA 3ZN2A 5JNLA 1H9BA 1XU7A 1O9BA 4L76A 3WQSB 1IB6A 3L77A 5CHEA 2IEDA 4R9SA 1T2CA 2ZJ0A 3FPLA 4O5OA 4KUGA 2CF6A 2QRJA 4IY1A 4OKNA 1HYEA 2PKQO 1DRUA 4K6FA 2NM0A 2C29D 4QTZA 3A06A 3VPXA 4DMMA 5DN9A 1ISJA 1LX6A 4I5FA 1LDBA 5G0VA 2R6JA 4IIUA 4GBJA 1ZVMA 2J3IA 3BHMA 1P0CA 3D1LA 3E6AA 5I7EA 3LU1A 3G1TA 4DUPA 3CZRA 1W0CA 4YT2A 4NIMA 4XGKA 3QV1A 4L74A 4D3DA 2GRAA 2EJVA 3E9NA 3S2FA 3SBOA 4CUZA 2JHFA 1NPYA 4M1QA 2HMSA 3AM3A 1A5ZA 4IDCA 4L0QA 5KJCA 3VKVA 1NNUA 2ZB3A 2PGDA 4JROA 3Q2KA 3R3JA 4E32A 4DLLA 3U4HA 2VCYA 3HZZA 2P5UA 3BMQA 3I9JA 4TVOA 3OFSA 4R16A 5T6BA 1W6UA 3GAFA 2PZMA 1P1KA 4YAKA 5GZ3A 1MLDA 3PJFA 3ULKA 4PG8A 4NFYA 1UP7A 4TWRA 1GCOA 3FNGA 3PJGA 1HEUA 3GK3A 3ZW9A 4E31A 4C7KA 2F1KA 4JK3A 3LQFA 3VZSA 4K9DA 1B0AA 2BF7A 3V5NA 1Y1PA 4R1UA 1CQJA 3TL2A 5LDHA 4R68A 1EBUA 1LDYA 1B15A 2O3SA 3G0OA 4OO3A 1B16A 4S1VA 2CDCA 4R5HA 3RC1A 3PFFA 1FF9A 5TSDA 3K73O 5KVSA 1FDTA 3N74A 3PFWO 5EL0A 5A06A 2AHRA 4XKJA 2VWGA 5ITVA 1HRDA 3RFXA 1Q0QA 3E1KA 4IQ0A 2CSUA 4MVJA 4AJHA 2UV8A 4NU6A 4RQTA 2GPTA 4CLOB 3JQGA 4BO8A 5T67A 1UAYA 3PI7A 1YOVB 2HDHA 2AA3A 4QT0A 4RVDA 1Q1NA 2EIHA 2FHSA 4IJVA 4NG5A 3EDMA 4ZICA 3K2BA 3A9WA 3I9KA 4D43A 2J3HA 4HV4A 1D4FA 5JMPA 2FMUA 3ASUA 2CD9A 2Q49A 1DRWA 3HUDA 4YPOA 4TMFA 2UVDA 4XB1A 1PR3A 1MG0A 2AEFA 4ALKA 5KOIA 4EBFA 1PR9A 1PJ2A 4QFCA 3S8MA 3WNVA 5IF3A 1TB4A 2X7HA 4CV3A 3U4DA 2QYTA 4HBGA 3IOYA 5DDIP 1ISGA 2HRBA 2VRCD 1U1IA 3GVHA 2Q2WA 2YV3A 1RM3A 2WDZA 3HJAA 4LSMA 1RWBA 4J7XA 3I52A 3HDQA 4AJLA 5B12A 4LGVA 1HE5A 3QWIA 3GDGA 4JX8A 1T26A 4JXKA 3MWDB 4CMEA 1O8CA 1Z45A 3BMOA 1PEDA 2YFQA 3AK4A 2D5AA 2E37A 3VH4A 2Y1FA 2PKRA 4WOJA 3LC2O 4PG5A 2ILTA 2AE2A 1CWUA 3GRKA 4Z9FA 3ZH2A 1XIVA 1BXGA 2FN7A 5DNAA 4CLHA 4CM3A 1UDCA 3VPFA 3MEQA 2GYYA 1AUPA 2FPPA 3ZU5A 2E82A 2I76A 3INTA 4DRYA 4IMRA 5DOVA 2E49A 2R00C 1DFIA 4IGFA 3G1UA 4R54A 1ISHA 5FEUA 3Q6IA 1JQBA 4DIBA 4UVHA 4A0SA 4IS3A 3ZGYA 1WZIA 5CPBA 4BKUA 3WGIA 3L4SO 2Q3EA 2WE8A 1BW9A 1VRWA 3OJLA 4IPTA 2EP7A 1PL7A 3FTPA 4J4TA 5TS3A 4E21A 2Q1UA 4JJIA 3EZLA 3H5AA 4IZHA 3BMOB 1DHRA 3PYXA 5EINA 1YXMA 3F1KA 3HHPA 1XELA 3DBHA 4ALMA 3UCXA 2X23A 3QJ5A 2BGMA 2VYND 4OQYA 1U28A 5TGDA 4MKZA 1B8PA 2VWQA 1ORRA 1BRMA 2Y1CA 2QQ5A 1HDXA 3VPGA 1BXKA 1K5HA 3ZW8A 4BO3A 1VJTA 2C7VA 1RM0A 2VN8A 2O48X 4QSMA 4EUEA 3CMCO 4FB5A 3E8XA 4AG3A 1NHGA 4AVYA 4BKRA 3PJEA 5COBA 5DCUA 2YDXA 5G2OA 3WDSA 3ZWCA 3W6ZA 1HTBA 1V9LA 4BMNA 3I3OA 1PZGA 1N7GA 3E9QA 1Z82A 4XGIA 4BNUA 2P4QA 4K28A 2VUSA 4K6CA 5FWNA 1NM5A 1O89A 5T5QA 2FSVA 2A9FA 3H9JA 1AXEA 1KEVA 3K9QO 1XA0A 3F9IA 4PLGA 2QRKA 3G17A 3QW2A 1VM6A 2V65A 3AWDA 4ZQFA 3M2PA 3I6QA 3DEYX 4URFA 4WUVA 1SC6A 3ENKA 1EK5A 2PZJA 2WD7A 2BD0A 2RH8A 1E5QA 3KO8A 3WQRA 3TQHA 5G0SA 2YV2A 2X58A 3ZWVA 1LRKA 1I8TA 4G2NA 2JD1A 5CG1A 3HE3A 1JWAB 4GGPA 1QYVA 4IDGA 3I9MA 4BNHA 1BTOA 1PJ3A 1SEVA 3RU9A 4DC1A 3K6JA 5GZ1A 1XDWA 3GMSA 3GLQA 4DWVA 1XEAA 3SX2A 4CM7A 3GNQA 3KXDA 3UH1A 3RIHA 2IZZA 4RO0A 4FD3A 4YACA 3WJ7A 1EVYA 5U1PA 1MA0A 2NU6A 3Q11A 5JMWA 4E4YA 3BMQB 3JQ6A 2RHRA 5TF4A 1DEHA 5DCYA 3UUWA 1KY5A 1X7DA 5I8ZA 3ANNA 4J7UA 3GEMA 1KETA 1SMKA 5T8KC 2OP0A 2DBRA 4NBRA 4R41A 4OH1A 3RC9A 3PQEA 1N5DA 3QVTA 1PZFA 3JYPA 2I9PA 3W8DA 3QE3A 4HWKA 4DL9A 1LQTA 2W90A 4J1NA 4YWJA 4XR9A 5AQ1A 5JW6A 2D3TA 1WNTA 3RC7A 2JKVA 4B79A 2B4RO 2PLAA 3ZWNA 3R0IA 2C7GA 2RCYA 1GUYA 1Y9EA 4PLYA 3SJUA 3KBOA 3RBXA 1Z73A 1F17A 2NQ8A 2W4QA 5L4SA 4KTTE 1XKQA 5C7LO 1LLQA 4LMRA 3KVOA 5IZ4A 4RVUA 1XSEA 4QEDA 1PL6A 3RBZA 4YAJA 1WVGA 2EKQA 3OHSX 4YJGB 4MIEA 4ZN6A 5KJ1A 4EUHA 1G0NA 2QYSA 4B3HA 1P1RA 2Y93A 1CERA 4R1SA 4D7AA 4BNGA 4BV9A 5HS4A 1JVSA 1H6BA 4IM7A 2VYNA 4INAA 2Z1NA 4J4HA 4FGWA 4XD2A 3DQPA 4ZQBA 2I5PO 3PTZA 2NACA 1B7GO 3WGGA 5B4TA 4G81A 1GUFA 2UUOA 5JAQA 3GOHA 3DAFA 1GY8A 4RDHA 3WG9A 5BSFA 1LBEA 1NR1A 3FR8A 4RORA 1MFPA 3ST7A 1X1EA 5AXBA 5IN5A 4Q3EA 1A27A 4LMPA 1NQAO 4IS2A 4W4TA 4J16A 2JCXA 4Q3DA 1GPJA 4NJMB 2VHZA 2VNSA 3DBRA 3G49A 3ZNNA 3D64A 3ZWYA 2JL1A 2B4QA 4R51A 4BGUA 3MJSA 4BNJA 2JHGA 2E4AA 5ES3A 1C3VA 1MV8A 2BFPA 4XYMA 4E6PA 4RPGA 1LUAA 2P9CA 4RVHA 2X8LA 3OA2A 3M2TA 2VWPA 3WBBA 1EEHA 4E2WA 5H82A 3OBBA 4I5GA 4YYZA 1RM5A 3RUEA 4WLFA 3AM4A 4DVJA 5ER9A 3ITDA 5BNIA 1I33A 5TX7A 4BNMA 6ADHA 5COQA 4PRLA 5BQFA 1MC4A 5ICMA 1C1XB 1PU2A 2W8ZA 3EGOA 5IAAA 1VI2A 3L07A 3SC6A 2B0JA 2PH3A 1YL7A 1ZJYA 4J9UE 2D0IA 2WYVA 5HM8A 3PHJA 1UZLA 3TZCA 4N5MA 1ZKMA 5CPFA 1PQPA 1DAOA 1Z6ZA 4U6QA 3PDJA 4J2HA 1YBMA 3LF2A 3OICA 3RJ5A 5JY1A 3GY0A 3WSWA 3DDNA 1ZMOA 2EKPA 4KWHA 3H2ZA 4MJLA 3VPHA 1SBYA 2GN6A 3HSKA 3UW3A 3ZDFA 1ONNA 2G17A 1RYDA 1DIHA 4TKLA 1J0XO 2NNLD 1B2LA 4B8ZA 5CEJA 4CM6A 3HN2A 4MVJP 5EESA 1X15A 4XIYA 2XAAA 1GEGA 2HMUA 3O8QB 2Y1EA 1KVRA 4FOSA 4XYBA 2BI7A 1YE3A 3L9WA 3P7MA 4OSPA 4CL8A 1GADO 4FN4A 3KYDB 1DJQA 1ZEJA 4E30A 2PY6A 3X2FA 4OIMA 4IDAA 1H6DA 2H63A 3L6DA 4JQCA 3ZV6A 3TPCA 4BGEA 1KEWA 3DWFA 4XGNA 1HZJA 3FWNA 3SC4A 4XIJA 2AMFA 2HCTA 3TZHA 5DP2A 3BXXA 1T24A 1HF3A 