3WX5A

Crystal structure of metagenome-derived glycoside hydrolase family 12 endoglucanase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
229
structure length
229
Chain Sequence
DEPTATVCDRWGSRDVAGGRYRVINNVWGAETAQCIEIGLETGNFILTRAEHSNGDNVAAYPAIYLGCHWGACTSQSGLPLRVEAISRLQSNWRLTPISSGRWNAAYDLWFSPSLTSTNGYSGGAELMIWLNWRGNVMPGGNRVATVSLAGATWEVWFADWDWNYIAYRRTTPVTEVTQLDLKAFIDDAVARGYISPTWYLHAVETGFELWEGGRGLKSSDFSVTLTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability of metagenome-derived glycoside hydrolase family 12 cellulase (LC-CelA) a homolog of Cel12A from Rhodothermus marinus
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Cellulase
total genus 59
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wx5A00
3WXPA 4XQ4A 1BVVA 1UU4A 3VZMA 3MF9A 2VULA 3VHPA 1YNAA 3WQ0A 5K7PA 2C1FA 2VGDA 3WP4A 1PVXA 2VG9A 2JEMA 3WT3A 4IXLA 4HKWA 2QZ3A 4H7MA 1C5IA 3VZKA 3WP6A 3MFCA 1XNCA 1H4HA 2BVVA 2JENA 4S2GA 2DFBA 1T6GC 3LB9A 3VLBB 1UKRA 3WY6A 3B7MA 4XQDA 3VHNA 1UU5A 1XYNA 4HK9A 2NLRA 3MF6A 3VZJA 1XNKA 3WQ1A 3AKSA 1HV1A 2B46X 3AMPA 2D98A 2D97A 2F6BA 2NQYA 3B5LB 4XPVA 1AXKA 5EJ3A 1XNDA 1OA4A 1XYPA 1HIXA 1OLQA 4S2HA 2DCYA 1H8VA 3M4FA 4S2DA 2BW8A 2B45X 1REEA 1NLRA 1OLRA 1KS5A 3VZLA 1HV0A 1XNBA 3WR0A 3LGRA 2BWAA 2DCJA 3EXUA 1F5JA 2DCZA 3VHOA 4HKOA 4NPRA 1H4GA 1BCXA 1BK1A 3HD8B 3ZSEA 3VL9A 3WQ7A 2QZ2A 3WP5A 3AMHA 3MFAA 5K9YA 1C5HA 2JICA 3AKRA 1H1AA 5HXVA 1REFA 1OA3A 1XYOA 4HK8A 1W2UA 3VGIA 3AKQA 2B42B 3VL8A 3AMQA 1XXNA 3O7OA 3VZNA 1H0BA 2DCKA 3AMNA 4HKLA 3RI9A 4S2FA 2DFCA 3RI8A 3AMMA 3WP3A 1OA2A 2Z79A 2VUJA 1ENXA 1M4WA 1QH6A 1QH7A 1TE1B 3AKPA 3WX5A 1REDA 3VZOA 1UU6A 4XQWA 1KS4A 3AKTA 2BWCA 1IGOA
chains in the Genus database with same CATH superfamily
3L2YA 1MPXA 1RUH1 4PLMA 3GHNA 3HEIA 3AB0A 1AR71 4V2WA 1OBNA 2DVGA 2AENA 4PLNA 3J8F3 1SLIA 3U75A 1DGWX 1W0PA 4J1XA 3MV01 4XFAA 1GFF2 3WHTA 3IPVB 1VBC1 1QJX1 4QDSA 4Y1ZA 5DAWA 4MHRA 2LALA 2O8QA 2VBDA 2W94A 5KXCA 1AR62 2WLPA 3BTAA 1VBB2 4DXRA 3LEIA 3GALA 5HCFA 5JI9A 1H2MA 3AYDA 4JQTA 2TEPA 1WW6A 4KNCA 4PIZA 2JENA 4AEMA 3O1SA 1RUD1 4PI2A 3LFMA 4B7EA 1O91A 2O14A 4BH9A 2FDGA 2XMLA 1AL22 2MNGA 1LHWA 1E57A 1X33A 5EIYB 3Q8AA 2OIIA 2F17A 1ZA7A 3IKWA 3PUSA 3AJZA 4PBPA 2ZX0A 3MF6A 3VZJA 1QOTA 1RTVA 1NQDA 4YGEA 5DG2A 2IFRA 4Z2WA 1ZRRA 3USSA 1JYVA 1CD3G 4XUTA 1SLCA 1D7PM 1R64A 3LIGA 3NV1A 4YVWC 1CPNA 1GZWB 2ZOEB 1SLBA 4XF3A 1YLLA 3VDCA 4NHKA 3I2HA 3EYPA 3VD5A 1QJY2 5F2WA 1UNBA 1VAMA 3OPZA 1UW8A 2Y26A 3PUQA 5EV7A 1DCSA 2HWB2 4LNVA 2PHWA 4V1PA 5E89A 4RHV3 1LODA 3FL7A 2OYZA 3VD3A 4PF5A 1ZBA1 3BPSA 3CZUA 3PMEA 3S5QA 3WINE 5FZAA 4H2AA 5BNNC 4XF9A 2ZHKA 1LTEA 3Q8FA 4IEUA 4DO0A 3V56A 4GZ9A 4FCAA 4Y5TA 2PAEA 2CNAA 5A3MA 5A6ZA 4XZPA 4CUGA 1EP0A 4F7ZA 1HN0A 3PNAA 1G9DA 4B29A 3BB6A 1K12A 4W8JA 4IGOA 1PGW1 4XJWA 4XMIA 1X82A 4WVZA 3S7EA 1YYNA 2XVKA 3O1RA 4M01A 1BKZA 2C9KA 4GH4B 1DG6A 1UD1A 1ST8A 3FHQA 3AL6A 4HVQA 5F3CA 1K45A 2A6WA 2GNBA 3ZVXA 2GH8A 1AX0A 3WW3A 4JHZA 4QT6A 1AR61 5AFEA 5CKQA 2EXIA 4LBLA 5DPNA 2VMHA 4BXSV 3VBFB 4XCBA 4ZHNA 4XUOA 4HETA 3OSDA 1UZYA 4XABA 1ZRIA 2CAVA 3H8UA 1ULGA 2QQLA 4FVVA 4KWUA 1YQ8A 5D8AB 3NAPB 2GN7A 1JODA 3AL5A 3AMMA 3C2UA 1CIWA 2Z79A 3KCYA 3WNLA 5E8AA 1CAWA 1CN1A 2JB4A 2R073 4I3GA 4PF1A 3TEWA 1W6QA 4KBZA 4PCRA 5A3OA 4DPNA 1W8HA 1UU6A 1XQNA 5ANQA 1OKOA 4XURA 4IEWA 5GALA 4Z1VA 5BV6A 5JOWA 2XKOA 2WS92 3AZZA 4CP9B 1R1ZA 1VBA2 1ZRCA 2W68A 2DF7A 4AF9A 3INAA 3RSJA 3JBG1 1DZTA 5KBFA 2BNMA 3OCPA 3KGZA 3KHBA 4CSWA 1N47A 2AEZA 1X50A 2RJLA 1OPOA 2WSVA 4B3NA 4HT1T 1OOPC 3NJXA 4YGCA 1WD3A 2R1BA 2C1FA 5K7PA 3PJYA 3I3BA 5FWEA 3AK0A 4U2AA 3U10A 1W06A 2OA2A 2VG9A 1V6JA 3C8XA 1XNAA 2EIEA 4FFGA 5LK5A 1IS4A 4QPWA 3ACFA 1HRI2 3IDAA 3WF3A 3JZVA 4MO3M 5IK8A 1EAH1 3ZXKA 2WS93 1AR91 4L92A 1TMF3 4AFDA 2WNEA 2UYBA 3J26N 4BA6A 4E8CA 3B7MA 2OXBA 3CIHA 2J1RA 2YB7A 3UJOA 3VHNA 1Q5OA 5L9BA 4NOTA 4LK6A 4IQPA 2VZ1A 1BLZA 1QJZA 2JDKA 2D6NA 4YGDA 4AI3A 2ARCA 2YXSA 4CU9A 4LHKA 4AGVA 2RS31 4IEQA 1H30A 2A71A 1FPN2 4XUNA 5AC92 4FTSA 3LOIA 1OOPB 4QXHA 5L19A 4FXKB 4CDXA 1UZWA 2NM1A 3ZYFA 4AOCA 3B94A 1Y4WA 3JBG3 4GD4A 4Q4X1 5GM0A 5IVYA 5A33B 2ARBA 3CU7A 4FBFA 1MZEA 2HWE3 1ZZ9A 3NSTA 5DAQA 1RIRA 2IXLA 2VH9A 3DYOA 1GOFA 2HBUA 2Y33A 1BBT1 2QJVA 2ORXA 4UF0B 1MEC1 3CJIB 2VECA 1AYM2 1HV0A 4Y33A 1V9U3 1K5MB 4BXFA 2XR4A 3RFRA 1KJRA 4IESA 3ZIWA 4LO4B 3FUQA 2D6KA 1F2NA 3HIFA 5BNPB 4Y4RA 5KXDA 5H9RA 1WKYA 5HCHA 2BOJA 3PU8A 1PO12 4KU8A 5J09A 2XBO2 5T50A 3ECQA 4IETA 4CEYA 1PK6C 4CCJA 5JR7B 3RYKA 2FDIA 1AL21 4Q5OA 5GKAC 2C26A 1AJOA 2RS33 3H9AA 3R6SA 2BEOA 2V4VA 1QXJA 5LBEA 4ZKTB 5K4LA 1CR7A 4FOVA 4DY5A 1YJLA 4RS5B 5FYHA 1MR5A 1IOAA 1QU0A 2RS52 1VRBA 4CUBA 4BJ0A 4DB5A 2HBTA 3TN92 4YLZA 4D7TA 3M70A 5BNOB 4R8HA 5FZ0A 4MGTA 3IMNA 2DCKA 4CP1A 5ABJB 1SPPA 2PHTA 3S0MA 3EB7A 1H6XA 4LJHA 4E2QA 2QQKA 4DZGA 3ZSKA 2MPFA 5IT6A 2B7YA 5FRAA 2BGCA 3N9OA 4A45A 4OULA 1TMF2 2YC4A 1DZRA 3VKNA 4BQ4A 3B93A 1GNYA 2ZPXA 2IZWA 4DXSA 5APAA 2FMYA 3N7MA 1PHMA 3KV4A 3WVJA 4EN6B 5IUQA 1FYUA 3VKMA 4YVSC 1HXS2 1NUKA 1V6OA 3B00A 2ZKNA 4HPKB 3IMMA 2SBAA 4LQRA 5FDBA 3N4MA 4ZZ8A 1OUSA 1PO23 2ZJCA 2E26A 3CL1A 