3WX0A

The crystal structure of d-lactate dehydrogenase from escherichia coli
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
320
structure length
303
Chain Sequence
KLAVYSTKQYDKKYLQQVNESFGFELEFFDFLLTEKTAKTANGCEAVCIFVNDDGSRPVLEELKKHGVKYIALRCAGFNNVDLDAAKELGLKVVRVPAYDPEAVAEHAIGMMMTLNRRIHRAYQRTRDANFSLEGLTGFTMYGKTAGVIGTGKIGVAMLRILKGFGMRLLAFDPYPSAAALELGVEYVDLPTLFSESDVISLHCPLTPENYHLLNEAAFDQMKNGVMIVNTSRGALIDSQAAIEALKNQKIGSLGMDVYEDVFRRLSACHNVLFTGHQAFLTAEALTSISQTTLQNLSNLEKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
publication title Allosteric D-lactate dehydrogenases from three Gram-negative bacteria
rcsb
source organism Escherichia coli bl21(de3)
molecule tags Oxidoreductase
total genus 100
structure length 303
sequence length 320
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.28: D-lactate dehydrogenase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wx0A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wx0A01
1P1IA 3PXXA 4PZEA 5GZ6A 1NHWA 1NPTO 3EY4A 3OA2A 3BMCB 4HFNA 1WMBA 3TRIA 1EVYA 2PK3A 3WBBA 5G0WA 4M55A 1J0XO 4BOYA 1R16A 1OC2A 3KSZO 4XJSA 5DCWA 3WIEA 2YZ7A 1H2HA 5J23A 1PJ4A 2O48X 1JKFA 5TS3A 1FDTA 5DOZA 1EMDA 1BG6A 2VQ3A 3I4CA 3BTVA 2I5PO 3WIDA 3I4FA 1HKUA 2B37A 4CMHA 2H6EA 1Z73A 2V6FA 4UAGA 4D42A 3DOOA 4CMBA 1ZKMA 1RJWA 2DM6A 1Q2XA 5DCUA 1K3TA 1F8GA 3I23A 3JYLA 2NVUB 3GK3A 3GMSA 2C5EA 4MVJA 4WPGA 4XQEA 3RUCA 4DXHA 4PLVA 2NTJA 1X0VA 4CM9A 2RAFA 3VH4A 3DBRB 2OXIA 1JKIA 1GCUA 2UVDA 4DIFA 3KO8A 5CP8A 1KC3A 3MTJA 3I9OA 3GR6A 3CPSA 4R9SA 5I7SA 1AGNA 3PWKA 4WK6A 3U5TA 2Q4BA 1FDUA 1X7HA 3H9JA 4HWKA 1TLTA 3TOZA 2AHRA 3NT4A 3KXDA 3H2SA 4OJNA 5CHEA 2GUGA 1FJHA 1J5PA 4H7PA 2IZ0A 1N92A 4YT5A 4CLOA 1ZH8A 4KUHA 3WSVA 1I01A 4PLHA 2X22A 3INGA 4P4NA 3X2EA 3H9GA 2DU8A 4EEZA 4YQZA 4JIGA 3QIVA 3E6AA 5L7YA 3TFQA 2P5YA 5F1OA 3ZWAA 4CMGA 1A71A 1UXJA 4C4OA 2EXXA 3GLQA 1P3DA 5JC1A 4TROA 4CMCA 3L6DA 1P33A 1UDBA 3FPCA 4NK4A 4PG8A 5EL0A 4E6PA 1GADO 3UICA 4WLOA 1BRMA 2C59A 1I30A 3AFNA 1V3TA 3NKLA 4J49A 3JV7A 4BNHA 2WM3A 4BKRA 3I6QA 2EJWA 1QYCA 2D4AA 2Q1TA 4FB5A 3OH8A 4PFJA 1K89A 4B7CA 3DBLB 1P9LA 4ND5A 3AK4A 2OO5A 1ZK4A 1A27A 3GDFA 1YJ8A 1RKXA 4BKUA 2GYYA 4BO8A 2DLDA 4BUCA 4E21A 5IJZA 3PGJA 4E4YA 5JAMA 4DYVA 4EUFA 3VPFA 3ZWCA 3OHSX 3WNVA 4YA6A 4IDDA 1Y5RA 2Q3EA 4HP8A 3P5SA 3WGYA 4D46A 3V1YA 5FWNA 5B1YA 1WVGA 2DQ4A 3GC6A 3H3FA 4R54A 4ZJUA 3KTDA 1XQ6A 4M87A 5KVSA 2EW8A 3NV9A 5T6BA 1NXQA 3JD1A 4FFOA 3UN1A 4YVFA 4PIVA 1Q0LA 4MDHA 3RVDA 1DOHA 1I3NA 4ZHSA 3PYLA 1N7GA 3O8QA 4J1NA 4WE3A 1HZZA 4AJ4A 1QP8A 5JCXA 5DNAA 1DPGA 4W9NA 3BTUA 1PJSA 4PCVA 3VH3A 4D7AA 2Y66A 4E2XA 3ZWXA 3WGZA 4BKQA 1N1EA 1A4UA 1E77A 2Y1CA 3FNHA 1E3WB 3FNFA 3VKUA 4NU6A 4WOJA 4DQUA 4RF2A 5JAQA 5EJ2A 5DULA 2X23A 5C37A 1EVZA 1T25A 4FOOA 1H0KA 5CDYA 1GUZA 3V8BA 3VDQA 1PEDA 1U9JA 3HG7A 3PFWO 3KV3O 2B83A 4ZQGA 3HN7A 2CUKA 2YFQA 4IBOA 2IE0A 3AY3A 1VJ1A 4E32A 1NPDA 1Y8QB 3BMOA 4LGVA 1YDWA 2IYOA 1VL6A 1ZK3A 1OC4A 1UH5A 2AW5A 4GWKA 2DAPA 3LT4A 4E2ZA 4WLUA 1H9AA 3TSCA 4II3A 1KC1A 4RO0A 3WS7A 2GN9A 3HDHA 2IRWA 1YB1A 4XKJA 3WX0A 2ZB8A 3D3WB 4Z9XA 3GAZA 1YS4A 5DZSA 3T7EA 4I5DA 2PWZA 2CZCA 5KTKA 3KLPX 4W9NC 3JQGB 1EK5A 2GCGA 3DZJA 3GVXA 4D0SA 2FN7A 1G1AA 2IXAA 1M76A 4LISA 2IDZA 2EEZA 2C07A 3PHIA 3KSUA 5B12A 2AA3A 2EP7A 2OP0A 3HUDA 1GV0A 3EYWA 1YJQA 3GA0A 3QJ5A 4GGPA 5A3VA 2BFPA 4AG3A 1EQ2A 1ZIDA 3BTSA 2J3HA 4L9RA 1MC5A 5AYVA 1U2GA 3NDIA 4QFCA 4ALNA 1HE5A 3UKOA 5A04A 3GEMA 1LLQA 2PKRA 1UXIA 1NVGA 5TGDA 3TZCA 4N54A 2DKNA 2NM0A 1GU7A 5L7TA 3W8DA 4MP6A 3JTMA 3P2YA 3LC7O 2XXJA 4RPGA 4A5OA 2I99A 1R4NB 3WGTA 3D4PA 1Y9AA 2Q46A 3PDUA 3ZWBA 2JL1A 3M1AA 3LZ6A 1N5DA 3GGOA 1PIWA 1Q7CA 3VH1A 4E12A 1KERA 2PNFA 1N8KA 4PLCA 3QHAA 3BHMA 4ITUA 4E5NA 3PJGA 2C54A 2PD4A 4BNVA 3MOIA 3K31A 1NX6A 3AM4A 3QSGA 4CLHA 4NIMA 3ANMA 4RF3A 1HDZA 5DDIP 1X14A 1SB8A 4FS3A 3HQ4O 2P4HX 3ABIA 4CUJA 2PR2A 2NU8A 2V6GA 3WFIA 3IJPA 4PVCA 3DMYA 1HYEA 4JROA 1FDVA 1KBZA 4OAQA 1C3VA 1T2CA 1Q0HA 1X0XA 1NFFA 1V3VA 2VNSA 5A5FA 2DFDA 2EGGA 4FIZA 4DVJA 2IEDA 2P68A 3PYMA 1TXGA 2NSDA 3SEFA 2HK8A 1PZHA 4OXKA 4XDYA 3N58A 3PQEA 4CQLB 3F5SA 2O50A 1HDXA 2PFGA 1U5CA 1KVSA 1RM0A 3AOEA 3BTOA 4J3FA 3W6ZA 7ADHA 3GDGA 4YRBA 3A28A 2GPTA 4TKMA 4Z6KA 4RVUA 2VRBA 5ER9A 3HSKA 2A35A 2HUNA 2OL4A 5FI5A 4ALJA 1DIHA 4DPMA 2LDBA 3JQAA 1B16A 4MIEA 1LI4A 3ZNPA 4HKTA 2V65A 3AI3A 4J6FA 4FR5A 3BIOA 1V3UA 3S2FA 1YKFA 3NT5A 3WMWA 3OM9A 3BMCA 2WDZA 1NQOA 3GOHA 3ADPA 4PZCA 1SPXA 5JY1A 5G4LA 3L77A 2Q50A 1BW9B 1KEUA 4XA8A 3GGGA 4CLEA 4FN4A 1R15A 1E1NA 2DBQA 4GSKA 5T8KA 2GERA 4IZHA 1P44A 5IF3A 3AW9A 3AOEC 1TT5B 5G4KA 4WNCA 5G0SA 1CWUA 4NMHA 1LQUA 2VWQA 4MVJH 2UV8A 4HADA 3EUWA 1LDBA 4PGFA 1LSOA 3ICCA 4XWYA 4BS9A 2GASA 2AE1A 3MWEB 5AXCA 2I9PA 2QYSA 3TN7A 3KYBA 3C3XA 3N7UA 4GMFA 5F1PA 3F9IA 4D3SA 2GSDA 2RHRA 1EE9A 2FZEA 4DMMA 2RBEA 4FJ0A 1LA2A 5EQFA 3KSDO 2AMFA 3OQ1A 5BSGA 2O3QA 3DBRA 1M67A 3DL2A 3Q9NA 4MP3A 3CH6A 3DHEA 3VHRA 2NU7A 3M2TA 3S2EA 4TZTA 4QO7A 4M1QA 1VKOA 4GGOA 5DBFA 1E1KA 5THKA 4TRNA 1G0OA 4J7CA 3WWYA 2Y68A 4IPTA 3EHEA 1ZO8A 4ZA2A 1VC2A 5T8KC 9LDBA 3ONFA 1Q1NA 2XAAA 3HDJA 1SMKA 4GVXA 2VN8A 5COAA 1LDEA 