3Q2IA 5A9SB 1R66A 5LCXA 2NADA 3CIFA 2TMGA 3DO5A 1WDMA 4NBUA 3VZPA 4CMBA 3W4JA 5THKA 3QP9A 2Y1DA 1VE9A 4QXMA 5DP1A 2O3JA 5AYVA 1KERA 1N92A 2CF5A 3P2YA 4J0EA 5TT1A 3OIFA 3PYMA 5K9ZA 2GZ3A 2P68A 3JQ7B 3O8QA 1LC3A 3D3EA 4N5NA 1NX6A 3DZFA 4DQVA 1Z7BA 2NUAA 3RUIA 1LRLA 4NDNE 4TRMA 4QFDA 2P9GA 2Y67A 1PSDA 1HE2A 5DULA 4PVCA 3RWBA 3GZNA 2O3UA 3TZ6A 1GL3A 3ZU4A 4D0SA 3SLKA 1NQOA 1C0PA 5CEEA 3QLJA 4TKMA 3BHIA 3VAZA 3SLGA 2HK9A 4GMGA 2PFGA 4I9UA 1BW9B 1CEQA 3PGXA 3NKLA 4BOYA 5ER6A 3I4CA 4BO6A 2FR1A 1ENOA 1XHLA 3RBVA 3DZBA 5TJHA 4WLVA 2V6MA 4XCVA 4HUJA 1R6DA 2C2XA 5TRTA 1MG5A 1X7GA 3OH8A 1A72A 1LTHR 1P1IA 2EKLA 2OUIA 3C7CB 2ZCVA 4FBGA 1KY4A 2QHXA 2PR2A 2R00A 2NU7A 4Z6KA 1LLCA 2FWMX 4BO0A 1SO8A 1IY8A 5EQFA 1LLUA 2PGJA 2ZYGA 1QYXA 2VHXA 4NU5A 3DBRB 4PGFA 4JCOA 4PRKA 4XX0A 2O3RA 4GAEA 3ZV5A 4DA9A 4WCFA 1ISFA 1HDZA 1KS9A 4J49A 4CMAA 1GV1A 3AUAA 4OSOA 4EDFA 1P31A 4M86A 2WE7A 4OM8A 1ID1A 1QRRA 1ONPA 3JD2A 5TJ9A 3STHA 5JDCA 1OMOA 2JFGA 3GEGA 3VZRA 3CE6A 2EEZA 3FI9A 4FFNA 4OMUA 1QV7A 4LISA 3HQ4O 1JKFA 4OAQA 3JQBA 3PZBA 4BO2A 4GVXA 1E7QA 4CMIA 1EE2A 5CDUA 5TT0A 1KYQA 3EUWA 1Z75A 2H5LA 3M1AA 4EI2A 3AI3A 1OOEA 4QQRA 2VHYA 4GL4A 3KUXA 2IODA 1R16A 2OMEA 2C5AA 1YH3A 3JQAA 4BNNA 1OZAA 5F1KA 1JKJA 1YBVA 2C54A 5A4DA 2O2YA 3LT1A 2BELA 1HYGA 4LCJA 2I99A 4RF5A 2VOEA 4M8SA 3WMXA 1JAXA 1T2FA 2J5QA 1L7DA 4TRJA 1T4BA 1EUDA 2A92A 5C37A 4J2OA 4M89A 4PLHA 4P4LA 3ZHYA 5C5IA 1ULUA 1GEEA 1S6YA 4LK3A 4ALNA 4IJWA 1G6KA 3QQPA 4K26A 4YJDA 1EZ4A 1FJHA 1K6JA 1EUZA 1ZK4A 2OBYA 3HFSA 4W7IA 3O9ZA 1U3VA 2EXXA 4JP2A 4P4NA 3HFGA 4YQYA 1QSGA 4D79A 3GZ4A 4QO8A 3JQ9C 2D2IA 3GG9A 2J3KA 3SVTA 5DBFA 4CR8A 2YHIA 5ILGA 1HLPA 5J23A 4NFHA 1LLDA 2RH4A 4H16A 2ZB4A 3QHAA 2OBNA 5G0UA 3ADOA 1J49A 5TIIA 4ND4A 3DTYA 3INGA 3NUGA 3Q9UA 3L4BC 3T7EA 3TSCA 1OC4A 1NPTO 1SEPA 3LK7A 4WCDA 2RIRA 1KBZA 4I9NA 2ZCUA 3PLRA 3MJTA 4OQZA 4CJXA 4PFJA 4NZ9A 1RYEA 5IXYA 4JP3A 5FI3A 3RFTA 2BGKA 1BDBA 2QG4A 3ZHBA 4NFSA 5T8KA 5FI5A 1NPDA 3OEWA 4WEOA 1WXDA 4XA8A 1UP4A 1VSUA 4IINA 3ON5A 2A35A 2EF1A 2ZQYA 1SOWA 2B83A 2NVUA 1OAAA 3NTRA 1EVZA 1EQUA 1H93A 4L4SA 4ZVVA 3JQ7A 1F06A 2P9EA 4P8RA 4FJ0A 3LVFO 2IYOA 2OZPA 2HMTA 3U4IA 4Q3CA 2GD1O 5G0TA 4NJOA 2AXQA 3DOCA 4PLPA 5GZ6A 3F5QA 4L8VA 1HWYA 3HDJA 3U0BA 3BIOA 2XF8A 1WAMA 2ZK7A 4FIZA 1NYTA 3BYZA 1MXFA 3DZIA 4NJMA 4ZQGA 4BNIA 4PVDA 2Q4BA 5IN4A 2J8ZA 4EGFA 4R9RA 1B14A 4Y6SA 3NT2A 1K0UA 1NQ5A 3VDRA 4F46A 1TA4A 3GT0A 4GLOA 4DMLA 4U0JA 4CMHA 4D42A 3VVCA 3MCVA 5JCJA 5A5FA 5HBRA 4JN6B 4D0RA 4DQUA 2HK7A 3WSVA 1E3JA 3WGZA 1PJCA 1WLYA 2EW8A 4GGOA 5EQDA 4NBTA 3VHRA 3Q9NA 3INRA 3WNQA 5C7IO 5EIOA 5ENVA 3GAZA 2PZLA 4DGSA 2D59A 4KUEA 4R01A 1CYDA 1TI7A 1YB4A 4IXWA 4XYEA 2Q1WA 3H7AA 4OXKA 1ZEMA 3BZUA 3ONEA 3BMNB 3DB2A 3WGHA 2CFCA 3PHGA 5B4VA 1LNQA 2OP1A 5BR7A 1FK8A 1VL8A 2JCYA 3ETDA 3KTDA 5LC1A 4CM9D 1U5CA 4EJ6A 1D8AA 1P44A 4HFRA 3VTZA 3OIGA 1IHYA 4Z0PA 4Z3DA 3NJ8A 1ZH8A 4R5MA 2V7PA 1UZMA 3L6EA 1U3TA 1D1SA 2BLLA 2FY8A 1C1DB 5BSHA 1NBOA 1GQ2A 2HMVA 1PL8A 4E33A 5I7SA 4IZIA 2JFHA 4OHUA 2NTJA 2QRLA 2IXAA 3AY3A 3JD4A 3H4VA 3OJ0A 3QRWA 4LCEA 1V3VA 2C82A 2QW8A 1ONOA 1DC4A 3GH3A 3ZHZA 2X86A 4WLOA 3CXRA 1T1RA 3ONFA 2EV9A 4W9NA 1HDRA 1PGNA 1LDGA 2Q50A 1PQWA 2FZEA 4DBVO 5F21A 4YT8A 3JTMA 4BVAA 4XR4A 3H9QA 1U4SA 4L9RA 4L4RA 3ROPA 4ZRMA 3ZNQA 4EW6A 2I66A 3H9GA 1O0SA 3GG2A 5THQA 2AQ8A 3ROMA 4RZHA 3D5QA 3JSAA 4GX1A 3TNLA 5JDCC 4CODB 5HRUA 3BTVA 2AW5A 1ZCJA 4PLFA 4BUCA 4Y67A 5IJZA 2EHDA 1KC3A 2DUWA 5KKAA 3LSYA 7MDHA 4YT5A 4PLWA 3TOZA 3LT2A 2NV6A 5IFLA 3GA0A 1CJCA 2J5RA 3HWRA 3T7CA 1P45A 2TMDA 3ZWPA 5ILOA 2VRBA 4MDHA 3WICA 4AJEA 1MUUA 1Y8QA 2GCGA 4W9NC 1YQXA 4UAGA 3IJRA 4BS9A 5KJ6A 4DPLA 3RUDA 1C0LA 2EW2A 2GN4A 2NTVA 1PJTA 4PG7A 5B1YA 4ZRNA 1DFGA 1BSVA 1V3TA 4LVUA 4MVJE 4BNYA 4Y98A 4O0LA 2R2GA 1DC6A 2I3AA 4U6SA 1I01A 1PGQA 4XDZA 1E7RA 4G5HA 3D5TA 2ZYAA 3C3XA 3TDKA 3BTUA 4F6LA 1IZ0A 4XYLA 3FSRA 4RPHA 3UAGA 2FRDA 4WKGA 3IKTA 1ZSVA 1K3TA 1H9AA 2PZKA 1UDBA 4FOOA 1I2BA 1UR5A 3GFGA 4A5OA 2UDPA 3V2HA 3H9EO 1LEHA 4DLBA 2DFVA 4X54A 4LRSB 1ISIA 3ZNPA 3VKUA 5KNLA 4IGEA 4Z9YA 3WLEA 1HLDA 3ZZNA 5L40A 3OEYA 4B4UA 3MJCA 1U3UA 3UHAA 4R3WA 1LSSA 3KYCA 2DTDA 2EJWA 3E03A 3QVXA 4N18A 3W6UA 1Q2XA 1OI7A 4ND1A 1QP8A 3WFIA 5ENDA 4RPJA 4PIVA 3W4IA 3WOHA 5I9NA 2RBEA 2XXJA 4TRNA 1EBFA 1DB3A 1WZEA 3ZWOA 1IYZA 2B5VA 3M6IA 2GZ1A 1QYWA 5K6AA 1R4MA 3PWKA 3ZU2A 4AJOA 3PIIA 1CIVA 4BB6A 2IZ1A 3ADPA 5GMOA 5CEFA 4O6VA 5DCWA 1PJLA 2C5EA 2ZTUA 3F6YA 4UUMA 5JDIC 1P0FA 3LYLA 3ANLA 1ZMTA 3GVCA 3MWEB 3RVDA 4U5QA 5IG2A 3WJAA 3ICCA 3PIDA 4RCVA 1GFSA 5U9CA 1PIWA 4GWGA 3W8FA 3PLNA 2OGUA 4AFNA 4PZDA 1ZK0A 1I36A 3JD0A 3OA0A 1E7SA 3OF2A 1KVSA 3IL2A 4IUYA 1RM4A 2NVBA 1E3SA 3FD8A 3FF4A 2BFAA 4I1IA 3BTSA 1YWGO 1ZK3A 4HX5A 3U3XA 4GX2A 4DREA 5I8WA 2FPGA 4E5YA 2FR0A 4LSWA 3FBTA 1DPGA 4E5KA 3K5PA 4J43A 1HSOA 4E12A 2Q2VA 1ZJZA 4KDFA 1NHWA 5AXCA 4AJIA 4DBZA 1FDUA 4II3A 1K89A 3W8EA 4FJ2A 3DHEA 