1MVQA 2VZTA 3LSDA 1IS6A 4QPGA 1VLNA 3VHPA 1CONA 1UYZA 1W99A 1LHNA 3S7IA 3KB5A 4LA3A 2RMU3 1QDCA 3HPNA 2VW1A 3IPVA 1W90A 4XFHA 1W03A 2VGDA 4P08A 5FFOC 3W5MA 4PDWC 3ZYBA 2W52A 2J1UA 3KV9A 4EZHA 4GKXA 2WUHA 4EN0A 2BGOA 2AREA 2UWCA 4ZZ5A 5FYTA 1DGWA 5A3WA 4IW3A 2A7AA 3ALQA 1RUI3 1N1YA 4IE5A 3O0XA 1RJ7A 1QJU2 1HRI1 2JECA 1W6PB 5FY4A 4AAXA 3RZGA 4GULA 5FPBA 3MPBA 4JKLA 3I54A 4XE9A 4XCAA 4G9SB 2LROA 3R0RA 2D6PA 2MEV3 2VR4A 4B8EA 2RDQA 4IE4A 1IZ3A 3PJQA 1PX3A 3NNJA 4WZCA 4YZ3A 2NQYA 2WFPA 4K6BA 1BXHA 1A8MA 1N1TA 2XJPA 4BIFA 4U36A 4QPIB 1C8M1 2F4PA 5FZOA 1HB1A 3R4UA 2DCYA 3A23A 5EFUA 5FKCA 1K5JA 3NMBA 2ES3A 2UY9A 2VTXJ 1UCXA 1ACCA 1LOCA 1UWWA 3POBA 1VMFA 2H0VA 3ACGA 1IS5A 4UFIA 4WVWA 2I74A 1QQP3 5T54A 5FXXA 1G7YA 3QLQA 4AQSA 1TME3 5EWSA 2WWSA 5GZDA 2YGMA 4YG6A 1N3QA 2IFWA 4ONUA 1ZZ6A 5FLHA 4MVTA 4CYDA 5CA6A 3UNPA 3IDBB 1UMZA 1HRI3 2RMU2 1BCXA 1BK1A 1VALA 1ZZ8A 1O6UA 2A6VA 4IDZA 4CCKA 4BM8A 4EWDA 1U0AA 1LOFA 2YMZA 3POJA 5A3LA 3E97A 4OZXA 5HPOA 1SLTA 4D0QA 1NZCA 3C3VA 1G9AA 5JXJA 4FPJA 1IQAA 1VBB1 1X8EA 4MUVA 4NIDA 2BP6A 3N35A 4SBVA 4XACA 5IVBA 2JIGA 2BJSA 4GH4A 1RL3A 1PGSA 3DYMA 1PMJX 2QQMA 1UOGA 2BZDA 4HK8A 3VGIA 1H9WA 1EUTA 1VIWB 4MGYE 2CGOA 1C28A 1LGNA 2ORZA 2VZRA 2IXKA 3M7AA 3N3HA 3OBRA 2VMIA 3SEPA 5LY1A 5A1FA 2D44A 2NPIA 3VBFA 5JUVA 3MLKA 1Z7S1 3GCWA 1NYWA 2P6HA 1VBC3 5LB6A 1FMD2 2O8OA 5D8AA 4KWKA 3NAPA 4YWAA 3C7HA 4FPEA 1QJU1 2C0ZA 1QQP1 1UPSA 3CHXA 3MV11 3OTFA 2K9ZA 2PLV1 5GLWA 4CCNA 4ZONA 4BQ3A 1IQDC 5FO9B 4AVCA 2VY0A 2WO1A 3N7LA 3PHMA 1U12A 3U07A 5JXGA 3ZMNA 2J7MA 3EBRA 2VMDA 5FP9A 4YZ5A 4RFT0 3ZKUA 4L2NA 2OT7A 2RDRA 3N7JA 2OKXA 3TEXA 4CP9A 5CG9A 3WXPA 3I3DA 3OEBA 3H7JA 1GNZA 4DEQA 1D4M3 1RINA 1RUF3 3KQRA 5G04L 3I2GA 4UFKA 2GC2A 5CIRA 2JG9A 1JHNA 1PIV3 4N8MA 3DPRB 4JVAA 2VQUA 3GBFA 1VMHA 1PVC2 1W9SA 2IXJA 3WHUA 3AYCA 4QGLA 1VPHA 4OYUA 2ZX2A 2DBNA 3SH5A 1DIWA 1C5IA 1OC1A 1PX4A 1TG7A 4XHBA 2WIIB 5H9SA 3T1LA 2PELA 2XJUA 4AAPA 1WLCA 1XNCA 2WT0A 3BVCA 5A3NA 1JW6A 4YZ2A 5SV8A 2QKDA 4NVPA 3ETQA 4HK9A 2XHKA 3QBQA 4Y1VA 2QFEA 5IVFA 2ARXA 1LOAA 4IL7A 4H14A 1MS1A 4P9XA 1POV0 3CF6E 3OG2A 3MIHA 3WDVA 4AFAA 3BU7A 1OVSA 5EYYA 1CZSA 5DXDA 3MEPA 1C3HA 2Y64A 3M8LA 4OHWA 1XU2A 1OOPA 3WDUA 4C0BA 4WVVA 1SFNA 4ASKA 4CDXB 3N9MA 4J25A 3VN4A 1AR82 5A32A 5A33A 1FV2A 5GLTA 5H9QA 2JE7A 4CDWC 4CDQA 2NN8A 3B01A 3D0JA 2BGPA 3M4FA 2F4LA 1KXGA 3ZXEA 4I0BA 4UF0A 5FV3A 3CJIA 1KS5A 1W9TA 1K5MA 4FQ4A 1UZVA 1AR73 1KRIA 4LKEA 4LULA 2RM23 4HLTA 4OQ8A 3LKJA 2QDNA 1PM7A 1OFSA 5ABJC 1MVEA 1GBGA 3KHCA 4G3YC 4OLLA 4FQZA 3U78A 2CDOA 4Q4X2 3VBOC 2P6CA 4TN7A 5L7OB 4I02A 4ARXA 3TEZA 1E5SA 2ZA9A 5T5OA 1RGSA 1TEIA 2QQUA 3NV4A 4IE0A 5JSPA 2R6QA 3HJRA 4CEYB 3LPFA 4XFFA 2LS6A 3O1PA 5A3PA 2GDFA 5GLUA 3AFGA 1S0GA 3T2TA 1Q3EA 3F95A 4W4ZA 2BTVC 1WCSA 4IE7A 2WJSA 5A6QA 5JZGA 1D4M2 1RUF2 2A6ZA 2W5FA 4COYA 4BQ2A 4NHMA 1UY3A 4NHXA 5A1AA 5KC5A 5LATA 4RS5A 1WLWA 5FKBA 2WR9A 3SQOA 4XAEA 4DRRA 1COV2 1YQ6A 4LBQA 1VBD1 5BNOA 1O5LA 1BEV1 4QPYA 2JDHA 5FZDA 3AMNA 4UW3A 3T4VA 1ALYA 1SPPB 2PFWA 1SCRA 1IPSA 1FX5A 4CDXC 3KCXA 2V5DA 4NMIA 3LEMA 4BCUA 4HXCA 4FO9A 1EPZA 4FP2A 4NUBA 2DU0A 2EXKA 4PQ9A 1QH7A 4QX1A 1P8JA 1WZXA 4Q8LA 1SQ4A 2RR13 4XOGA 1DGRA 3JBG2 5IVCA 2X05A 3AFKA 4E27A 1GICA 3ZOIA 2WNVC 3WUDA 1UU4A 4PJYA 2P17A 4AL9A 1I3HA 4QPGB 2RMU1 4X6QB 1W9YA 3E5QA 3GJAA 3LDKA 5CNAA 2BV4A 1AR83 3LZZA 1RUE1 2AH2A 2VW0A 4IXLA 4IV3C 1WLDA 5FY5A 3QOPA 3W20A 1Y7BA 5IVVA 4XUQA 1JN2P 2AR6A 1IS3A 3OD0A 2BERA 2QVSB 2JDZA 1TME1 5FBZA 4ZXKA 4NIIA 5KHKA 3GNEA 5EYXA 2HWD3 1RXFA 1LRHA 1W6PA 1ASJ1 4AVTA 4XW3A 2EF6A 4AK3A 1ULDA 2Y6HA 3WNPA 1OQ1A 3IN9A 4RN5A 3THPA 4LBOA 4CDQC 4CDWA 2E7QA 1XNKA 2E31A 2D3RA 4KBBA 3K3OA 2DWRA 3SC7X 2ZKLA 3E6BA 4YZ1A 1VAVA 2ADDA 2PTMA 2WNUA 3X29B 4NAOA 5FZ4A 4BQ5A 2FZ2A 2WAAA 3ES4A 4Z92B 1ASJ3 2V5YA 4QXKA 4W6YA 2D6LX 4I30A 5LASA 2ZABA 4PBOA 5AC91 1NG0A 1Q56A 3SCGA 2R0HA 3DECA 4QPIA 2JDAA 1PNGA 5FZOB 1GMMA 4LBKA 2FDKA 1HJGA 1JU3A 3KZ4C 3BOPA 3OB8A 3VDDC 2X8KA 3THDA 4CPBD 1GP5A 1NLQA 2VAUA 1CX1A 4MYEA 3ZFGC 2A6YA 1PIV2 2O1QA 1CX4A 3GGLA 3HT2A 4Z8BA 3PU3A 2VCCA 3S30A 4ASLA 1PVC1 3NNGA 3S6PA 2WO3A 4FPGA 4PI0A 3IZOA 3O1OA 4ES9A 3PVEA 3ZSMA 2OQ6A 2NMOA 4BQWA 4A4AA 2VW2A 3H8OA 2Z69A 5C6CA 3H1WA 4CCEA 1NCQB 4XZUG 1CAVA 1J83A 4XJAA 2VNRA 3VKOA 5K9YA 1XU1A 2W95A 4R9AA 5DN2A 3EHKA 5DUVA 3U11A 4AHXA 1JYIA 1DQ5A 4F3JA 2E51A 2KM2A 4OQ9A 5CFDB 4FTBA 4XDOA 4AI9A 2ZZQA 3CMGA 1A8DA 4DUVA 4N53C 1UYXA 3MO4A 5HXVA 3ZFGB 3UGFA 3UK9A 4BOWA 2C6SA 5ANNA 4MG2A 4OUSA 3AP5A 3JB8A 2HWE2 4QU2A 1R092 1YUDA 3AKQA 3VDDB 4JV4A 3RRDA 1O5UA 4KG8A 1QJX2 2BFUL 4HL0A 2VBPA 1H0BA 5IFPA 1UZ0A 2VMFA 4E9KA 1QY4A 1V6NA 5J1XA 4XBNA 4META 2Q8EA 5A3UA 2YU1A 3I2IA 3DF0A 3T0AA 4UFHA 4BHPA 1GYKA 5T5JA 2D93A 2DTWA 4C0HA 1ASJ2 3BCWA 4HSJA 4R9CA 3AKPA 5E1RA 3WF2A 3OJBA 1G86A 4LO6B 1RUD3 2J42A 1Y9GA 2QQWA 3D6EA 2WZEA 4BMEA 5A7PA 1CESA 5E88A 5JIAA 4GWNA 4N43C 3I3QA 3THTA 3MBWA 2HWB3 3ZSJA 5AVAA 3SLIA 3J7MA 4OFGA 2VZQA 4RS5C 4O61A 4KGGA 2JG9B 1E5RA 4BMBA 2W39A 1F9KA 3DPRA 2PLV2 1LJ7A 5LCWL 3SKJE 1MQTC 2VTFA 2QQIA 2X10A 2TUNA 3PVBB 5HCAA 1C8M3 4ORFA 2R063 4K3UA 3TNQA 4XFCA 