3WX9A

Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
404
structure length
404
Chain Sequence
SMLGDVERFFSKKALEMRASEVRELLKLVETSDIISLAGGLPNPKTFPKEIIRDILVEIMEKYADKALQYGTTKGFTPLRETLMKWLGKRYGISQDNDIMITSGSQQALDLIGRVFLNPGDIVVVEAPTYLAALQAFNFYEPQYIQIPLDDEGMKVEILEEKLKELKSQGKKVKVVYTVPTFQNPAGVTMNEDRRKYLLELASEYDFIVVEDDPYGELRYSGNPEKKIKALDNEGRVIYLGTFSKILAPGFRIGWMVGDPGIIRKMEIAKQSTDLCTNVFGQVVAWRYVDGGYLEKHIPEIRKFYKPRRDAMLEALEEFMPEGVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKGVAYVPGEAFYAHRDVKNTMRLNFTYVDEDKIMEGIKRLAETIKEELKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Pyrococcus horikoshii kynurenine aminotransferase in complex with PMP, GLA, 4AD, 2OG, GLU and KYA
rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Transferase
molecule keywords Putative uncharacterized protein PH0207
total genus 148
structure length 404
sequence length 404
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3wx9A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3wx9A01
4BQ0A 3HQTA 2W7MA 2AY1A 1IJIA 1AY8A 3FZ7A 4OCAA 4XJLA 4N0WA 2BIAA 4A0FA 1C0NA 1G7XA 2BYJA 2OQXA 3F0HA 4F5HA 2VMQA 3A8UX 3GWPA 3CQ6A 1DJEA 3JW9A 2VI9A 2DKBA 4FFCA 4QGRA 4ZSWA 4ADDA 1RVUA 2VYCA 2D64A 3OP7A 2FM1A 2YKUA 4JEZA 2ZY4A 3QM2A 3VOMA 7AATA 2JJGA 2YCNA 4JF0A 1O62A 1T3IA 3VK4A 1MDZA 4RLGA 3HL2A 5G2PA 4OBVA 1GEXA 2V0YA 2EPJA 2Z9WA 3KGXA 4XK1A 2X5FA 1WYUB 2W7EA 1UU2A 2WK7A 1AMRA 3E2ZB 4PFFA 3RCHA 4ZDOA 3E77A 4B98A 4CVQA 4TV7A 4ZAHA 3FQ7A 1ASNA 3BWNC 1VP4A 4UHOA 4CXQA 3BC8A 4A6RA 4AZKA 3ZZKA 1I41A 2EH6A 3QGUA 2O0RA 4F5IA 2CJDA 3MEBA 4A00A 3RBFA 4ITXA 4JE5A 5M4BA 2AY6A 2QB2A 1KKPA 1LC8A 4DBCA 4LW4A 2VMPA 1V72A 1D7RA 2GMSA 1O4SA 2VMYA 1TOEA 4IXZA 4ADBA 1ELQA 2HUIA 3DXWA 2FNUA 1ASMA 4A0HA 3ZRQA 4P3MA 3FSLA 1IBJA 1AICA 1BJNA 1YJSA 3I16A 1ECXA 4GE7A 2PB0A 3L8AA 2JISA 4AH3A 1J04A 5EUNA 2EZ1A 4MQQA 4W1VA 4ZWMA 3WCOA 1ASGA 4ZDLA 2W8VA 2FNIA 1AJSA 1H1CA 2Z67A 1IAXA 1BS0A 2VMRA 1TOGA 1YIZA 3COGA 2NMPA 3PD6B 4JEVA 4WYAA 2AY5A 1WYTB 2GSAA 1FG3A 1W23A 2O7CA 4WP0A 5EUEA 1LC7A 3AATA 3GSBA 3KGWA 1JS3A 2ORDA 1RV4A 1EJIA 2W8JA 4WD2A 3ELEA 3A9XA 5DB5A 3B46A 4AOAA 2C0RA 4WB0A 5FT4A 4RJYA 1ASEA 3ZZJA 2EGYA 3AEPA 1CJ0A 1CQ7A 2X5DA 3EI5A 3EI7A 1MLZA 4EB7A 1AKAA 4M2KA 2X8UA 1AMSA 3B1EA 3AV7A 1G7WA 1AHFA 1M7YA 3FQ8A 4WLHA 3ZRRA 4Q6RA 2CH2A 4I8AA 4WLJA 1E5FA 3PDXA 3UAKA 1DFOA 2W7DA 2GB3A 1SPAA 4GDYA 4K2MA 4UHMA 3MAFA 1AX4A 5G2QA 3UWCA 1BW0A 4R8DA 3MC6A 2JG2A 4ISYA 1G4XA 3GR9A 5LHAA 3KKIA 1PMMA 2AY4A 1J32A 2XH1A 4LW2A 2CB1A 1X0MA 3MADA 1ARIA 3WKSA 2QLRA 1CL2A 1EG5A 2W8UA 4RKCA 4AO4A 2WKAA 3EI8A 1QZ9A 3BCXA 1AHYA 3NUIA 9AATA 1C7GA 4A6TA 2G6WA 5EFSA 3WZFA 3EI6A 4WYCA 1CZEA 2VGUA 3CBFA 3II0A 4W8IA 3BCBA 1VJOA 1KMKA 2GMUA 1VEFA 5HDMA 5BJ3A 4F5KA 1ASBA 1GEWA 2YCPA 1KKJA 2DGLA 3VK2A 3NRAA 2R5CB 3W1HA 3P1TA 5HXXA 5G4JA 1M0OA 3TATA 4A0GA 1S08A 3FRKA 5BJ4A 1QITA 2F8JA 3JZLA 2W7LA 5DJ9A 3ELPA 4TN4A 1W3UA 2DR1A 2QMAA 2HP2A 3DYDA 4KXKA 4EMYA 1V2EA 3DR7A 2BI9A 4O6ZA 3B1DA 3FD0A 1AMAA 2HORA 3NTJA 5FT6A 2W7JA 2VMWA 1H0CA 4W5KA 3BV0A 2AY2A 4WYDA 3Q8NA 3QBOA 4IY7A 3EI9A 2CY8A 1QGNA 1TOJA 2CH1A 5G4IA 2JJFA 1UU0A 1N2TA 4WXFA 3LVLB 3EZSA 3N0LA 1B8GA 3HDOA 1YNUA 1Y4IA 1ARTA 2VGWA 1OHWA 1M0PA 4E3QA 4RKDA 5D95A 4Q76A 3TCMA 2AY8A 1LW5A 4GE4A 4AO9A 2VMNA 2QA3A 3BWNA 3AOWA 3EIAA 2ZSMA 1B5OA 3MAUA 1ORDA 3IHJA 3ECDA 4EFFA 1BJOA 1QISA 2HOZA 4AZJA 3BN1A 3OKSA 4CXRA 3JU7A 4JEYA 3PA9A 4WXGA 1OHVA 1WYVB 4XEWA 1CS1A 2JGTA 5K8BA 2CJHA 3H14A 3H7FA 1X28A 4NOGA 1DKAA 2ZP7A 3B8XA 3TFUA 4UOYA 5EUDA 2WK9A 2Z9UA 2AY9A 1DJUA 3FCRA 4PIWA 1TASA 4RJ0A 3FFRA 4Q75A 1B5PA 1SZSA 2HZPA 2VGSA 4JEXA 2DOUA 2BIEA 3E2YA 1AKBA 2HUUA 3NYUA 2CSTA 3A9ZA 1SZKA 5F8VA 4GEBA 4LNJA 2ZY3A 3EIBA 1S0AA 2W7KA 3JTXA 2E54A 2E7IA 1CZCA 2FQ6A 4R5FA 1ASFA 5DX5A 