1PX0A 3PPIA 3AI2A 1R4NA 4JNKA 1LDEA 3MJ4A 1DIBA 2X9NA 5JC1A 2Q1TA 3BTOA 1NAIA 2YQ4A 4WLNA 3D3WB 5F1OA 1EFKA 3RI3A 3DZHA 4QECA 1MP0A 3L4BA 5GY7A 2JD2A 1Q0LA 4WK6A 2C59A 2P91A 1EDOA 3NTOA 4RLSA 1ARZA 5JFOA 1IL0A 4AJKA 2ZATA 4PZCA 2O23A 1DLJA 1GCUA 1O94A 3OJOA 2VWHA 2ET6A 1BHSA 2PGLA 2Y66A 5IDQA 1E6EA 1LSOA 4NK5A 4CM8A 1JLLA 2CDBA 1YVEI 2AQKA 3PEFA 1DC3A 6LDHA 4W7HA 3ETGA 3BAZA 2YV1A 5AXAA 5IZCA 4XQ9A 2X9GA 1Y5MA 1IOLA 4TZKA 3I83A 1PGPA 1UZNA 2Q45A 1HE3A 3GGGA 2BGLA 3C7DB 2JAHA 4J3FA 1NQTA 1V35A 4Q9NA 3ABIA 4MPDA 5AXDA 2WD7B 3GDFA 4I8XA 4YJGA 3K96A 3EMKA 1U2GA 4O63O 3KZVA 5TLSA 2JD0A 1I2ZA 3UXYA 3KRTA 4HFMA 1R12A 3PRJA 4Y8VA 4B8WA 2QX7A 2YHIB 1OBFO 3WFJA 2G76A 1UDAA 1JU9A 4IJUA 5K0ZA 3PGJA 3WLFA 5JSFA 4B4OA 2UAGA 2RAFA 3GNSA 3I1JA 3DMYA 3E5MA 3R1IA 4CQMB 1M6HA 3H2SA 3R3SA 3V8BA 2FZWA 2X0IA 3EC7A 3H3FA 4J0FA 3DOJA 4PZEA 5JAZA 9LDBA 1QMGA 1X14A 3L6OO 4D44A 3AU8A 1B3RA 1QXSA 5KJEA 2I6TA 1JW9B 3IUSA 5I9LA 2CZCA 1AE1A 4ND5A 3ONDA 2VNAA 3RJ9A 1HXHA 3FWZA 2F00A 1XU9A 1Y81A 4OGWA 1EUCA 2W2KA 4IBOA 1MB4A 2BHLA 1SZJG 4NPCA 5AOVA 1GU7A 3WIEA 3ROQA 1IE3A 3DMTA 1E1MA 4FS3A 2PWZA 2W2LA 2QZ9A 3DFZA 3KM0A 4EEZA 5BSGA 1ZUD1 1Y6JA 1YGYA 3COSA 1U2DA 1PJBA 4A2CA 2DC1A 4YJHA 3OJFA 1F8GA 3JQ8A 2PD4A 1MX3A 5EERA 3TZQA 4B7XA 2Q4EA 1ISMA 1J6UA 4RF2A 2WTBA 2CVOA 3DZKA 5ICSA 3GRPA 1AGNA 1VKNA 3I6IA 3VPSA 3WGYA 4DC0A 2BMAA 1XQ1A 2DTEA 3AW9A 1QORA 4MVJI 4A03A 4HXYA 2B69A 2ZQZA 3WWYA 5BNFA 5IDXA 4FC6A 3PHHA 2H9IA 4AJJA 4D3FA 4E2XA 1M66A 1ULSA 3UOGA 5CFZA 4CM5A 1NFRA 1BXGB 2PD3A 4NMHA 3RU7A 3EHEA 1FMCA 2DPGA 2Y1OA 3MTJA 1EFLA 3PWZA 4GX0A 4IDDA 2V6GA 5L95A 2HSDA 1O6ZA 1QR6A 2X0JA 3CINA 3NJ4A 4B3JA 4DIFA 4PLVA 4E2YA 2DBQA 3BMNA 2YY7A 1ZO8A 7ADHA 5L51A 3DXFA 1BWSA 1H5QA 1HDOA 1Y8QB 4FGSA 4XB2A 1TLTA 5C3MA 3TN7A 4B3IA 2B4TO 2W2LD 1E0DA 1UXHA 4BV8A 1KEPA 3C1OA 4NHEA 4YJFB 5FF9A 2Y68A 1HKUA 1X0XA 5JYEA 1QG6A 4OOFA 2I3GA 4WCFC 1IPEA 1JN0A 2YYYA 2ZJ1A 2G82A 4CM8B 4IDFA 4KOAA 3AOEC 4F45A 1GYRA 4BKPA 4E0BA 3D4NA 1LSUA 4ALIA 1I3NA 4MP8A 1N1GA 1R37A 2GN9A 4JLWA 5HWSA 1WMBA 2ZTLA 4W99A 3P5SA 5JE8A 3OSUA 4GLLA 1GD1O 3S2EA 1W73A 4FFOA 4IIVA 3EVNA 4XRRA 4AJNA 5A9RA 4BL5A 1LQUA 3RASA 1UAGA 1I10A 1LSJA 2OOSA 2X5OA 2PH5A 1HDYA 1VSVA 2YW9A 5K6AC 1YOVA 5U4QA 4BNKA 2NU8A 3RCBA 3RUCA 3E82A 4S3MA 4N54A 1YS4A 3UF0A 3ZWWA 1WMAA 5A1TA 1M75A 4PLTA 1HYHA 1Y7TA 2DQ4A 3RROA 1R4NB 4TRRA 4NH4A 3PDUA 2P2SA 1GQYA 4GWKA 3DBHB 3TOXA 5KJFA 1M76A 4WNCA 4R69A 3C1AA 1R0LA 1N1EA 3O38A 4BNTA 2YZ7A 5IXSA 2X1HA 4LVCA 4MVJG 3JQCA 1YJQA 4ESOA 2B36A 1AXGA 2NVWA 1T25A 4PG4A 4RVSA 4IQGA 4GMFA 3U62A 3DR3A 2O50A 2VQ3A 3HN7A 3JQEA 4UVDA 4BO4A 1EE9A 1PWZA 3H8VA 5L53A 3WYEA 2W2KB 4FQ8A 1P1JA 1QKIA 2HQ1A 3HB4X 1AN9A 1EVJA 3DBVO 4MVJF 4CR6A 1KVUA 3B70A 1UXKA 4A73A 5H83A 4HADA 3FNEA 3PK0A 3VH3A 4E5NA 4J1SA 4DYVA 3ROKA 5B4UA 2WSBA 1KVTA 3PHIA 1A9YA 1U8XX 2OFPA 1I3MA 5L45A 3DONA 4ROSA 4C7JA 1PJ4A 3DZJA 2SCUA 1IUKA 1W8DA 3AUTA 3JQBC 1JVBA 4E13A 3K8ZA 3V2GA 1RPNA 2CVZA 1EQ2A 3C8MA 1I32A 3JQDA 4B7CA 1FDVA 2CDAA 4IXTA 2X6TA 2YFHA 2PNFA 5JO0A 1JWBB 4YJFA 4MO2A 5I7FA 2FP4A 5DT9A 4EUFA 4JBGA 2PD6A 4J7CA 2Y0DA 3TRIA 1QLJA 3OQ1A 4XJTA 1NXQA 2C07A 2X5KO 1UH5A 2DBZA 1AHIA 2VHWA 1P3DA 4J6FA 4BNFA 3FPCA 2FOIA 4AJ2A 4W6ZA 4Q3BA 3PQDA 4WASA 4XZ3A 3UVEA 3RUFA 4HFNA 2CUKA 3IIEA 4KQWA 1M67A 1PTJA 1DBVO 3JCZA 3IMFA 4EEXA 2HJSA 3N58A 4NBVA 2DUUA 2HAEA 4CMIB 3MTGA 3LLSA 3B6ZA 4M87A 5KWEA 4DLAA 4CMJA 5CDGA 2D8AA 2Q2QA 1DJNA 2D1YA 3ZWBA 3DMTC 3CMMA 4YT4A 4MIOA 4CM4A 2LDBA 1I3LA 4R1NA 2B35A 1N9GB 4IQ8A 3DHNA 4CLRA 1M2WA 3D4PA 3JQ8B 1Q0HA 4JBIA 4RJTA 1HZZA 1SB8A 3RUHA 1R15A 5B37A 5EMHA 3O03A 4QUKA 3DAGA 3FTNA 1A71A 1ZFNA 1OFGA 4M55A 2H6EA 4Y6RA 1L1FA 4OOEA 3V1UA 4ZQEA 3QY9A 4HNGA 3ZI0A 5A3JA 3A14A 5HTOA 5JS6A 4AJ4A 4BNWA 2DLDA 4BGIA 3GVIA 3U9LA 1CRWG 2VHVA 2Y0CA 3P2OA 1KEUA 4DPKA 2Y05A 1ADCA 3CZMA 3JD3A 1NFFA 1ZK1A 2GN8A 3NDRA 3S2IA 3DOOA 3UN1A 4MVJH 3OQ6A 3PHLA 4R4JA 1BGVA 4OL9A 5FYDA 3WR5A 4CM1A 2VUTA 1DXYA 3WYBA 5G4KB 2C2YA 2HRZA 4R3NA 5IZCC 2FSSA 2CMDA 5EPOA 2IXBA 4BNZA 1DIGA 4GSLA 3WYCA 4AICA 1E5LA 1BVUA 3MJVA 4J91A 2O7SA 3DAPA 3GN2A 3Q1LA 3V2UA 3HADA 3GF4A 2B37A 2GR9A 3AUUA 1DSSG 1EVIA 1WP4A 1XWFA 2OXIA 2AG8A 1ADBA 1KC1A 4BMVA 2WJPA 2NVUB 5CG2A 4F3YA 2O3TA 1O5IA 4P22A 3TFQA 1KOLA 2DVMA 4RF4A 4ZGWA 2ZB7A 1K6IA 3AY6A 3GC6A 4Z3KA 2VUUA 4YDRA 4HKTA 2Y0EA 3H65A 3LT4A 4FDAA 4KWIA 1SNYA 3GGOA 3I23A 4WJZA 2O2SA 3VDQA 1YRLA 1Y5RA 2CY0A 4ILKA 4J1QA 2IDZA 3M1LA 3TF5A 2YUTA 1DHTA 4OJNA 4A27A 1CF2O 5L7WA 1H94A 3JQFA 3LC7O 3VH1A 2NU9A 3OQBA 3RC2A 2JJYA 1VC2A 4JJFA 1U3WA 3PJDA 4ND2A 2GUGA 3ASVA 5MGBA 2GASA 1PS8A 4TROA 1P33A 4GKBA 1A4IA 1YONA 2QZZA 3B1FA 1M6WA 1PGOA 3FNHA 1NAHA 4IJKA 4M54A 1J4AA 5IDYA 3CPSA 4DIOA 3WWZA 3IUPA 4CLEA 3GGPA 3ZCXA 4E2ZA 1H0KA 4G65A 2O4UX 3JYOA 3CKYA 5G4LA 3X2EA 3D0OA 5JLAA 3WX0A 4YRAA 4QX6A 2EG9A 3PZRA 3KSUA 3ZV4A 3U4CA 3W1VA 1I30A 3FHLA 4FFPA 