1OMOA 1Z7EA 1R0SA 4D43A 3RUDA 5ADHA 1PR3A 3BMNB 4XYLA 5JDIA 3D4OA 4P4LA 2DT5A 2PZKA 3BMQB 4FGSA 1PL8A 3W6UA 1GQYA 4L4RA 4FDAA 3CTMA 1T1RA 2JD0A 3DR3A 1PJ2A 3ZWOA 1HDCA 3QVTA 2NTVA 3PWSA 2P5UA 1PGQA 2C7GA 3CZRA 1YONA 3GN2A 1CF2O 4L75A 5BSEA 4PG7A 4P22A 4GL4A 3WNQA 1CQIA 1PGNA 2D8AA 2AQHA 2JCVA 3DZHA 1WWKA 2HO5A 4FPXA 4IDCA 4KUGA 4RZHA 4Y8VA 1ZK2A 3VKVA 2B4RO 3HADA 3JD3A 4D3FA 4W99A 1ZK1A 4IDAA 3WB9A 1UUFA 3GNSA 4CUKA 4MO2A 3H3JA 1EBFA 3GHYA 3DZKA 3GG2A 3MJSA 2VZ8A 2JD1A 2RIRA 2SCUA 1HDGO 2XOXA 4IJVA 3FN4A 3W4JA 2YHIB 4NDNE 2WTBA 4M54A 4BO0A 4LMRA 5JDIC 4AJPA 1X1TA 1ZSYA 2NUAA 2VWGA 1T2EA 2X0JA 1IZ9A 1PZGA 2Q49A 1NR7A 5A03A 3PQFA 1YBVA 1A9YA 4K9DA 1PX0A 2JD2A 5A06A 3QV1A 4BNLA 4XDZA 1B2LA 2OP1A 4TRMA 2GO1A 2WE7A 2D5CA 2G0TA 4EJ6A 1U1IA 2XF8A 3DWFA 2CMDA 4RVFA 4U7WA 4NH4A 4FJ1A 3ZU4A 5A9RA 5C3MA 3PHHA 4XQGA 4A7PA 4D41A 3TFOA 1OI7A 2IYPA 1WNTA 2JHGA 2HK7A 3ZHXA 3PWZA 3UOGA 2HRZA 1QRRA 1X13A 4Z9YA 1RM4A 1JTVA 4DL9A 3IOYA 4QO8A 1PGOA 4J90A 1SB9A 2ZQYA 5A3JA 3C8MA 1NAHA 4NJMB 4E30A 2FWMX 3IL2A 4NG5A 3UVEA 3H9QA 3QE3A 4XQCA 3M6IA 2J6IA 2ZK7A 4ESOA 1DHTA 3RUAA 4K1LA 3QWAA 3B1JA 3HDYA 3T7CA 4BGUA 1CETA 1ENZA 2HQ1A 2J5QA 2NTNA 1R4MA 1Y8QA 3E9MA 3GZNB 3JQ8B 3GPIA 3BHJA 4XR4A 1H94A 1JU9A 3RC1A 1XA0A 1PGJA 1XWFA 4Q9NA 1XKQA 1W73A 2FSVA 4J1QA 4KTTE 4J2OA 3NGXA 5TIIA 1T2AA 2YDYA 1B7GO 2BELA 1QYXA 5BQFA 2BHLA 1J4AA 2JFFA 5KKAA 3D3WA 4IQ8A 5HTOA 3I9JA 3QVSA 1ZBQA 1YOVB 4A73A 3ZWMA 1B0AA 2FP4A 1K2WA 1MC4A 5F3RA 2XXBA 3IS3A 3JQGA 2EERA 4DUPA 5A9SB 1KEWA 3SJ7A 4B79A 4D45A 3HN2A 2Z95A 1LRKA 2QZ9A 4AVYA 4EJ0A 3DB2A 4GLOA 1H6BA 1KVTA 3WYEA 1HF3A 1O95A 3GVHA 2CDBA 1B14A 4DIOA 3R6DA 1AUPA 2J8ZA 4LSMA 3I9KA 3R1IA 1CIVA 3RC7A 5CEEA 5JAIA 5AVOA 2Z1MA 1VE9A 2X58A 4GX2A 3JYNA 4DPKA 1K6XA 4ZU3A 3QVOA 3ZV6A 4GX1A 1N2SA 1QYWA 3CSDA 2ZJ1A 1YQXA 1ZXLA 4RVDA 3TQHA 5KOIA 3GVIA 3IC5A 5JCJA 4J43A 4F6CA 1GYQA 3OJ0A 1GPJA 4A26A 1UDAA 3IMFA 4RLSA 5EINA 5BSHA 2Y1GA 4J9UE 4RZIA 1Y1PA 3GNQA 3GGPA 4GKBA 2BF7A 2OGUA 1BXGB 1E6UA 3HNPA 2X0RA 1UP4A 3O4RA 1XEAA 3E5MA 5I7EA 2V6MA 5L3ZA 2I66A 5I8WA 1Y7TA 4YJFB 5H83A 4WCFA 1I2CA 1NP3A 4RGBA 3E48A 2Q1SA 4NPCA 4DA9A 2WD8A 4TRJA 4CLDA 4FFRA 1X1EA 5JMWA 2BKAA 2H5LA 1WXDA 4YT2A 2VUSA 1Q7BA 2R00A 2FR8A 5C7IO 4NQZA 3NDRA 8LDHA 5DBGA 1U3UA 1PS8A 1CJCA 3OFSA 2BI8A 3WGOA 3DBVO 2Y0EA 4IDBA 5GMOA 4ZICA 1H93A 2C82A 1ZMOA 1O89A 4MJLA 4D3DA 4YYZA 4EEXA 1LC3A 4NU5A 4WEOA 1S6YA 3H7AA 4CODB 3ZNNA 3WGIA 4H3VA 1HSZA 3AU8A 3COSA 1H5QA 2QX7A 2DFVA 2JHFA 3IAHA 4WLEA 4CQLA 4E5MA 3HHPA 2AQ8A 5L40A 3RIHA 2O3SA 2JCYA 4R4JA 3HE3A 3MCVA 4BMNA 4CMEA 5L51A 3JD2A 4R1SA 3NDJA 1E1MA 3OP4A 3D7LA 4UVDA 3JSAA 3A14A 1AXGA 4GBJA 4F6LA 1QXSA 1LQTA 4MVJM 2BFAA 4OOFA 3VPXA 4UREA 4WCFC 4IS2A 5KCZA 2HMUA 2DUWA 2VHZA 5JO0A 3CE6A 3KYDA 1KETA 1PQUA 1LDYA 2ZQZA 4M86A 4ZD6A 2C0CA 3ZWWA 2B36A 2H63A 2W2KB 2PZJA 1A5ZA 1YL6A 2BGMA 2R00C 3H8VA 5GY7A 3UGKA 1DC6A 4GWGA 5LDGA 1N9GB 4YAJA 4TVOA 3GRKA 2WYVA 3IP3A 4GX0A 3L4SO 5K6AA 3DBHA 4MINA 1IB6A 6ADHA 1YH3A 1L7DA 1E6WA 3VZSA 1LLDA 4CMIB 4O1MA 4JP3A 3BA1A 1NPYA 3ZWYA 2A94A 2X5JO 3QQPA 1RM5A 1K6JA 4N5LA 2ET6A 3JQFA 1RPNA 1GD1O 2B0JA 1TT5A 4DREA 1WMAA 3V2HA 1BHSA 4CMEC 1YQDA 3EGOA 1U7TA 1Q7GA 4ND2A 3JQ7B 1TI7A 2WEKA 3Q11A 4IZIA 4YJDA 3RUIA 4TZKA 4BNTA 1B3BA 1Z6ZA 4UEOA 1B8PA 3AUUA 4PRKA 3K2BA 4EUEA 1Z45A 1HRDA 4BO3A 3KRTA 1LRLA 4LMPA 4PLZA 5A5EA 3GN1A 4CM8B 1ID1A 1E3SA 4HFRA 4IGEA 3ZHZA 5JE8A 5K6AC 3RBXA 1HDRA 2AEFA 4B3IA 3E03A 4RQUA 5DP2A 2C2YA 4BQPA 3ZWVA 2DUUA 4L76A 4OKIA 2X9VA 1PL6A 2I76A 4RORA 1XGKA 5TT1A 2GZ3A 4HBGA 4HUJA 4AJJA 1X7DA 3JQFC 5L45A 2Z1NA 2B5WA 4NNJA 2IODA 3KB6A 3PIIA 4JN6B 5I9MA 4A27A 4ALMA 1PL7A 1SBYA 2GN4A 2P9CA 2Q99A 3BMNA 4U0JA 4LRTB 4KZPA 3WOHA 3DZBA 5CFZA 3DTTA 3JYOA 4J0EA 4J7UA 2GN6A 1GTMA 3H5AA 1NQAO 3GUCA 4OQZA 4M8SA 1LDMA 2HKIA 1OZAA 2UAGA 3RC2A 1MV8A 4CL3A 3TZQA 4R3NA 4H16A 1ZEMA 2G82A 2FPIA 5G0TA 2JFGA 1M66A 3C1TA 2OMEA 1YGYA 3E82A 4LVCA 3ZWPA 1SEPA 4ZQHA 2X7HA 1ISJA 3GEGA 3D5TA 1MA0A 4R1TA 3WQRA 4E13A 1QKIA 1ZSVA 3BHIA 3WJAA 1IHXA 4JJIA 5JDCA 2E48A 2VOEA 4J7XA 4CMKA 1IYZA 2W2LA 3JQ9A 4YJHA 3G79A 4ZQEA 2BMAA 1O6ZA 1NQ5A 1ZSNA 5HS6A 1U7HA 5KVQA 3TOXA 3P7MA 5TT0A 1B8VA 3U3XA 3W1VA 3ETEA 1YB5A 4WUVA 2IZZA 4UULA 1E5LA 4WASA 2QHXA 2FY8A 2PD6A 1ADFA 1C0LA 4IJKA 4RPLA 3KEOA 4L4SA 4BO7A 3PFFA 3DEYX 3PZBA 1LX6A 3BZUA 4R51A 1AN9A 5KVVA 2Y1DA 1ENOA 3VH2A 4Q3EA 2BD0A 1H6DA 3JYPA 4JXKA 4PVDA 1GV1A 5EN4A 3HJAA 2QW8A 4BGIA 4BNKA 3WGGA 3HZZA 2EKQA 1GUFA 1IY8A 2O2SA 4INAA 2C20A 1ZMTA 1AE1A 4IQGA 3MJ4A 4LVUA 5COBA 2OUIA 4O0LA 3RFXA 4LW8A 1XQ1A 2G76A 3ROMA 5IAAA 1HLPA 5KVCA 5JDCC 3S1LA 3WFJA 2J3KA 1SOVA 4WJZA 3JQ9C 3B20A 5IG2A 4DPLA 4NJMA 4ZRMA 5KJ6A 1B3RA 1EVIA 4R69A 4GVLA 1QR6A 3KYCB 5CG2A 1MX3A 2Y05A 2HMTA 4JBIA 3WWZA 4I5EA 1XDWA 3CEAA 1YQGA 4OXNA 3TNLA 1IZ0A 4B4VA 3GZNA 3JQ8A 4AL4A 4LCJA 3TZHA 1ISFA 2PGLA 4I08A 2Q2QA 5HS4A 4OMUA 1H2BA 1L1FA 3PP8A 3WLEA 2G17A 1QG6A 1NYTA 5A4DA 5C5IA 3F46A 5DP1A 3WYBA 4K26A 2PH3A 4BB5A 5JS6A 5U9CA 1YWGO 1DIBA 2X9GA 3AI1A 4CQMA 2Y99A 3NUGA 5AOVA 4B8WA 1IUKA 1WZIA 1UAGA 1YOVA 1O8CA 3K30A 4FFLA 3VZPA 4S3MA 1I3KA 3DZIA 4UUNA 4CPDA 3D3EA 