1TPLA 2AATA 3AENB 2XBNA 3ASAA 3KE3A 3N5MA 2AEVA 3HMUA 3PIUA 3A9YA 2RFVA 2YOBA 4Y0HA 2VMXA 2VMVA 4WYFA 5G09A 3LVJA 5EIGB 3NU8A 1DGEA 4GRXA 1WYUA 3FTBA 3E2ZA 5C6UA 1PFFA 4FL0A 4WYGA 3ASBA 3TFTA 1V2FA 5IWQA 3FDBA 1JG8A 4PFNA 2D66A 3ACZA 3AOVA 3D6KA 3BS8A 4OC9A 3PAAA 1M32A 3LY1A 4R5ZA 1CQ8A 3DRDA 1WKGA 1SZUA 4XJPA 2ZC0A 1ARHA 1PMOA 2DGKA 3QHXA 4XJMA 2HP1A 1MAQA 2VIBA 2VI8A 4IYOB 4ZASA 3HBXA 5M4DA 5E5IA 3DODA 1IUGA 4JEWA 3FVXA 3P6KA 2PO3A 2BI1A 5JAYA 1BKGA 1SVVA 3UE8A 2EO5A 2Z20A 1O61A 8AATA 1YOOA 5J8QA 3GBXA 4HVKA 3PDBA 2BKWA 1X29A 2CTZA 1AAMA 4IW7A 1AMQA 4IXSA 2YHKA 4J8LA 1WKHA 4MQRA 1CL1A 4BHDA 2AY7A 4LNMA 1AJSB 4M2MA 4F5LA 1QJ3A 3FDDA 4ADEA 4BA5A 3LVMA 3PPLA 1AHEA 1WYTA 3G0TA 1GD9A 3F6TA 3G7QA 1AIBA 1DJ9A 2D5YA 1AKCA 2BI2A 1EQBA 2AY3A 3TQXA 2W7IA 2YRIA 1I43A 1C7NA 4OTLA 4F5FA 4F5GA 2BWNA 1BJ4A 1GDEA 3ATHA 4PVFA 1GC4A 4WB0B 1OXOA 3JWBA 2BWPA 2AEUA 1GC2A 4Y0DA 5D5SA 3AEMA 4MQPA 1MGVA 1GEYA 3RBLA 1RVYA 1P3WA 4R2NA 2X3LA 3DXVA 3DR4A 4E1OA 1XI9A 3F9TA 1AHXA 1GBNA 1TATA 4RITA 3NU7A 3PJ0A 1LKCA 4M2JA 2W7FA 4XQ2A 3VK3A 3CQ4A 4F5MA 2YKVA 1JF9A 5G0AA 2BWOA 1B4XA 3HT4A 1UU1A 1PG8A 4IXOA 3QPGA 4P7YA 4U1TA 5HHYA 4CBSA 3M5UA 1WSTA 2ZY5A 5M49A 4ZLVA 1BJWA 4GE9A 3W1IA 2C7TA 4OYTA 4EB5A 4E3RA 1BQAA 2V1PA 2C81A 1OXPA 1IX8A 2WK8A 3I4JA 2ZSLA 1YJYA 1E5EA 4E77A 4MSOA 1G4VA 4EU1A 1S09A 1D7VA 3EUCA 1YIYA 1ASCA 1ARGA 1C7OA 1LW4A 1M0NA 2CJGA 3E6GA 3NYTA 2YCTA 1GC0A 3HVYA 3PGYA 3LG0A 2W8WA 1TARA 3LV2A 2Z1ZA 2Q7WA 5FT5A 4L0OA 2ZYJA 3BWOA 3T32A 5AX8A 2HUFA 3NYSA 4RIZA 4HF8A 3JWAA 3GZDA 5F9SA 1W7LA 1ARSA 2CANA 2VIAA 4WBTA 1Z7DA 3A2BA 2JJHA 3B1CA 3FVSA 3WKRA 1MDXA 3RQ1A 3RCHB 5DJ1A 4BMKA 1DGDA 3E2FA 1ASDA 1KL2A 2E7UA 4Q31A 3GETA 2W7GA 4DQ6A 3FFHA 2VMSA 1MLYA 1MDOA 1ZODA 3G8MA 1MAPA 3I5TA 2OKKA 1I48A 3EZ1A 4OMAA 1BJOB 2D63A 5EQCA 3WCNA 3R4TA 1D7SA 4WYEA 1LS3A 1N31A 2Z9VA 3AEJC 5LH9A 4IX8A 4XJOA 2HOXA 4TMRA 1LK9A 4W1WA 2R5EA 3GZCA 1FC4A 2ZUKA 3QN6A 3RUYA 1IX7A 2BYLA 1IX6A 3LVKA 4KAMA 4ZM3A 2YRRA 2BIGA 2D7YA 5FT8A 1W7MA 3PD6A 2DGMA 4ATPA 2YKXA 2EZ2A 4A72A 4UQVA 1GCKA 3IF2A 3USFA 1ASLA 1O69A 1S07A 4GSAA 1TOKA 3FVUA 4CBRA 2VMTA 2ZJGA 1KMJA 4MY5A 2HOYA 1S06A 1OHYA 3GZDC 2QB3A 1AY4A 3AENA 4XAUA 2CFBA 4U2HA 3AELA 4H51A 1B9HA 2YKYA 4MGRA 3LWSA 4W91A 2VGZA 2E7JA 1DTYA 5TF5A 4N0BA 1C4KA 5EIGA 1U08A 4ZM4A 2OGEA 4A6UA 4LC3A 1M6SA 4ZSYA 1D2FA 4F4EA 3CAIA 5I92A 2D65A 3ZRPA 4ADCA 2VMUA 1AHGA 3NDNA 3R9AA 3FZ6A 1B9IA 1AAWA 5EAVA 3AEMC 2BI5A 3FZ8A 1JS6A 2CINA 3MAFB 4ZDPA 3WLXA 2QBTA 4WXBA 4ATQA 1AJRA 2PB2A 2Z61A 2DKJA 3AEJA 3FQAA 3QI6A 4IYOA 4W1XA 1ZOBA 3NNKA 5M46A 4DGTA 1RV3A 2VMZA 3ISLA 3GJUA 1X2AA 1I29A 3DC1A 3WGCA 1BQDA 4K2IA 1YAAA 1KL1A 3CQ5A 4KYOA 3PDBB 2VMOA 2D61A 3VAXA 4MKKA 3NX3A 3FKDA 2W8TA 2ZY2A 1CQ6A 3RI6A 4UHNA 2C44A 2JJEA 2R5CA 4JE5D 4JF1A 1YJZA 1IAYA 1XEYA 1TOIA 1ASAA 1M0QA 3K28A 3DZZA 4MKJA 1W7NA 4OBUA 4ZWVA 3NUBA 1QIRA 2Z9XA 3L44A 3VP6A 2VGTA 3BCAA 4Y0IA 2BHXA 4F5JA 2O1BA 1OATA 2VLHA 3MBBA 2TPLA 4RAEA 4ITGA 1FG7A 5E3KA 2OATA 1ELUA 3K7YA 5E4ZA 1C9CA 1BT4A 1GC3A 3BB8A 3W1JA 3WY7A 1SFFA 2VLFA 1IVRA 3K40A 4LNLA 2OKJA 4B9BA 4BA4A 1SF2A 2D7ZA 5EAAA 1QJ5A 4A0RA 4RM1A 2W7HA 2GQNA 3MC6C 1D7UA 4OT8A 3WGBA 2R2NA 3HLMA 4K2BA 3DU4A 1Z3ZA 2FN6A 2Z1YA 3WX9A 2FYFA 2BI3A 3AEOA 3N75A 1M4NA 1V2DA 1AIAA 1LC5A 1ZC9A 3E9KA 3MKJA 1N8PA 1UKJA 1WYVA 2OGAA 4J5UA 1AY5A 2R0TA 2VGVA
chains in the Genus database with same CATH superfamily