4XYGA 1HETA 3RQSA 1D7OA 1S7CA 2O7QA 2XPCA 4YQZA 2EP5A 2GDZA 5DBIA 5C7OO 1DOHA 1GDHA 4RPLA 4J9VA 1A4UA 3C7AA 3F46A 1R0KA 4RGBA 4YRDA 2WYWA 3SEFA 4D41A 4TVBA 1BMDA 3IP1A 1ZSNA 1Y9AA 3LF1A 4RVGA 4DPMA 3EW7A 3WQQA 2EWMA 1PS9A 2H1SA 4MOWA 3GVPA 3VH2A 3I9OA 1JTVA 2RHCA 3WGQA 3AOEA 4BQPA 5CDSA 3GPIA 1YB5A 3WGTA 1SOVA 4YTEA 3WTBA 4H3VA 3BA1A 3HB5X 5L3ZA 4CLRB 3JQAD 3QVOA 1B8VA 2BH9A 2DAPA 4HFJA 1P1FA 4FFLA 4A10A 1FDSA 1GPDG 2CNBA 4FCCA 1K2WA 3KOUA 4UREA 1ZXBA 2P4HX 4XDYA 2EGGA 3MOIA 2WEKA 3BMCB 4AJPA 2Z5LA 2YQ5A 5F5NA 4IDBA 2DM6A 2CVQA 3KETA 3ZU3A 4MKXA 5DF1A 2VT3A 5T64A 1I24A 4GH5A 4D3SA 1VJ0A 1IHXA 1IULA 1H6AA 1ZIDA 2NWQA 5JDIA 2E6UX 1DAPA 4ITUA 4E5PA 3F47A 4YR9A 1BG6A 3QA9A 1H6CA 4CM9A 1GZ6A 1PZHA 5G4KA 2P5YA 2ZIZA 4B7UA 2BFOA 4Q39A 2DFDA 1T2AA 5F5LA 1ENYA 1HT0A 5A9TA 5A04A 3NX4A 3L9XA 1ZSYA 2NSDA 2Z95A 4BMSA 1E7WA 4CV2A 3A1NA 5KTKA 3DBLA 1TT5B 1AHHA 4GSKA 1Q7BA 1V3UA 2WD8A 1A7KA 1XCBA 4JGBA 4UEJA 4KTVE 3C85A 2AQHA 5H81A 5A3VA 4BNXA 1DC5A 1C1DA 1OC2A 4Y6PA 2FR8A 2DKNA 2GSDA 3EY4A 1EMDA 4UUPA 4BO5A 4D45A 1DIAA 3OM9A 4HP8A 4WOKA 4A7PA 3AFNA 4DXHA 1HSZA 1GYPA 2PA3A 3ZNOA 3KLMX 5TQVA 3S55A 4EJ0A 4YA6A 3H3JA 1E3LA 2GZ2A 2WWRA 1D1TA 4RLHA 4BNVA 1PWXA 2O3QA 4PCVA 4XEHA 3JQGB 1DLIA 4ONEA 3MZ0A 4FFRA 3GZNB 4NBWA 5BNTA 3TWOA 5JYDA 1Z7EA 1Y8RB 1JDJA 3O26A 3KV3O 1TEHA 4WEQA 1I3KA 4PG6A 5IDWA 4N5LA 3B1KA 4ZD6A 1PJSA 4OYRA 2ZTVA 2ZKLA 3JQAB 3DL2A 1H2HA 3ORFA 4HY3A 1ZK2A 1T2DA 5L7YA 1T4DA 1T2EA 4Q3NA 1C0KA 5CP8A 4DTIA 2JCVA 3UICA 3Q3CA 1JA9A 4KMSA 4OKIA 4BKQA 4CV0A 4U7WA 4B4VA 4DQXA 4KQXA 4P38A 4XWYA 3CEAA 3VTFA 1ZBQA 5JCJD 2YDYA 1PQUA 4HNHA 5BT9A 1LRJA 3W4KA 5L7TA 4EITA 4H15A 1E3WA 2Y1GA 2ZB8A 1LC0A 1VPDA 1RKXA 5KVQA 4JBHA 3PP8A 3U49A 4BO7A 2AQIA 4ZQHA 4FR5A 3F4BA 5DBGA 2HKIA 2I67A 2VYVD 2W98A 4TSKA 4TZTA 1VKOA 1Q7GA 9LDTA 3EAGA 3IAHA 1UJMA 3OJEA 4CMCA 1E7YA 1PS0A 1GR0A 1F0YA 3LT0A 3CUKA 4YAIA 5JY6A 4JIGA 1C0IA 1GZ3A 2VZ0A 1V6AA 1ADGA 2DTXA 2JFFA 3T4EA 1E3IA 3T4XA 4A26A 2V6BA 4CR7A 4P4GA 1Z74A 2X5JO 4R1TA 3DFUA 2VOJA 2PKQP 4MP6A 4ALLA 2LDXA 2DPHA 3NEPX 5JC8A 3S1LA 1UXIA 2Q46A 1NASA 2X0NA 4WPGA 3LLVA 4FC7A 1A9ZA 1NVGA 3KSZO 4Q3AA 5JO9A 4GKVA 3AUSA 4KP7A 1ENZA 3KSDO 1LDMA 2HK8A 4CMEC 3ITKA 3OECA 5F3RA 5ADHA 2B5WA 1W4ZA 3ZHXA 2PV7A 1NP3A 4M49A 1E1NA 3VVBA 2OORA 1LI4A 3KHUA 1X13A 2J5KA 4WNIA 1N8KA 3GUCA 4YAEA 5HA5A 3S2GA 5JCXA 1P1HA 4KDEA 2YHUA 3RAJA 4BKOA 5A5EA 2J3JA 4WLEA 2XOXA 2QIOA 4Y9DA 3GPDG 2HMWA 3JYLA 1N2SA 3DBLB 3H5NA 4BO9A 3AM5A 1G1AA 3ICPA 3D4OA 3P19A 1GUZA 1VL6A 2BKAA 3JYQA 4NK4A 3ETEA 3A4VA 4BIIA 1F12A 4WLUA 5FFFA 4I5DA 3CH6A 1YQGA 2X0RA 5F1PA 4ZA2A 4U0KA 1YB1A 3V1YA 1YL5A 3H9UA 5EJ2A 4CLXA 2NLOA 4J1TA 4BHTA 3D3WA 2A94A 3HG7A 4K1LA 1GAEO 1DO8A 1WPQA 4YJHB 1WWKA 2X4GA 2Y99A 3EVTA 3FRJA 1NFQA 1B8UA 1QLHA 3JD1A 3ZWAA 3JQFC 1G0OA 1Y8RA 3UGKA 3A28A 2JAPA 3ENNA 4LRTB 4L4XA 3RFVA 1YJ8A 4BNLA 3RKUA 1ADFA 1TT5A 1XR3A 4RPKA 3UFXA 3N7UA 3QWBA 3IKVA 1ZXLA 4EYEA 4H7PA 3WTCA 3DZGA 3GQVA 5I7VA 1WW8A 5TC4A 1C14A 1P74A 3IC5A 4TQGA 5T57A 3RKRA 3DTTA 3R6DA 2AE1A 1DIRA 1GYQA 2Q99A 3QWHA 3LC1O 4BGVA 4FPXA 1XYGA 2POQX 5L4NA 2J6IA 3GNTA 4WE3A 3EK2A 4MIYA 3WGOA 4F6CA 1GQQA 3UKOA 3GUYA 3GDOA 2OL4A 1WDLA 3SXPA 2D5CA 4CQLB 4UEOA 2FPIA 3OP4A 8LDHA 2Z1MA 5L9AA 4B4WA 1E92A 3F3SA 4CUKA 1J5PA 1U7HA 2GO1A 4CMGA 3IJPA 3PVZA 1T1SA 4UUNA 3WBFA 5JXWA 4UEKA 4NQZA 2IZ0A 3CSDA 4MINA 4IMPA 1LXCA 1QYCA 3QWFA 5CAEA 2GF2A 4GX5A 1HDCA 4NR0A 3B20A 4RZIA 3IP3A 3TZKA 3KLPX 5L4LA 3GN1A 3O4RA 1DDOA 4BQRA 1U5AA 3C24A 3K30A 4I08A 5A05A 3NT5A 1JAYA 3NAQA 3OIDA 4CLDA 1C1XA 3KYDA 2AEJA 1GZ4A 4U8GA 5MDHA 4Z0HO 2O4CA 1QV6A 2ZYDA 1ZNQO 1ML3A 1I2CA 4UUOA 1Q7CA 3NYWA 1NVMB 5HS6A 1YDWA 2OHXA 1KVQA 4FSHA 1DRVA 4C4OA 4NI5A 4ZU3A 1X1TA 2AG5A 5DOZA 3U5TA 1D3AA 4XRGA 8ADHA 3JYNA 4GI2A 1UUFA 3ZV3A 1LU9A 1E1KA 3AI1A 2VTDA 3I5MA 4RDIA 2NQTA 4AJ1A 2D4AA 3TL3A 4FW8A 3FR7A 2HO5A 1GV0A 3NGXA 4OXNA 2XXBA 1F8FA 2GERA 3GR6A 3K2EA 4ID9A 1EDZA 1XLTA 4CL3A 3KB6A 4JJGA 4EJMA 3LZ6A 3G79A 3VZQA 3BHJA 4XQGA 3F5SA 2DT5A 2IYPA 2PK3A 4YBZA 1FDWA 4OXYA 3NGLA 4I5EA 3ANMA 1YBAA 1I0ZA 3AFMA 3IQDB 3RSHA 4D46A 3WS7A 2GGSA 3HNPA 1VLLA 2A4KA 1ENPA 4ALJA 5CDTA 2IRWA 2C0CA 4YXFA 1N7HA 2WM3A 2DBVO 4YB8A 3OETA 3AOGA 1MGOA 1LA2A 5KIAA 1P9LA 3MOGA 3FN4A 4XQCA 5LDGA 3RD5A 4AL4A 1YDEA 3QSGA 1N9GA 5A02A 4PN3A 2GLXA 1NTOA 2VYVA 2G0TA 2DU8A 3NV9A 3K92A 5A03A 4CPDA 1ZZEA 4E3ZA 1U9JA 4YAGA 3D7LA 4RL6A 1SCUA 2IE0A 1O95A 4J4BA 1R4MB 4NNJA 2X9VA 1NWHA 3PXXA 5COAA 2HU2A 2UUPA 3I9LA 3HDYA 5JPIA 4PLZA 1VL0A 3GMDA 3AJRA 5ITWA 5AVOA 4W82A 3WMWA 1EK6A 1GTMA 3UCEA 5JBIA 1R0SA 3DHYA 4MKRA 2BFMA 4LW8A 2HJRA 3MJEA 3ZWXA 1DFHA 4UVGA 4XJSA 4UVEA 4CMKA 2VZ8A 4FFMA 4FJ1A 1ZW1A 1X0VA 3WXBA 3KEOA 1BDMA 1XQ6A 2WMDA 4DYDA 3HDHA 2Q1SA 3OMLA 4WGGA 1CDOA 4J90A 3LDHA 1E6WA 4RVFA 1E7MA 2I65A 1TT7A 1L7EA 2PTGA 1IZ9A 1MXHA 3NRCA 3E18A 3IS3A 2HUNA 3NTQA 3RUAA 1PJQA 3H5RA 1BXZA 1U4OA 3UCFA 2VRCA 2NTNA 1F14A 1P77A 5CDYA 1CQIA 1NWCA 1XG5A 2VT2A 3GEDA 4UVIA 4CM4B 4CQMA 3U09A 2ZTMA 3KYCB 3WIDA 3EZYA 3Q0EA 2HLPA 1PGJA 3C1TA 1K6XA 3QVSA 3V1TC 5KKCA 4RF3A 1UP6A 5KVCA 4YRBA 1E6UA 1KIFA 1E77A 2E48A 2GNAA 3GVXA 4KZPA 1E3WB 1UXJA 3E5RA 4CUJA 1QYDA 3SJ7A 5BSEA 1BVRA 3FNFA 3KYBA 4I9HA