2HEWF 4CUAA 2V09A 4H7LA 2WQZC 2X5IA 5FPVA 2Z42A 1YC61 3L2HA 1UY2A 2BPA2 2XQRA 5F1RA 2EIBA 2RJKA 3WG1A 5FPXA 3KS7A 1PGW2 4FOQA 5FZ1A 2FCUA 5I0TA 1DU3D 3ZXDA 5IATA 3WSOA 5IK4A 3H8XA 5F2SA 2IVJA 3RJRA 3BALA 3EJKA 4JGZC 5HV4A 5IK5A 2WZR1 1YFUA 3DXTA 1YQ5A 1YXWA 1LKNA 1W05A 3SITA 3WD5A 2WBKA 2D98A 5FMOS 5HBAA 3WDTA 5A6XA 1WBFA 1W2AX 3B5LB 4XXAA 2UURA 4DQAA 1W8UA 1FOD2 1MS5A 2ZEZA 3WW1A 2XVGA 4Y20B 4EWAA 2GNMA 3GM8A 4C1WA 5A32B 1CQ9A 2A1XA 1GZ9A 1XYPA 2IUWA 4CDQB 1RUOA 4LO8A 5A3TA 1O4YA 4B4PA 3C7FA 4AE2A 4NWWA 3CJXA 3JD73 1A6CA 3OUHA 4AEDC 5FYBA 4QX5A 1O59A 1PZ7A 1QGLA 5FY1A 1RUI2 4W50A 2D6MA 1GV9A 2RS13 4D94A 3EXUA 2VXRA 4P9IA 1FI2A 4A7KA 1U5ZA 2KA3A 3T30A 2RS51 2A3WA 1N3OA 5L7OA 5L9RA 5FLIA 3MHZA 1PK6B 4NPRA 2WZ8A 2ADEA 1BHGA 1H4GA 4QKDA 3FE5A 3MLLA 4Y1XA 5K0UA 1DYOA 3N9NA 5IW0A 3ZSEA 2GSYA 3DYPA 2QBXA 3AMHA 1RVF3 5FMBA 3HNYM 2HYKA 3MPPG 2JIJA 5DDJ1 5I0SA 3ZMOA 4FFIA 2A3YA 3LFIA 1RMU2 3ZYGA 2WFF3 2W92A 1K5MC 2A6XA 5KXBA 3WDYA 1SFPA 1ENQA 4Q29A 4EE2A 4LBQB 5KWRA 2CL2A 2WINB 1NA1A 3M3OA 5CB7A 1KJLA 5CKNA 1T6BX 2JB8A 2JDYA 2OVUA 3A22A 4UFLA 1JZ8A 1QQP2 1SACA 2DFCA 4AQTA 3LEGA 5DUXA 2ZXQA 3POFA 1J3RA 4AXOA 1J3PA 3KGLA 1ENXA 2VUJA 1UIJA 3AXEA 5JOYA 5FXZA 3OGGA 4XVHA 2D5HA 2CY6A 4CU6A 1Y43B 1DQ1A 1W39A 4JDOA 4K21A 1UY1A 1S2KA 4E2SA 5LWBA 3TOJA 3U37A 3HQXA 5G05L 5FQ0A 3P3NA 3BN6A 3WV6A 1OXCA 3TYJA 3T08A 4M3CF 2Y0OA 2VCAA 2R32A 5FLJA 4RQPA 1XBFA 3V64A 3FBMA 3SKVA 1ND2C 4AI8A 1LOEA 4Q2FA 2XLAA 5L9VA 4TSVA 4Q4X3 4UOJA 1LHVA 3D5OA 1ZA4A 3PUIA 3ZKYA 2R041 2BVVA 2H0BA 1WLTA 2ZGNA 4QGMA 1UOBA 1RUG1 2ID4A 2HWF2 1UO9A 2VOVA 3URFA 1W3VA 5C3OA 1CGPA 3WOGA 3OBAA 4XQDA 4FOWA 1L3JA 1XYNA 4Y1UA 3UV9A 2JE9A 3H1MA 4MX3A 1OH3A 3VKFC 4BU2A 1ZZCA 4CDWB 1RXGA 3I2JA 2R30A 5C5UA 1TVGA 1DQ2A 4EYUA 1Z7S3 3IBMA 1DGRN 4ITCA 2EALA 2W47A 2YGLA 2TNFA 5A70A 2N7GA 1O3TA 1JUIA 1S2EA 2WNUB 1Q8VA 1KFXL 2CWMA 3I4IA 3IM0A 4W6WA 4FSJA 4FAGA 5DABA 2JD9A 4AFMA 4QDQA 1RUD2 1M06G 2AACA 3ZXGA 3SCFA 2AGSA 1AHSA 1RJ8A 1RMU1 5K0UC 2BVBA 4Q27A 3UGHA 1UL9A 2P3KA 5FXVA 2XOMA 4MXVA 2FCVA 4YW4A 3UYJA 1H8VA 4I0AA 4LR4A 5D2AA 3RJ2X 4V2VA 3BTZA 1LU1A 1ND2A 1ZRFA 2ZHNA 1W9FA 4XJ9A 4ES8A 4M3CB 3H1YA 1OLRA 2LW8A 3T1MA 5D8AC 2XUMA 5IVEA 1XNBA 1YI7A 1SHWB 3J4UH 1WCDJ 2PA7A 1AR92 2DCJA 1DQ0A 3MW3A 3LIHA 3VBFC 4YW6A 2IXHA 1F5JA 2VU9A 1YEWA 3IDCB 4WVMA 4LEJA 2RHPA 4LIVA 3DV8A 1DYKA 3T2PA 4Q1RA 4JTNA 5A7OA 1NCQA 2GZWA 2HWB1 1T2XA 4QDRA 1CAVB 4AYUA 3WP5A 2ZTNA 4I0WB 1CZTA 1HXS3 2EVXA 4ASMB 5CFDA 4HVOA 4CU8A 3WNMA 1GP6A 1O7FA 2XQXA 2YUEA 1QXPA 4IV1B 1G6NA 3ZFGA 4P9JA 1ULOA 1VBD2 3NV2A 1QMJA 4KI5M 1BEV2 4N9HA 2HEVF 1DP0A 2JKBA 4QKNA 3LA7A 3VDDA 1Q8PA 1WA6X 2YPDA 3PUHA 1LOBA 2PN5A 1X9TA 3O7OA 2WYSA 4XILA 4Y3OA 2R061 5IHRA 4O9GA 3VZNA 3WG2A 2MEV2 4JC1A 1ZBE1 5FZHA 3RZLA 4HKLA 4NO4A 2XONA 4W65A 3I49A 4I01A 2YC2A 3AP6A 3KQ4B 5FMOL 4FOYA 1JYTA 4HG6B 4AHZA 1F4HA 4WM8C 3DL3A 4BE3A 1IHMA 1S0IA 1WCQA 5EZWA 1QNYA 1QJU3 5FO8B 1J1TA 1MS4A 3IT8A 1EPWA 3CNAA 1UXXX 4H3WA 3GJBA 3KT4A 5FMCA 2WLQA 4BQ1A 4JGYB 3C7EA 3KSCA 4R9BA 1FXZA 3WX5A 4COWA 1YCIA 1XC6A 4QX7A 3OOXA 4XQWA 4JX0A 5FUNA 3USUA 5FY8A 1BQPA 3OPTA 4O7XA 4YGBA 5FMDA 1S0JA 1WMFA 3U14A 2R16A 4CCMA 1E5IA 1IKQA 4DS0A 3VZMA 4C90A 3ZFFC 4LHSA 4DUWA 4QKFA 4AGGA 1AYN1 3MF9A 1VJ2A 1F35A 1QXRA 4E4SA 3E6DA 5LW9A 5C8CB 1QJFA 3DN7A 3Q8EA 1QIQA 2JG9C 2W3JA 1R1A2 4CPBA 5A6YA 2IVIB 1VMJA 2JEMA 4NRQA 1NXMA 5GJ6A 5I91A 3TB0A 1NX9A 3ZPYA 4XDQA 1JOJA 4ISRA 4B4QA 1CIYA 5ACA3 1H4HA 2DUOA 2X5IB 1S0FA 4S2GA 3D82A 1JTZX 1LCLA 3PL0A 4MV2A 3MIBA 4Q4V2 2P37A 1HB3A 2FZ1A 4ATFA 4BIOA 3LQCA 1PMIA 3EMRA 3PDQA 4UW6A 5BPXA 4TLGA 2Y38A 3B02A 4ZU5A 5CISA 3RZZA 1X7NA 5KHHA 2RG4A 2KR2A 3HOBA 3KD4A 2FCTA 4JGZA 4NHYA 4P02B 4Y22B 5JOXA 3N9QA 1AXZA 4TZDA 4K20A 4E4HA 1PMHX 4LE3A 3ZO0B 2YG0A 2ZZJA 2Y6KA 3E5UA 1UYYA 5C8CC 4Y20A 2PQSA 1AXKA 5IJRA 3GDBA 1W8WA 3H3UA 4LUMA 1JZ3A 4LOSA 2OPKA 4JRLA 4ZS2A 2JD4A 2X5IC 3I2KA 1H2LA 5F6LB 2QTWB 2WRAA 4C1XA 3ORJA 2FDHA 3AYAA 2DUPA 3ILRA 1U5YA 4H55A 3RWKX 5C3SA 4GMP1 3FLPA 3VBSC 2QQNA 2P4EA 3GBGA 2ZAAA 4AI2A 2A5ZA 5EQUA 4ZU4A 3NJVA 1VBE2 2WO2A 1RVF1 2Y6FA 1FOD1 1NAEA 2WSUA 3J8F2 4FPLA 3RWNA 4ZU7A 2NP0A 3E1F1 3NKTA 3FLRA 3OBTA 1A3KA 4M0NA 3RS6A 1QKQA 4RSUA 3WF0A 1DDLA 1NE4A 1SMVA 3WDWA 3VV1A 4Y26A 1PK6A 1SBEA 3VUOA 1V70A 1US3A 3EO6A 5K0UB 5IVJA 1R1A3 2ZCWA 2QZ2A 5F3EA 2WNVB 1JHJA 4JGYC 2J1TA 1OSGA 4UW5A 1LECA 2WN3A 3M3EA 1YIFA 5FZEA 4DY3A 2WAOA 1ZREA 1H1AA 4NJ4A 1H2NA 5FJHA 1JZ7A 3IIIA 1GSLA 1WCKA 5EJ1B 3ZX7A 2DVFA 2WQ8A 4YVSB 3U1XA 4XAAA 4GQ7A 4RR3B 2D43A 3ZYJB 5LBCA 4EROA 5FUPA 5D1IA 5C3RA 1YFWA 2XWJB 2W0XA 2Q8OA 5FJKA 2Q1MA 3THCA 2RE9A 1NA1B 2Y6LA 3DKQA 4LKDA 5FK7A 2ZEWA 4GAZA 4XF1A 4HVRA 1ZZBA 3K51A 3C7OA 1ZBE2 2GMMA 5DAVA 4IV3A 4MZUA 3ZYHA 3BYWA 5EP9A 3GZUC 5BUVA 2XGXA 2QQVA 3OGRA 1GQGA 2XJVA 3EQEA 3ZDSA 4DXTA 2AYHA 5FZ6A 1HKDA 4WM7C 2AC1A 4L11A 4P00B 4RHV2 1ZBA2 4PIYA 1AR93 5J37A 1I6XA 5JAXA 4QQHA 5I0UA 4YM0A 2D40A 1RUC2 3WUCA 4B1LA 2Y60A 3PVNA 3MGUA 2XLFA 4KH9A 2LTNA 5FQ0B 4QU1A 1TNFA 4XMAA 4ZS3A 1H1MA 4AGRA 3K4AA 1UQXA 3KF3A 4JZRA 3T2QA 1R093 2QQPA 5J7MA 1VB4A 2D7FA 3R05A 2A70A 1AR81 5FY9A 