2E82A 2A4KA 3OEYA 3OJOA 4YB8A 2A92A 3CMCO 1ARZA 1NAIA 3QWFA 1KOLA 4BKPA 2Y1OA 2O3RA 4UVEA 5JW6A 2GRAA 2VYND 4BO4A 3L9XA 3ZN2A 3L0DA 2ZCUA 2D5AA 3DAFA 3WGHA 3UCEA 4J16A 2VOJA 1BSVA 4OO3A 3C1AA 3G49A 4L8VA 5AXBA 2Q1WA 4PG6A 2VRCA 4XGNA 5I7FA 4UVGA 4IJUA 4JP2A 5BNFA 1I32A 1HTBA 1Z82A 2ZYDA 5BSFA 4JBHA 3E9NA 4BNIA 3DHNA 3PK0A 1SC6A 3DONA 4H15A 4EITA 2J5KA 1V6AA 1NWCA 3K8ZA 2FHSA 5JLAA 4R3WA 3VDRA 2Q1UA 4PG5A 1I0ZA 4YACA 3ZU2A 1BXGA 1E7WA 1PJ3A 1J49A 4FQ8A 3ONEA 3O03A 4P8RA 1B8UA 2DTEA 3EAGA 1NFRA 4YJFA 4MPDA 1TT7A 4BNMA 3PEFA 1P74A 4CLXA 3INTA 1OBFO 4XB2A 2HSDA 4RVSA 1K0UA 3H2ZA 2C29D 4QT0A 1CQJA 4XIJA 3Q9UA 5CEJA 3K96A 1T4BA 1ZW1A 1WAMA 2YHUA 5COQA 3IDSA 2NNLD 4U8GA 1XELA 3H9EO 1YVEI 3QWHA 4KWIA 3PZRA 4DMLA 2VHWA 1HT0A 4MKZA 3RC9A 2VUUA 2HDHA 2R2GA 3AM5A 4RCVA 1DDOA 4XGIA 2I67A 2PZLA 1PSDA 4ONEA 1JW9B 3D1LA 4UVHA 4BNNA 2EV9A 1ZVMA 1E3EA 3VAZA 4B7XA 3UCFA 4IGFA 2X8LA 1W0CA 3IKVA 3RD5A 4BQRA 4AJIA 2YY7A 1GPDG 1HLDA 1KVUA 4FBGA 1C1DB 1DJQA 5HBRA 2IXBA 3FHLA 1MFPA 5KJ1A 4HNHA 3JQEA 4IDEA 2VHVA 2DTXA 3E18A 2Y0DA 5ILGA 1JAXA 5F21A 1EUCA 3TWOA 4DQXA 1PZFA 1WDLA 1NNUA 1N7HA 1PQWA 3DAPA 4XRRA 3K5PA 1IL0A 5ENDA 5B4TA 5A9TA 3B1KA 3RAJA 1NQTA 3H6KA 4K6CA 3OETA 4YAGA 1CYDA 4N5MA 4W6ZA 5DOVA 1NVMB 1PWXA 1ZUD1 4E3ZA 2GNAA 5T57A 3ZV3A 2B35A 4Y98A 1DO8A 4PLGA 1PTJA 3F5QA 4WOKA 4Q3AA 3DAGA 5IN5A 3ZHYA 1EFKA 4BL5A 2O23A 5IXSA 2HMVA 5CEFA 3PJDA 4WCDA 1DJNA 1E3LA 2WSBA 3G0OA 4Q3BA 5TJHA 3T4EA 1WW8A 3SLGA 2YW9A 1XCBA 3KEQA 4FW8A 3VVCA 4G5HA 3FF4A 4A2CA 4CV3A 4YR9A 3LT2A 2VYVD 3HB4X 3NGLA 4CMJA 5IDWA 1PS0A 3GVCA 3PLRA 3GFGA 5ES3A 3JQ7A 4YQYA 2YV3A 4B3HA 4EGFA 4PN3A 3ENNA 3RJ5A 2I3AA 3ZU3A 1T2DA 1TA4A 3R3SA 1UDCA 3GRPA 1DXYA 2NVUA 4J91A 2Q2WA 2PD3A 4CM8A 2ZYAA 2DBZA 5HRUA 2NVBA 3JQBA 1F0YA 1FF9A 2OBYA 5B4UA 5CDGA 1NBOA 5LDHA 1U2DA 4NBUA 5LCXA 4CV2A 3EDMA 4E0BA 3Q3CA 3QWIA 1D8AA 2FZWA 4XYMA 3G1TA 4XX0A 3X2FA 1E6EA 2F1KA 5A02A 1SZJG 2Y67A 1NTOA 4TRRA 3S2IA 1ZCJA 2YV1A 3G1UA 4ZRNA 9LDTA 3OSUA 2HK9A 2E6UX 1QYDA 2FSSA 3I52A 4EJMA 4FSHA 1LU9A 2HRBA 1O94A 4IXTA 3AI2A 1P1FA 3AY7A 3VPSA 4BHTA 3CINA 3DHYA 3TJRA 5MDHA 4WKGA 3WXBA 3MJEA 3O38A 4D44A 3AFMA 2WE8A 5G0UA 5TQVA 3FBGA 4P4GA 1ISHA 1IOLA 2W8ZA 1UZMA 4XB1A 1UXKA 3HDQA 3OA0A 1JVBA 3INRA 1DRWA 4PLWA 1NR1A 2GDZA 1HE2A 3I9MA 3NYWA 2Y1EA 3JQBC 1KY5A 1KEVA 2VHYA 1JKJA 2O4CA 1UR5A 5TX7A 3U0BA 2AQKA 1FK8A 4UVIA 3DBLA 2BFOA 3ZDFA 4AFNA 3PHGA 4OHUA 5JPIA 3RUFA 4AICA 4DTIA 3BAZA 3D0OA 4AJLA 3LVFO 3S2GA 4WECA 4BNZA 1R37A 1KY4A 2PLAA 5C7OO 4MVJD 1NHGA 4WLVA 1DFGA 1DLIA 1MLDA 1M2WA 1R0KA 2FPGA 2JAHA 3G17A 5AXAA 2C7VA 4C7KA 4CM9D 4PRLA 3ONDA 4J4HA 4Q39A 5TC4A 3ZNOA 1FMCA 4Q3CA 1WPQA 3U4DA 5F5NA 5F1KA 4UUPA 3MTGA 1HETA 1E0DA 2PGDA 4KDEA 4I5FA 4ZGWA 4ND4A 4AJHA 3I3OA 4IIVA 5CDTA 4YJGB 4KWHA 2Q4EA 4RPJA 5I9NA 3MJVA 5T64A 2HJSA 2AQIA 3HFGA 3KETA 2JCXA 4BV8A 4E5YA 2XPCA 2NQ8A 2VNAA 1DAOA 2FRDA 2X6TA 4R5MA 4BIIA 3C24A 2P9EA 5A1TA 5FI3A 1BDMA 2VZ9A 1HL3A 3ST7A 3UFXA 1LDNA 4EBFA 5KJFA 5THQA 1T2FA 4YCAA 3F1LA 3SBOA 5GZ1A 2YUTA 2VT3A 4K6FA 1BWSA 3UCXA 1M6WA 2QYTA 1E3WA 1U3VA 3WG9A 2GZ1A 4KP7A 4YT4A 1I8TA 4JCOA 5JBIA 3Q2IA 2PKQP 2D1YA 3DO5A 4YRAA 4NR0A 4BNXA 1ONNA 3KYCA 2GN8A 2OORA 2D59A 4GSLA 3GUYA 4I9NA 3P2OA 1E7RA 5L4NA 2HMWA 4U6SA 4FGWA 3HB5X 4ROSA 4DQVA 1LC0A 1GYPA 1NASA 2G1UA 2V6BA 3OMLA 4CM5A 2BGLA 3GFBA 4IUYA 4UUOA 1UZLA 1I5RA 4YWJA 5H82A 1YRLA 2D0IA 3FNGA 4YAIA 1QMGA 3JD0A 4RPKA 1L7EA 3D64A 3ZV5A 4RL6A 1BXKA 4OKNA 5H81A 5ENVA 1UP7A 1BTOA 4CL8A 1YE3A 3OJLA 2CNBA 2CDCA 3K92A 1MG0A 1DB3A 1XIVA 4MKRA 4BO1A 4RJTA 3ZV4A 3WBFA 4BO6A 4NK5A 3S8MA 3M1LA 5IFLA 3ZU5A 3CMMA 1G0NA 5CPBA 2YV2A 3QLJA 3K6JA 1VSUA 3I9LA 4J4TA 3U9LA 4WGGA 5CDUA 5JXWA 5IN4A 1CERA 1YDEA 5U4QA 4L0QA 1ZJZA 4ID9A 5T5QA 4R01A 3ZNQA 3RJ9A 3Q2KA 5I8ZA 1IPFA 3CKYA 4RDIA 4DRYA 4IDFA 2B5VA 4OSPA 3IJRA 1VKNA 1PWZA 2ZTMA 4QX6A 4AJ2A 1BGVA 3FRJA 3WYCA 4JJGA 4B7UA 1NM5A 4R41A 1R4NA 3PQDA 4XQ9A 3IUSA 1PU2A 1B26A 3LYLA 4QTZA 4O59O 4Q3NA 5DBIA 3OJFA 3ETDA 4Z0PA 1BMDA 4KTVE 4ZN6A 5AXDA 3E8XA 1ENYA 1Z7BA 3GZ4A 4BB6A 1X7GA 1HEUA 4NI5A 4IQ0A 3OQBA 3SXPA 1R0LA 1UJMA 1LSUA 2LDXA 4B3JA 4GPD1 2DTDA 4BNUA 4Y9DA 3ZI0A 1DAPA 1QV6A 1DEHA 1T24A 2ZB4A 2P4QA 4BNJA 2QRLA 1DIGA 1W6UA 3TL3A 5CG1A 2Q45A 3UH1A 5G2OA 4BMVA 4E31A 3I6IA 5KJEA 3ADOA 4XYEA 1F17A 3KUXA 1JAYA 2WJPA 3EVTA 3ROQA 1SAYA 1RYDA 2P9GA 5IZ4A 1EUZA 2O7SA 4KQWA 1ADCA 2JFHA 3JQDA 3QW2A 5L4SA 2NWQA 4EI2A 5JMPA 2TMDA 3WMXA 3Q0EA 1LJ8A 3UUWA 5JYEA 4ND3A 2HMSA 5T67A 3DZFA 1DRVA 2BLLA 3V2UA 1C1DA 4CM3A 2CY0A 4NBRA 1U4OA 4TMFA 2ZYGA 3DXFA 1HYGA 1HYHA 1NWHA 1U3WA 3W8EA 1S7CA 4II2A 1O9BA 1VPDA 3UW3A 2X9NA 1WDKA 3PIDA 3DFZA 4BVAA 1ISGA 3U09A 1U3TA 1T26A 2DVMA 2I3GA 4JGBA 1QSGA 1P31A 4O63O 4FFMA 5L4LA 2PH5A 5IDQA 2RH4A 4XZ3A 4O5OA 3ZHBA 1E1LA 4TQGA 4DBZA 3OIFA 3PRJA 4QEDA 4OXYA 1BW9A 1XR3A 1U8FO 1I3LA 3ICPA 1GYRA 2NVWA 2WYUA 1DIAA 1JWBB 3VPHA 1I2ZA 1Y8RB 3O9ZA 3QY9A 4TWRA 5L7WA 4AJEA 3ITDA 4QUKA 2WWRA 4E5KA 4W7IA 4LN1A 5B4VA 1IULA 2H1SA 4EZBA 2YFHA 3Q1LA 1VSVA 1I33A 2PZMA 4A03A 5I9LA 3DZGA 3ETGA 2CVQA 5ITWA 3OECA 2X5KO 5EQDA 2O3UA 5JO9A 3NT2A 2FMUA 3L07A 4B8ZA 5HM8A 1ORRA 1HSOA 4RLHA 1W4ZA 