chains in the Genus database with same CATH superfamily
3C4QA 1Z7YA 2Z2KA 2EQBA 4F9FA 4DJEC 1FFXB 4QPZA 4C6TB 1OR8A 4RTNA 1J8YF 3MRVA 3KL2A 5FOUA 1ID8A 3T54A 1GZUA 2LD4A 2XXAB 2OGWA 2BFCB 4XOUA 3THRA 4ZJUA 3PQFA 4K6GA 2C20A 1Z15A 1T5TA 3SWWA 4OQMA 4ENPA 1FX0B 1V1RA 3NBQA 3VR1A 4L6IA 1PD0A 2CYCA 2EKZA 5ESXA 5ARDA 4WL0A 4V0RA 3GFBA 1DOAA 1O97C 3T8YA 4RQUA 4O4LA 4KWEA 4G37A 1ZUNA 4CLOA 5JTTA 2V3CC 1WDKA 1CC1S 2XKBA 1SPXA 5TEVA 4Z4GA 1L6RA 3K31A 4WERA 3SYNA 1UM8A 1XXLA 5KINB 1VE1A 5E3IA 2IEBA 3E9MA 5LMZA 1RJGA 2Y27A 1UJ2A 1RPJA 2QM7A 1KO8A 3M33A 3SEZA 1BS2A 2O14A 2YJZA 1VI6A 1FXSA 2OO5A 4MVWA 1QC5A 4FHCA 1FVOA 5DTRA 1CFZA 3ZWMA 1F3OA 3N0RA 3TUJC 1A7AA 3PYLA 2B8JA 2X6RA 5JRZA 2OCPA 3HUEA 5KMGA 4IDEA 4BO1A 4L5BA 2BFDA 3AB7A 4O1MA 3KZCA 4XQEA 1LD3A 2GTHA 2XOEA 1OLXA 2F55A 3UUGA 1AMUA 4B4DA 1S9HA 3KPJA 1B26A 1U2DC 3QVWA 2I2DA 3X1JA 2XNKA 2FUG6 4CFYA 1OA0A 3ENVA 1RRCA 1Z7GA 1OFUX 1E1LA 3VOSA 2Y1LA 1PEKE 1BVYF 3VU9A 1YL6A 5C31A 5CCEA 2JBAA 4ZHSA 4N0QA 3LY5A 1J0AA 4JNCA 1SUPA 2FPGB 4FDVA 3WGLA 1AKRA 1JQAA 2ZAIA 5L6LB 4C03A 3KDPA 3MGKA 4KYIB 4EA6A 1KU6A 1U8FO 3PPVA 4HDNA 1YAHA 2EGHA 1MCZA 3QE0A 1W36B 1XGKA 5CDFA 1T3HA 1KZ1A 4WCFB 1Q20A 5LYJA 1YO6A 1TXGA 3QXXA 1CUBA 2A58A 4RC9A 1F0PA 3QQ5A 4LS3A 3TLZA 5E7JA 4EG8A 1NW6A 1SUSA 5U4XA 5J58A 4NMXB 1LK0A 2V6FA 1U9CA 4TXJA 1T9GS 2Z8YA 5DXFA 1OX4B 1XU7A 2MU1A 3WQSB 2WUFA 1USKA 1GO2A 3EMVA 3FFWA 2IEDA 4K03A 1UODA 3FVWA 2ZJ0A 1KFCB 4F8EA 2CF6A 4DLZA 3COPA 4OFWA 4U00A 2EYQA 3BWCA 4IY1A 4EKDA 3KZKA 1HYEA 1DRUA 1V5GA 3LVQE 2ZWMA 4MS4A 2C29D 1CY4A 4N8SA 1T36A 3SXJA 2PMCA 2YINC 5JIBA 3AQIA 4DN6A 1KE1A 1ZM9A 3L0BA 5B30A 1ISJA 1RRKA 3L1JA 3MINA 2OBMA 3A3NA 2IGTA 2QNIA 4YUAA 1QNLA 1US8A 3G1TA 4ZO8A 1W0CA 2IX9A 4NIMA 1BX3A 2BEVB 3C3CA 1VG9B 4DMHA 3QU5A 3W2TA 4LV5B 2IYRA 1SBTA 1Z0KA 3A6JA 4AC9A 3JVEA 2HMSA 4L0QA 2ZTHA 3VHXA 4Z49A 2DFTA 3ZDZB 4D02A 5IKMA 4QZVA 1QG4A 1NNUA 1R3DA 2ZB3A 3CF2A 3HCEA 4JROA 4P4SB 3R3JA 1KQOA 4YRPA 2VS1A 1FFBA 1W88B 2H5IA 3U4HA 2IITA 5EZYB 4YRZA 1XMSA 3OQPA 4NE2A 5L3QB 4RD0A 3H2HA 4BIMA 1YS1X 5T6BA 4U2KA 3GAFA 5GIOE 3D81A 3KUCA 4US1R 1RHMA 1G20E 1JIVA 3VDNB 4BZWA 4DWOA 4F1WA 4YAKA 2OXEA 4UTNA 5KU1A 2FCAA 2PFSA 1MJ5A 3ULKA 5KSWB 1K06A 4NFYA 1CJVC 1EK1A 4BFUA 3VISA 3EXHC 3JR7A 4URYR 1HEUA 3G85A 3VZSA 1QHIA 3K0KA 1PVDA 4KNYA 3V5NA 1Y1PA 3N39C 4E15A 3LDUA 3BIXA 4OAPA 3TL2A 4FBLA 1ZM7A 1EBUA 4HTAA 1A5AB 5HIIA 2EKBA 2O3SA 3G0OA 4OO3A 1OB5A 4BXOB 1QX4A 3K1JA 4R5HA 4S1VA 2XRYA 3ND5A 1Z6TA 3KKKA 5TSDA 1KMMA 3K73O 1KH1A 3OQHA 2H18A 1E32A 1IM8A 5KVSA 4ZI7F 2BTEA 1RLTA 1GNQA 2QLTA 5A06A 3PEVA 2H17A 2AHRA 1V16B 1GN9A 2WG0A 4ARZA 3DP7A 1GT6A 4CBVA 2IQ5A 3ZHUA 4NU6A 3HVHA 4HWTA 3V8QA 4CG2A 3A1SA 3JQGA 1SJ9A 4F96A 5T67A 1UAYA 2C3YA 1JEQB 2P27A 4UE2A 2HDHA 2AA3A 2FHSA 3P9PA 4GD3Q 2DEUA 4AZVA 5K3FA 4FE3A 5E6SA 1I7LA 4ZOLA 3ZD6A 2ZAGA 5KTNA 3A9WA 3PGLA 2J3HA 2AG0A 1W4RA 3R8XA 4CIYA 4A1OA 3IHLA 2VNJA 1SUWA 2QT9A 3NHSA 3DSRA 5EOVA 1RQPA 5J5AA 1L8XA 3RARA 1V39A 2CD9A 2Q49A 3ASUA 3DZCA 3ZVNA 3B9RA 1ST2A 3PXUA 4TMFA 4C4SA 4BEBA 3C5VA 4UKDA 4XB1A 3CURA 3I32A 2YWDA 4CEHB 1NOJA 3MA0A 5KOIA 5E7IA 1HK7A 3V4PB 2ECFA 3B3QA 1DC7A 4K8RB 2ORIA 3DMNA 4ABTA 1WIWA 3GEIA 3WNVA 4Z4HA 3AF6A 3LKBA 1HTWA 2QYTA 2GM9A 1FQWA 1MB9A 4B9EA 1D6SA 5DDIP 5IEJA 1QO0A 2AZDA 2HRBA 3L8HA 3SZLA 4ADSG 1T2VA 1U2EA 4L5YA 5JUWA 3NH9A 1NXSA 5JNWA 3C3JA 2AJCA 5BO5A 4OBEA 1FFHA 4JY7A 1W25A 4J7XA 3SGLA 2CC2A 4AJLA 3GBPA 4LGCA 5JVDF 3GYBA 1PK8A 4EVQA 4BJ3A 1XN4A 2W6ZA 4WK4B 1I1OA 4N0MA 3GDGA 3P26A 3KR1A 1P73A 3MWDB 1JHPA 4EARA 1O8CA 2O8DB 3BMOA 4BCBA 3LAWA 5AW0A 1VJ5A 3DP9A 4RA6A 2B3TA 3S5UA 3B7PA 4PNPA 2QORA 4JJAA 5KX5F 3PFNA 4PG5A 2VK1A 2AE2A 1CWUA 4Z9FA 3T3HA 5A9RA 1XIVA 3EF0A 3RTCA 1X38A 2PUJA 5H02A 4EJ2A 2CDRA 3LCJA 1ODIA 1THZA 3MEQA 5DW0A 4REOA 3PXDA 2FPPA 4DDKA 2CJPA 4U3JA 1Y0BA 3SFZA 1I4OA 1E96A 2H1LA 3FSGA 3H9BA 3D4LA 3UJ6A 3V6MA 4RVOA 2VK8A 3KIPA 3M0EA 4PYJA 4IWNA 1G38A 3HB7A 2E49A 2R00C 4CNQA 1INLA 1BX1A 3J80A 1KWGA 1P5HA 2A84A 5FEUA 4Q19A 5HUQA 1POXA 3Q6IA 2PUCA 1KAGA 2WLSA 4GZ6A 4IS3A 1CY0A 1WZIA 3HLKA 5FA8A 4EHFA 3BH7A 1BEEA 2WNSA 3OJLA 3HKEA 1AXRA 1GGNA 1SRQA 1PL7A 4KO1S 1CJTC 1U1DA 2FMFA 1JH8A 3FTPA 1YCFA 4D2IA 2E3JA 4E21A 1CHNA 2Q1UA 3QV2A 3EZLA 3H5AA 4IZHA 2W37A 1KF0A 3R7AA 1KR5A 1UM9A 2X3UA 2ZUWA 4QDZA 4HGZA 3VU8A 4O4JF 3UHOA 5LBIA 2K7ZA 3WA7A 4K2HA 421PA 3WJ1A 3DBHA 3TBFA 1QANA 5IPFA 2IUEA 3UCXA 2WJ4A 1JMYA 1MZVA 4XIFA 5JS8A 4OQYA 3ME5A 4M1TA 3WLAA 3G6WA 3T9EA 5EE9A 4EYKA 3THWB 1SVKA 1QF7A 2WMOB 4AK9A 4DY6A 1T6ZA 1OW3B 3VPGA 2NU9B 1VJTA 4YPFA 4DCCA 1R10A 3G6KA 5H70A 1ZOLA 