5DDJ3 4CP0A 4RQPB 1JMUB 4D7SA 3P6BA 3WP4A 3NNMA 1KGYA 2WNOA 2XJSA 3KCCA 4HKWA 4CXYA 1RUJ2 2QZ3A 2ZHLA 2VZ3A 3K2OA 1H9PA 2XJQA 4QWNA 1HX6A 2V73A 5FOJB 1POV1 5I0RA 1UOJA 2EA7A 2OW4A 1EV12 3UKTA 2D3PA 2RM22 1H6YA 2J1SA 3VBHC 3WDXA 2ZACA 3GZTB 3S5AA 4QX8A 1W8OA 3J9SA 4IEVA 1VBC2 3P1IA 2Q8DA 1VBA3 3GBWA 1RC6A 4GA9A 4IEXA 4KWJA 2ZHMA 1W0NA 3FHIB 1YI9A 4QX0A 1DQ4A 1LB2A 3RDIA 1UN1A 3FFQA 5T52A 1US2A 4URTA 5FP8A 4AEJA 3HN1A 1ZM1A 2YBPA 4XYXA 5F5QA 1PM4A 1SBFA 3HNMA 4W6XA 2VUAA 3HMYA 3CO2A 4UW4A 3VBOA 3CLPA 5F32A 4HONA 2ET7A 5A1LA 1ND2B 2B45X 3H42B 3IAPA 1WCUA 2WC2A 4M3CA 4WM7A 4OUMA 2WZPP 4GH4C 5CBLA 2OZ6A 2YFUA 4LBNA 3SH3A 1HQLA 2ZX1A 1PZ9A 2Q0AA 3QD6A 2BWAA 2CHHA 3GZEA 4P9LA 4CRQA 2XLGA 4FTEA 4FFHA 4WVMB 1PO22 2Z5WA 3PUAA 4YARA 3AX4A 4K8RB 3QH7A 2W1SA 4QHOA 4JAAA 5ACA2 1FPN3 3GF6A 3T0BA 1J59A 1QJEA 2J1VA 1DQ6A 1ZBA3 3LPGA 2YROA 4LMFA 2JWPA 4E4DX 3TAYA 2VXJA 2XB6C 4NPMA 4QHBA 2XVLA 3VBHA 2HWC1 4D6QA 4IV1A 4K40A 3KWVA 4Y1YA 4ISQA 3R4DB 3K4DA 4QAWA 1NLSA 3AMQA 5A7WA 3VL8A 1FPN1 2R49A 2EAAA 2B5HA 2CU5A 2AEYA 1B35A 3ATGA 3GCXA 5GZFA 3T4HB 5C3QA 3TEYA 4HZFA 2DUQA 4D8MA 2WS91 4Q0PA 1WGPA 1CJPA 1OVPA 3NAPC 1GP4A 1LGCA 5EJZB 5AVPA 4FPKA 2CTVA 5FR3A 4L99A 3E5XA 2I07B 3RI8A 1O4ZA 3A4UA 1F4AA 1OI6A 2PHDA 2W87A 3NJYA 4D6RA 2UYAA 1NY71 1RYYA 1BVP1 5FY0A 3VKLA 4EWEA 3V0BA 3D4KA 2Y6JA 3G7DA 1V00A 3JD71 4JGYA 5C71A 2R0FA 4Y4YA 2X09A 5LRSA 3OYWB 3USUB 1ULEA 4XTPA 4CU7A 5CFCA 2E53A 3FUOA 5JMOA 3CDZB 3NNFA 4KU7A 4XIKA 4AI0A 5JMCA 2ZEXA 4ZXEA 1I5ZA 2VNOA 5C8CA 3MUY1 2JX9A 1DHKB 1O3SA 3WEZA 5SV5A 1CWPA 1V9U1 4KWLA 1UY0A 1UY4A 1CAXA 1LEMA 2ILMA 3W21A 2QUOA 4UBHA 1ZVFA 3AP4A 4AFCA 4CXWA 5JCTA 2P34A 4UYBA 3ZR5A 4P14A 2G9FA 3I2OA 5JOZA 4MGIE 3WQBA 2DFBA 3ILFA 5C8WA 4XTMA 2VZPA 2W91A 3S57A 4LE4A 3AYEA 2PYTA 1IPJA 4RGKA 4A41A 5CAZA 2YYOA 2YDEA 5HCBA 2DVBA 2DDUA 2VMCA 2H6CA 4TXWA 3NRUA 3N9LA 1GQHA 2Y8KA 3WQ1A 1OT5A 3N36A 2FDJA 3AC0A 3D3AA 4JGZB 3DUIA 1AYM1 4Y22A 3A21A 1DYPA 4QKBA 4GMP3 1GUIA 5CFDC 1C8NA 2LRPA 3IWZA 2CAUA 4Q0UA 5E6HA 3POEA 5DZEA 3ZR6A 1WW7A 2HYXA 3K77A 4M3CE 4F83A 1FMD3 2JDUA 3IDEA 4M00A 1OLQA 2FBEA 1RUC3 1J1LA 1ZNPA 3VBUB 3KT1A 1O3RA 5FP3A 2VUDA 4A44A 2EIGA 4OI0A 2ZX3A 2YBSA 1RUNA 1EYBA 4DXZA 3KVAA 4LBJA 5LZ6A 1GWLA 5GZEA 1JXNA 2VNGA 1JYNA 1UX6A 4OHVA 4OCTA 5A7SA 3O0WA 4A6SA 1GWMA 2G9GA 4RA0A 4EJRA 1XB9A 4XFIA 1G8WA 2DCTA 3U4SA 2VMGA 3AVRA 2EICA 1B09A 4GALA 5F5AA 5JXIA 1LGBA 2XJTA 4K9SA 4EV0A 5BNNA 1DBNA 3NWKA 4Y5Z0 5KHGA 2P5BA 3ACIA 4CCDA 4QM8A 3WQ7A 3SMHA 3Q8BA 2WNVA 1SEFA 2RM21 4EN8B 3VDAA 4MSVA 3JU9A 3BPZA 1W8NA 4HFSA 4Z82A 3ABZA 2G4IA 1GQPA 2JG8C 2ZGUA 3J8F1 1REFA 4YVSA 2RS12 3D8CA 4RR3A 4QPIC 3BTYA 4IV1C 2A3XA 4L97A 4P5HA 1GZCA 1W0OA 3Q8CA 5E16A 4YW5A 1AYN3 3ZN4A 1DFQA 4AZZA 5J3UA 4Q4V1 1RHI2 4A3ZA 3ZYPA 1KQRA 3RI9A 4YSFA 3FFZA 2GN3A 3FX3A 1XE7A 4NAMA 5BNQA 2YHJA 4QD2A 4A2UA 4IV3B 3POIA 4AEKA 1OA2A 3J7NA 4JDNA 4BQYA 3J7LA 5FK8A 1X36A 3ZXFA 4AVSA 4L0PA 1QH6A 4BISA 1TE1B 4FT8A 5KC6A 3FBYA 3LEKA 3VZOA 1COV1 4AVAA 1JH5A 4CEWA 4N9IA 5FWJA 3HR9A 4ET7A 2JDPA 1S0CA 4Q4W2 5JXHA 1DGLA 1AYN2 2HEYF 3JD72 2BWCA 5FO7B 1JBCA 4QM9A 4N7IA 3MI8A 5FYVA 3WF4A 3ELNA 2OX0A 4WM8A 1RUI1 2HWF1 4MGQA 4FFFA 3TNPB 3M3CA 3ZFEC 5J96B 1CPMA 4Z07A 1URXA 1VBE3 3U0ZA 5JLVA 5T5PA 3UL2A 2BNNA 2XL9A 2PQQA 3WT3A 2QDRA 4RHV1 4CTEA 1HXS1 2LUWA 4H7MA 1QOSA 2Q1FA 2WA4A 3VZKA 2J1EA 3WF1A 2JDMA 5F8PA 1NQJA 5A7QA 2VC9A 4N7UA 4MGSA 2DTYA 1T6GC 3LB9A 1W04A 2VPVA 4OUEA 5I93A 3CBNA 2WFF1 3RZKA 1UU5A 4A42A 3MYXA 1MZ5A 4UI9L 4AWDA 1RUE3 2A75A 2VL4A 1LOGA 2W1UA 4QQ2A 4RGGA 3AMPA 2Q30A 3RYRA 2F6BA 3TN91 3ITQA 3D0SA 3MZHA 4CDUB 2E7AA 3NKGA 4IGPA 3WNXA 1JS9A 1OF4A 3FC0A 4K8FA 4OZOA 1K42A 3NVCA 1D2QA 3HVDA 5CU1A 4GJZA 1RMU3 1Y9MA 3VBOB 5L7OC 4L8QA 2CSGA 4NIAA 2B4KA 1AX1A 1GR3A 1HLCA 1LNSA 4UT5A 2G19A 5C3PA 2W2IA 1VBE1 2H6BA 1UOFA 2J1AA 1FAYA 1NLRA 3TN93 4CEYC 1C4RA 2YC0A 4WM7B 2ZGLA 1ND3A 5FZ7A 2PHFA 3FJSA 3O1VA 1UAIA 3OGSA 3PVOA 5DMYA 4Q4W3 1QHDA 1V6KA 5B4NA 4JTOA 5FPZA 1L7QA 4YM1A 1RUC1 3H3ZA 4D6SA 1QF3A 1GU3A 1FT9A 4LPLA 2UWAA 5T55A 1C8M2 4HOOA 3ZXLA 3ETPA 4BB3A 2P3YA 5LK7B 1QEXA 4FI9A 3I2DA 4B4RA 2C4XA 1VRH1 2CGPA 4Q4W1 4DOUA 4YG0A 2X29A 3VD7A 4BWOA 2XKPA 1XSRA 5B2GB 1S0BA 4IGQA 1DZQA 3FMGA 3BGAA 3VBHB 1BBT3 3LA3A 2AUYA 1MZ6A 1H8TA 2ZGOA 4RR3C 1MEC3 3M3IA 3RQ0A 5JPMB 2Y0IA 4LA2A 5J36A 4CP2A 1FV3A 4BK5A 5A7WB 3ZXJA 1Z78A 1XXNA 5EPAA 1B35B 4QXBA 5LBBA 4A7ZA 4YYOA 3HN3A 4L9BA 4CEWC 5FREA 4DINB 5FZKA 4XIOA 4UFMA 3PIGA 1G9BA 1RHI1 5DZGA 1VE0A 1W6NA 4TTGA 1JUHA 5CZKA 2YBKA 1MQTB 4CCLA 2VQTA 1XOYA 1RUG2 3KM5A 1SG3A 3LDBA 1WA4A 3V0BB 2VOKA 4E2GA 5FPUA 2BFUS 1NKGA 1REDA 1ONAA 3OYWA 5FXWA 1G9CA 1IG0A 1UMIA 1KD7A 1WBLA 5CFCB 1OUXA 1QJY3 3AKTA 4KG0A 2BOIA 1Z7S2 4UWDA 3UKNA 3VBRC 4AEDB 5JWPA 5F37A 1VP6A 4Q4V3 2BBAA 2FQPA 5F7UA 1E5HA 2DYCA 2VULA 2VZOA 1SLAA 3ACLA 5FZ9A 3WG3A 4IEPA 1RB8G 1NE6A 1FATA 4LHLA 5IK7A 4AI1A 1XRUA 4RYDA 2BUKA 1KFUL 4CCOA 5F5IA 5FY7A 4I3PA 1LAJA 4SLIA 5F3GA 1CAXB 4X8PA 2HKXA 3BTXA 5F6KA 3TBDA 3VB9A 3BODA 1UPIA 1PNFA 4QB2A 3WCSA 3FN9A 1OPMA 1ZZ7A 2ZMLA 3IAQA 4A3XA 5HV0A 2BNOA 1TME2 4R9DA 1PZ8A 3RVHA 1NCRC 