4BQ0A 3HQTA 2W7MA 2AY1A 1IJIA 1AY8A 3FZ7A 4OCAA 4XJLA 4N0WA 2BIAA 4A0FA 1C0NA 1G7XA 2BYJA 2OQXA 3F0HA 4F5HA 2VMQA 3A8UX 3GWPA 3CQ6A 1DJEA 3JW9A 2VI9A 2DKBA 4FFCA 4QGRA 4ZSWA 4ADDA 1RVUA 2VYCA 2D64A 3OP7A 2FM1A 2YKUA 4JEZA 2ZY4A 3QM2A 3VOMA 7AATA 2JJGA 2YCNA 4JF0A 1O62A 1T3IA 3VK4A 1MDZA 4RLGA 3HL2A 5G2PA 4OBVA 1GEXA 2V0YA 2EPJA 2Z9WA 3KGXA 4XK1A 2X5FA 1WYUB 2W7EA 1UU2A 2WK7A 1AMRA 3E2ZB 3N4SA 4PFFA 3RCHA 4ZDOA 3E77A 4B98A 4CVQA 4TV7A 4ZAHA 3FQ7A 1ASNA 3BWNC 1VP4A 4UHOA 4CXQA 3BC8A 4A6RA 4AZKA 3ZZKA 1I41A 2EH6A 3QGUA 2O0RA 4F5IA 2CJDA 3MEBA 4A00A 3RBFA 4ITXA 4JE5A 5M4BA 2AY6A 2QB2A 1KKPA 1LC8A 4DBCA 4LW4A 2VMPA 1V72A 1D7RA 2GMSA 1O4SA 2VMYA 1TOEA 4IXZA 4ADBA 1ELQA 2HUIA 3DXWA 2FNUA 1ASMA 4A0HA 3ZRQA 4P3MA 3FSLA 1IBJA 1AICA 1BJNA 1YJSA 3I16A 1ECXA 4GE7A 2PB0A 3L8AA 2JISA 4AH3A 1J04A 5EUNA 2EZ1A 4MQQA 4W1VA 4ZWMA 3WCOA 1ASGA 4ZDLA 2W8VA 2FNIA 1AJSA 1H1CA 2Z67A 1IAXA 1BS0A 2VMRA 1TOGA 1YIZA 3COGA 2NMPA 3PD6B 4JEVA 4WYAA 2AY5A 1WYTB 2GSAA 1FG3A 1W23A 2O7CA 4WP0A 5EUEA 1LC7A 3AATA 3GSBA 3KGWA 1JS3A 2ORDA 1RV4A 1EJIA 2W8JA 4WD2A 3ELEA 3A9XA 5DB5A 3B46A 4AOAA 2C0RA 4WB0A 5FT4A 4RJYA 1ASEA 3ZZJA 2EGYA 3AEPA 1CJ0A 1CQ7A 2X5DA 3EI5A 3EI7A 1MLZA 4EB7A 1AKAA 4M2KA 2X8UA 1AMSA 3B1EA 3AV7A 1G7WA 1AHFA 1M7YA 3FQ8A 4WLHA 3ZRRA 4Q6RA 2CH2A 4I8AA 4WLJA 1E5FA 3PDXA 3UAKA 1DFOA 2W7DA 2GB3A 1SPAA 4GDYA 4K2MA 4UHMA 3MAFA 1AX4A 5G2QA 3UWCA 1BW0A 4R8DA 3MC6A 2JG2A 4ISYA 1G4XA 3GR9A 5LHAA 3KKIA 1PMMA 2AY4A 1J32A 2XH1A 4LW2A 2CB1A 1X0MA 3MADA 1ARIA 3WKSA 2QLRA 1CL2A 1EG5A 2W8UA 4RKCA 4AO4A 2WKAA 3EI8A 1QZ9A 3BCXA 1AHYA 3NUIA 9AATA 1C7GA 4A6TA 2G6WA 5EFSA 3WZFA 3EI6A 4WYCA 1CZEA 2VGUA 3CBFA 3II0A 4W8IA 3BCBA 1VJOA 1KMKA 2GMUA 1VEFA 5HDMA 5BJ3A 4F5KA 1ASBA 1GEWA 2YCPA 1KKJA 2DGLA 3VK2A 3NRAA 2R5CB 3W1HA 3P1TA 5HXXA 5G4JA 1M0OA 3TATA 4A0GA 1S08A 3FRKA 5BJ4A 1QITA 2F8JA 3JZLA 2W7LA 5DJ9A 3ELPA 4TN4A 1W3UA 2DR1A 2QMAA 2HP2A 3DYDA 4KXKA 4EMYA 1V2EA 3DR7A 2BI9A 4O6ZA 3B1DA 3FD0A 1AMAA 2HORA 3NTJA 5FT6A 2W7JA 2VMWA 1H0CA 4W5KA 3BV0A 2AY2A 4WYDA 3Q8NA 3QBOA 4IY7A 3EI9A 2CY8A 1QGNA 1TOJA 2CH1A 5G4IA 2JJFA 1UU0A 1N2TA 4WXFA 3LVLB 3EZSA 3N0LA 1B8GA 3HDOA 1YNUA 1Y4IA 1ARTA 2VGWA 1OHWA 1M0PA 4E3QA 4RKDA 5D95A 4Q76A 3TCMA 2AY8A 1LW5A 4GE4A 4AO9A 2VMNA 2QA3A 3BWNA 3AOWA 3EIAA 2ZSMA 1B5OA 3MAUA 1ORDA 3IHJA 3ECDA 4EFFA 1BJOA 1QISA 2HOZA 4AZJA 3BN1A 3OKSA 4CXRA 3JU7A 4JEYA 3PA9A 4WXGA 1OHVA 1WYVB 4XEWA 1CS1A 2JGTA 5K8BA 2CJHA 3H14A 3H7FA 1X28A 4NOGA 1DKAA 2ZP7A 3B8XA 3TFUA 4UOYA 5EUDA 2WK9A 2Z9UA 2AY9A 1DJUA 3FCRA 4PIWA 1TASA 4RJ0A 3FFRA 4Q75A 1B5PA 1SZSA 2HZPA 2VGSA 4JEXA 2DOUA 2BIEA 3E2YA 1AKBA 2HUUA 3NYUA 2CSTA 3A9ZA 1SZKA 5F8VA 4GEBA 4LNJA 2ZY3A 3EIBA 1S0AA 2W7KA 3JTXA 2E54A 2E7IA 1CZCA 2FQ6A 4R5FA 1ASFA 5DX5A 1TPLA 2AATA 3AENB 2XBNA 3ASAA 3KE3A 3N5MA 2AEVA 3HMUA 3PIUA 3A9YA 2RFVA 2YOBA 4Y0HA 2VMXA 2VMVA 4WYFA 5G09A 3LVJA 5EIGB 3NU8A 1DGEA 4GRXA 1WYUA 3FTBA 3E2ZA 5C6UA 1PFFA 4FL0A 3H9XA 4WYGA 3ASBA 3TFTA 2EYQA 1V2FA 5IWQA 3FDBA 1JG8A 4PFNA 2D66A 3ACZA 3AOVA 3D6KA 3BS8A 4OC9A 3PAAA 1M32A 3LY1A 4R5ZA 1CQ8A 3DRDA 1WKGA 1SZUA 4XJPA 2ZC0A 1ARHA 1PMOA 2DGKA 3QHXA 4XJMA 2WB6A 2HP1A 1MAQA 2VIBA 2VI8A 4IYOB 4ZASA 3HBXA 5M4DA 5KTBA 5E5IA 3DODA 1IUGA 4JEWA 3FVXA 3P6KA 2PO3A 2BI1A 5JAYA 1BKGA 1SVVA 3UE8A 2EO5A 2Z20A 1O61A 8AATA 1YOOA 5J8QA 3GBXA 4HVKA 3PDBA 2BKWA 1X29A 2CTZA 1AAMA 4IW7A 1AMQA 4IXSA 2YHKA 4J8LA 1WKHA 4MQRA 1CL1A 4BHDA 2AY7A 4LNMA 1AJSB 4M2MA 4F5LA 1QJ3A 3FDDA 4ADEA 4BA5A 3LVMA 3PPLA 1AHEA 1WYTA 3G0TA 1GD9A 4K05A 3F6TA 3G7QA 1AIBA 1DJ9A 2D5YA 1AKCA 2BI2A 1EQBA 2AY3A 3TQXA 2W7IA 2YRIA 1I43A 1C7NA 4OTLA 4F5FA 4F5GA 2BWNA 1BJ4A 1GDEA 3ATHA 4PVFA 1GC4A 4WB0B 1OXOA 3JWBA 2BWPA 2AEUA 1GC2A 4Y0DA 5D5SA 3AEMA 4MQPA 1MGVA 1GEYA 3RBLA 1RVYA 1P3WA 4R2NA 2X3LA 3DXVA 3DR4A 4E1OA 1XI9A 3F9TA 1AHXA 1GBNA 1TATA 4RITA 3NU7A 3PJ0A 1LKCA 4M2JA 2W7FA 4XQ2A 3VK3A 3CQ4A 2KFPA 4F5MA 2YKVA 1JF9A 5G0AA 2BWOA 1B4XA 3HT4A 1UU1A 1PG8A 4IXOA 3QPGA 4P7YA 4U1TA 5HHYA 4CBSA 3M5UA 1WSTA 2ZY5A 5M49A 4ZLVA 3N4XA 1BJWA 4GE9A 3W1IA 2C7TA 4OYTA 4EB5A 4E3RA 1BQAA 2V1PA 2C81A 1OXPA 1IX8A 2WK8A 3I4JA 2ZSLA 1YJYA 1E5EA 4E77A 4MSOA 1G4VA 4EU1A 1S09A 