1CDEA 3IX7A 3E8XA 4KRYA 4BKRA 1P17A 1YJAA 4BWGA 3ZY5A 2PSDA 1TQHA 1UANA 4ZHQA 3HKEB 2YXLA 2Q29A 3O74A 2UYOA 4M3NA 5EE0A 3WDSA 4BVHA 1CR0A 2HI0A 1H2EA 4FS8A 1PZGA 3RUPA 3E9QA 4I55B 3W3ZB 1R0YA 3KT6A 4AUMA 5FHQA 2VUSA 1NM5A 5T5QA 2V5AA 1YA6A 1RWPA 2FSVA 3N2LA 2WPNA 3H9JA 3FE2A 1AXEA 4LDNA 1NI5A 4R98A 4KR7A 1YI8A 3F2IA 1XA0A 4CGYA 1TO2E 5LA6A 1VM6A 2V65A 1T10A 3VVMA 4ZQFA 5HXAA 5DNWA 3KWJA 4BP3A 1V8PA 4URFA 5C32A 3WL4A 1SC6A 2LZ0A 3K2IA 3SQOA 3JQQA 3ENKA 3IE0A 3KKNA 2GJKA 1BROA 2Q1YA 2I22A 3MS2A 1L4KA 3RS3A 1XTTA 1OGYA 3HA7A 5A5DA 2RH8A 2PRKA 2Z98A 1T1JA 2BMJA 2UZ4A 2GKSA 4ZCSA 5G0SA 1LRKA 4OBWA 1V8ZA 4GO1A 4PX3A 3WV5A 3HE3A 1JWAB 1T29A 3ESCA 1U7DA 2QQFA 4AN4A 1QAOA 3I9MA 2BEJA 3GUZA 1X2EA 4C4RA 3UA4A 3W77A 5BV8A 5GZ1A 4DC1A 3GLQA 1KQNA 3FTFA 3WYAA 2HFKA 2D7CA 4COOA 4GNKA 3UH1A 1CCWA 4CTOA 4Q7KA 4TKZA 2G80A 3WVNA 2Q0XA 3VR6A 4FD3A 3L6RA 1OTHA 2B94A 1N1MA 4FK8A 3SS8A 4YPVA 5U1PA 3Q11A 3I1FA 3Q5GA 5ECWA 4E4YA 2F9LA 3O82A 3GLFE 1QGYA 2Q5EA 4DRXA 1N6IA 1TLFA 2F8LA 1Q16A 5TF4A 1WZUA 2J3DA 3VA7A 1X7DA 1PRYA 4EHDA 3TLGA 5JXGA 4Q4HB 1KMHA 3VKFA 1C30A 2JIZA 4NBRA 3W9UA 4R05A 1XNRB 2YN0A 4WZBA 3T7TA 1N5DA 2WJWA 1JHRA 3QVTA 3I61A 2FMTA 2I9PA 2XQFA 4K40A 2QPTA 3AG6A 2QAJA 2XV1A 1LQTA 2HYDA 3AUFA 3I05A 4NBKA 3ILSA 4JXJA 4PICA 2IW1A 4JITA 5JW6A 1YVPA 1BFDA 4UNIA 1LBIA 1WNTA 2D3TA 5LDDC 2ZRLA 1JX6A 1S3SA 3RYCB 2B4RO 2J33A 4FD2A 3NIDB 1JP7A 5AVUA 4MLDA 2CUZA 3KPVA 3L6BA 4ZCRA 1U80A 5DU2A 2YYZA 1GUYA 1Y9EA 2FSHA 3C48A 5EUMA 3JATA 2VSYA 5FPHA 4NMLA 2P0EA 1Z73A 2W4QA 3TZEA 4ARZB 2DFPA 1V25A 2FMIA 3HSSA 1XKQA 5C7LO 3M1YA 3KVOA 5EJEA 1PFGA 4QEDA 3T1NA 1RC0A 1Z5PA 3DG9A 3SF8B 4C3UA 4YJGB 1MO6A 1IZYA 1NULA 3IIIA 3PSAA 4ZN6A 5LXTB 2JGFA 5CFLA 5T41A 1CERA 4NCHA 5BN3B 4BNGA 4BV9A 5HS4A 1CUAA 4RHTA 1Y80A 3W9BA 1M7BA 4D1YA 1H6BA 2CD7A 5EJ5A 4Y2VA 3CYFA 5BW8A 4INAA 1EZ1A 2BM0A 3KXIA 2OTCA 1M2NA 3AHGA 3F5DA 2Z4TA 3FOWA 3MUOA 3CXUA 4FGWA 5HCUA 1X8XA 3N7TA 4ZQBA 1U9IA 2FFRA 2JI9A 2PPVA 3FCXA 5E1BA 2NACA 3EIWA 1Z2DA 2WA2A 3EASA 4FDMA 5D7BA 5KQLA 1KHHA 1P2DA 2C7RA 2JH8A 4R1LA 4AP5A 3HYTA 3OZXA 2JRLA 4DJJA 4QDTA 1LBEA 3FR8A 3ST7A 2X4LA 3KVRA 2XOKD 5AXBA 3RHTA 5IN5A 2R8ZA 4DCOA 5LD2B 1L6IA 2BP7A 3PCRB 4LMPA 4C0JA 1XRSB 2JLQA 3EE6A 1KI7A 2RAPA 3AGQA 4J16A 5BN5A 5EYPA 1PT5A 2VP4A 1GPJA 3HCCA 1GLVA 1J0EA 2LKDA 1P80A 2W93A 3GFQA 3H17A 4XDGA 2B2CA 4PEVA 2HWYA 4URUR 4IOJA 3PX7A 2B4QA 1RCTE 4FZ5A 3TVDA 3MJSA 4NZPA 1CQJB 4DIDA 2JHGA 4M0EA 3GLFB 1PL0A 3ZCTA 2ID7A 2JFWA 4JKYA 5WRFA 1MV8A 4XYMA 5HRCA 4RPGA 1Z4JA 1F9AA 4TYMA 3OA2A 2PH1A 1WZNA 3ZEAA 1GGFA 3WLSA 5BSKA 3S3TA 2ZJZA 4JGGA 3IT1A 2H2DA 3AM4A 4WLFA 4B31A 2SNIE 3UMVA 1FVHA 1I33A 1U7XA 3NAGA 2J4CA 5COQA 1DBRA 5EG5A 2FH5B 1CZRA 4OGKA 4RADA 4RY0A 1QZUA 5ICMA 2OVFA 1XZBA 1P5FA 1Z6XA 3L82B 4KR9A 2HMYB 2PT6A 4YRGA 1PEAA 2WWHA 3C6ZA 4FYYA 3SC6A 1YL7A 2PH3A 2ZJBA 3KKQA 4OUDB 2KI5A 2RJNA 4ZAXA 1UZLA 4MGKR 2HIGA 3LBNA 3UFBA 4JBLA 2XGGA 2QVYX 2MSWA 3C14C 1RZUA 4J2HA 1RAEA 4OHCA 4ZV7A 3LF2A 1VLQA 4N0EA 5JY1A 4MUEA 3B1VA 3GY0A 3H2ZA 4MJLA 1EDDA 4LYEA 2MIIA 4CKCA 1E9EA 3LCUA 1Z4OA 3D4BA 1XFDA 1ONNA 2AJ8A 2G17A 1NRIA 4EB8A 3LCRA 2AB0A 3G68A 2WYOA 1B2LA 2ODAA 5CEJA 4CM6A 1DAHA 2C4NA 3HN2A 4MVJP 1X15A 4PC1A 5KTSA 3O4IA 4XIYA 1HC7A 4IGAA 3PDIA 2QT1A 4MV8A 2BGTA 2Y6VA 1XCGB 4REMA 4DCJA 1RXVA 2C78A 4XYBA 1E1DA 1MRZA 3L9WA 3N1UA 4CL8A 2R6R1 9ABPA 2DWCA 3ICVA 2WB2A 2A4MA 2NSLA 4RWZA 3X2FA 1OU0A 3L0CA 4L08A 3A4IA 3G2JA 3ZV6A 5TEWA 5JWOA 4BGEA 3O8CA 1RZ3A 2RSLA 2PUAA 1LPBB 3JAKB 3LPLA 2H06A 1O3YA 1KIMA 5K1ZA 1WUKS 3TLXA 2DSTA 8MHTA 3AIKA 2RMKA 2VJLA 3DDSA 4QBHA 4CEJA 4NZNA 721PA 1R66A 2HWWA 3A9CA 3P4UA 4XASA 4BUJA 2NADA 1WDMA 2XMZA 2HRQA 3KKEA 2FQ1A 4INPA 4QXMA 3PD0A 2O3JA 5D87A 1KERA 1DJMA 1N8SA 2QD5A 1USVA 2R85A 3DBOB 4MR9A 2GZ3A 2ZCJA 4N8DA 1Y82A 3L18A 1UXOA 2GPYA 2NU6B 3D3EA 3W2EA 3WO1A 3DZFA 5E4FA 4TRMA 1A2KC 2NMVA 2VF4X 3A9RA 1RBYA 2P9GA 4QFDA 3TIVA 5EIBC 1JKXA 3V1NA 3RWBA 4UPEA 2XA1A 1BCRA 5DHSA 5P8WA 2WK1A 3ZYCA 4QWWA 4D0SA 3SLKA 1TZBA 4G8JA 3EG9B 1G8PA 1G2IA 1RBQA 5BXYA 5ALGA 1GGKA 1FSFA 1OKKD 1SCQA 1S96A 3HKCB 4CDNA 2FQQA 4M2LA 1SY7A 3I58A 3N8GA 2PFGA 3HPRA 4I7EA 1CEQA 4I9UA 4J0JA 2YKGA 5D1NA 3LG2A 1GTG1 1J07A 2QL9A 4LY0A 3DBIA 1SCIA 2V6IA 1NLMA 2FR1A 1ENOA 3P20A 3B1XA 3WHIA 1V6CA 2FZCA 3DZBA 3PICA 5TJHA 4XCVA 3OOEA 2C2XA 2GNOA 3B78A 1DCFA 1MG5A 2G63A 3MBKA 1ZW6A 5EVCA 2WSMA 3RAEC 1LF5A 2JGDA 4MW6A 1LTHR 4NESA 3O2NA 1P1IA 1QMPA 1NZFA 3GD7A 4HRVA 4I19A 1A50B 4AYWA 3PFGA 3O9VA 3I6MA 2VDUE 2LIPA 3RK0A 2XECA 3C7CB 2OV1A 3VPAA 2ZCVA 3VZCA 4ZFNA 1T5BA 3MYYA 2PTHA 4K86A 5FX2A 3E22B 3AVUA 4MRVA 4Z6KA 3E9RA 1J5XA 3F5MA 4JJ4A 1KTIA 1LLCA 4Y9RA 8ABPA 1SO8A 5EQFA 2NVOA 2V59A 4BVGA 2ZYVX 1QGOA 4PGFA 4PRKA 1Z37A 4GAEA 3E3AA 1WDTA 5C34B 3CLSC 4EYGA 1CVRA 4D4HA 1ISFA 4EGJA 4CIAA 2JLCA 4CMAA 1N5RA 1PAUA 2EHJA 2GN1A 4OSOA 5F77A 4OX9Y 5CB4F 4UQLA 4M86A 3A1EA 2GBCA 4GPAA 3OPNA 