1ML3A 4XD2A 3LC2O 5G4KB 3A4VA 1NVTA 1ZXBA 3RFTA 1GQ2A 1OOEA 1GL3A 5I7VA 4HV4A 4GH5A 3TPCA 1R66A 4OIMA 3RU7A 1H9BA 3PJEA 4YXFA 2H9IA 6LDHA 2VWHA 4KQXA 2PTGA 4NFYA 3PVZA 1HXHA 3BXXA 1GQQA 3JQAD 2WD7B 1KIFA 2VCYA 2YQ5A 3PLNA 5K9ZA 1LSJA 4XIYA 5FYDA 1T4DA 5FF9A 3DQPA 3WTBA 2DPHA 1I10A 1LRJA 3ANNA 1PQPA 4PLYA 4M89A 2NU9A 4GMGA 3ROPA 4DYDA 1IE3A 2TMGA 4I9HA 2EGHA 3BYZA 3M2PA 3FNEA 5FFFA 4U5QA 1H6AA 1ZK0A 3RU9A 1RM3A 1VRWA 3BMQA 1JQBA 3O26A 3DOCA 2QRKA 1E3IA 4I9UA 4BGEA 3UAGA 5F5LA 3RI3A 4R9RA 1TVEA 4LSWA 3ASVA 3H5NA 3SX2A 4EYEA 1GZ4A 1P1KA 3KVOA 3F1KA 4HX5A 3W8FA 1CDOA 2OBNA 5TSDA 4URFA 4CLRB 4DLBA 4J1TA 1RWBA 8ADHA 3NAQA 1VJTA 3PYXA 2W4QA 5TF4A 2Z5LA 4IXWA 4R1UA 4HFJA 2BI7A 5KJCA 1VM6A 2A9FA 3PI7A 3B6ZA 1CEQA 4MVJI 2EIHA 1UXHA 3GY0A 4Y67A 1WP4A 5CAEA 4R5HA 1R6DA 1PJBA 2OFPA 3KZVA 1DBVO 2YHIA 5JNLA 1C0PA 3F4BA 3H4VA 4NFSA 4WLNA 1AHIA 4Z3KA 4MKXA 3QVXA 3HFSA 3FTPA 1YL5A 2AXQA 2CF5A 3SVTA 4YJGA 5ILOA 5KWEA 4YPOA 1ISMA 3LC1O 5IDYA 1EDZA 1G6KA 4IIUA 4D0RA 1ZEJA 4NHEA 2B4TO 3H65A 1H6CA 3GDOA 3WICA 1Y81A 2VZ0A 1C1XB 2CF6A 4W82A 4J9VA 1KVQA 1VLLA 3QWBA 2PA3A 3C7CB 4DIBA 3FR8A 4JX8A 1GR0A 4DLLA 5JAZA 1LNQA 4RVGA 2B69A 1F12A 3AU9A 3JYQA 1OAAA 3FWZA 4JNKA 3W4KA 1EEHA 3CUKA 5LC1A 1PJLA 1E7QA 1RYEA 3Q6IA 2I6TA 4G65A 1GFSA 3F4LA 1WDMA 2O2YA 3GNTA 3EMKA 4ZQFA 2HAEA 3EK2A 4CUZA 4QQRA 4ND1A 1YXMA 3B70A 4G2NA 1EBUA 1EFLA 2V7PA 2EKPA 3ZH2A 1P1HA 5U1PA 2BRUA 3GG9A 1M6HA 4RF5A 1P1JA 3FI9A 4YEDA 4MVJE 3WQSB 1YB4A 4GKVA 1JLLA 4CR6A 4FFPA 3WR5A 1DLJA 1C14A 3QP9A 1UZNA 3GMDA 5A9SA 4BNFA 5ICSA 1R4MB 1VL0A 1A9ZA 4FCCA 4P38A 1I24A 1QYVA 1ZZEA 2EG9A 4J0FA 4GLLA 5BR7A 5DF1A 1XU9A 3TF5A 2YJZA 1IHYA 2YYYA 3VZQA 2RHCA 4E33A 3D4NA 2IEBA 4AJ1A 3EZLA 4X54A 4ZQBA 2OHXA 5B37A 4F46A 1GDHA 1ADBA 4XCVA 1EQUA 3MWDB 1J6UA 5DCYA 4C7JA 4CV0A 4RF4A 3LK7A 1P77A 3LF1A 1I2BA 3K9QO 5HWSA 3RASA 4YT8A 5JY6A 3K2EA 5KIAA 3H5RA 1MXHA 4GQAA 2QRJA 1R12A 3MOGA 2EKLA 1JVSA 3CIFA 2GZ2A 2ZJ0A 3FBTA 4I5GA 3JD4A 3OJEA 3C7AA 4J2HA 3NEPX 3LF2A 3FWNA 2UYYA 2PGJA 3EVNA 4LK3A 2RCYA 2GR9A 4CR7A 2O3JA 4WNIA 2JJYA 1ZJYA 3ZGYA 4IINA 3NRCA 3E1KA 4K28A 5DT9A 2RH8A 4EW6A 2P2SA 4BO2A 3ZCXA 4YAKA 4XGKA 3ZWNA 3F3SA 2B4QA 4JK3A 4OM8A 3ON5A 3W4IA 1Z74A 4JJFA 2HJRA 2DPGA 5HA5A 3N74A 4BKOA 3GPDG 1E7SA 4CM4B 1P0CA 2NV6A 1A72A 3ASUA 3CZMA 3V1UA 4MVJG 2AEJA 3EW7A 4E5PA 4W4TA 1E7MA 1F14A 1DFIA 3LLSA 3PHLA 4L74A 3TZ6A 4IDGA 5TLSA 3DTYA 3C85A 4B4OA 4DC1A 4FC7A 4EUHA 4TSKA 4WCFB 2CFCA 4OQYA 1PGPA 3IKTA 4UEJA 4NBWA 3FTNA 2UUOA 5IDXA 3K73O 1MUUA 3CXRA 1UXGA 3FD8A 1MXFA 1XHLA 4MVJP 4KMSA 1C0IA 1EZ4A 3F47A 1KS9A 2DBVO 3L6OO 2X1HA 4XJTA 3QVWA 2POQX 2HLPA 3AUSA 3HWRA 3WTCA 1SNYA 3GVPA 4BV9A 3MJTA 3OICA 4G81A 4RV9A 3VC7A 4W7HA 5JCJD 1EUDA 1E7YA 2EW2A 4IY1A 4D79A 2P91A 1C0KA 1HE3A 2W2KA 3NTQA 2AG5A 1KVRA 3AOGA 3KHUA 4I8XA 3LSYA 4OH1A 4Z0HO 1HZJA 1N9GA 3U4IA 1VL8A 3VZRA 4IM7A 3DOJA 1YO6A 3A1NA 3ZW8A 3A06A 1E5QA 1LTHR 3UXYA 3OIGA 4ILKA 4CMIA 3KYDB 5TJ9A 2ZTVA 2ZB7A 5A05A 3VTFA 1QORA 4BNWA 3WDSA 2VHXA 3MJCA 3WQQA 5K0ZA 2VTEA 2VTDA 3UF0A 1Y8RA 1K6IA 2EWMA 5DN9A 5BNTA 4CV1A 2O7QA 5L95A 2I65A 3PDJA 4B4UA 3OF2A 3DBHB 2ZB3A 3L6EA 4TVBA 3S55A 4YTEA 3JQCA 3KM0A 1O5IA 2PKQO 3RBVA 1FDSA 1EDOA 4ALIA 4FFNA 4LRSB 1D7OA 2WYWA 1VJ0A 3DFUA 4AJOA 1K5HA 4QXMA 1YL7A 2R6JA 4JQCA 2J3IA 1ONOA 3E9QA 1PR9A 1Y6JA 4BO9A 2J3JA 1LDGA 1MP0A 4M49A 4XRGA 5IXYA 5CDSA 1DC3A 4MVJF 4IMRA 3I9NA 1CRWG 3D5QA 4Z3DA 3TL2A 3KOUA 1BVRA 4GI2A 3IQDB 5L9AA 2WD7A 1ISIA 3ORFA 4UUMA 4R68A 2Q2VA 4CMAA 4FOSA 2VWPA 1WZEA 5ICMA 3PTZA 3I5MA 3LQFA 3LDHA 1KEPA 2ZKLA 3NJ4A 4EDFA 4I1IA 5CPFA 2X0NA 1B15A 2WMDA 4PLTA 3RROA 1ULUA 4CJXA 2FOIA 3ENKA 3ULKA 1KYQA 1LSSA 1Y5MA 2FR0A 3B1FA 2ZTUA 3V5NA 3ANLA 2QG4A 2OOSA 1PJTA 1U5AA 4CLOB 5EPOA 4AJNA 2W98A 1PZEA 1EVJA 1GEEA 4MIOA 1X15A 3GT0A 4CLRA 1HE4A 2HCTA 1IPEA 4F3YA 1MGOA 4OOEA 4OL9A 4CR8A 1N1GA 4WLFA 3WGQA 1AXEA 3IP1A 2ZCVA 4B4WA 5ITVA 4DBVO 2D3TA 4YBZA 4NFHA 5KKCA 2YDXA 4OSOA 2Y93A 1GZ6A 4MP8A 3ITKA 2C2XA 4HY3A 3NJ8A 3OQ6A 4LCEA 4FC6A 4OGWA 3SJUA 1GZ3A 4IMPA 3RUHA 3UHAA 4ALKA 1SO8A 1QLJA 1XYGA 7MDHA 4J4BA 3U49A 1DRUA 1LLCA 4QECA 5EMHA 2F00A 2NACA 3RWBA 3GF4A 4U6QA 3RKUA 4YDRA 2J5RA 4YJHB 2GF2A 3JCZA 5EIOA 2VT2A 3FCOA 2EP5A 4ALLA 2X5OA 4PZDA 1O0SA 1C1XA 4OYRA 1ZNQO 2DBRA 4F45A 3MEQA 2ZATA 4TKLA 2CDAA 4J1SA 4NBVA 1DIRA 3RCBA 4QFDA 5BT9A 1NFQA 4DGSA 3ZZNA 3I83A 1YBAA 2UDPA 2CVZA 2VYNA 2AE2A 3L4BA 4U0KA 3I1JA 2YQ4A 3FPLA 1HDOA 3OIDA 3R0IA 2Y0CA 2O4UX 4BO5A 3DMTA 3JQ6A 3GEDA 5FEUA 3KLMX 1XLTA 2QIOA 1JDJA 2QQ5A 4NZ9A 4KOAA 3O8QB 3GQVA 3RFVA 4IS3A 2CVOA 2E37A 3SC6A 1V0JA 1ZFNA 3DC2A 1FDWA 4JLWA 4AJKA 1M75A 3VTZA 3WSWA 1OFGA 4Y6PA 4BGVA 2W2LD 3V1TC 3RQSA 3NX4A 5EERA 3STHA 3ZW9A 1V8BA 5JC8A 3L9WA 5JYDA 1DC4A 1A7KA 1JWAB 4Y6RA 1XSEA 4L73A 3NTRA 2O3TA 1P0FA 3G3EA 5MGBA 3F6YA 4ZVVA 5KNLA 1GUYA 3BMOB 5GZ3A 4HNGA 5JFOA 1GCOA 2GGSA 4DWVA 3AY6A 5IZCA 1GAEO 3L4BC 4E2YA 2CD9A 4RQTA 4XYGA 2PY6A 3IUPA 3PPIA 4KUEA 4CQMB 1ULSA 3DMTC 4E2WA 1EK6A 1I36A 4PLPA 3RUEA 2ILTA 1EE2A 3LU1A 3TZKA 2C5AA 5G0VA 2E4AA 1UAYA 2Y1FA 3R3JA 3EC7A 4QSMA 2EHDA 5C7LO 3AJRA 4L4XA 4CM1A 1V9LA 2G5CA 2ZTLA 4BNGA 1BXZA 3LT1A 4CM6A 1LXCA 