1D7VA 3EUCA 1YIYA 1ASCA 1ARGA 1C7OA 1LW4A 1M0NA 2CJGA 3E6GA 3NYTA 2YCTA 1GC0A 3HVYA 3PGYA 3LG0A 2W8WA 1TARA 3LV2A 2G7JA 2Z1ZA 2Q7WA 5FT5A 4L0OA 2ZYJA 3BWOA 3T32A 5AX8A 2HUFA 3NYSA 4RIZA 4HF8A 3JWAA 3GZDA 5F9SA 1W7LA 1ARSA 2QSRA 2CANA 2VIAA 4WBTA 1Z7DA 3A2BA 2JJHA 3B1CA 3FVSA 3WKRA 1MDXA 3RQ1A 3RCHB 5DJ1A 4BMKA 1DGDA 3E2FA 1ASDA 1KL2A 2E7UA 4Q31A 3GETA 2W7GA 4DQ6A 3FFHA 2VMSA 1MLYA 1MDOA 1ZODA 3G8MA 1MAPA 3I5TA 2OKKA 1I48A 3EZ1A 4OMAA 1BJOB 2D63A 5EQCA 3WCNA 3R4TA 1D7SA 4WYEA 1LS3A 1N31A 3N7NA 2Z9VA 3AEJC 5LH9A 4IX8A 4XJOA 2HOXA 4TMRA 1LK9A 4W1WA 2R5EA 3GZCA 1FC4A 2ZUKA 3QN6A 3RUYA 1IX7A 2BYLA 1IX6A 3LVKA 4KAMA 3N4RA 4ZM3A 2YRRA 2BIGA 2D7YA 5FT8A 1W7MA 3PD6A 2DGMA 4ATPA 2YKXA 2EZ2A 4A72A 4UQVA 1GCKA 3IF2A 3USFA 1ASLA 1O69A 1S07A 4GSAA 1TOKA 3FVUA 4CBRA 2VMTA 2ZJGA 1KMJA 4MY5A 2HOYA 1S06A 1OHYA 3GZDC 2QB3A 1AY4A 3AENA 4XAUA 2CFBA 4U2HA 3AELA 4H51A 1B9HA 2YKYA 4MGRA 3LWSA 4W91A 2VGZA 2E7JA 1DTYA 5TF5A 1KAFA 4N0BA 1C4KA 5EIGA 1U08A 4ZM4A 2OGEA 4A6UA 4LC3A 1M6SA 4ZSYA 1D2FA 4F4EA 3CAIA 5I92A 2D65A 3ZRPA 4ADCA 2VMUA 1AHGA 3NDNA 3R9AA 3FZ6A 1B9IA 1AAWA 5EAVA 3AEMC 2BI5A 3FZ8A 1JS6A 2CINA 3MAFB 4ZDPA 3WLXA 2QBTA 4WXBA 4ATQA 1AJRA 2PB2A 2Z61A 2DKJA 3AEJA 3FQAA 3QI6A 4IYOA 4W1XA 1ZOBA 3NNKA 5M46A 4DGTA 1RV3A 2VMZA 3ISLA 3GJUA 1X2AA 1I29A 3DC1A 3WGCA 1BQDA 4K2IA 1YAAA 1KL1A 3CQ5A 4KYOA 3PDBB 2VMOA 2D61A 3VAXA 4MKKA 3NX3A 3FKDA 2W8TA 2ZY2A 1CQ6A 3RI6A 4UHNA 2C44A 2JJEA 2R5CA 4JE5D 4JF1A 1YJZA 1IAYA 1XEYA 1TOIA 1ASAA 1M0QA 3K28A 3DZZA 4MKJA 1W7NA 4OBUA 4ZWVA 3NUBA 1QIRA 2Z9XA 3L44A 3VP6A 2A1VA 2VGTA 4H63Q 3BCAA 4Y0IA 2BHXA 4F5JA 2O1BA 1OATA 2VLHA 3MBBA 2TPLA 4RAEA 4ITGA 1FG7A 5E3KA 2OATA 1ELUA 3K7YA 5E4ZA 1C9CA 1BT4A 1GC3A 3BB8A 3W1JA 3WY7A 1SFFA 2VLFA 1IVRA 3K40A 4LNLA 2OKJA 4B9BA 4BA4A 1SF2A 2D7ZA 5EAAA 1QJ5A 4A0RA 4RM1A 2W7HA 2GQNA 3MC6C 1D7UA 4OT8A 3WGBA 2R2NA 3HLMA 4K2BA 3DU4A 2FKIA 1Z3ZA 2FN6A 2Z1YA 3WX9A 2FYFA 2BI3A 3AEOA 3N75A 1M4NA 1V2DA 1AIAA 1LC5A 1ZC9A 3E9KA 3MKJA 1N8PA 1UKJA 1WYVA 2OGAA 4J5UA 1AY5A 2R0TA 2VGVA
chains in the Genus database with same CATH topology
4BQ0A 3HQTA 2W7MA 2AY1A 1IJIA 1AY8A 3FZ7A 4OCAA 4XJLA 4N0WA 2BIAA 4A0FA 1C0NA 1G7XA 2BYJA 2OQXA 3F0HA 4F5HA 2VMQA 3A8UX 3GWPA 3CQ6A 1DJEA 3JW9A 2VI9A 2DKBA 4FFCA 4QGRA 4ZSWA 4ADDA 1RVUA 2VYCA 2D64A 3OP7A 2FM1A 2YKUA 4JEZA 2ZY4A 3QM2A 3VOMA 7AATA 2JJGA 2YCNA 4JF0A 1O62A 1T3IA 3VK4A 1MDZA 4RLGA 3HL2A 5G2PA 4OBVA 1GEXA 2V0YA 2EPJA 2Z9WA 3KGXA 4XK1A 2X5FA 1WYUB 2W7EA 1UU2A 2WK7A 1AMRA 3E2ZB 3N4SA 4PFFA 3RCHA 4ZDOA 3E77A 4B98A 4CVQA 4TV7A 4ZAHA 3FQ7A 1ASNA 3BWNC 1VP4A 4UHOA 4CXQA 3BC8A 4A6RA 4AZKA 3ZZKA 1I41A 2EH6A 3QGUA 2O0RA 4F5IA 2CJDA 3MEBA 4A00A 3RBFA 4ITXA 4JE5A 5M4BA 2AY6A 2QB2A 1KKPA 1LC8A 4DBCA 4LW4A 2VMPA 1V72A 1D7RA 2GMSA 1O4SA 2VMYA 1TOEA 4IXZA 4ADBA 1ELQA 2HUIA 3DXWA 2FNUA 1ASMA 4A0HA 3ZRQA 4P3MA 3FSLA 1IBJA 1AICA 1BJNA 1YJSA 3I16A 1ECXA 4GE7A 2PB0A 3L8AA 2JISA 4AH3A 1J04A 5EUNA 2EZ1A 4MQQA 4W1VA 4ZWMA 3WCOA 1ASGA 4ZDLA 2W8VA 2FNIA 1AJSA 1H1CA 2Z67A 1IAXA 1BS0A 2VMRA 1TOGA 1YIZA 3COGA 2NMPA 3PD6B 4JEVA 4WYAA 2AY5A 1WYTB 2GSAA 1FG3A 1W23A 2O7CA 4WP0A 5EUEA 1LC7A 3AATA 3GSBA 3KGWA 1JS3A 2ORDA 1RV4A 1EJIA 2W8JA 4WD2A 3ELEA 3A9XA 5DB5A 3B46A 4AOAA 2C0RA 4WB0A 5FT4A 4RJYA 1ASEA 3ZZJA 2EGYA 3AEPA 1CJ0A 1CQ7A 2X5DA 3EI5A 3EI7A 1MLZA 4EB7A 1AKAA 4M2KA 2X8UA 1AMSA 3B1EA 3AV7A 1G7WA 1AHFA 1M7YA 3FQ8A 4WLHA 3ZRRA 4Q6RA 2CH2A 4I8AA 4WLJA 1E5FA 3PDXA 3UAKA 1DFOA 2W7DA 2GB3A 1SPAA 4GDYA 4K2MA 4UHMA 3MAFA 1AX4A 5G2QA 3UWCA 1BW0A 4R8DA 3MC6A 2JG2A 4ISYA 1G4XA 3GR9A 5LHAA 3KKIA 1PMMA 2AY4A 1J32A 2XH1A 4LW2A 2CB1A 1X0MA 3MADA 1ARIA 3WKSA 2QLRA 1CL2A 1EG5A 2W8UA 4RKCA 4AO4A 2WKAA 3EI8A 1QZ9A 3BCXA 1AHYA 3NUIA 9AATA 1C7GA 4A6TA 2G6WA 5EFSA 3WZFA 3EI6A 4WYCA 1CZEA 2VGUA 3CBFA 