4YI5A 3JD2A 1QRRA 2A0WA 1Z26A 1OMOA 1L5SA 2ISCA 4RZXA 4MR9B 1LKZA 4Y2HA 1YASA 3VZRA 5AKHA 4AG5A 5J43A 4TKUB 3UXHA 1L2TA 3FI9A 3TRFA 1SQFA 3TOCA 4YP9A 4QBGB 4OAQA 5ELLA 2I87A 3JQBA 1MW9X 3B38A 5D3KA 1JE1A 2ZAYA 4YN3A 5IEBA 3CZAA 4OK6A 1KSHA 5BPHA 1E7QA 5FTMA 2EFCB 1RAIA 1X6VA 1PG5A 2QRMA 1OOEA 4OP3A 3M8KA 2VHYA 1IY2A 2RC6A 4W8GA 1B4DA 4ND7A 1R16A 4PGAA 3VR4A 3ZJUA 4UNPA 1FJ2A 1JJVA 2CJFA 2HJ9A 1JKJA 4LNHA 2WHPB 2GAFA 4DT1A 3F6BX 2O2YA 3LT1A 3BJRA 5DISB 5BW4A 4FP9A 4KV9A 3SI7A 3R6WA 1HYGA 1L4BA 2I99A 4UARA 1Z2OX 3WK5A 4M8SA 3TGWA 2C03A 4Z9BA 3SVZA 1FYFA 2EZ8A 4HVTA 5CLFA 1RQLA 1R2QA 5TQJA 4HOYA 1XF9A 1JTEA 2QXTA 3T94A 1VXRA 3IQZA 4M89A 1NA5A 3UV7A 3QEBZ 1M34B 4YRKA 4F4UA 1S6YA 4LJSA 5KQMA 2QAGA 2QN2A 1BD3A 2FPUA 2Q9UA 1WB6A 3ENZA 4G5GA 2DGDA 1CY6A 4GR5A 4FSXA 3HFSA 4QQKA 1V43A 2FWBA 2P77A 1W8IA 3RM3A 3SHWA 4JP2A 3AH8A 1YE5A 2ZBDA 3ND7A 4YRNA 1YI0A 2MSNA 2IL1A 2XA2A 1S4QA 1VGRA 3GFSA 3KB8A 3NBMA 4IVNA 2D2IA 2ZR9A 4L2IA 4TYPA 2XWJI 1M8GA 1RQGA 5B3JA 2O8EA 5C1DA 4C04A 1H1DA 3QJGA 2BUBA 4FDLA 2CL7X 3SP1A 1P0IA 3K6SA 1MH1A 3QHAA 3QXHA 3UHJA 5JALA 3TSCA 1A04A 3Q9UA 1OC4A 4C7MA 1EGAA 4MB2A 4WCDA 4ZCLA 4OQZA 2JS7A 1YR8A 1J2EA 3PLRA 4QQ8A 4CJXA 4NZ9A 4XUGB 1BJTA 2V54A 3KHKA 3BK7A 5E3JA 5IXYA 1RYNA 2A5JA 3FMOB 1UOPA 2BR4A 1VYTA 3ZHBA 1VIYA 3D7KA 2R5WA 3PNMA 4H6XA 4R8LA 5T8KA 3UJNA 1IBLB 4RY9A 2BGGA 1D03A 4QNRA 3TCNA 2GCPA 2FZ5A 2RK3A 4IWXA 4X7BA 1NKVA 4XWOA 3ON5A 4CEIB 2ZQYA 2X1MA 5DGXA 1JHYA 2VH2A 4JUIA 1OAAA 3TUIC 1EQUA 2RB4A 1L5NA 4RTKA 3C3YA 1Q92A 3B9QA 2E4WA 4EQZA 1IUOA 3T1OA 1USIA 1E18A 4ZVVA 3JQ7A 4MUGA 3GI1A 1F06A 4FZJA 1DV2A 5IBRA 5LA6B 4B71A 3E8MA 2XR1A 2G4CA 3QOFA 3U4IA 4HSEA 1ULTA 1X7ZA 5LP1A 1W75A 5FO1A 5IM5A 1X9GA 4JU9A 2GD1O 3BC1A 3ZHRA 3R3ZA 4R81A 3NCHA 5G0TA 1VCHA 1MF7A 3AF0A 4PLPA 4CRWB 3JVVA 4IYJA 3F5QA 3TTUA 3EVEA 2G8LA 1NOIA 2XF8A 4NOLA 5EXPA 3BYZA 6PFKA 2J6HA 2J8ZA 4AY3A 1JFFA 1UPAA 3N6RA 4Y6SA 1NDQA 1C80A 1CJSA 1L7AA 1N25A 2YJ4A 3NT2A 1TA4A 5B6PA 1EK2A 4DXDA 4DUYB 4KL8S 3VFDA 4DMLA 2QSZA 4V0NA 2UYQA 4Z2AA 5BWLA 1ZOIA 3MCVA 5A5FA 2GHIA 4MQFB 4HR7A 2JCGA 4KE8A 4RH1A 4DQUA 5FCDA 2FPKA 1E3JA 1GG5A 2HA2A 3VUEA 5EQDA 2EW8A 5I7FA 2ZJ8A 3VHRA 3INRA 3WNQA 4H77A 2D13A 1XT6A 5CW2A 1DVRA 3BF8A 5ENVA 1DKOA 2BFFA 2PZLA 3GAZA 2WWIA 3IP9A 4IILA 2QZPA 4L9SA 4QXRA 4YQEA 1MHPA 4BE7B 2IS2A 1QCCA 2Q1WA 2AN1A 1KSJA 3B13B 3BIFA 4UM9B 4B82A 3BZUA 3BMNB 3ZCUA 3TB4A 3TL6A 4JQZA 1WBBA 2NOAA 1UBSB 1LNQA 5BR7A 3K1AA 1MN6A 1KYXA 3OVMA 1Z25A 4BUZA 1RAAA 4ZDWA 1PFWA 2CVFA 1GQOA 1P44A 1Y1TA 2WIDA 3PC2A 2NPIA 2B21A 2COEA 2ALJA 1ZH8A 3Q9SA 3G82C 4G5YA 2V7PA 1G8GA 1UZMA 1U3TA 3L6EA 4YRRA 4EAQA 5BSHA 4QRHA 5AW9A 2JIOA 4WN9A 4KR3A 5J47A 1I7PA 2HMVA 2I9KA 1KJQA 3NB0A 2BGJA 1BYIA 2Q5CA 1ORTA 1JB9A 2VF5X 4ANFA 2IXAA 3OHMA 2QW8A 5CCDA 2ODQA 2PANA 3EFEA 2QYOA 4R9NA 2VLBA 2L2QA 1RR6A 3NWPA 1ZI8A 1FXWA 2L42A 3JSXA 1NVEA 4L5JA 5GJWC 4WBNA 1VECA 2IH2A 2EV9A 3AHJA 3E5NA 4RZUA 2ZS9A 4JKIA 1DNPA 1HDRA 3A2NA 4R84A 5FULA 4Q34A 3RAGA 2Q50A 4DBVO 5F21A 4YT8A 5H4HA 2XB6A 1NSTA 4A8JB 2V6JA 1G4UR 4XR4A 3T5CA 3T1TA 4N65A 1EM8A 1CUYA 2RAVA 3RYIB 4NPAA 4UD6A 3KQTA 4ZPJA 3IIJA 4KFTA 1PR0A 3DE1X 3G5LA 3RTDA 3DFFA 2XI4A 2Q6TA 1CR2A 1TK2A 3GG2A 1XDBA 4RZHA 1P4HA 4GX1A 4F85A 4JLDA 5KYYA 5JDCC 2A33A 1ZCJA 3SE7A 3LVBA 2XYPA 1YK0A 1CR6A 4B45A 1ATZA 4S1WA 1OWLA 4RK1A 1YZFA 4Q3KA 2P69A 3SZUA 3EXFA 4QYWA 3LRPA 5D86A 3IEVA 2OILA 1HZZC 3FZEA 1JAZA 1OI2A 3MAJA 1CJCA 2OV2A 3NNSA 5SZJA 1P45A 1B42A 4EJSB 4G5RA 2IUFA 3WICA 3GLSA 4YCCA 5KX5B 2RHHA 1GCAA 2WAXA 5D00A 1SA0A 4QWMA 2QENA 3A9SA 1U0TA 2OLEA 4BS9A 3IUYA 5KJ6A 2C9ZA 3K70D 2BPOA 1XMOB 5ECGC 3RUDA 3SJBA 5JATA 2FZKA 1RCFA 1KDOA 1XQYA 2OMKA 3SN6A 4IHKA 1UAAA 2JG3A 5DM2A 3KQVA 3KP1A 1DFGA 1T2UA 2OECA 2ZBRA 3DVLA 4KQCA 4LVUA 4MVJE 3PTAA 4O0LA 4JU8A 1W2GA 1PJRA 4NMWA 1QQTA 2B0CA 3HJRA 5ERYA 2E5LB 3FYUB 1I01A 1ZN2A 4RIEA 2W2QA 1E7RA 3B7WA 3PPXA 3PUZA 4G5HA 4GM1A 4XDZA 2WU0A 1CNMA 3VPBA 4FYPA 3N2IA 3BTUA 1T4MA 1IZ0A 3HNRA 1F2UB 3TDKA 1G2PA 2C58A 2FRDA 3H86A 5A4FS 2VVTA 5KNCD 3DGFC 3IKTA 2GM4A 4EPRA 3D6TB 3P9IA 1H9AA 2JJQA 1I2BA 1PFQA 2A1IA 3PFCA 4NU0A 3ZKWB 4A5OA 2RH9B 3AERA 3T7JA 5B7QA 1G5FA 5T4FA 1LEHA 3QVGA 3GEEA 2FXVA 1E0AA 4X54A 1VKJA 5L4NA 2IBMA 1W85A 1JQLB 1MRSA 2C9YA 1RQ2A 1BHO1 3PE6A 4B34A 5FBVB 5KYXA 3THXA 4PYKA 3OMXA 1VZ3A 3PG5A 2DERA 5K0JA 1KYTA 3TW8B 2Z4RA 3WLEA 1HLDA 2XD9A 2F3RA 2VTKA 1GPKA 4LF9B 3COYA 4NARA 4NEHB 1TPYA 2XB8A 3W6NA 4IHJF 4ZANA 3WGMA 4EKYA 3PEUA 2LCIA 3DA8A 3MJCA 3UAZA 2M1ZA 2NQ2C 2CJYA 1J24A 3P2KA 5DX8A 5ADUS 2VXBA 5FTNA 3W6UA 4YJ2B 1KXJA 4ND1A 5ENDA 1YA4A 1DG3A 3KC2A 3W4IA 5HFNA 2RBEA 2C2MA 4TRNA 1EBFA 1DB3A 1WHTA 1WZEA 2IOFA 1NJSA 2A67A 3AFGA 1IYZA 2WVGA 4KG7A 3ZWOA 2ZKIA 4EQ6B 5KTMA 2O19A 2W6JD 3TH5A 3SIRA 2GZ1A 2EATA 1QYWA 4HS4A 3KCNA 4EIWA 1R4MA 3NOXA 1E64A 2IZ1A 5GMOA 4LA4A 3GEHA 4R0VA 3U0VA 3OX1A 4MYTA 3UFXB 5JZSA 2C97A 5JDIC 