4J1WA 5FZLA 4PIXA 2VMEA 2PHUA 1CAUA 1HV1A 1EY2A 3AKSA 4YW3A 1ZBE3 3ZYIB 3RZHA 4Q8KA 4KL1A 1XSQA 4GWIA 2K46A 5B4XA 1LOFC 1ENRA 1RITA 2BDRA 1OLMA 2W9XA 1ULCA 1XNDA 4CE8A 3K48A 4NPLA 2GALA 2VUCA 2MHFA 2VTXA 2ZS6B 4AR2A 1C1LA 1AVBA 2ARAA 2RR12 2W08A 1X9PA 3DXUA 4J6GA 4S2HA 1BEV3 4BLJA 3VBSB 2E33A 3VBUA 1AX2A 3W5NA 4S2DA 4RGAA 3ZDVA 1J58A 1W3XA 3RMYA 3GYDA 4BYYA 4CUCA 1H1IA 2WT2A 4N43B 4MGZE 2HWD2 1W9WA 1AL23 2VD7A 1J3QA 3W9AA 4M0HA 2DCZA 3JB4C 4OVEA 3VHOA 5T5LA 4DMIA 2G1MA 1WW5A 3HAGA 1HQWA 5BNNB 2VZSA 3I3EA 3I3MA 1YQ2A 3JQXA 4X6RB 1RUJ3 3NQHA 3QH6A 5F5CA 3VL9A 5JDBA 2HLEA 4I09A 2W46A 3V0AA 3W58A 4YFWA 4MOAA 1YO8A 2XHNA 4YM2A 1EV13 3KF5A 3KV6A 4MLOA 4RFRB 3NL1A 3WCRA 2ZGSA 5IYYA 2JDNA 2EAKA 2V4AA 1W2UA 2HWC2 4N53B 4WZFA 2BU9A 4AVVA 2XWBB 1OH4A 2RDNA 1IG3A 5FZGA 1CJDA 3VBRB 1A34A 2VOTA 4Q4Y2 2NMNA 1D0GA 3SNMA 1LHUA 3G6JB 2VVEA 2RV9A 3BUCA 3LAGA 1VB2A 2VE1A 3H3LA 3W59A 1HW5A 2D5FA 4OI4A 1U5XA 4DIQA 1M4WA 5KXEA 3HWJA 4HN1A 4OI1A 5JI7A 1D2SA 1NCRB 4CEWB 2ZGQA 1YHFA 4OI2A 4AW7A 1RUJ1 2DBIA 2SLIA 3ENRA 5FCCA 5FPAA 5I0DA 3ON7A 1YQCA 4B1MA 1XE8A 3T0DA 1ODNA 1YFYA 3Q9OA 4WM8B 1L7RA 1ZX5A 2GMPA 1JOBA 2YFZA 4GB33 3RYPA 3P3PA 1V9U2 5FP4A 1WWYA 2EXJA 2XUEA 1ZRDA 2W1QA 1QJX3 1DLCA 4IEOA 3ZN5A 3ZM8A 3ZIXA 3MW4A 1HDKA 3LSEA 1PVXA 3WNOA 4FAHA 2MEV1 5FYUA 4R4XA 1APNA 3OPWA 1KITA 1MEC2 1PO13 2OZJA 3KVBA 2BYVE 3LWCA 3QACA 4LLFA 2XBO3 4LORA 1VBD3 2UY8A 4Q26A 4XF4A 1QDOA 2PHRA 1VR3A 4ATEA 1AR72 1HB2A 2R072 3ASIA 5FBJA 5K8SA 2BBVA 4YW2A 4MADA 4GB32 4E4ZA 1UIKA 2CYFA 2ZBJA 2WO7A 1XPWA 3I59B 4XDPA 3RG0A 1D4VB 1JU4A 2K0GA 2RS11 2VNVA 4OHZA 4LKSA 2B8MA 5BNOC 4URAA 1GNHA 2GC1A 4K1ZA 4PDWA 4CDUA 2PXJA 4LO7A 2R042 3AZYA 2KD7A 3K75B 4JKMA 1DF0A 4BZ4A 2YV8A 5DAXA 4LBQD 1OA4A 1AL0G 2UU8A 4LHNA 1AXYA 1JZ2A 3SEEA 3A0KA 3T3YA 2ZGRA 2BW8A 3LD8A 1COV3 4DEVA 2Z4FA 1I5PA 2VOWA 1UKGA 1WMXA 5TSWA 4I2OA 1S0DA 1ND3B 2R7EB 5C4WC 1Q43A 5JSOA 5GLZA 4FPCA 1SZBA 5FZCA 3JQWA 2RVAA 3O0VA 3AXDA 4XJ8A 2KXLA 2HWD1 1ENSA 5T3NA 1Y9QA 5LEKA 5EHDA 3OBZA 1W2OA 4G4FA 2DURA 4UAPA 3BOWA 3DEMA 5DG1A 5F39A 5FP7A 2Z2SB 2C24A 2VQAA 4D7YA 2R1DA 3WLUA 4JCKA 2IXIA 3CJIC 4QB6A 2OUHA 5FZMA 1VBB3 3NNLA 2JICA 2IWGB 1Y3TA 4D3WA 4MXWA 2QQOA 1H8TB 5FAXA 4HBNA 3MW2A 1ND3C 3HT1A 5C4WB 1GLHA 1NY72 3GHMA 1XYOA 4QXCA 1V0AA 4Q0SA 2E32A 5A80A 5C33A 5DUWA 4N90A 1G9FA 2NZ9A 4PHZA 4ZPIA 1RUH3 2W1WA 3E6CC 4AVBA 2VJXA 2BQPA 4XBQA 4BLIA 1HJFA 4NROA 5CEHA 4GWMA 1AYM3 4PQQA 1VRH2 4TYSA 4GXLA 1BYHA 4K1YA 1IKPA 1I9RA 1STMA 1WMDA 2XH6A 1W6NB 5AFBA 4O65A 1F8VA 3ZSLA 5KHIA 2DV9A 4P9YA 1MQTA 4HMZA 4LBMA 2R071 4Q1PA 1S55A 4EZ4A 2RJ2A 1OLME 2HWE1 2P2KA 3K3NA 4P5YA 3C7GA 3GXUA 1OQDA 1POV3 3T2OA 1LEDA 1FNZA 5BXXA 3WNNA 1VAKA 3TWIA 4DNYA 1O3QA 1H8TC 2Y6GA 4XFBA 4M4PA 4CDUC 4AEDA 5CVRA 3BKZA 1N1SA 3CKHA 1EUUA 4BDVB 3VDBA 2C5DA 2P1BA 2JG8B 1YNAA 2WA3A 4RL7A 2Q1ZB 1W8ZA 4D69A 2E7TA 3MLJA 5LEJA 3I2FA 1OD3A 2GU9A 5JVVA 3KV5A 3HNBM 2XG3A 3MICA 1SDWA 3K4ZA 1BMV1 1HQNA 5FPLA 1NZIA 3HBZA 3PLQA 4Q0QA 3V65A 1BJQA 1MS8A 3WP6A 1W6MB 4CXXA 2WFF2 4IERA 2FHRA 3VLBB 3O1MA 1HN1A 5C9AA 1W28A 2VQ0A 1A78A 4Q4Y1 1WMEA 1LENA 5JPNB 4YNIA 3ZFEB 2PLV3 4DRVA 2WYFA 3I7DA 1CAUB 2YY1A 3FWEA 4QHZA 3OY8B 4GIQA 3MDPA 1MZFA 2EXHA 3M3QA 5EXOA 1ULPA 2E63A 4EN7B 2RDSA 3PIJA 3HBKA 5CKMA 3H0OA 3JXSA 4GKYA 2I45A 4BPZA 3N9PA 1XNTA 1JYXA 2ZGMA 1F31A 2OUJA 2WABA 5FTTC 3VBSA 5C7GA 4XEZA 4QB1A 1IPKA 2ZMNA 3LF7A 1QOOA 4NRPA 3M1HA 5F9TA 2RS32 4TWTA 3R4SA 4QX3A 3VZLA 1JOPA 4MHUA 4N43A 1WW4A 3ZN6B 3WR0A 3LGRA 3RNSA 4Q0VA 1EV11 1YWKA 2HWF3 1D4M1 1RUF1 1V6LA 5FYMA 2HH9A 3RPQA 3SISA 1Z0HA 1AR63 5I8YA 1UZZA 4HKOA 4YZ4A 1NOVA 3UETA 4A7YA 3AP7A 3QCWA 2WWUA 5GZCA 4C8DA 3BIEA 1W2TA 1GANA 5ISLA 4YVWB 2LM3A 3V0AB 2FDFA 3LOBA 2DVDA 1SFYA 2OPWA 5GZGA 3K46A 4K7JA 1Q8QA 5FYSA 3H8RA 1FNYA 3PTYA 4NIHA 5LA0A 2HJIA 3FLTA 3ROUA 4FPYA 3AKRA 5IAXA 3WW4A 5IAVA 2XPJA 1R081 1WD4A 1OA3A 2P3JA 2XXZA 2BRTA 3JCIA 4N53A 1SLLA 3OGJA 5GLVA 3VBRA 1R1A1 5BY5A 3O1TA 3VBUC 1YFXA 1BMV2 3DGTA 4JDMA 1JZ5A 4YPJA 3WW2A 3APBA 2R062 1W6OB 4FPOB 3MIDA 3AZXA 3HQUA 1R083 4FP3A 1V6IA 3BIWE 4UBGA 2XJRA 3WP3A 3ZFFB 4E8DA 4XETA 1JYWA 3MIFA 1FOD3 4NRMA 2GNTA 1KEXA 4ARYA 4FPHA 3ZLIA 2ZGTA 4AQ2A 4KGQA 4X8NA 1HRV3 1OQEA 4Y24A 1NCRA 5ACA1 2GC3A 2C9AA 3KLSA 4QX2A 5LY2A 1AJKA 1OURA 2RS53 2Q4SA 4F8AA 5F3IA 4LXLA 3HQRA 1IGOA 2ZGPA 2ZEYA 3H50A 4A6OA 3O14A 3VD9A 2A73B 5AC93 5LA2A 1UXZA 1X8MA 1R091 4JHTA 4LKFA 5A7NA 2QCSB 4XUPA 4CVUA 5JZGC 2GAUA 1JZ4A 2ZMKA 4DFSA 3KT7A 1O8PA 3NV3A 3CQOA 5IWFA 1YJKA 1XE0A 1QWRA 4YG3A 1HRV2 3AZWA 3M2MA 1FMD1 2FMDA 1NXD1 2X53S 2VCMA 5FOBB 4NR1A 1RVF2 2WL1A 2VCBA 3ZXAC 4XJUA 5CADA 5DUUA 1S1AA 2B9UA 2ZGKA 3A0NA 1JYCA 2NYYA 1TQ5A 3AZVA 1F15A 3WY6A 3ZPOA 3DKWA 2IC1A 3LE0A 1SDDB 5FYYA 5LA9A 2Q5TA 2G9ZA 3I59A 4P9WA 4HN0A 5I8TA 2E6VA 1NCQC 4PLOA 1CVNA 3FHAA 2HWC3 1RHI3 1W8TA 1PIV1 2D97A 1LU2A 2L9LA 2PHLA 4PDWB 4Q4Y3 3KMHA 5J98B 3NO8A 1RUG3 3A7QA 3H7YA 1GZWA 2VM9A 1OMIA 3POGA 3IB3A 1R082 3F2ZA 1PVC3 4QPGC 3RZJA 1LESA 2EIDA 3SH4A 5BNPC 4EQVA 1TZOA 4PT6A 4YRDA 3SCHA 1B35C 4QGNA 4AHYA 1VBA1 4O9EA 4Y5SA 1W8FA 3AP9A 1OD5A 2B39A 3POWA 2RR11 4OMCA 5HXMA 