3II0A 4W8IA 3BCBA 1VJOA 1KMKA 2GMUA 1VEFA 5HDMA 5BJ3A 4F5KA 1ASBA 1GEWA 2YCPA 1KKJA 2DGLA 3VK2A 3NRAA 2R5CB 3W1HA 3P1TA 5HXXA 5G4JA 1M0OA 3TATA 4A0GA 1S08A 3FRKA 5BJ4A 1QITA 2F8JA 3JZLA 2W7LA 5DJ9A 3ELPA 4TN4A 1W3UA 2DR1A 2QMAA 2HP2A 3DYDA 4KXKA 4EMYA 1V2EA 3DR7A 2BI9A 4O6ZA 3B1DA 3FD0A 1AMAA 2HORA 3NTJA 5FT6A 2W7JA 2VMWA 1H0CA 4W5KA 3BV0A 2AY2A 4WYDA 3Q8NA 3QBOA 4IY7A 3EI9A 2CY8A 1QGNA 1TOJA 2CH1A 5G4IA 2JJFA 1UU0A 1N2TA 4WXFA 3LVLB 3EZSA 3N0LA 1B8GA 3HDOA 1YNUA 1Y4IA 1ARTA 2VGWA 1OHWA 1M0PA 4E3QA 4RKDA 5D95A 4Q76A 3TCMA 2AY8A 1LW5A 4GE4A 4AO9A 2VMNA 2QA3A 3BWNA 3AOWA 3EIAA 2ZSMA 1B5OA 3MAUA 1ORDA 3IHJA 3ECDA 4EFFA 1BJOA 1QISA 2HOZA 4AZJA 3BN1A 3OKSA 4CXRA 3JU7A 4JEYA 3PA9A 4WXGA 1OHVA 1WYVB 4XEWA 1CS1A 2JGTA 5K8BA 2CJHA 3H14A 3H7FA 1X28A 4NOGA 1DKAA 2ZP7A 3B8XA 3TFUA 4UOYA 5EUDA 2WK9A 2Z9UA 2AY9A 1DJUA 3FCRA 4PIWA 1TASA 4RJ0A 3FFRA 4Q75A 1B5PA 1SZSA 2HZPA 2VGSA 4JEXA 2DOUA 2BIEA 3E2YA 1AKBA 2HUUA 3NYUA 2CSTA 3A9ZA 1SZKA 5F8VA 4GEBA 4LNJA 2ZY3A 3EIBA 1S0AA 2W7KA 3JTXA 2E54A 2E7IA 1CZCA 2FQ6A 4R5FA 1ASFA 5DX5A 1TPLA 2AATA 3AENB 2XBNA 3ASAA 3KE3A 3N5MA 2AEVA 3HMUA 3PIUA 3A9YA 2RFVA 2YOBA 4Y0HA 2VMXA 2VMVA 4WYFA 5G09A 3LVJA 5EIGB 3NU8A 1DGEA 4GRXA 1WYUA 3FTBA 3E2ZA 5C6UA 1PFFA 4FL0A 3H9XA 4WYGA 3ASBA 3TFTA 2EYQA 1V2FA 5IWQA 3FDBA 1JG8A 4PFNA 2D66A 3ACZA 3AOVA 3D6KA 3BS8A 4OC9A 3PAAA 1M32A 3LY1A 4R5ZA 1CQ8A 3DRDA 1WKGA 1SZUA 4XJPA 2ZC0A 1ARHA 1PMOA 2DGKA 3QHXA 4XJMA 2WB6A 2HP1A 1MAQA 2VIBA 2VI8A 4IYOB 4ZASA 3HBXA 5M4DA 5KTBA 5E5IA 3DODA 1IUGA 4JEWA 3FVXA 3P6KA 2PO3A 2BI1A 5JAYA 1BKGA 1SVVA 3UE8A 2EO5A 2Z20A 1O61A 8AATA 1YOOA 5J8QA 3GBXA 4HVKA 3PDBA 2BKWA 1X29A 2CTZA 1AAMA 4IW7A 1AMQA 4IXSA 2YHKA 4J8LA 1WKHA 4MQRA 1CL1A 4BHDA 2AY7A 4LNMA 1AJSB 4M2MA 4F5LA 1QJ3A 3FDDA 4ADEA 4BA5A 3LVMA 3PPLA 1AHEA 1WYTA 3G0TA 1GD9A 4K05A 3F6TA 3G7QA 1AIBA 1DJ9A 2D5YA 1AKCA 2BI2A 1EQBA 2AY3A 3TQXA 2W7IA 2YRIA 1I43A 1C7NA 4OTLA 4F5FA 4F5GA 2BWNA 1BJ4A 1GDEA 3ATHA 4PVFA 1GC4A 4WB0B 1OXOA 3JWBA 2BWPA 2AEUA 1GC2A 4Y0DA 5D5SA 3AEMA 4MQPA 1MGVA 1GEYA 3RBLA 1RVYA 1P3WA 4R2NA 2X3LA 3DXVA 3DR4A 4E1OA 1XI9A 3F9TA 1AHXA 1GBNA 1TATA 4RITA 3NU7A 3PJ0A 1LKCA 4M2JA 2W7FA 4XQ2A 3VK3A 3CQ4A 2KFPA 4F5MA 2YKVA 1JF9A 5G0AA 2BWOA 1B4XA 3HT4A 1UU1A 1PG8A 4IXOA 3QPGA 4P7YA 4U1TA 5HHYA 4CBSA 3M5UA 1WSTA 2ZY5A 5M49A 4ZLVA 3N4XA 1BJWA 4GE9A 3W1IA 2C7TA 4OYTA 4EB5A 4E3RA 1BQAA 2V1PA 2C81A 1OXPA 1IX8A 2WK8A 3I4JA 2ZSLA 1YJYA 1E5EA 4E77A 4MSOA 1G4VA 4EU1A 1S09A 1D7VA 3EUCA 1YIYA 1ASCA 1ARGA 1C7OA 1LW4A 1M0NA 2CJGA 3E6GA 3NYTA 2YCTA 1GC0A 3HVYA 3PGYA 3LG0A 2W8WA 1TARA 3LV2A 2G7JA 2Z1ZA 2Q7WA 5FT5A 4L0OA 2ZYJA 3BWOA 3T32A 5AX8A 2HUFA 3NYSA 4RIZA 4HF8A 3JWAA 3GZDA 5F9SA 1W7LA 1ARSA 2QSRA 2CANA 2VIAA 4WBTA 1Z7DA 3A2BA 2JJHA 3B1CA 3FVSA 3WKRA 1MDXA 3RQ1A 3RCHB 5DJ1A 4BMKA 1DGDA 3E2FA 1ASDA 1KL2A 2E7UA 4Q31A 3GETA 2W7GA 4DQ6A 3FFHA 2VMSA 1MLYA 1MDOA 1ZODA 3G8MA 1MAPA 3I5TA 2OKKA 1I48A 3EZ1A 4OMAA 1BJOB 2D63A 5EQCA 3WCNA 3R4TA 1D7SA 4WYEA 1LS3A 1N31A 3N7NA 2Z9VA 3AEJC 5LH9A 4IX8A 4XJOA 2HOXA 4TMRA 1LK9A 4W1WA 2R5EA 3GZCA 1FC4A 2ZUKA 3QN6A 3RUYA 1IX7A 2BYLA 1IX6A 3LVKA 4KAMA 3N4RA 4ZM3A 2YRRA 2BIGA 2D7YA 5FT8A 1W7MA 3PD6A 2DGMA 4ATPA 2YKXA 2EZ2A 4A72A 4UQVA 1GCKA 3IF2A 3USFA 1ASLA 1O69A 1S07A 4GSAA 1TOKA 3FVUA 4CBRA 2VMTA 2ZJGA 1KMJA 4MY5A 2HOYA 1S06A 1OHYA 3GZDC 2QB3A 1AY4A 3AENA 4XAUA 2CFBA 4U2HA 3AELA 4H51A 1B9HA 2YKYA 4MGRA 3LWSA 4W91A 2VGZA 2E7JA 1DTYA 5TF5A 4N0BA 1C4KA 5EIGA 1U08A 4ZM4A 2OGEA 4A6UA 4LC3A 1M6SA 4ZSYA 1D2FA 4F4EA 3CAIA 5I92A 2D65A 3ZRPA 4ADCA 2VMUA 1AHGA 3NDNA 3R9AA 3FZ6A 1B9IA 1AAWA 5EAVA 3AEMC 2BI5A 3FZ8A 1JS6A 2CINA 3MAFB 4ZDPA 3WLXA 2QBTA 4WXBA 4ATQA 1AJRA 2PB2A 2Z61A 2DKJA 3AEJA 3FQAA 3QI6A 4IYOA 4W1XA 1ZOBA 3NNKA 5M46A 4DGTA 1RV3A 2VMZA 3ISLA 3GJUA 1X2AA 