5L3SB 4UUMA 1LZKA 2PWAA 1YMVA 3K05A 3ANLA 1ZMTA 3LYLA 4BRZA 2XNDA 2RD2A 4U5QA 2A9PA 2BZ1A 3IXMA 3NHWA 4YMUA 1GFSA 2XJ4A 3WNCA 3W8FA 3D6HA 2OGUA 2PU7A 2PUWA 4U7HA 4OHRA 1N2CB 5J2TA 2VIIA 2A9VA 3BRWD 2AD1A 3JD0A 4KR6A 3P9YA 4IO0A 4WSOA 1KVSA 3WV4A 5E6RB 3IL2A 1M6EX 3CC8A 2NVBA 3EXIB 2XUGA 2VL7A 3MLEA 3PC3A 4Q5IA 5FWXA 3LP8A 3FF4A 1WUHS 4NAUA 1DDGA 2BFAA 3BTSA 3V8MA 1L4FA 1ZK3A 4EY3A 4HX5A 5F52A 2B1QA 4O02B 1VE7A 2JFBA 3GGJA 2CBXA 3NR2A 4LSWA 4OL0A 3F7NA 1VGVA 3O92A 4RBNA 4X1KB 4BQFA 3PFIA 3U3KA 4J43A 3FXAA 3RT1A 1FCJA 2OCAA 3IVXA 4G1BA 1ZJZA 3HXTA 3IB3A 3KTOA 4UTRA 4OBXA 4YECA 3U3OA 1DXOA 5AXCA 2BFNA 3C2QA 3WWEA 4AJIA 4DBZA 1QRAA 3NEYA 1PX0A 2O2ZA 4C0HA 1SKBA 1U02A 2XMQA 4WN9B 2ZRAA 3HYRA 5GONA 4EL5A 5JC1A 1RYYA 2VYCA 1XDUA 3R3YA 1J8FA 5ALKA 1JFLA 2ZI6A 1D4OA 4D8VA 1BDHA 3IHKA 2YQ4A 3MWLA 4KE6A 2HV8A 3D3WB 3GJ6A 4WLNA 1T13A 4C0KA 4TYWA 1OLXB 3PFBA 3DZHA 4HDCA 4IH9A 2PO5A 1QU2A 3REQA 3BBPA 4HTFB 4OTZA 3ZIDA 1MP0A 2ZWVA 3L4BA 3RS9A 1P4GA 4UUBA 1M1XB 2FPWA 2JD2A 2O7NA 3KFVA 3I9V6 1Q0LA 4U02A 1QZ3A 3QH4A 4B0PA 2JIQA 1XCMA 4TWIA 4BN0A 2IF2A 2D7DA 2QGFA 3PEYA 3BH0A 3IBTA 4F7WA 1H66A 4S0XA 4EYQA 3NTOA 4WBXC 5E6SB 3U44A 1EAMA 4I4IA 1ARZA 3PNVA 3H18A 4EHJA 1A2OA 5CU7A 4HHEA 2IDJA 4PZCA 4AJKA 2O23A 4GPTA 5CURA 1K2VN 2FUNB 1YHZA 2ET6A 1BHSA 4JT2A 3BORA 2FOXA 1QG0A 4Q9AA 1E6EA 1LSOA 2KMLA 3LH5A 5JZVA 3JVUA 2CDBA 2IXFA 4G8DA 1Y7LA 3PR1A 4RW0A 4PSAA 6LDHA 3AV3A 1Y3CE 1SUFA 4LVNA 4NBLA 4GZLA 4LZOA 3REFA 4RDXA 1RLJA 3EOBI 2BEWA 2X9GA 4ZAZA 1X3LA 4PHGA 2FWPA 3M6UA 2OYSA 3NW9A 4G23A 1AKEA 1RRVA 4GF5A 1V5EA 3EGXA 2WDPA 3UWKA 1PR5A 5DI3A 1CS4C 1ZVVA 5IAJA 3RSOA 3HBAA 1G6OA 2BGLA 2FKNA 2RONA 3C7DB 1F6WA 4LRUA 1QH9A 4UBMA 2XTNA 1KOFA 1G59A 3ET5A 1DO2A 3RSGA 3CHYA 5LIRA 1AKQA 5AXDA 1T9KA 1IDOA 3DTVD 3MINB 3K96A 5DX1A 2P2DA 4O63O 1RIFA 1GU0A 2Z43A 3DAOA 3KZVA 5KYWA 4WXRA 2F8TA 1XE3A 3RWOA 2AIRA 2EJBA 5ILQA 2EZTA 4YMTA 1ZQ9A 1H1LB 1M74A 4Y8VA 4ZMSA 1OBFO 4WH0A 2CE7A 1E9VA 4MKIA 2O54A 3DDZX 3WLFA 5KC8A 5JSFA 3DL7A 2X5XA 1D7AA 1NQXA 3UMJA 2JDIA 3NLLA 1G55A 4G0XA 1S2MA 5E1DA 3TDMA 4FMDF 4P7FA 3VHXB 1ZRMA 1RZRD 3WB2A 4JBNA 3EC7A 4OXQA 3AONB 3MHTA 2EOAA 3HDGA 4C01A 4HQOA 1W93A 5F2OA 2WF6A 4FKBA 1TYAE 3AU8A 1ZOOA 2MDTA 1B3RA 4D44A 1VXOA 5KJEA 3DKIA 2BDTA 3PC8A 4MCAA 2GWRA 2W8BB 2CLOB 2CZCA 3EXAA 4ND5A 2JFZA 1IZZA 3ONDA 4W5TA 1HXHA 1U0HC 3QF4A 1ZA2A 3JALB 2VHEA 1QPGA 4NSNA 4K6HA 1JEAA 5G53C 3T52A 4DARA 1VP9A 5HUHA 3WKBA 1EUCA 1H22A 5EMNA 1QHSA 3FYSA 1MB4A 3GDWA 4IBOA 1IQPA 1SCAA 3SVLA 3OZSA 3UGJA 4E3WA 4Q1FA 2V96A 3J7AC 5EJGA 1E0JA 3H0CA 3I01A 3WIEA 1E1MA 2PWZA 5I5EA 5BSGA 3EEFA 1ZUD1 3RK4A 1CYEA 2IPOA 1TKRA 2QQGA 4ZV4A 5FPPA 1Y7HA 1MIHA 1TTTA 1OBOA 1U2DA 3MTBA 2DC1A 1NUAA 4MCIA 3LS2A 3OJFA 5AJUA 4P32A 5A62A 1NVVR 1Q0ZA 1X86B 1MX3A 2G9VA 5EERA 5DPMA 3W5AA 2Q4EA 4XM0A 2FN3A 4TUYA 2J46A 3AVQA 5DLPA 2JFVA 3CW9A 4ZT4A 3TRKA 1SG6A 2QAGB 3NHMA 4Q9IA 1JEYA 1AGNA 3AEUB 3I6IA 3NXKA 3WGYA 4JR1A 4A6PA 4KLAA 5FB3A 4PN7A 1V6SA 3EG9A 1J7JA 1UDWA 4Z7OB 1E6CA 3ZQKA 4DC9A 5I7RA 3MLBA 2IVZA 3B82A 3NTVA 4M7WA 1T0JB 3WWYA 5IDXA 4JI8B 1V48A 4KBGA 1NIJA 1UCFA 2VJYA 3H4MA 3IEPA 1Z56C 3PHHA 4FC6A 2P9TA 5D51S 3LW7A 4KQ2A 1GT91 3GBSA 5G02A 2PWPA 1YACA 3AVTA 5BRNA 2RGWA 4E2XA 1YB7A 1UBLS 3QU9A 1VBMA 1CNEA 5EIWA 3T06B 3RREA 1BFUA 3JWIA 4L8LA 2LNDA 3EHEA 4XFDA 4O2BF 1FMCA 2DPGA 4I1PA 1EFLA 1RBZA 1Z6QA 3PWZA 4CKWB 3FVTA 2CHUA 5DHAA 3U4MA 1Q6YA 1R00A 3EJ6A 1O6ZA 1QR6A 2I2WA 3D3KA 3NJ4A 4O4JA 5JJLA 4QU8A 4E4TA 3BMNA 4EA9A 1P3Y1 2PSJA 2YY7A 3GAMA 3GJXC 2X2FA 4KGXA 2PZEA 3VR2D 3DXFA 5A1JA 2FW9A 2YTZA 4FGSA 5AMXA 1TLTA 1ZD3A 1RRPA 1UPTA 4FGZA 4B3IA 4WY8A 1ORVA 2O5RA 4B6GA 1Z3IX 2CJWB 2Q41A 3T34A 2JAWA 1X19A 4NHEA 3I8OA 4QHYA 3SMVA 3W5UA 4M0PA 1N6HA 4MA0A 1N32B 2QN8A 1MW8X 4P35A 3A36A 4WFKA 4HEJA 5EP1A 1IPEA 1NKSA 2ZJ1A 2PS3A 3NKFA 1OGIA 2ETXA 2HDNB 3ENQA 5K09A 4LOJA 3CLUC 2Z57A 3WRYC 1JHZA 1MRNA 3CSSA 3F6PA 4JI6B 4BLRA 3LW8A 4PQRA 1M0TA 3W6OA 1CTQA 2EWVA 3IP7A 1LSUA 1FFCA 1N1GA 3L7LA 3QPBA 2DOKA 4QHSA 2CMKA 5HWSA 1QH8A 3A6KA 1J8DA 4L3OA 2ZRCA 2GN2A 1QTRA 2XUJA 3OPXA 3OSUA 4IIGA 4KR0A 3DVSX 4JS0A 1W73A 3FYDA 1NC3A 3EVNA 3CZPA 3K0AB 3MPOA 4IAOA 4Z99A 1QUEA 5F51A 4XRRA 4UBKA 3S28A 1EWKA 3SZOA 1N6KA 4J8PA 4B3SB 3R74A 4EBBA 3PU6A 1KKUA 2GPSA 3FYTA 1E3TA 1LSJA 1L5HA 1ECCA 2VRNA 5D6OA 5K6AC 1YOVA 3TINA 1FS4A 2JDID 4BNKA 3DLCA 2HQSA 5AM4A 4DILA 3E82A 2CZGA 3GIDA 2YWBA 4S3MA 4CT4B 3QXJA 2C7BA 3HC7A 4FZVA 1WMAA 5A1TA 1G21E 2C3UA 1J0DA 1QDLB 1Z2PX 5CDHA 1U1FA 1Y7TA 2DQ4A 3BMXA 4TTTS 5FKJA 2OHFA 4TRRA 4BECA 2OENG 3PDUA 3ZBTA 5MGNA 1YS6A 1RHJA 1E2HA 4H0NA 4TQAA 5BUCA 3ONWA 2GF9A 4D0GA 3A37A 1FYEA 4WNCA 1HNNA 3UGTA 4AF6A 1R0LA 4KQKA 4WD3A 2YZ7A 4G85A 4TXMA 5LZ2A 3UYKA 4LVCA 1ZMXA 2ORVA 3Q0TA 3H99A 4GFDA 4D9BA 1XLUA 5JU6A 1YJQA 3ZHTA 2HUPA 4ESOA 3ZEIA 4OI0A 1XZDA 2PRIA 2OLJA 4QD3A 1QGUA 2OVBA 1U3CA 4LGMA 2OHJA 3DE7X 5AKGA 3ZE2B 1HOXA