2ZX4A 3ZYRA 3RGBA 3FZ3A 2ENRA 4LK7A 1SBDA 4LTAA 4NHLA 3J7HA 5CG8A 2JKXA 3NJZA 4CCCA 1MACA 3MIEA 2WNUC 2XBO1 1N3PA 2WQ4A 2B9VA 4UFJA 1UMHA 2QE3A 1F5FA 1JI6A 1ULFA 1I1EA 1PGL1 1MS0A 3HD8B 2QNKA 5D21A 1LHOA 4YW1A 4LUKA 3WG4A 4COUA 4XJZA 5DDJ2 3AVSA 1GOGA 3SXWA 4BK4A 2JJ6A 3LCPA 2VVFA 3OF1A 4FXGB 3LDRA 1D0HA 2GMEA 4MXWB 2D3SA 4P9GA 4XFGA 5CFCC 1JZ6A 5C4WA 2WT1A 4IEZA 2ET1A 3T09A 2UWBA 3OUJA 1PO21 2WWJA 4CZSA 3P5BA 4WBBA 3BI3A 1EAH3 2GC0A 4XHXA 1HB4A 4YW7A 1RUE2 4AQ6A 3UT0A 5FZIA 4KMQA 1AF9A 1QNWA 3TRSB 5DQ0A 1HRV1 1OHFA 5C5TA 4S2FA 2TBVA 5ERLA 3WZ1A 1BK0A 5DAPA 5H9PA 4B7KA 3L9JT 1ZYBA 1BZWA 3AJYA 2GP3A 1U5IA 5FZ3A 3UESA 1CAWB 1BBT2 4GMP0 2VO5A 4XC9A 4RD7A 1W6QB 3N7KA 3POYA 2O0OA 4IE6A 1NA1C 3PTRB 2AZ5A 4XXPA 5KR7A 1GZTA 1Q8OA 5FYCA 2GP5A 3VD4A 4LITA 5FZ8A 4LOTA 1EAH2 4XQ4A 1BVVA 1ODMA 4MGKE 5JR2A 4HANA 3MIGA 1POQA 2JG8A 4CA9A 3WQ0A 4JQRA 1YIPA 3I8TA 2ATFA 4OHXA 4QMAA 5FIXA 1DLLA 3PURA 3ACHA 3UKVA 4COVA 4XF0A 3B9CA 2YZ4A 4HSLA 1J84A 4OHYA 2VOXA 2QQJA 3DCQA 3CZJA 4EN9B 2K2SA 4JKKA 2VBBA 1XJAA 4YM3A 3I97A 1GOHA 4LT5A 3UJQA 1S4CA 2I2SA 2DU1A 1WUVA 2VVDA 3MFCA 2Y34A 1W6MA 1SCSA 2VZVA 3ES1A 4YFZA 4LIUA 5FZFA 2Q8CA 2J22A 1KDMA 2WN2A 3VHRA 4AHWA 1UKRA 4GWJA 2CWSA 4NN0A 4AG4A 4LLOA 2PAMA 5C9AB 2ERFA 2D6OX 4RQPC 2DVAA 4NWVA 2NLRA 5C70A 2WZR3 3ZFEA 1UF2C 5L73A 4AFBA 1PGL2 4GB31 2VZUA 2B46X 3OY8A 3BU0A 1MS9A 1RUH2 3OD4A 3POSA 4OMDA 3LA2A 1UYPA 2V72A 3RZMA 1TMF1 4XPVA 5CYYA 1CZVA 1S2BA 2XL7A 3JUUA 1VRH3 4QQPA 4R52A 5EJ3A 5C9AC 5LA1A 4M4RA 4TLFA 1HIXA 1L7LA 1PO11 2E9QA 1S0EA 4MH0E 1N1VA 1O4TA 5FYIA 1REEA 3PMSA 3OEAA 4COZA 1C57A 1NT0A 5IFTA 1TNRA 2PHXA 5JSRA 1W2NA 1O8SA 3ZN6A 5LBFA 5HI0A 2ZAHA 1K3IA 1C1FA 4QQOA 3WNKA 5JIUA 5L36A 1AZDA 1MS3A 3O5SA 4FPFA 5BNPA 4R4ZA 1H2KA 2YPJA 3ME2A 4Z2AA 4NE9A 1V6MA 4UXAA 4INDA 3U4XA 4YVWA 1AUYA 3GZAA 3MFAA 2JE8A 1GKBA 1C5HA 3OGVA 4GJYA 5BYNA 2WKKA 3ST7A 4DUXA 3MUZ1 2OS2A 2GNDA 4WV8A 5FYZA 1YRZA 5J48A 3AM2A 1OF3A 2B42B 5KHJA 1QJY1 3O1UA 2CV6A 5FZBA 3IIAA 3O12A 4C91A 3B9IA 3B3QE 1LR5A 5DZFA 1GWKA 5LRRA 2JXAA 1OKQA 5I8SA 2WDBA 2FD8A 1Q8SA 2GH2A 1KDKA 2PAKA 2R043 5ABJA 2XDVA 4IUGA 4IEYA 1W6OA 3DPRC 2IXCA 4XBLA 4JRAA 1UX7A 2OQ7A 3ILNA 3NW4A 4ZY9A 3OUIA 3ZFFA 3CEWA 5FUIA 4QQLA 2PMWB 2P3IA 4NIGA 3SHRA 2CDPA 2ETEA 4BQXA 5JZGB 5M0TA 4LO5B 3B69A 3RMXA 1LULA 2CGNA 3UGGA 4KQ7A 2WZR2 4HPKA 1KS4A 1OFNA 2YU2A
chains in the Genus database with same CATH topology
3L2YA 1RUH1 4PLMA 3GHNA 3AB0A 1AR71 2DVGA 2AENA 4PLNA 3J8F3 1SLIA 1DGWX 1W0PA 4J1XA 4XFAA 3WHTA 1GFF2 3IPVB 1VBC1 1QJX1 4Y1ZA 2LALA 2O8QA 1AR62 5KXCA 2WLPA 3BTAA 1VBB2 3GALA 5HCFA 5JI9A 1H2MA 3AYDA 2TEPA 1WW6A 4KNCA 4PIZA 2JENA 4AEMA 1RUD1 4B7EA 1O91A 4BH9A 1AL22 2MNGA 1LHWA 1E57A 1X33A 2OIIA 3IKWA 4PBPA 3AJZA 2ZX0A 3MF6A 3VZJA 1QOTA 1RTVA 1NQDA 4YGEA 5DG2A 2IFRA 4Z2WA 1ZRRA 3USSA 1CD3G 1SLCA 3NV1A 4YVWC 1CPNA 1GZWB 2ZOEB 1SLBA 4XF3A 1YLLA 4NHKA 1QJY2 1VAMA 3OPZA 1UW8A 2Y26A 5EV7A 2HWB2 4LNVA 2PHWA 4V1PA 5E89A 4RHV3 1LODA 2OYZA 4PF5A 1ZBA1 3PMEA 3WINE 5BNNC 4XF9A 2ZHKA 1LTEA 4IEUA 3V56A 4FCAA 2PAEA 2CNAA 5A3MA 4XZPA 1EP0A 4F7ZA 3PNAA 1G9DA 4B29A 3BB6A 1PGW1 4XJWA 4XMIA 1X82A 4WVZA 3S7EA 1YYNA 2XVKA 4M01A 1BKZA 4GH4B 1DG6A 1UD1A 4HVQA 2GNBA 2A6WA 3ZVXA 2GH8A 1AX0A 3WW3A 4QT6A 1AR61 5AFEA 2EXIA 4LBLA 2VMHA 3VBFB 4HETA 1UZYA 2CAVA 3H8UA 1ULGA 5D8AB 4FVVA 3NAPB 2GN7A 3AMMA 3C2UA 1CIWA 2Z79A 3KCYA 5E8AA 1CAWA 1CN1A 2R073 4I3GA 1W6QA 4PCRA 4DPNA 1UU6A 1XQNA 5GALA 4IEWA 4Z1VA 5BV6A 5JOWA 2XKOA 2WS92 3AZZA 1R1ZA 1VBA2 1ZRCA 2W68A 2DF7A 4AF9A 3INAA 3RSJA 3JBG1 1DZTA 5KBFA 2BNMA 3OCPA 3KGZA 1N47A 1X50A 2RJLA 1OPOA 2WSVA 4B3NA 4HT1T 1OOPC 4YGCA 1WD3A 2R1BA 2C1FA 5K7PA 3PJYA 3AK0A 4U2AA 3U10A 2OA2A 2VG9A 1V6JA 5LK5A 1IS4A 1HRI2 3JZVA 5IK8A 1EAH1 3ZXKA 2WS93 1AR91 4L92A 1TMF3 4AFDA 2WNEA 2UYBA 3J26N 4BA6A 3B7MA 3UJOA 3VHNA 1Q5OA 4NOTA 4IQPA 1QJZA 4YGDA 2D6NA 4AI3A 2YXSA 4LHKA 4AGVA 2RS31 4IEQA 1H30A 2A71A 1FPN2 5AC92 4FTSA 3LOIA 1OOPB 5L19A 4FXKB 4CDXA 2NM1A 3B94A 3JBG3 5A33B 4Q4X1 5GM0A 2ARBA 3CU7A 4FBFA 1MZEA 2HWE3 1ZZ9A 3NSTA 1RIRA 2IXLA 2VH9A 1BBT1 2QJVA 1MEC1 3CJIB 2VECA 1AYM2 1HV0A 1V9U3 1K5MB 1KJRA 4IESA 3ZIWA 4LO4B 3FUQA 2D6KA 1F2NA 3HIFA 5BNPB 5KXDA 5H9RA 1PO12 4KU8A 5J09A 2XBO2 5T50A 3ECQA 4IETA 4CEYA 1PK6C 5JR7B 3RYKA 1AL21 5GKAC 1AJOA 2RS33 3H9AA 3R6SA 2BEOA 1QXJA 4ZKTB 1CR7A 4FOVA 4DY5A 1YJLA 4RS5B 1MR5A 1IOAA 1QU0A 2RS52 4DB5A 3TN92 4YLZA 4D7TA 3M70A 5BNOB 4R8HA 3IMNA 2DCKA 4CP1A 5ABJB 2PHTA 3S0MA 4E2QA 4DZGA 3ZSKA 2MPFA 5IT6A 2B7YA 5FRAA 2BGCA 4OULA 1TMF2 1DZRA 3VKNA 3B93A 2ZPXA 2IZWA 4EN6B 5JZGA 2FMYA 3N7MA 1PHMA 3WVJA 5IUQA 1FYUA 3VKMA 4YVSC 1HXS2 1V6OA 3B00A 3N4MA 2ZKNA 4HPKB 2SBAA 5FDBA 3CL1A 1PO23 2ZJCA 1MVQA 4QPGA 3LSDA 1IS6A 3VHPA 1VLNA 1CONA 3S7IA 1LHNA 3KB5A 4LA3A 2RMU3 1QDCA 2VW1A 3IPVA 4XFHA 2VGDA 5FFOC 4PDWC 2W52A 4GKXA 4EN0A 2UWCA 2AREA 1DGWA 2A7AA 3ALQA 1RUI3 1N1YA 3O0XA 1RJ7A 1QJU2 1HRI1 2JECA 1W6PB 4GULA 3MPBA 3I54A 4XE9A 4G9SB 3R0RA 2D6PA 2MEV3 4B8EA 1IZ3A 3PJQA 4WZCA 4YZ3A 2NQYA 2WFPA 4K6BA 1BXHA 1A8MA 1N1TA 2XJPA 4BIFA 4U36A 4QPIB 1C8M1 2F4PA 3R4UA 2DCYA 5EFUA 2ES3A 2UY9A 1UCXA 