3VVBA 4O6VA 1HWYA 3E5RA 1U8XX 4GX5A 2NADA 3AUTA 1U28A 1DHRA 4Y6SA 3WLFA 4CM7A 4RVHA 1YBMA 3C7DB 4A0SA 5BNIA 4HXYA 1W8DA 1T1SA 1A4IA 3T4XA 1XU7A 3RKRA 4N7RA 2FPPA 2CSUA 4RDHA 1U4SA 1ADGA 5L53A 4NJOA 1DFHA 4S1VA 1FXSA 1UP6A 1GEGA 3AM3A 3GHHA 2FR1A 3U4CA 1JN0A 2X86A 1HDYA 3WJ7A 4Q3DA 5EESA 5IZCC 1SOWA 4UEKA 4KDFA 1E92A 3LT0A 2W90A 3PGXA 1PJCA 2D2IA 1ONPA 3QA9A 4CM4A 4CQMD 1DC5A 1A7AA 2NU6A 4PLFA 3AUAA 1QLHA 1BVUA 3PHJA 4N18A 3OBBA 1I3MA 2GD1O 2AG8A 4PG4A 4YAEA 3SC4A 1TB4A 3PJFA 5TNXA 1P45A 2GLXA 3AWDA 4R1NA 4Z9FA 3SLKA 5AQ1A 3VOSA 3C1OA 3MZ0A 2HU2A 2DC1A 1BDBA 5JSFA 3KBOA 3VPGA 1MG5A 2UUPA 4IJWA 4NBTA 2BH9A 2JAPA 1MFZA 1E3JA 3RSHA 4Z0TA 2ZIZA 4R16A 3ROKA 1SEVA 2VRCD 2BFMA 1D1TA 1F06A 1F8FA 2VYVA 2X4GA 3GH3A 2NQTA 1Y9EA 2JKVA 3U4HA 3OEWA 1WLYA 1VI2A 2PV7A 3FR7A 3RBZA 1TEHA 4A10A 1PS9A 1V35A 1LBEA 4GAEA 2OZPA 1D1SA 5ER6A 4DC0A 1LLUA 4WEQA 1AHHA 1P1RA 2NLOA 3GAFA 3EZYA 4MIYA 2IZ1A 3IIEA 4FD3A 4JBGA 3TDKA 4HFMA 4BMSA 2EF1A 3A9WA 1XG5A 3P19A 1MB4A 2EJVA 4XR9A 5TRTA 1DSSG 1LUAA 2BGKA 2E49A 3FSRA 2VUTA 1D3AA 4MOWA 1PJQA 1SCUA 2AEMA 3U62A 1ENPA 4RPHA 1JA9A 1GY8A 3NTOA 4XEHA 2QZZA 4FJ2A 3H9UA 1D4FA 1QV7A 3JQAB 3LLVA 2X0IA 4XYBA 3V2GA 4DLAA 1Q0QA 1Z75A 4N5NA 4YRDA 4BNYA 3QRWA 3DDNA 1LEHA
chains in the Genus database with same CATH superfamily
1FL9A 2J5XA 1P1IA 3K9HA 3KU4A 1NHWA 3FCEA 4MDFA 2XBUA 2IF2A 5DM2A 1P29A 3E2IA 3A2MA 3QA3E 5AOCA 4NX2A 3BMCB 4HFNA 2WUWE 4WEOA 2FGJA 4YMSA 1J21A 1T8YA 4OF4A 4HN9A 1J0XO 2QI9F 1A8QA 5JXIA 2DBYA 3I1FA 4DUGA 1MENA 1F8UA 2G5TA 2YMPA 1QK3A 1H2HA 2BJHA 2X15A 4UKDA 2WY2D 3ZKWB 2XR1A 4RETA 5DOZA 2G77B 1EMDA 3PRKE 3V9PA 5EOVA 2VQ3A 4QUAA 2VF2A 3I4CA 1PEYA 1CNFA 2JZNA 3BTVA 1TW3A 3G6KA 4IXMA 5FORA 5CVTA 4P3PA 3A2KA 1MPTA 3LGSA 4HDSA 4OP1A 4QGSA 3IQEA 3CX8A 4I6GA 3CEHA 2L2QA 3DOOA 4JCCA 3LRPA 1KJIA 1SVLA 2DFKB 1Y9DA 5HJEA 2JLWA 3VSDA 5JCPA 2VQEB 1LZLA 1M2FA 2QVCA 5A62A 4RHCA 3Q8WA 1F8GA 1FJXA 5FBRB 3UAWA 4DXHA 3RRBA 2OT3B 3P4UA 2JI7A 1WKCA 3MMZA 5BV8A 2GKGA 5I9TA 4FONA 2RAFA 4I8IA 1XJWA 2JKYA 2YBDA 3DBRB 1YZGA 2FA9A 4QELA 2UVDA 4C04A 1JDPA 3KO8A 4YRNA 5AK5A 5I7SA 4LZLA 1AGNA 1TTPB 3DMDA 5JWOA 3TOZA 4BX9A 3U5TA 1QH0A 1QKKA 2A5GA 3CW2A 2AHRA 4HWKA 1TIPA 1PFGA 1L5KA 2W6QA 2WHXA 2IY9A 5BV1A 1EWTA 3HYRA 5K45A 1FJHA 2W71A 4MV3A 3EEYA 1JXQA 4CLOA 4KUHA 5IXJA 4H0CA 1HY3A 4PLHA 3NETA 2QRNA 4GSYA 5AJHA 3R7BA 4AO8A 5AW4A 2G1KA 3PX3A 3X2EA 3OHPA 4OUKX 3H9GA 4MPPA 4EEZA 4OG2A 4PPGA 3CX7A 3MGKA 4L02A 5L7YA 1L6RA 4D4JA 4DLNA 3SBXA 1EE1A 1EFPA 3HLTA 4C4OA 5ADWA 1MEJA 4IIFA 1KAOA 3C43A 3BDVA 3DKKA 3L6DA 1GL9B 4NK4A 4PG8A 4URVR 1SZDA 2OVBA 3KCQA 4KO2S 4UM9D 1CF9A 1M1NB 3X0DA 3PR3A 3VRHA 4QAQA 3PQ5A 3ZQKA 4A2PA 4CFYA 3JV7A 4FR2A 4U63A 2GD6A 3KUCA 5LP6F 1W5BA 2JFOA 4OCZA 3W2HA 2B7BA 3OPMA 4XVUA 3GFVA 1SXJE 4FB5A 3UMVA 1ZM7A 4GYYA 5B1HA 4DB4A 1WL8A 2XNKA 1G8PA 3FRIA 4DM3A 1E2IA 5FNVF 1MVOA 1P62B 4ND5A 2IV7A 3AK4A 1JTEA 4RLFA 3JAWB 2DLDA 5EHXA 5IJZA 5CYFA 4O4IB 1JJFA 4QTTB 2IKQA 3VHQA 1SA0A 1ZH2A 2IOQA 3EXHA 2DOKA 3P9NA 4JLMA 4M0PA 3RRMA 3SJBA 5C4IA 1A3CA 2B4AA 3CEMA 5CM9C 3OHSX 3ZWCA 1DRJA 3U61B 1XMOB 4GIBA 4DBLC 1JKXA 2OSVA 2H2FA 3HXLA 4E4RA 1BQEA 1FTYA 3AKEA 4KN8A 3AB7A 2NUAB 1W4AA 2O05A 2OGZA 3AETB 3OOWA 5GJWC 3H3FA 4RA6A 1L4FA 4R54A 1L4EA 3OQJA 1XQ6A 4KO8A 1S0UA 1GM5A 3UY4A 1NXQA 2ZE6A 2TECE 2XDYA 3QMPA 4OHWA 5AVRA 1M8FA 3R41A 2WV9A 3UN1A 4RJ2A 2FX2A 1Z0IA 4YVFA 3WRWA 1AF4A 1UK6A 3RVDA 5EHZA 5AI4A 5KU7A 3G2IA 4F3CA 2F62A 5KYXB 4TSRA 1ODLA 1PT8A 2XNSA 3C3CA 4TX1A 5FLKA 3G0HA 3HMKA 1PYGA 3EIQA 3V4FA 4EUNA 3EOBI 1EM8B 4Z4QA 3WRYA 2Y66A 2IVZA 3PEUA 3DF7A 4BKQA 2ZUFA 2Y1CA 4XVCA 3Q85A 2MYUA 1A9OA 1S3FA 4HAOA 4NU6A 3FSGA 4PQRA 4RF2A 1XZDA 1DEXA 2H2WA 4GT1A 1F0NA 1UMBA 3EISA 1H0KA 4JJEA 3ZU6A 3AHCA 1GUZA 4X1KB 5ALIA 1KQNA 3V8BA 3HG7A 2Q6LA 3TAXA 2RB4A 3ZYCA 3DCYA 1M0EA 4FKBA 3ROFA 2ODEA 4MV1A 4REQB 5EMKA 1VJ1A 3K4PA 4NE7A 1JHOA 4LGVA 1YDWA 2YMQA 4MUIA 4CG2A 3GLHA 4ZT3A 3IEVA 3FPAA 4XASA 1Q0UA 1CS4C 2I8LA 4G4IA 2FJPA 5C3UA 3OJWA 2RHJA 2A59A 3DH0A 2AW5A 3FSJX 4UNSA 4EHKA 4WHMA 4Y9UA 2RKBA 2B6NA 2X9QA 1H0HA 3C3AA 1M2OA 4GE3A 1KC1A 4H1TA 4IDNA 4II3A 2DR0A 4PSUA 4RO0A 5DLQC 4XCXA 2E6KA 2GFHA 3WS7A 1OX6A 3RGGA 3CT6A 3BH0A 5HX7A 2ZB8A 3D3WB 3DDOA 3V33A 4ENQA 1J8DA 4QRIA 3WL5A 2RDMA 4UPDA 5BOSA 1KL7A 3T7EA 4C6TA 4DCPA 1E1CA 2ZRHA 4QU8A 3VKGA 2EQAA 1JNYA 1FRVA 4Y2GA 5KYYB 4U3JB 4RKRA 4D9GA 2J48A 3QF4B 4A9AA 1PLLA 3HJGA 2NPIA 3UH0A 3WISA 1IQPA 3PXBA 4NE2A 4D98A 1G9XA 2GESA 2ORIA 1H2EA 2PUAA 1KJQA 3FMIA 5E6SB 1YJQA 4ZYUA 5A3VA 5K4GA 3E1GA 1WUJS 3MCAA 3A58B 1ZIDA 4CCYA 1C8KA 4MVCA 3LZDA 1MC5A 3SVLA 3H75A 4K6MA 4ALNA 4WKPA 1UXIA 5TGDA 4A0FA 1J5EB 3CGGA 1U0JA 4MHSA 1I3CA 2B20A 2IYQA 1ZM3A 5I3ZA 1JP7A 5L7TA 2FFAA 5HCIA 2VEDA 3AVTA 4ISBA 3VR5A 3LC7O 3VV3A 2NVOA 2R8XA 3D6VA 1Z4KA 2HWKA 3NHSA 1DWUA 3L7DA 5DH9A 2V45A 3O8BA 4KIGA 3ND7A 1K3FA 3WYDA 2X41A 3P9ZA 4KQ6A 4TT3D 1N5DA 2GPYA 3GGOA 1PIWA 4RIGA 3CZPA 3VH1A 3LYHA 3VNRA 5KSPA 3ZCQA 3SX0A 4ITUA 4BX3A 4P33A 1JAHA 5FTWA 2PD4A 2WT4A 3NEAA 3OD1A 3K1ZA 2RGEA 4RCYA 4BXOB 5ALXA 4M76B 5FKJA 3FTQA 2PRSA 3RFFA 3AM4A 3QSGA 1DAEA 4NOJA 4QTUB 3EVDA 5DDIP 1X14A 