3WX2A

Mouse cereblon thalidomide binding domain, native
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
b'GPTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKASNLNLIGRPSTVHSWFPGYAWTIAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein cereblon
publication title Structure of the human Cereblon-DDB1-lenalidomide complex reveals basis for responsiveness to thalidomide analogs
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein
total genus 20
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.150.20 Mainly Beta Beta Complex Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A Peptide methionine sulfoxide reductase. 3wx2A00
4CI2B 1L1DA 3MAOA 3HCJA 4TZUA 3WX2A 4V31A 4CI3B 4CI1B 3WX1A 5AMHA 2KZNA 4V2ZA 2KV1A 3HCHA 3HCGA 3CEZA 4TZ4C 3E0MA 2K8DA 3HCIA 3CXKA 4TZCA 4V30A 4V2YA 3E0OA
chains in the Genus database with same CATH superfamily
2LOYA 4CI2B 3NCUA 3LRNA 1L1DA 3MAOA 4A2VA 2HR9A 2QFDA 3HCJA 3P3KA 4TZUA 3EBMA 5E3HA 3WX2A 2W4RA 4V31A 3ZD7A 3ZD6A 2FU5A 1HXRA 3OG8A 1YZ1A 3DJMA 2RQBA 3EQTA 4A2XA 3FACA 4CI3B 4CI1B 2KWBA 1TXJA 2RQAA 5AMHA 3WX1A 5F98A 2KZNA 4V2ZA 1FWQA 2KV1A 3HCHA 5F9FA 1H7YA 2YKGA 3HCGA 2LVLA 3CEZA 4TZ4C 3E0MA 2K8DA 3GA3A 3HCIA 2RMJA 3CXKA 4TZCA 1H6QA 4V30A 4V2YA 4BPBA 3LRRA 4AY2A 3E0OA 5F9HA 2QFBA
chains in the Genus database with same CATH topology
4CI2B 1L1DA 3MAOA 3HCJA 4TZUA 3WX2A 4V31A 4CI3B 4CI1B 3WX1A 5AMHA 2KZNA 4V2ZA 2KV1A 3HCHA 3HCGA 3CEZA 4TZ4C 3E0MA 2K8DA 3HCIA 3CXKA 4TZCA 4V30A 4V2YA 3E0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CI2 B;  1L1D A;  3MAO A;  3HCJ A;  4TZU A;  3WX2 A;  4V31 A;  4CI3 B;  4CI1 B;  3WX1 A;  5AMH A;  2KZN A;  4V2Z A;  2KV1 A;  3HCH A;  3HCG A;  3CEZ A;  4TZ4 C;  3E0M A;  2K8D A;  3HCI A;  3CXK A;  4TZC A;  4V30 A;  4V2Y A;  3E0O A; 
#chains in the Genus database with same CATH topology
 2LOY A;  4CI2 B;  3NCU A;  3LRN A;  1L1D A;  3MAO A;  4A2V A;  2HR9 A;  2QFD A;  3HCJ A;  3P3K A;  4TZU A;  3EBM A;  5E3H A;  3WX2 A;  2W4R A;  4V31 A;  3ZD7 A;  3ZD6 A;  2FU5 A;  1HXR A;  3OG8 A;  1YZ1 A;  3DJM A;  2RQB A;  3EQT A;  4A2X A;  3FAC A;  4CI3 B;  4CI1 B;  2KWB A;  1TXJ A;  2RQA A;  5AMH A;  3WX1 A;  5F98 A;  2KZN A;  4V2Z A;  1FWQ A;  2KV1 A;  3HCH A;  5F9F A;  1H7Y A;  2YKG A;  3HCG A;  2LVL A;  3CEZ A;  4TZ4 C;  3E0M A;  2K8D A;  3GA3 A;  3HCI A;  2RMJ A;  3CXK A;  4TZC A;  1H6Q A;  4V30 A;  4V2Y A;  4BPB A;  3LRR A;  4AY2 A;  3E0O A;  5F9H A;  2QFB A; 
#chains in the Genus database with same CATH homology
 4CI2 B;  1L1D A;  3MAO A;  3HCJ A;  4TZU A;  3WX2 A;  4V31 A;  4CI3 B;  4CI1 B;  3WX1 A;  5AMH A;  2KZN A;  4V2Z A;  2KV1 A;  3HCH A;  3HCG A;  3CEZ A;  4TZ4 C;  3E0M A;  2K8D A;  3HCI A;  3CXK A;  4TZC A;  4V30 A;  4V2Y A;  3E0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...