1I29A 3DC1A 3WGCA 1BQDA 4K2IA 1YAAA 1KL1A 3CQ5A 4KYOA 3PDBB 2VMOA 2D61A 3VAXA 4MKKA 3NX3A 3FKDA 2W8TA 2ZY2A 1CQ6A 3RI6A 4UHNA 2C44A 2JJEA 2R5CA 4JE5D 4JF1A 1YJZA 1IAYA 1XEYA 1TOIA 1ASAA 1M0QA 3K28A 3DZZA 4MKJA 1W7NA 4OBUA 4ZWVA 3NUBA 1QIRA 2Z9XA 3L44A 3VP6A 2A1VA 2VGTA 4H63Q 3BCAA 4Y0IA 2BHXA 4F5JA 2O1BA 1OATA 2VLHA 3MBBA 2TPLA 4RAEA 4ITGA 1FG7A 5E3KA 2OATA 1ELUA 3K7YA 5E4ZA 1C9CA 1BT4A 1GC3A 3BB8A 3W1JA 3WY7A 1SFFA 2VLFA 1IVRA 3K40A 4LNLA 2OKJA 4B9BA 4BA4A 1SF2A 2D7ZA 5EAAA 1QJ5A 4A0RA 4RM1A 2W7HA 2GQNA 3MC6C 1D7UA 4OT8A 3WGBA 2R2NA 3HLMA 4K2BA 3DU4A 2FKIA 1Z3ZA 2FN6A 2Z1YA 3WX9A 2FYFA 2BI3A 3AEOA 3N75A 1M4NA 1V2DA 1AIAA 1LC5A 1ZC9A 3E9KA 3MKJA 1N8PA 1UKJA 1WYVA 2OGAA 4J5UA 1AY5A 2R0TA 2VGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQ0 A;  3HQT A;  2W7M A;  2AY1 A;  1IJI A;  1AY8 A;  3FZ7 A;  4OCA A;  4XJL A;  4N0W A;  2BIA A;  4A0F A;  1C0N A;  1G7X A;  2BYJ A;  2OQX A;  3F0H A;  4F5H A;  2VMQ A;  3A8U X;  3GWP A;  3CQ6 A;  1DJE A;  3JW9 A;  2VI9 A;  2DKB A;  4FFC A;  4QGR A;  4ZSW A;  4ADD A;  1RVU A;  2VYC A;  2D64 A;  3OP7 A;  2FM1 A;  2YKU A;  4JEZ A;  2ZY4 A;  3QM2 A;  3VOM A;  7AAT A;  2JJG A;  2YCN A;  4JF0 A;  1O62 A;  1T3I A;  3VK4 A;  1MDZ A;  4RLG A;  3HL2 A;  5G2P A;  4OBV A;  1GEX A;  2V0Y A;  2EPJ A;  2Z9W A;  3KGX A;  4XK1 A;  2X5F A;  1WYU B;  2W7E A;  1UU2 A;  2WK7 A;  1AMR A;  3E2Z B;  4PFF A;  3RCH A;  4ZDO A;  3E77 A;  4B98 A;  4CVQ A;  4TV7 A;  4ZAH A;  3FQ7 A;  1ASN A;  3BWN C;  1VP4 A;  4UHO A;  4CXQ A;  3BC8 A;  4A6R A;  4AZK A;  3ZZK A;  1I41 A;  2EH6 A;  3QGU A;  2O0R A;  4F5I A;  2CJD A;  3MEB A;  4A00 A;  3RBF A;  4ITX A;  4JE5 A;  5M4B A;  2AY6 A;  2QB2 A;  1KKP A;  1LC8 A;  4DBC A;  4LW4 A;  2VMP A;  1V72 A;  1D7R A;  2GMS A;  1O4S A;  2VMY A;  1TOE A;  4IXZ A;  4ADB A;  1ELQ A;  2HUI A;  3DXW A;  2FNU A;  1ASM A;  4A0H A;  3ZRQ A;  4P3M A;  3FSL A;  1IBJ A;  1AIC A;  1BJN A;  1YJS A;  3I16 A;  1ECX A;  4GE7 A;  2PB0 A;  3L8A A;  2JIS A;  4AH3 A;  1J04 A;  5EUN A;  2EZ1 A;  4MQQ A;  4W1V A;  4ZWM A;  3WCO A;  1ASG A;  4ZDL A;  2W8V A;  2FNI A;  1AJS A;  1H1C A;  2Z67 A;  1IAX A;  1BS0 A;  2VMR A;  1TOG A;  1YIZ A;  3COG A;  2NMP A;  3PD6 B;  4JEV A;  4WYA A;  2AY5 A;  1WYT B;  2GSA A;  1FG3 A;  1W23 A;  2O7C A;  4WP0 A;  5EUE A;  1LC7 A;  3AAT A;  3GSB A;  3KGW A;  1JS3 A;  2ORD A;  1RV4 A;  1EJI A;  2W8J A;  4WD2 A;  3ELE A;  3A9X A;  5DB5 A;  3B46 A;  4AOA A;  2C0R A;  4WB0 A;  5FT4 A;  4RJY A;  1ASE A;  3ZZJ A;  2EGY A;  3AEP A;  1CJ0 A;  1CQ7 A;  2X5D A;  3EI5 A;  3EI7 A;  1MLZ A;  4EB7 A;  1AKA A;  4M2K A;  2X8U A;  1AMS A;  3B1E A;  3AV7 A;  1G7W A;  1AHF A;  1M7Y A;  3FQ8 A;  4WLH A;  3ZRR A;  4Q6R A;  2CH2 A;  4I8A A;  4WLJ A;  1E5F A;  3PDX A;  3UAK A;  1DFO A;  2W7D A;  2GB3 A;  1SPA A;  4GDY A;  4K2M A;  4UHM A;  3MAF A;  1AX4 A;  5G2Q A;  3UWC A;  1BW0 A;  4R8D A;  3MC6 A;  2JG2 A;  4ISY A;  1G4X A;  3GR9 A;  5LHA A;  3KKI A;  1PMM A;  2AY4 A;  1J32 A;  2XH1 A;  4LW2 A;  2CB1 A;  1X0M A;  3MAD A;  1ARI A;  3WKS A;  2QLR A;  1CL2 A;  1EG5 A;  2W8U A;  4RKC A;  4AO4 A;  2WKA A;  3EI8 A;  1QZ9 A;  3BCX A;  1AHY A;  3NUI A;  9AAT A;  1C7G A;  4A6T A;  2G6W A;  5EFS A;  3WZF A;  3EI6 A;  4WYC A;  1CZE A;  2VGU A;  3CBF A;  3II0 A;  4W8I A;  3BCB A;  1VJO A;  1KMK A;  2GMU A;  1VEF A;  5HDM A;  5BJ3 A;  4F5K A;  1ASB A;  1GEW A;  2YCP A;  1KKJ A;  2DGL A;  3VK2 A;  3NRA A;  2R5C B;  3W1H A;  3P1T A;  5HXX A;  5G4J A;  1M0O A;  3TAT A;  4A0G A;  1S08 A;  3FRK A;  5BJ4 A;  1QIT A;  2F8J A;  3JZL A;  2W7L A;  5DJ9 A;  3ELP A;  4TN4 A;  1W3U A;  2DR1 A;  2QMA A;  2HP2 A;  3DYD A;  4KXK A;  4EMY A;  1V2E A;  3DR7 A;  2BI9 A;  4O6Z A;  3B1D A;  3FD0 A;  1AMA A;  2HOR A;  3NTJ A;  5FT6 