1J22A 2IYYA 1T13A 3MBIA 3W7VA 1YDMA 4YNBA 1V5EA 3MPUA 2FFRA 5I9BA 4KPEC 3U3ZA 4JKIA 2XXAB 1KNQA 4NYJR 4PVCA 2YNMA 3A4YA 3RTCA 1HV8A 1U2GC 2I3DA 4PX2A 5CLQA 4C4SA 5J43A 4WINA 3SP1A 4Z4EA 1UMCB 2A84A 1MV5A 3X1JA 4B6RA 1C3VA 4OXQA 1T2CA 4OAOA 2OAP1 1Z0DA 1AZSC 3V8PA 2JJMA 4N0MA 4LFBB 3G8BA 4FIZA 1V7PC 4DVJA 5J4KA 2A8YA 3PYMA 2OPBA 2HK8A 1PZHA 1FFDA 3EPPA 3C6YA 1J1IA 1PFYA 1VG1A 2JI9A 3FVQA 2O50A 3JVUA 3LFTA 3PQEA 1HDXA 4GC5A 4DYHA 4F4IA 1QE3A 1U5CA 2I54A 4HYQA 4JA2A 4AZWA 4ZI2A 3S2YA 3GDGA 2H2HA 4D02A 3IDFA 5CHYA 4YRBA 1V5FA 1E9DA 1CW2B 4EHFA 1F2TA 3A28A 4OBEA 3S0JA 1Q1QA 3HM2A 1ZPDA 1WD5A 3IEUA 3DLPX 1UKZA 1KXJA 2F4NA 3P1JA 3QYFA 2HUNA 1Q1BA 1KFJB 2VDNB 2RG1A 2C5HA 3CKLA 4Y2YA 4ALJA 4DPMA 2EC5A 4TTTS 5JZ9A 4QJ3A 2FEPA 1KYWA 2AMVA 4FCVA 3AIIA 3K6SB 2HREA 2KBEA 4MIEA 5BN3B 1CJVC 3ZNPA 4HKTA 1T0HB 4FR5A 3RVOA 1T4MA 3BIOA 3O91A 4N40A 1V3UA 3GCGA 2IOHA 3JAKB 4DAEA 2FHPA 4A23A 1RLOA 3NT5A 4TKZA 4ZV4A 1L7PA 3BMCA 2WDZA 4KW7A 4WZBE 2BEVA 1XYVA 3TXAA 4W9RA 2J3LA 1XAGA 5F52A 4P93A 5TMDA 3IOEA 4LOJA 4QPPA 1S3GA 3MUNA 3JWIA 4XA8A 4PYJA 5KQGA 4XFKA 5C8XA 4NV1A 1NVEA 1E1NA 1RQXA 4POOA 2WAOA 1O08A 5TQJA 3ONVA 4PC1A 3AW9A 1L7QA 4HWRA 2VDWA 3U6KA 4WNCA 3D3QA 1ADJA 1R88A 2BR5A 2XYPA 1LI5A 1M73E 1CWUA 1TU3A 2I2WA 2VJMA 3GLVA 5G0SA 1T8TA 1JIXA 4K87A 2JEZA 3DE7X 1EAYA 3EUWA 2CJXA 3ITNA 1QK4A 1HC7A 3LQKA 4NNOA 4PGFA 5GVSA 5B53A 3ZGOA 4BS9A 2GASA 5IABA 2VF7A 3D81A 3KJFA 2WSLA 2QYSA 3KYBA 4HNSA 2W0SA 4P3NA 3N7UA 3JQRA 4GMFA 4GOKA 3TVYA 4D3SA 4DWJA 4EHIA 3DKIA 3GFFA 2QG6A 3Q7EA 1KAEA 5KYWB 1LA2A 3FVRA 3ASZA 4MUAA 4UHEA 4AN1A 1DO0A 5KQSA 5EKUA 1G6HA 4V0RA 1RWNA 1XZ8A 3DBRA 3OMWA 3Q9NA 4GICA 2XOKA 4MP3A 1OGJA 4RLQA 4TYWA 3A04A 1UJBA 4QT4A 3MD9A 1PNTA 5IJAA 1YTLA 3MXTA 5KAMA 4GD3Q 3I6YA 2JC3A 4UU1A 2Q0QA 1F3OA 5B1DA 3DD1A 4ACBA 3MWJA 3UBTA 3FDZB 1FNSA 5DBFA 3DJYA 5DX0A 3IHTA 4C5CA 2YC4C 3WWYA 1N5KA 1P8JA 1T3SA 2QDXA 2Y68A 1Q3KA 3JR7A 4IPTA 1SG9A 1Z5NA 3K05A 1PJRA 4ZA2A 2EKDA 4ZYLA 5IT4A 1JEYA 2JFYA 4CZ2A 4JKYA 3BGVA 2AC4A 2QQ0A 2WWWA 2VN8A 3BS4A 3MMXA 1SKMA 1LDEA 1OMOA 3UT0A 4D43A 3RUDA 2JAXA 3OZDA 1PR3A 3DE6X 2XB9A 4PONA 3GCXA 1CLEA 2YVKA 5BNWA 3ZC3A 1NVVQ 2PPLA 4QLOA 4DV2B 2NO4A 2OXRA 2GZMA 2CYCA 5LMZA 2ZIAA 1T1RA 2VJKA 2VJYA 3G68A 1M1NA 4HGOA 5E1DA 1Q44A 3RBAA 1PD0A 2EQBA 4PYOA 1Z06A 1QBGA 3EJWA 2NTVA 3PWSA 2P5UA 4EGSA 1DP4A 3OEHD 1IM2A 3LKBA 4X61A 3W6OA 3CB2A 1CF2O 3UQYS 2B8NA 1K8RA 4E46A 4PG7A 2P2GA 2W58A 2XYQA 4KQFA 4P22A 4ENVA 3T0IA 5CT8A 5CXQA 4WWHA 4C29A 2GRJA 4Y8VA 3JAWA 5EY5B 2WJ3A 1SQFA 4OP3A 4O4IA 2ZBUA 1CY1A 5EE0A 1ZK1A 4IDAA 2VRNA 3WB9A 3EXG1 1Z33A 4G1CA 3FYUC 3H3JA 3USZA 3GHYA 1SHTX 3GG2A 4HDQB 4IDQA 4C4PA 2RIRA 5IULC 1QOPB 4O2AB 3RHZA 4IJVA 3DVLA 5FYQA 3MXOA 3W4JA 1S5PA 2WUEA 2YHIB 3UKDA 4M54A 1VBKA 3O90A 2BZ0A 3ZTWA 4AJPA 3OESA 4GM4A 2BISA 3TRFA 2X0JA 2NUAA 1IZ9A 1HQCA 3AETA 3FWKA 3LXXA 5ALWA 3THRA 5IEJA 5KMGB 3ZLBA 3RVKA 1ISRA 5CDFE 2IIVA 4H7HA 4MS4A 1VE7A 1YBVA 3A6LA 4RTKA 1U0RA 2JD2A 1DX9A 3IUBA 4GECA 2HA3A 3FGNA 3U9TA 4BNLA 2PXCA 2OP1A 2D5IA 1YZHA 2GO1A 1GCIA 2G0TA 2PX8A 2YJ5A 1Y48E 1JG2A 4EJ6A 2C9BA 4ZOEA 3H2GA 1OWOA 5KYXA 4U7WA 4NH4A 1WBBA 3ZU4A 3LQQA 5C3MA 1U81A 3PHHA 4D41A 4UHKA 1M2GA 1WNTA 3PKJA 4P7FA 1EM8A 3ZHXA 4KE6A 5CW2A 3RRNA 3OZEA 4MKHA 4R1QA 1QRAA 1MNQA 5JQWA 4B47A 3QVKA 4AC9A 3QV2A 3K6KA 1GT6A 1UBJS 2ZQYA 2V55B 3C8MA 1N1DA 3AR7A 3BF8A 2JIDA 4LJ9A 4NJMB 1I6LA 3DTVD 4FDLA 4XSHA 2WU8A 5EXEA 3RRXA 3T06B 1G4AE 2GXQA 2PS9A 3TAUA 3G7UA 3TRDA 4E1AA 1NLZA 4OLHA 3QLUA 4HPJB 2J6IA 4PGGA 1E0JA 3WLJA 1H2AS 3QWAA 1QG4A 3B1JA 4REQA 3T7CA 5JJBA 1MW8X 1ONSA 3HY6A 1CETA 2NTNA 1NW8A 2LTAA 4J6EA 2X6QA 3PSHA 4K9PA 4PICA 3ZQJA 3K0CA 2QWXA 1V37A 2QE7D 4XR4A 1H94A 2J46A 1QGAA 1XA0A 3O2SB 4MVXA 3T38A 1UFQA 1UT5A 2FSVA 4J1QA 4FZVA 4O4JA 4P80A 5JNSA 4KTTE 4A15A 3NGXA 1D0IA 4OB6A 4G9GA 1P5JA 1FTNA 3ILVA 3A27A 3Q0TA 4KR6A 4C01A 3KTOA 4U7JA 3NHYA 2FSUA 3D3WA 4XB6B 2Z6UA 2O2CA 3I9JA 4UHHA 2FRDC 1ZBQA 3QVSA 4MUBA 3TJMA 2VP2A 3VR4D 1PJZA 3ADDA 2ZS9A 2EBFX 1B0AA 2O59A 2H1LA 1UC5B 5KYYA 4AY5A 2XXBA 3IS3A 4KN5A 2EERA 2ZI6A 1RBMA 3RREA 2DFTA 3K5IA 4U3JA 3SJ7A 1J39A 4ND7A 1YCDA 3IT2A 3DB2A 4GLOA 3SN6A 3T5AA 4KQJA 1KP2A 4OU4A 2YCBA 1YIDA 1T3HA 3LNCA 3R6DA 1FS6A 2C2OA 4OQNA 4P7JA 1BA2A 3C87A 1F2VA 4LSMA 2M6SA 5AM0A 2C3YA 5E6SA 3ZI7A 4EG1A 2UYQA 5JAIA 1GGHA 4I0WB 1R0BA 1RVDA 3CLSD 1UF9A 4U00A 5EIHA 3UB3A 3W2EA 1K6XA 3KOYA 3WO0A 2VNIA 5BYKA 2FW7A 2HBQA 3PPWA 3CNLA 3WYFA 3ZV6A 4DM4A 3I5YA 1DMSA 4CGYA 3DO6A 2ZJ1A 2D7CA 3C41J 3SZUA 1W93A 4RVDA 4OREX 2PVPA 3GVIA 5TMBA 4O4LB 4WFJA 5JCJA 5DHQA 2PLRA 4DLSA 5CR9A 2FW9A 2BMDA 4X44A 4AW9A 1BJKA 2DRIA 3HPRA 1V3QE 5EJ8A 5JYCA 1MPXA 2Y1GA 2GA9A 1Y1PA 2WIKA 2FRXA 3KV1A 3D7NA 2ZBQA 4K6GA 3W5AA 1QVAA 4GKBA 1XV5A 2OGUA 4NY1A 1E6UA 5H1YA 3EDRA 1DADA 3I12A 4QQNA 5LLTA 2DQYA 3QVUA 4KJXA 4WUTA 3E5MA 1U0GA 1K4KA 2EL9A 3NIDB 4HEJA 2B7LA 4D3YA 3H2JA 3I01M 3RK1A 1FFYA 2P9TA 3WBJA 3OE5A 3ZLUA 1O97D 4BN4A 2G63A 5EKTA 3E48A 1WMDA 3M4JA 1CJBA 3MTAA 4BXOA 2I1VB 3PS9A 5DHTA 3W3AD 2ORVA 2CVHA 3HKCB 1AQ6A 2VUSA 4YT2A 1KO7A 3P0FA 4E1VA 1WMEA 1Q7BA 3MBKA 5BR8B 5A6VA 1WZ2A 1RYHA 2Z58A 5IASA 2FR8A 