1LOCA 2H0VA 1IS5A 4WVWA 2I74A 1QQP3 5T54A 1G7YA 3QLQA 4AQSA 1TME3 5EWSA 2WWSA 5GZDA 2YGMA 4YG6A 1N3QA 2IFWA 4ONUA 1ZZ6A 5FLHA 4MVTA 4CYDA 5CA6A 3IDBB 1UMZA 1HRI3 2RMU2 1BCXA 1BK1A 1VALA 1ZZ8A 2A6VA 4EWDA 5A3LA 4BM8A 1U0AA 1LOFA 2YMZA 3E97A 4OZXA 1SLTA 1NZCA 3C3VA 1G9AA 4FPJA 1IQAA 1VBB1 1X8EA 4MUVA 3N35A 4SBVA 4GH4A 1RL3A 1PGSA 4HK8A 3VGIA 1H9WA 1VIWB 4MGYE 2CGOA 1C28A 1LGNA 3N3HA 2IXKA 3M7AA 3OBRA 2VMIA 2D44A 2NPIA 3VBFA 3MLKA 1Z7S1 1NYWA 1VBC3 1FMD2 2O8OA 5D8AA 4KWKA 3NAPA 4FPEA 1QJU1 1UPSA 1QQP1 2C0ZA 3OTFA 5GLWA 2K9ZA 2PLV1 5FO9B 2VY0A 3N7LA 3PHMA 1U12A 3U07A 3ZMNA 3EBRA 4YZ5A 4RFT0 4L2NA 3N7JA 5CG9A 3WXPA 3H7JA 1GNZA 1D4M3 1RINA 1RUF3 3KQRA 2GC2A 5CIRA 2JG9A 1JHNA 1PIV3 3DPRB 4JVAA 3GBFA 1PVC2 3WHUA 2IXJA 3AYCA 4QGLA 2ZX2A 3SH5A 1DIWA 1C5IA 4XHBA 5H9SA 2WIIB 3T1LA 2XJUA 2PELA 1WLCA 1XNCA 2WT0A 1JW6A 4YZ2A 5SV8A 2QKDA 4NVPA 3ETQA 4HK9A 2XHKA 3QBQA 4Y1VA 2QFEA 2ARXA 1LOAA 4IL7A 4H14A 1MS1A 4P9XA 1POV0 3CF6E 4AFAA 3MIHA 3WDVA 3BU7A 5EYYA 5DXDA 3MEPA 1C3HA 3M8LA 4OHWA 1XU2A 1OOPA 3WDUA 4C0BA 4WVVA 1SFNA 4CDXB 3VN4A 1AR82 5A32A 5A33A 1FV2A 5GLTA 5H9QA 2JE7A 4CDWC 4CDQA 2NN8A 3B01A 3D0JA 3M4FA 1KXGA 3ZXEA 4I0BA 3CJIA 1KS5A 1K5MA 4FQ4A 1AR73 1KRIA 4LULA 2RM23 4HLTA 3LKJA 2QDNA 1PM7A 1OFSA 5ABJC 1MVEA 1GBGA 4G3YC 4OLLA 4FQZA 4Q4X2 3VBOC 5L7OB 4I02A 2ZA9A 5T5OA 1RGSA 1TEIA 3NV4A 5JSPA 2R6QA 4CEYB 4XFFA 2GDFA 5GLUA 3AFGA 1S0GA 3T2TA 1Q3EA 2BTVC 1WCSA 2WJSA 1D4M2 1RUF2 2A6ZA 4COYA 4NHMA 5KC5A 4RS5A 1WLWA 4DRRA 1COV2 4LBQA 1VBD1 5BNOA 1O5LA 1BEV1 4QPYA 3AMNA 4UW3A 1ALYA 2PFWA 1SCRA 1FX5A 4CDXC 3KCXA 4BCUA 4FO9A 1EPZA 4FP2A 2DU0A 2EXKA 4PQ9A 1QH7A 4Q8LA 1SQ4A 2RR13 4XOGA 1DGRA 3JBG2 3AFKA 4E27A 1GICA 2WNVC 3WUDA 1UU4A 4PJYA 2P17A 1I3HA 4QPGB 2RMU1 4X6QB 3E5QA 5CNAA 1AR83 3LZZA 1RUE1 2AH2A 2VW0A 4IXLA 4IV3C 1WLDA 3QOPA 1Y7BA 1JN2P 2AR6A 1IS3A 3OD0A 2QVSB 2JDZA 1TME1 5FBZA 4ZXKA 5KHKA 3GNEA 5EYXA 2HWD3 1W6PA 1LRHA 1ASJ1 4AVTA 4XW3A 2EF6A 4AK3A 1ULDA 1OQ1A 3IN9A 3THPA 4LBOA 4CDQC 4CDWA 2E7QA 1XNKA 2D3RA 4KBBA 2DWRA 2ZKLA 3E6BA 4YZ1A 1VAVA 2PTMA 2WNUA 3X29B 2FZ2A 3ES4A 4Z92B 1ASJ3 2V5YA 4QXKA 4W6YA 2D6LX 4I30A 2ZABA 4PBOA 5AC91 1NG0A 1Q56A 3SCGA 2R0HA 4QPIA 1PNGA 4LBKA 3KZ4C 3BOPA 3VDDC 2X8KA 4MYEA 3ZFGC 2A6YA 1PIV2 2O1QA 1CX4A 3HT2A 4Z8BA 3S30A 4ASLA 1PVC1 3S6PA 4FPGA 4ES9A 3PVEA 3ZSMA 2NMOA 2VW2A 2Z69A 5C6CA 3H1WA 1NCQB 1CAVA 4XJAA 2VNRA 3VKOA 5K9YA 1XU1A 5DUVA 4R9AA 3EHKA 3U11A 4AHXA 1JYIA 1DQ5A 4F3JA 2E51A 2KM2A 5CFDB 4FTBA 2ZZQA 1A8DA 4N53C 5HXVA 4BOWA 3ZFGB 3UK9A 4OUSA 3AP5A 3JB8A 2HWE2 4QU2A 1R092 1YUDA 3AKQA 3VDDB 4JV4A 3RRDA 1O5UA 4KG8A 1QJX2 2BFUL 4HL0A 1H0BA 4E9KA 1QY4A 1V6NA 4XBNA 4META 3DF0A 4BHPA 1GYKA 5T5JA 2D93A 2DTWA 4C0HA 1ASJ2 3BCWA 4HSJA 4R9CA 3AKPA 5E1RA 3OJBA 1G86A 4LO6B 1RUD3 3D6EA 4BMEA 1CESA 5E88A 5JIAA 4GWNA 4N43C 3THTA 2HWB3 3ZSJA 5AVAA 3SLIA 4OFGA 4RS5C 4KGGA 2JG9B 4BMBA 3DPRA 1F9KA 2W39A 2PLV2 1LJ7A 1MQTC 2TUNA 3PVBB 5HCAA 1C8M3 4ORFA 2R063 4K3UA 3TNQA 4XFCA 2HEWF 2V09A 4H7LA 2WQZC 2X5IA 2Z42A 2BPA2 3L2HA 5F1RA 5FPXA 2RJKA 3WG1A 3KS7A 1PGW2 4FOQA 5I0TA 1DU3D 3ZXDA 5IK4A 3RJRA 3BALA 3EJKA 4JGZC 5IK5A 2WZR1 1YFUA 1YXWA 1LKNA 3WD5A 3SITA 5HBAA 2D98A 5FMOS 3WDTA 1WBFA 3B5LB 4XXAA 2UURA 4DQAA 1FOD2 1MS5A 3WW1A 2XVGA 4Y20B 4EWAA 2GNMA 4C1WA 5A32B 1CQ9A 1GZ9A 1XYPA 4CDQB 1RUOA 4LO8A 1O4YA 4B4PA 4AE2A 4NWWA 3CJXA 3JD73 1A6CA 4AEDC 4QX5A 1PZ7A 1QGLA 1RUI2 2D6MA 1GV9A 2RS13 4D94A 3EXUA 2VXRA 4P9IA 1FI2A 4A7KA 1U5ZA 2KA3A 2RS51 2A3WA 1N3OA 5L7OA 5FLIA 4NPRA 1PK6B 1H4GA 3FE5A 3MLLA 4Y1XA 5K0UA 3ZSEA 2GSYA 3AMHA 1RVF3 2HYKA 3MPPG 5DDJ1 5I0SA 3ZMOA 2A3YA 1RMU2 3ZYGA 2WFF3 1K5MC 2A6XA 5KXBA 3WDYA 1ENQA 4Q29A 5KWRA 4LBQB 2CL2A 2WINB 1NA1A 3M3OA 5CB7A 1KJLA 2OVUA 1QQP2 1SACA 2DFCA 4AQTA 5DUXA 1J3RA 4AXOA 1J3PA 3KGLA 1ENXA 2VUJA 1UIJA 3AXEA 5JOYA 3OGGA 2D5HA 2CY6A 1Y43B 1DQ1A 1W39A 4JDOA 4K21A 1S2KA 4E2SA 3TOJA 3HQXA 5FQ0A 3P3NA 3WV6A 3TYJA 4M3CF 2Y0OA 2R32A 5FLJA 4RQPA 3V64A 3FBMA 1ND2C 4AI8A 1LOEA 4Q2FA 2XLAA 4TSVA 4Q4X3 1LHVA 3D5OA 1ZA4A 2R041 2BVVA 2H0BA 1WLTA 2ZGNA 4QGMA 1RUG1 2VOVA 2HWF2 3URFA 1CGPA 3WOGA 4XQDA 4FOWA 1L3JA 1XYNA 4Y1UA 3UV9A 2JE9A 3H1MA 4MX3A 3VKFC 4CDWB 1ZZCA 2R30A 1DQ2A 1Z7S3 3IBMA 1DGRN 4ITCA 2EALA 2YGLA 2TNFA 2N7GA 1O3TA 1JUIA 2WNUB 1Q8VA 1KFXL 2CWMA 3I4IA 3IM0A 4W6WA 4FSJA 4FAGA 4AFMA 1RUD2 1M06G 3ZXGA 3SCFA 2AGSA 1AHSA 1RJ8A 1RMU1 5K0UC 2BVBA 4Q27A 1UL9A 2P3KA 4MXVA 4YW4A 1H8VA 4I0AA 4LR4A 3RJ2X 1LU1A 1ND2A 1ZRFA 2ZHNA 4XJ9A 4ES8A 4M3CB 3H1YA 1OLRA 3T1MA 5D8AC 2XUMA 1XNBA 1YI7A 3J4UH 1WCDJ 2PA7A 1AR92 2DCJA 1DQ0A 3MW3A 3VBFC 2IXHA 1F5JA 2VU9A 3IDCB 4WVMA 4LEJA 2RHPA 3DV8A 1DYKA 4Q1RA 4JTNA 1NCQA 2GZWA 2HWB1 4AYUA 1CAVB 3WP5A 2ZTNA 4I0WB 1HXS3 2EVXA 4ASMB 5CFDA 4HVOA 1O7FA 2YUEA 1QXPA 4IV1B 1G6NA 3ZFGA 4P9JA 1VBD2 3NV2A 1QMJA 1BEV2 4N9HA 2HEVF 3VDDA 2JKBA 3LA7A 1Q8PA 1LOBA 2PN5A 3O7OA 4XILA 2R061 4O9GA 3VZNA 3WG2A 2MEV2 4JC1A 1ZBE1 4HKLA 4NO4A 4W65A 4I01A 3AP6A 5FMOL 4FOYA 4AHZA 4WM8C 3DL3A 4BE3A 1IHMA 1S0IA 5EZWA 1QNYA 1QJU3 5FO8B 1MS4A 1J1TA 3IT8A 1EPWA 3CNAA 4H3WA 3KT4A 5C8CC 2WLQA 4BQ1A 4JGYB 3KSCA 4R9BA 1FXZA 3WX5A 4COWA 