A;  2W7J A;  2VMW A;  1H0C A;  4W5K A;  3BV0 A;  2AY2 A;  4WYD A;  3Q8N A;  3QBO A;  4IY7 A;  3EI9 A;  2CY8 A;  1QGN A;  1TOJ A;  2CH1 A;  5G4I A;  2JJF A;  1UU0 A;  1N2T A;  4WXF A;  3LVL B;  3EZS A;  3N0L A;  1B8G A;  3HDO A;  1YNU A;  1Y4I A;  1ART A;  2VGW A;  1OHW A;  1M0P A;  4E3Q A;  4RKD A;  5D95 A;  4Q76 A;  3TCM A;  2AY8 A;  1LW5 A;  4GE4 A;  4AO9 A;  2VMN A;  2QA3 A;  3BWN A;  3AOW A;  3EIA A;  2ZSM A;  1B5O A;  3MAU A;  1ORD A;  3IHJ A;  3ECD A;  4EFF A;  1BJO A;  1QIS A;  2HOZ A;  4AZJ A;  3BN1 A;  3OKS A;  4CXR A;  3JU7 A;  4JEY A;  3PA9 A;  4WXG A;  1OHV A;  1WYV B;  4XEW A;  1CS1 A;  2JGT A;  5K8B A;  2CJH A;  3H14 A;  3H7F A;  1X28 A;  4NOG A;  1DKA A;  2ZP7 A;  3B8X A;  3TFU A;  4UOY A;  5EUD A;  2WK9 A;  2Z9U A;  2AY9 A;  1DJU A;  3FCR A;  4PIW A;  1TAS A;  4RJ0 A;  3FFR A;  4Q75 A;  1B5P A;  1SZS A;  2HZP A;  2VGS A;  4JEX A;  2DOU A;  2BIE A;  3E2Y A;  1AKB A;  2HUU A;  3NYU A;  2CST A;  3A9Z A;  1SZK A;  5F8V A;  4GEB A;  4LNJ A;  2ZY3 A;  3EIB A;  1S0A A;  2W7K A;  3JTX A;  2E54 A;  2E7I A;  1CZC A;  2FQ6 A;  4R5F A;  1ASF A;  5DX5 A;  1TPL A;  2AAT A;  3AEN B;  2XBN A;  3ASA A;  3KE3 A;  3N5M A;  2AEV A;  3HMU A;  3PIU A;  3A9Y A;  2RFV A;  2YOB A;  4Y0H A;  2VMX A;  2VMV A;  4WYF A;  5G09 A;  3LVJ A;  5EIG B;  3NU8 A;  1DGE A;  4GRX A;  1WYU A;  3FTB A;  3E2Z A;  5C6U A;  1PFF A;  4FL0 A;  4WYG A;  3ASB A;  3TFT A;  1V2F A;  5IWQ A;  3FDB A;  1JG8 A;  4PFN A;  2D66 A;  3ACZ A;  3AOV A;  3D6K A;  3BS8 A;  4OC9 A;  3PAA A;  1M32 A;  3LY1 A;  4R5Z A;  1CQ8 A;  3DRD A;  1WKG A;  1SZU A;  4XJP A;  2ZC0 A;  1ARH A;  1PMO A;  2DGK A;  3QHX A;  4XJM A;  2HP1 A;  1MAQ A;  2VIB A;  2VI8 A;  4IYO B;  4ZAS A;  3HBX A;  5M4D A;  5E5I A;  3DOD A;  1IUG A;  4JEW A;  3FVX A;  3P6K A;  2PO3 A;  2BI1 A;  5JAY A;  1BKG A;  1SVV A;  3UE8 A;  2EO5 A;  2Z20 A;  1O61 A;  8AAT A;  1YOO A;  5J8Q A;  3GBX A;  4HVK A;  3PDB A;  2BKW A;  1X29 A;  2CTZ A;  1AAM A;  4IW7 A;  1AMQ A;  4IXS A;  2YHK A;  4J8L A;  1WKH A;  4MQR A;  1CL1 A;  4BHD A;  2AY7 A;  4LNM A;  1AJS B;  4M2M A;  4F5L A;  1QJ3 A;  3FDD A;  4ADE A;  4BA5 A;  3LVM A;  3PPL A;  1AHE A;  1WYT A;  3G0T A;  1GD9 A;  3F6T A;  3G7Q A;  1AIB A;  1DJ9 A;  2D5Y A;  1AKC A;  2BI2 A;  1EQB A;  2AY3 A;  3TQX A;  2W7I A;  2YRI A;  1I43 A;  1C7N A;  4OTL A;  4F5F A;  4F5G A;  2BWN A;  1BJ4 A;  1GDE A;  3ATH A;  4PVF A;  1GC4 A;  4WB0 B;  1OXO A;  3JWB A;  2BWP A;  2AEU A;  1GC2 A;  4Y0D A;  5D5S A;  3AEM A;  4MQP A;  1MGV A;  1GEY A;  3RBL A;  1RVY A;  1P3W A;  4R2N A;  2X3L A;  3DXV A;  3DR4 A;  4E1O A;  1XI9 A;  3F9T A;  1AHX A;  1GBN A;  1TAT A;  4RIT A;  3NU7 A;  3PJ0 A;  1LKC A;  4M2J A;  2W7F A;  4XQ2 A;  3VK3 A;  3CQ4 A;  4F5M A;  2YKV A;  1JF9 A;  5G0A A;  2BWO A;  1B4X A;  3HT4 A;  1UU1 A;  1PG8 A;  4IXO A;  3QPG A;  4P7Y A;  4U1T A;  5HHY A;  4CBS A;  3M5U A;  1WST A;  2ZY5 A;  5M49 A;  4ZLV A;  1BJW A;  4GE9 A;  3W1I A;  2C7T A;  4OYT A;  4EB5 A;  4E3R A;  1BQA A;  2V1P A;  2C81 A;  1OXP A;  1IX8 A;  2WK8 A;  3I4J A;  2ZSL A;  1YJY A;  1E5E A;  4E77 A;  4MSO A;  1G4V A;  4EU1 A;  1S09 A;  1D7V A;  3EUC A;  1YIY A;  1ASC A;  1ARG A;  1C7O A;  1LW4 A;  1M0N A;  2CJG A;  3E6G A;  3NYT A;  2YCT A;  1GC0 A;  3HVY A;  3PGY A;  3LG0 A;  2W8W A;  1TAR A;  3LV2 A;  2Z1Z A;  2Q7W A;  5FT5 A;  4L0O A;  2ZYJ A;  3BWO A;  3T32 A;  5AX8 A;  2HUF A;  3NYS A;  4RIZ A;  4HF8 A;  3JWA A;  3GZD A;  5F9S A;  1W7L A;  1ARS A;  2CAN A;  2VIA A;  4WBT A;  1Z7D A;  3A2B A;  2JJH A;  3B1C A;  3FVS A;  3WKR A;  1MDX A;  3RQ1 A;  3RCH B;  5DJ1 A;  4BMK A;  1DGD A;  3E2F A;  1ASD A;  1KL2 A;  2E7U A;  4Q31 A;  3GET A;  2W7G A;  4DQ6 A;  3FFH A;  2VMS A;  1MLY A;  1MDO A;  1ZOD A;  3G8M A;  1MAP