2H11A 2ZJ2A 3UPTA 5C7IO 1GNRA 1NJGA 4Q5IA 5DBGA 2IHTA 3WGOA 1SC1A 4GI7A 1TZJA 2XD4A 4ZICA 1UMCA 5T4BA 3H19A 1AQUA 1D5CA 4YP9A 3OWOA 4NU5A 4FFBB 1S6YA 3H7AA 2OGSA 2E4XA 2H0RA 4PYLA 5EZYB 4CODB 4ZMBA 1E2BA 2R0QC 1H5QA 2DFVA 4POAA 2VJAA 3IAHA 5LQRA 3HUTA 3L1JA 1SXPA 4WFQA 3RSQA 2CUZA 4B71A 2XW6A 3OE7A 3RS8A 5L40A 4C6HA 3C74A 4R1SA 3NDJA 4I36A 5M34A 4XLTA 2F3UA 3STXA 3JSAA 1R8QA 2G4VA 3ANYB 4LNUB 5F1YA 4F6LA 1QXSA 1WZUA 4EMUA 3UAYA 1RQPA 3LGXA 1L7MA 5B7NA 2NSJA 4HEA1 1UM9B 2HMUA 1ONBA 3F4KA 5M3BA 4MW5A 1OWNA 1PQUA 2X40A 3ROEA 4GDMA 2C0CA 2PA0A 1ZOPA 2XIJA 4M0EA 1J97A 4Y6QA 4EY5A 3KB1A 2PZJA 3K6SA 1NV8A 3T9DA 1KFBB 2LIVA 3H8VA 3OUZA 4QHTA 5FUVA 5GY7A 5BN3A 1CUAA 2E1RA 4FBLA 3ZDEA 1N9GB 1O9HA 2JVKA 2XTNA 3Q15C 4TVOA 4NBNA 1HQYE 4FYYA 1ZI8A 1JSLA 4H3KB 2VO1A 3AH8A 3D3NA 2BM9A 3JAKA 3L4SO 3NWBA 4ML3A 5D8DA 4JWKA 1N77A 2IOFK 4HYTA 3K5WA 4MINA 2X0KA 4JBNA 1V7ZA 4W5JA 1GPNA 5JAPA 5DNVA 3CZAA 3Q3GE 1UZAA 1YH3A 3DE4X 3PNMA 4C0BA 2X4DA 3VZSA 1LLDA 4LWZA 2CLDX 4GXRA 2IDKA 1KMIY 4AO6A 2Q6VA 2EARA 3BA1A 3TZEA 2A94A 1U80A 5J5CA 4PE5B 4IOMA 2PSSA 2QD3A 1PK9A 2B0JA 3IP6A 1SXJC 5GP1A 1L4BA 2MCFA 1WMAA 2ROQA 4CMEC 2OCDA 2BTQB 5JVDA 2V0GA 1RJ9B 1LJUA 1UIRA 1RYZA 4ND2A 4RPIA 3JQ7B 2XCRB 2WP8J 3O74A 4R8SA 2BY4A 3HYSA 2RK3A 3MSXA 1JYEA 1B3BA 3C97A 1Z6ZA 4JDUA 5ALEA 1B8PA 4BNTA 1G7SA 2DPLA 2R84A 3LBAA 3A1WA 3R09A 3RPEA 3HBNA 4AB1A 3V6LA 4JSYA 5HIAA 1HRDA 4ZOAA 1GCAA 4TT8A 5ICFA 2C2WA 3IQHX 4BO3A 2YWGA 3HDTA 3KRTA 3M6LA 4JWTA 4P5EA 2J4CA 1ZGZA 5KYWA 1UWLA 1VI6A 1IN4A 1QC5B 2HXSA 4FHFA 4LMPA 1N8SA 1P5HA 3W2IA 2KE5A 5DU2A 1PN3A 2QX9A 3OZFA 3U48A 2APJA 4BVHA 2JGAA 3TLCA 4CEIB 1EKXA 2GZRA 5JE8A 4YGXB 4WACA 3RBXA 1HDRA 2AEFA 1KQOA 1I0IA 3C3PA 4B3IA 4DZRA 5K6AC 1C8LA 1OTYA 1SUFA 4RQUA 5DP2A 2C2YA 4BQPA 3CLTD 2YJTD 3Q7PA 4R2HA 3TD2A 2BM8A 3H13A 1JB1A 2M32A 3FDZA 3WAKA 3LSTA 4N7MA 1MOPA 2RI6A 2Z2IA 1S96A 4RORA 4XX0B 5DEIA 4Y9TA 2XKBA 2HA2A 1L7XA 5DK4A 1DRKA 4UBIA 4AJJA 3B5EA 1VP9A 3LO8A 5JLJA 3S99A 3AZQA 3PE3A 5L45A 1COZA 3HFRA 4IVNA 2OLJA 2SKCA 1T6YA 1RZ3A 1XZMA 3Q6MA 1QLWA 3WLIA 3T9FA 1M0TA 3PIIA 1YS1X 4JN6B 1TTTA 1JSXA 2SKEA 2VPYA 2FZ4A 5EZ6B 3FCSB 4WGFA 1SBYA 3K1YA 4KRXA 1Q15A 1V4NA 3LKZA 4FFWA 4WZAE 4LRTB 3DZBA 1DBRA 2HTFA 3M4YA 2GN6A 3BEDA 1JEAA 3R7SA 3GUCA 5JARA 1Y89A 1VBFA 1ZA1A 3OZ7A 1GXSA 4OAPA 4EL0A 1YQWA 4M8SA 3LV8A 2GF0A 2HU5A 1LDMA 2BBSA 4TYPA 2PSEA 2RHWA 3G13A 3N3BC 3ZY6A 2W22A 1VLQA 4TWIA 4YX9A 1TFUA 2G72A 1AZTA 2Q9AA 1DQPA 2GARA 2RJ3A 4C6RA 2JFGA 3UK6A 2OFXA 4E88A 3LVRE 2FYTA 1DJMA 1YGYA 5M2QA 1NSYA 2WWGA 4XVRA 1E59A 2X7HA 5JI2E 3RV3A 1ISJA 3EUAA 2VPWA 3D5TA 3WQRA 2QW1A 5FXMA 3LI2A 5ECGC 1JHZA 2H4JA 1Y4ZA 1FOEB 1NIPA 4K81B 3TLYA 2Y0BA 2E48A 1J2JA 1G8AA 3RW9A 3NKVA 4JOCA 4W8GA 3W9BA 1VRCA 1TVKB 1Z15A 4ZARA 3BIJA 1ESEA 1ZN8A 4GPZA 5CT9A 3U80A 1NQ5A 2ZUWA 1ZSNA 4QD3A 4O2AA 4BBJA 1BFDA 3ZS8A 5KVQA 1PKXA 2D1RA 3G6WA 3MMNA 4ER3A 4YMWA 5TT0A 1B8VA 5KOIA 1R6VA 3ETEA 5CX4A 3S1AA 1JIUA 3E9ZA 3S3TA 3CHYA 3SEZA 1H2FA 1SQ6A 1I94B 2V7QA 1E5LA 2A78A 5FOXA 2FY8A 2QHXA 1ADFA 1SQGA 1JA1A 1UC8A 3AF0A 3IA2A 1FQWA 4BUJA 1Z5GA 2MSWA 2PFSA 1LX6A 2XOEA 2ZRPA 3M5PA 4N3NA 4R51A 1AN9A 1VECA 2HWUA 3OT5A 3R0XA 4W5RA 2WDPA 4TYYA 5F2OA 1KDOA 1Y82A 3ZD9A 2DH6A 2XWQA 4EX7A 1Z34A 2A7QA 4YAWA 2PRKA 3N7TA 2BR3A 3INNA 4IQGA 1P81A 4M8NE 2UXBB 4X62B 3AERA 3MJ4A 1JI0A 4LVUA 5COBA 1KYZA 2YJNA 3ROMA 1AGYA 2ZJZA 1MJGM 4TS9A 3TKLA 4DZZA 5BUQA 4OHCA 4WJZA 3RRFA 4MV0A 1PCXA 1SQSA 2QM8A 4N6OA 2B0CA 2WF9A 3C8HA 4MWZA 4NJMA 2QLBA 2C7QA 4BC0A 1B3RA 3PG5A 5M5BA 4XUDA 4MYHA 3KYCB 1EQAA 1JH8A 2B34A 2V6JA 5CG2A 2C2MA 1MX3A 1U9IA 1P5RA 1XOIA 3LC0A 5K7SA 2CKDA 3GRAA 4TS1A 5IKPA 5K4AA 3CEAA 3HKDB 4M46A 2N9UA 5CM2Z 4YN3A 3V1LA 2BPOA 2ZLBA 1ZW6A 1SVWA 4MH0R 4QVKA 3E7XA 5BSUA 4NXNB 2Q3MA 4LGMA 3F2VA 1WTCA 2Q2QA 4ZT6A 4XTRA 4AQ7A 1AK2A 2QUBA 3PP8A 4QXRA 2G17A 2IYXA 1QG6A 1DQNA 1NYTA 2P30A 1MTOA 3F46A 5DP1A 3WYBA 3MJRA 2Z9DA 2PH3A 1KBOA 2RGWA 2WOOA 5AMXA 5FPSA 3ZHQA 2B98A 1YWGO 4BAUA 1K7SN 2X9GA 1AX9A 5E6UB 1BCRB 1JUDA 2FDCA 4FYWA 3DD5A 4ADSG 1ILEA 3D4IA 5EJ4A 2XECA 3DL7A 4FFLA 4ILEA 1WW2A 4JJZA 3FHTA 3DPIA 4URZR 4MW2A 1Y6QA 2E5WA 1G59A 4DA6A 1KDTA 3D3EA 5LB2A 1USIA 2E82A 2XWJI 3OEYA 4GKAA 3KDAA 3CMCO 4Q4AA 1NAIA 2WAMA 1ZQ9A 3CF6R 1KOLA 3AKZA 2QV0A 2GRAA 2VYND 4NWIA 4PWYA 3ZN2A 3OQVA 3NM4A 1C0EA 3HU2A 3BG5A 5FWAA 1HM5A 4ZXFA 5TMEA 3NYQA 4RDCA 3UCEA 1KI7A 1O0CA 1BSVA 3PUVA 1TAGA 3TXYA 3KR0A 4HQFA 4GMXA 2FX3A 1UT8A 4L8VA 3UC9A 2Q1WA 4PG6A 5IAGA 3B3QA 4XGNA 3RYTC 3SLRA 3L8GA 3QKRB 3S27A 3EIWA 1VI5A 3OCWA 2EP8A 1PT6A 2HYDA 3R24A 4JP2A 1I32A 2BHTA 4TOIA 3H9CA 2RFLA 4UBLA 2ZYDA 4YAFA 4JBHA 4OQEA 1NUHA 1SC6A 3DONA 1XL1A 3IPRA 2Y1KA 2H4FA 4KO4S 1FTQA 1E32A 1PR2A 1CUCA 3LQ2A 3R0ZA 4F2PA 1I7LA 1NWCA 3RSZA 3KL4A 5CMLA 2H1WA 3PNLA 4WBSA 3ZU2A 4QLBA 5JADA 2CHQA 1GRNA 2VNHA 5AW9A 1J49A 1FXWA 4LJ4A 5E3HA 4UTRA 3QHPA 3MWFA 3COJA 3O03A 3S2ZA 1B8UA 4L9AA 3EAGA 3T9AA 3DDHA 4P2BA 1C1YA 4Y2JA 1P74A 2IQ5A 1OA0A 1HE8B 2H18A 1GZ5A 1OBFO 2QPTA 4H9GA 4L95C 1XWIA 3P9XA 4HGNA 4MICA 3HKCA 4ZVTA 1BMTA 4JNCA 3SNHA 3H2ZA 3C2QA 4J16C 5F7OA 3PEWA 1E96A 5CEJA 4QT0A 2IOFA 3VR3D 3WNDA 