1YCIA 4XQWA 3USUA 1BQPA 4YGBA 1S0JA 1WMFA 2R16A 1IKQA 4DS0A 3VZMA 4C90A 3ZFFC 4AGGA 1AYN1 3MF9A 1VJ2A 1QXRA 4E4SA 3E6DA 5C8CB 3DN7A 2JG9C 1R1A2 2JEMA 1NXMA 5GJ6A 5I91A 3TB0A 3ZPYA 4XDQA 1JOJA 4ISRA 4B4QA 5ACA3 1H4HA 2DUOA 2X5IB 1S0FA 4S2GA 3D82A 1JTZX 1LCLA 4MV2A 3MIBA 4Q4V2 2P37A 2FZ1A 4ATFA 4BIOA 1PMIA 4UW6A 5BPXA 2Y38A 3B02A 4ZU5A 3RZZA 1X7NA 5KHHA 5JOXA 3KD4A 4JGZA 4Y22B 4TZDA 1AXZA 4K20A 4LE3A 3ZO0B 2ZZJA 3E5UA 4Y20A 1AXKA 3H3UA 4LUMA 2OPKA 4JRLA 2JD4A 2X5IC 1H2LA 5F6LB 4C1XA 3AYAA 2DUPA 3ILRA 1U5YA 4H55A 4GMP1 3FLPA 3VBSC 3GBGA 2ZAAA 4AI2A 2A5ZA 4ZU4A 1VBE2 4FPLA 1RVF1 1FOD1 3RWNA 2WSUA 3J8F2 4ZU7A 2NP0A 3NKTA 3FLRA 3OBTA 1A3KA 4M0NA 3RS6A 1QKQA 4RSUA 1DDLA 1NE4A 1SMVA 3WDWA 3VV1A 4Y26A 1PK6A 1SBEA 3VUOA 1V70A 3EO6A 5K0UB 1R1A3 2ZCWA 2QZ2A 2WNVB 4JGYC 1OSGA 4UW5A 1LECA 3M3EA 4DY3A 1YIFA 1ZREA 1H1AA 1H2NA 1GSLA 1WCKA 3ZX7A 2DVFA 4YVSB 4GQ7A 4RR3B 2D43A 3ZYJB 4EROA 5D1IA 1YFWA 2XWJB 2W0XA 2Q8OA 2Q1MA 2RE9A 1NA1B 4XF1A 4HVRA 1ZZBA 3K51A 1ZBE2 2GMMA 4IV3A 4MZUA 3GZUC 5BUVA 2XGXA 1GQGA 2XJVA 3EQEA 3ZDSA 2AYHA 1HKDA 4WM7C 4L11A 4RHV2 1ZBA2 4PIYA 1AR93 5J37A 1I6XA 5JAXA 4QQHA 5I0UA 4YM0A 2D40A 1RUC2 3WUCA 3PVNA 3MGUA 2XLFA 4KH9A 2LTNA 5FQ0B 4XMAA 1TNFA 4AGRA 1H1MA 1R093 2QQPA 5J7MA 1VB4A 2D7FA 3R05A 2A70A 1AR81 4CP0A 5DDJ3 4RQPB 4D7SA 3WP4A 2XJSA 3KCCA 4HKWA 1RUJ2 2QZ3A 2ZHLA 1H9PA 2XJQA 1HX6A 2V73A 5FOJB 1POV1 5I0RA 2EA7A 2OW4A 1EV12 3UKTA 2D3PA 2RM22 3VBHC 3WDXA 2ZACA 3GZTB 3J9SA 4IEVA 1VBC2 1VBA3 3GBWA 1RC6A 4GA9A 4IEXA 4KWJA 2ZHMA 3FHIB 1YI9A 1DQ4A 1LB2A 3RDIA 1UN1A 3FFQA 5T52A 4URTA 4AEJA 3HN1A 1ZM1A 4XYXA 5F5QA 1SBFA 4W6XA 2VUAA 3HMYA 3CO2A 4UW4A 3VBOA 3CLPA 2ET7A 1ND2B 2B45X 2WC2A 4M3CA 4WM7A 4OUMA 2WZPP 4GH4C 5CBLA 2OZ6A 4LBNA 3SH3A 1HQLA 2ZX1A 1PZ9A 2Q0AA 3QD6A 2BWAA 4P9LA 4CRQA 2XLGA 4FTEA 4WVMB 1PO22 2Z5WA 4YARA 3AX4A 3QH7A 4JAAA 5ACA2 1FPN3 3GF6A 1J59A 1DQ6A 1ZBA3 2YROA 4E4DX 3TAYA 2XB6C 4QHBA 2XVLA 3VBHA 2HWC1 4IV1A 4K40A 4Y1YA 4ISQA 3R4DB 3VL8A 1NLSA 3AMQA 1FPN1 2R49A 2EAAA 2B5HA 3ATGA 5GZFA 1B35A 4HZFA 2DUQA 2WS91 4Q0PA 1WGPA 1CJPA 3NAPC 1LGCA 5AVPA 4FPKA 2CTVA 4L99A 3E5XA 2I07B 3RI8A 1O4ZA 3A4UA 1OI6A 2PHDA 2UYAA 1NY71 3VKLA 1BVP1 4EWEA 3V0BA 3D4KA 3G7DA 1V00A 3JD71 4JGYA 2R0FA 4Y4YA 5LRSA 3OYWB 3USUB 1ULEA 4XTPA 5CFCA 2E53A 3FUOA 4KU7A 4XIKA 4AI0A 5JMCA 1I5ZA 2VNOA 5C8CA 2JX9A 1DHKB 1O3SA 5SV5A 1V9U1 4KWLA 1CAXA 1LEMA 2ILMA 2QUOA 4UBHA 1ZVFA 3AP4A 4AFCA 5JCTA 2P34A 4P14A 2G9FA 5JOZA 4MGIE 2DFBA 3ILFA 5C8WA 4XTMA 4LE4A 3AYEA 2PYTA 1IPJA 5CAZA 2YYOA 2YDEA 5HCBA 2DVBA 2H6CA 1GQHA 3WQ1A 3N36A 4JGZB 3DUIA 1AYM1 4Y22A 1DYPA 4GMP3 5CFDC 1C8NA 3IWZA 2CAUA 4Q0UA 5DZEA 1WW7A 4M3CE 4F83A 1FMD3 3IDEA 4M00A 1OLQA 2FBEA 1RUC3 1J1LA 1ZNPA 3VBUB 3KT1A 1O3RA 2EIGA 4OI0A 1RUNA 1EYBA 4DXZA 4LBJA 5GZEA 1JXNA 2VNGA 1UX6A 4OHVA 3O0WA 2G9GA 4RA0A 4EJRA 4XFIA 1G8WA 2DCTA 2VMGA 1B09A 4GALA 1LGBA 2XJTA 4K9SA 4EV0A 5BNNA 1DBNA 3NWKA 4Y5Z0 5KHGA 4QM8A 3WQ7A 3SMHA 2WNVA 1SEFA 2RM21 4EN8B 4MSVA 3JU9A 3BPZA 4HFSA 4Z82A 2G4IA 2JG8C 2ZGUA 3J8F1 1REFA 4YVSA 2RS12 3D8CA 4RR3A 4QPIC 4IV1C 2A3XA 4L97A 4P5HA 1GZCA 1W0OA 5E16A 4YW5A 3ZN4A 1AYN3 5J3UA 1DFQA 4Q4V1 1RHI2 3ZYPA 1KQRA 3RI9A 4YSFA 3FFZA 2GN3A 3FX3A 1XE7A 5BNQA 2YHJA 4QD2A 4A2UA 4IV3B 4AEKA 1OA2A 4JDNA 1X36A 3ZXFA 4AVSA 1QH6A 1TE1B 4FT8A 5KC6A 3FBYA 3VZOA 1COV1 4AVAA 1JH5A 4CEWA 4N9IA 3HR9A 1S0CA 4Q4W2 1DGLA 1AYN2 2HEYF 3JD72 2BWCA 5FO7B 1JBCA 4QM9A 4N7IA 3MI8A 3ELNA 4WM8A 1RUI1 2HWF1 3TNPB 3M3CA 3ZFEC 5J96B 1CPMA 4Z07A 1URXA 1VBE3 3U0ZA 5JLVA 5T5PA 3UL2A 2BNNA 2XL9A 2PQQA 3WT3A 2QDRA 4RHV1 4CTEA 1HXS1 2LUWA 4H7MA 1QOSA 2WA4A 3VZKA 1NQJA 4N7UA 2DTYA 1T6GC 3LB9A 2VPVA 5I93A 2WFF1 1UU5A 4AWDA 3MYXA 1MZ5A 1RUE3 2A75A 1LOGA 4QQ2A 4RGGA 3AMPA 2Q30A 3RYRA 2F6BA 3TN91 3D0SA 3MZHA 4CDUB 2E7AA 3NKGA 3WNXA 3FC0A 4K8FA 3NVCA 1D2QA 5CU1A 1RMU3 3VBOB 5L7OC 4L8QA 1AX1A 1GR3A 1HLCA 1VBE1 2H6BA 3TN93 1FAYA 1NLRA 4CEYC 1C4RA 2YC0A 4WM7B 2ZGLA 1ND3A 2PHFA 3FJSA 1UAIA 3PVOA 4Q4W3 1QHDA 1V6KA 4JTOA 5FPZA 4YM1A 1RUC1 3H3ZA 1QF3A 1FT9A 2UWAA 5T55A 1C8M2 3ZXLA 5LK7B 3I2DA 4B4RA 1VRH1 2CGPA 4Q4W1 4DOUA 4YG0A 2X29A 4BWOA 2XKPA 5B2GB 1S0BA 1DZQA 3FMGA 3VBHB 1BBT3 3LA3A 2AUYA 1MZ6A 1H8TA 2ZGOA 4RR3C 1MEC3 3M3IA 3RQ0A 5JPMB 2Y0IA 4LA2A 5J36A 4CP2A 1FV3A 3ZXJA 1Z78A 1XXNA 1B35B 4A7ZA 4YYOA 4L9BA 4CEWC 5FREA 4DINB 4XIOA 1G9BA 1RHI1 5DZGA 1W6NA 1JUHA 1MQTB 1RUG2 3KM5A 1WA4A 3V0BB 2VOKA 4E2GA 2BFUS 1REDA 1ONAA 3OYWA 1G9CA 1WBLA 1KD7A 5CFCB 1QJY3 3AKTA 4KG0A 3UKNA 1Z7S2 3VBRC 4AEDB 5JWPA 1VP6A 4Q4V3 2FQPA 2DYCA 2VULA 3WG3A 1SLAA 3ACLA 4IEPA 1RB8G 1NE6A 1FATA 4LHLA 5IK7A 4AI1A 1XRUA 2BUKA 1KFUL 4I3PA 4SLIA 1CAXB 4X8PA 2HKXA 5F6KA 3TBDA 3BODA 1UPIA 1PNFA 3WCSA 1OPMA 1ZZ7A 2ZMLA 4A3XA 2BNOA 1TME2 4R9DA 1PZ8A 1NCRC 4J1WA 4PIXA 2PHUA 1CAUA 1HV1A 1EY2A 3AKSA 4YW3A 1ZBE3 3ZYIB 4Q8KA 4KL1A 1LOFC 1ENRA 1RITA 1ULCA 1XNDA 3K48A 2GALA 2MHFA 2ZS6B 4AVCA 1C1LA 1AVBA 2RR12 2W08A 4J6GA 4S2HA 1BEV3 4BLJA 3VBSB 3VBUA 1AX2A 4S2DA 4RGAA 1J58A 3RMYA 3GYDA 4BYYA 1H1IA 2WT2A 4N43B 4MGZE 2HWD2 1AL23 1J3QA 3W9AA 4M0HA 2DCZA 3JB4C 4OVEA 3VHOA 5T5LA 4DMIA 1WW5A 3HAGA 1HQWA 5BNNB