3K96A 1RLUA 1T4BA 1WAMA 2FFHA 3D8UA 4MUXA 4CKEA 3FY4A 4DEVA 5COQA 2OR3A 1B0ZA 1C3LA 3C5EA 3H11B 3CIOA 5A3RA 1RC1A 2ERXA 3QWHA 3SQMA 4N0QA 4DMLA 6YASA 3RC9A 3C39A 3P0HA 3QFRA 4NDZA 4BLPA 5G41A 3NATA 1KK1A 3WMRA 3GRCA 1DDOA 1VGVA 1J0DA 2I4IA 4UD2A 1NT2A 3AO0B 4ZCMA 3FGOA 5DJ5A 3UXMA 4N65A 5LNK1 1Z5VA 2VHUA 4FFBA 3AQ4A 3G1WA 3PUKA 4G4GA 1VB5A 4KV7A 4ONEA 4QTXA 4Y2VA 5EZYA 5CCEA 5E0KB 3AEQB 1ZVMA 1E3EA 4OQMA 5ALJA 3VAZA 4B7XA 5L8VA 5A9SB 1ULAA 1W1IA 2X2OA 1RQ2A 1S1CA 1N3IA 4HC4A 2YW2A 2V3VA 2ZM6B 3G8AA 3QOFA 1KVUA 2IGTA 3EDOA 2RGYA 2QL9A 1G66A 2KYRA 2ST1A 5DHAA 4ZREA 3ACBA 4LNUA 4I8DA 4LJRA 1KH3A 1BMQA 5J5AA 1D6MA 2K7ZA 4M4SA 4BFSA 4PZ0A 3LRXA 1MZPA 1REQB 4Y0NA 2BZGA 1JAXA 5ILGA 1YR7A 3TWOA 1UM9A 1PZFA 2DQZA 1WDLA 3K94A 4JKOA 1NNUA 2QJOA 3K5PA 5LYYA 1ND6A 1IL0A 4RZ2A 3ZKAA 5A9TA 3PKZA 4MX8A 5LXTF 3B1KA 4FGZA 1NW6A 1WHTA 1NQTA 3K1AB 1HFEL 1XX6A 1CYDA 2VXCA 3OETA 4AUEA 1E8DA 1NVMB 1PWXA 1VA5A 3C3MA 5IVDA 1Z2DA 1FVHA 3MPOA 4H59A 4E3ZA 1P75A 3OPNA 1CZRA 2H8KA 4QU0A 4DKXA 2CNOA 3DGFC 3ZV3A 2EJCA 4HNQA 1FY2A 2D74A 2GLTA 4LF8B 4KBGA 4PLGA 3BPSA 1ZNXA 3ITEA 3VPAA 2II6A 1U99A 1GA6A 3RF7A 1UPCA 3DAGA 4WOBA 3DKPA 5E3JA 2IUFA 4TYQA 5CX1A 3G9TA 3PRHA 5IXSA 4P4UA 2Z57A 3SMQA 1BVHA 2AX4A 1E79A 5C32A 4WCDA 4AZ0A 1XCPA 1YGPA 3L7AA 5CT6A 5BY2A 4ZTZB 1QF6A 3SLGA 2IF0A 2R79A 2XUKA 4G5HA 4KFTA 4YR9A 2VYVD 3LYUA 3NGLA 4CMJA 4EY3A 4JYAB 1N5IA 3GVCA 1F6WA 3OY2A 3GFGA 1RJ9A 2BC9A 1RNLA 5F5XA 5ES3A 3JQ7A 4EGFA 5ARBA 3KSMA 2O54A 3O8DA 4N8EA 4IKEA 4MZXA 3ZDDA 4DFDA 1GKKA 2D1QA 3M6WA 3IL2A 1T2DA 3RTBA 1JIKA 1G5QA 5H5JA 1T8PA 2AL7A 3ET4A 4K1XA 3QELB 4XLZA 5AKGA 3DE1X 3RSSA 2OQIA 5CBPB 1OZ0A 1QC5A 4FEAA 1WF6A 4Z4CA 1SHZA 3OLYA 3UBMA 3K4HA 1F0YA 1U7ZA 1YI0A 1JU4A 1EXWA 1QBKC 1USGA 5B4UA 5CDGA 5J4VA 4CEIA 1FNNA 4MW0A 1V8OA 4BN0A 3IEMA 1TQ8A 4ZWNA 5JWRA 1U2DA 2GPAA 4TV8F 4NBUA 4PR3A 2J32A 3G59A 5J2UB 3ZDAA 4LY0A 3Q3JB 4LHXA 3Q3CA 1ELOA 2J9ZB 2Y92A 3PGKA 4KYUA 4S35A 1E4OA 2F1KA 2FUNB 3A9TA 3M70A 1YCGA 4KHZA 1SZJG 2Y67A 4V39A 3AUYA 3N6RA 4G5XA 2WHYA 3PUIA 2JLAA 1K6MA 4G0YA 5IJXA 2HK9A 2G70A 4EMTA 821PA 1QYDA 1IONA 4FGKA 3I52A 1VHDA 2PO7A 1O94A 1YA8A 5LIRA 4Y1EA 2QN8A 2CEKA 4MR7B 3WXBA 3VU8A 4BZWA 1BOOA 3MT8A 3S1SA 1QCYA 1Z6QA 2AN9A 3E7FA 3TBFA 4B33A 5TQVA 3ZLJA 4MQMA 4DUGD 5I51A 1FP4B 1ISHA 3QEKA 2HCFA 2W8ZA 3M6AA 2CCGA 1RD4A 4Y6GB 1KYTA 2VP4A 4XB1A 5CGQB 2HWXA 3DAYA 4YI3A 1UL1X 4HQ6A 3HDQA 4ITVA 1SCAA 1NR1A 2GDZA 1T1GA 3H1FA 1N6KA 3NYWA 3PQ3A 4EGQA 1HQDA 1Z5PA 2PO5A 1KEVA 4NS4A 1F0PA 1G3UA 3AVVA 5CXXA 1UR5A 2XRMA 3U0BA 5FTLA 4OI1A 5D5PA 3TDNA 4UVIA 2IHBA 4HZIA 3DBLA 1FS5A 1H1DA 4MNTA 2FEKA 4XUEA 4JI6B 2HPZA 3U7GA 5EUBA 4MWTA 3WIOA 4F97A 4Z7NB 1JAZA 3MLEA 5JPIA 1WXEA 4BZPA 2YN4A 1OH7A 4QOIA 4P0PB 3JVDA 4BB9A 1RWXA 1QIFA 2PLAA 3LO5A 4EJSB 1T4CB 1NC1A 1NHGA 2K5UA 2C9YA 5EJGA 2X76A 1TVKA 2BKUA 4N39A 5EYPA 2H1IA 2Q3HA 4GI5A 5AXAA 1FLDA 1Z22A 5BUZA 4TSFA 3IMKA 4IIEA 4J4HA 2DPXA 4MUHA 5EIXA 3ZNOA 1VPEA 2NT4A 1F1BA 3QG5A 4Q3CA 3WKDA 2XY4A 1V9CA 2XNCA 2OGWA 2FPUA 2OCKA 4L6CA 5F1KA 3V8NA 2I6SA 1I4TD 3AQIA 3MCZA 4XIFA 4LZPA 4UUQA 2B5OA 3DB1A 3I3OA 3DCJA 5CDTA 5I9NA 2EZ4A 4KAXA 2B9EA 3KHKA 2HJSA 3LGAA 4H6VA 2JLUA 1I6MA 3CX4A 2C96A 3N75A 1FTGA 3UMYA 2WG1A 3SSMA 3MYRA 1P0QA 2XPCA 1MNAA 1QTIA 3BIXA 3N0WA 1DAOA 1E9EA 1L6IA 3N53A 4BIIA 2R7MA 2MOKA 4KQGA 5FI3A 1Z4OA 4S2UA 4XOUA 1V1JA 1CUFA 2IDMA 5C4MA 3C3EA 4ZQCB 4CCWA 3SBOA 1Z4QA 3WK5A 4FI3F 4WADA 2IX9A 1II8B 4K6FA 3LXRA 1K7EB 4TTVA 3DEFA 2Y77A 3FW1A 3VAYA 3AR2A 4JB2A 2A0UA 5JBIA 5JTUA 2PKQP 4YRAA 4LGYA 3UJ9A 4Z4IA 1CEXA 4NR0A 4G3XA 5EXSA 2YIMA 3MUFA 3FPEA 1ONNA 3PDHA 2PG3A 3KYCA 1E9CA 1LPAB 2DHCA 4MV9A 2D59A 3TLMA 2QENA 4LJ8A 1A2QA 1P2UA 1O3YA 1CR6A 2JGMA 1HMPA 5ALRA 5C8YF 4AZSA 2QN7A 4QBGB 4U6SA 2I4NA 1N75A 1EFHA 4UW9A 4YBRA 3ZVNA 2O1EA 4JJAA 1JTFA 1LS1A 4R2LA 1GYPA 1RC0A 4Y3UA 4LF4B 3KR1A 1NASA 3LUHA 4RSRA 2JIPA 4UEWA 1XP8A 4PW0A 4Q15A 1V1MA 4CM5A 4YK7A 4C0QC 1LBTA 3ZY3A 3TSYA 1I5RA 3HXPA 2OWDA 3KUUA 3O4VA 4MGYR 3EXEB 4MRMB 4Z9AA 2BH2A 1BCRA 2V03A 3RAGA 1QMGA 2B2CA 4RPKA 4C5BA 3PNVA 2NG1A 1BXKA 1H05A 1NYQA 1W46A 2PPVA 5H81A 4DMGA 1KE1A 1INLA 1AQIA 1U2QA 3LD9A 2PX4A 2PQ0A 3BRWA 2ENUA 2NO6A 4LRUA 4PM4A 2A9QA 3TIFA 3K92A 5C0OE 1UBFA 4RJTA 1ZH6A 1EWRA 4F3RA 4BO6A 7MHTA 2I4LA 1PUIA 2XMZA 2C98A 2QMYA 4BVGA 2MMGA 3B38A 5LU8A 1R64A 3V55A 4DUYB 1SVSA 4U5XA 3AVXA 3L7JA 2YV2A 4PX3A 5CPBA 3J81k 2FUEA 2RGUA 3R3XA 3QKRA 3EZ2A 4WGGA 2B61A 1U94A 4DCVA 4EAQA 2CYBA 4NH0A 2FV8A 5JXWA 1CERA 3QLVC 3QVVA 4L5CA 5J4LA 3MC1A 2Q5OA 1ZJZA 2RMKA 3Q2KA 1CUIA 1IPFA 3CKYA 4GM0A 4DRYA 3RG8A 2B5VA 3OIUA 3IJRA 4OSPA 3TO5A 1PWZA 4IH1A 3IB6A 1X9GA 3TK1A 3FSGD 2IBTA 2FSFA 1BGVA 2IY8A 1F2UB 3EW9A 3FRJA 3KOOA 4OGLA 3UMCA 5GIPE 4BFTA 3ED5A 3PJRA 2QJFA 4KN6A 2J6HA 1EFTA 3ZD8A 1MOSA 5HZGA 3X1ZA 2VZEA 4OQPA 3K1TA 1C3XA 2V5UA 2PLNA 4O59O 1IY9A 3ENVA 1F8YA 2ZU6A 2BEUA 3GRYA 2CLFB 2GEKA 3OJFA 5DBIA 5DN6A 3JZMA 3UMFA 1O77A 4KI7A 4Z0PA 4ZN6A 3E8XA 1BMFA 1GPYA 1G17A 3KZMA 4NI5A 5IDVA 3RS0A 4QNNA 5DBOA 3OQBA 3I1YA 4URHA 1KY2A 1ZGAA 2R6FA 1C4WA 4D80A 4OGFA 2J0VA 3HL4A 4FMCB 1MO5A 4BNUA 4BWYA 1N4AA 1C9DB 2IU4A 2XX3A 3UQZA 1DEHA