A;  3I5T A;  2OKK A;  1I48 A;  3EZ1 A;  4OMA A;  1BJO B;  2D63 A;  5EQC A;  3WCN A;  3R4T A;  1D7S A;  4WYE A;  1LS3 A;  1N31 A;  2Z9V A;  3AEJ C;  5LH9 A;  4IX8 A;  4XJO A;  2HOX A;  4TMR A;  1LK9 A;  4W1W A;  2R5E A;  3GZC A;  1FC4 A;  2ZUK A;  3QN6 A;  3RUY A;  1IX7 A;  2BYL A;  1IX6 A;  3LVK A;  4KAM A;  4ZM3 A;  2YRR A;  2BIG A;  2D7Y A;  5FT8 A;  1W7M A;  3PD6 A;  2DGM A;  4ATP A;  2YKX A;  2EZ2 A;  4A72 A;  4UQV A;  1GCK A;  3IF2 A;  3USF A;  1ASL A;  1O69 A;  1S07 A;  4GSA A;  1TOK A;  3FVU A;  4CBR A;  2VMT A;  2ZJG A;  1KMJ A;  4MY5 A;  2HOY A;  1S06 A;  1OHY A;  3GZD C;  2QB3 A;  1AY4 A;  3AEN A;  4XAU A;  2CFB A;  4U2H A;  3AEL A;  4H51 A;  1B9H A;  2YKY A;  4MGR A;  3LWS A;  4W91 A;  2VGZ A;  2E7J A;  1DTY A;  5TF5 A;  4N0B A;  1C4K A;  5EIG A;  1U08 A;  4ZM4 A;  2OGE A;  4A6U A;  4LC3 A;  1M6S A;  4ZSY A;  1D2F A;  4F4E A;  3CAI A;  5I92 A;  2D65 A;  3ZRP A;  4ADC A;  2VMU A;  1AHG A;  3NDN A;  3R9A A;  3FZ6 A;  1B9I A;  1AAW A;  5EAV A;  3AEM C;  2BI5 A;  3FZ8 A;  1JS6 A;  2CIN A;  3MAF B;  4ZDP A;  3WLX A;  2QBT A;  4WXB A;  4ATQ A;  1AJR A;  2PB2 A;  2Z61 A;  2DKJ A;  3AEJ A;  3FQA A;  3QI6 A;  4IYO A;  4W1X A;  1ZOB A;  3NNK A;  5M46 A;  4DGT A;  1RV3 A;  2VMZ A;  3ISL A;  3GJU A;  1X2A A;  1I29 A;  3DC1 A;  3WGC A;  1BQD A;  4K2I A;  1YAA A;  1KL1 A;  3CQ5 A;  4KYO A;  3PDB B;  2VMO A;  2D61 A;  3VAX A;  4MKK A;  3NX3 A;  3FKD A;  2W8T A;  2ZY2 A;  1CQ6 A;  3RI6 A;  4UHN A;  2C44 A;  2JJE A;  2R5C A;  4JE5 D;  4JF1 A;  1YJZ A;  1IAY A;  1XEY A;  1TOI A;  1ASA A;  1M0Q A;  3K28 A;  3DZZ A;  4MKJ A;  1W7N A;  4OBU A;  4ZWV A;  3NUB A;  1QIR A;  2Z9X A;  3L44 A;  3VP6 A;  2VGT A;  3BCA A;  4Y0I A;  2BHX A;  4F5J A;  2O1B A;  1OAT A;  2VLH A;  3MBB A;  2TPL A;  4RAE A;  4ITG A;  1FG7 A;  5E3K A;  2OAT A;  1ELU A;  3K7Y A;  5E4Z A;  1C9C A;  1BT4 A;  1GC3 A;  3BB8 A;  3W1J A;  3WY7 A;  1SFF A;  2VLF A;  1IVR A;  3K40 A;  4LNL A;  2OKJ A;  4B9B A;  4BA4 A;  1SF2 A;  2D7Z A;  5EAA A;  1QJ5 A;  4A0R A;  4RM1 A;  2W7H A;  2GQN A;  3MC6 C;  1D7U A;  4OT8 A;  3WGB A;  2R2N A;  3HLM A;  4K2B A;  3DU4 A;  1Z3Z A;  2FN6 A;  2Z1Y A;  3WX9 A;  2FYF A;  2BI3 A;  3AEO A;  3N75 A;  1M4N A;  1V2D A;  1AIA A;  1LC5 A;  1ZC9 A;  3E9K A;  3MKJ A;  1N8P A;  1UKJ A;  1WYV A;  2OGA A;  4J5U A;  1AY5 A;  2R0T A;  2VGV A; 
#chains in the Genus database with same CATH topology
 4BQ0 A;  3HQT A;  2W7M A;  2AY1 A;  1IJI A;  1AY8 A;  3FZ7 A;  4OCA A;  4XJL A;  4N0W A;  2BIA A;  4A0F A;  1C0N A;  1G7X A;  2BYJ A;  2OQX A;  3F0H A;  4F5H A;  2VMQ A;  3A8U X;  3GWP A;  3CQ6 A;  1DJE A;  3JW9 A;  2VI9 A;  2DKB A;  4FFC A;  4QGR A;  4ZSW A;  4ADD A;  1RVU A;  2VYC A;  2D64 A;  3OP7 A;  2FM1 A;  2YKU A;  4JEZ A;  2ZY4 A;  3QM2 A;  3VOM A;  7AAT A;  2JJG A;  2YCN A;  4JF0 A;  1O62 A;  1T3I A;  3VK4 A;  1MDZ A;  4RLG A;  3HL2 A;  5G2P A;  4OBV A;  1GEX A;  2V0Y A;  2EPJ A;  2Z9W A;  3KGX A;  4XK1 A;  2X5F A;  1WYU B;  2W7E A;  1UU2 A;  2WK7 A;  1AMR A;  3E2Z B;  3N4S A;  4PFF A;  3RCH A;  4ZDO A;  3E77 A;  4B98 A;  4CVQ A;  4TV7 A;  4ZAH A;  3FQ7 A;  1ASN A;  3BWN C;  1VP4 A;  4UHO A;  4CXQ A;  3BC8 A;  4A6R A;  4AZK A;  3ZZK A;  1I41 A;  2EH6 A;  3QGU A;  2O0R A;  4F5I A;  2CJD A;  3MEB A;  4A00 A;  3RBF A;  4ITX A;  4JE5 A;  5M4B A;  2AY6 A;  2QB2 A;  1KKP A;  1LC8 A;  4DBC A;  4LW4 A;  2VMP A;  1V72 A;  1D7R A;  2GMS A;  1O4S A;  2VMY A;  1TOE A;  4IXZ A;  4ADB A;  1ELQ A;  2HUI A;  3DXW A;  2FNU A;  1ASM A;  4A0H A;  3ZRQ A;  4P3M A;  3FSL A;  1IBJ A;  1AIC A;  1BJN A;  1YJS A;  3I16 A;  1ECX A;  4GE7 A;  2PB0 A;  3L8A A;  2JIS A;  4AH3 A;  1J04 A;  5EUN A;  2EZ1 A;  4MQQ A;  4W1V A;  4ZWM A;  3WCO A;  1ASG A;  4ZDL A;  2W8V A;  2FNI A;  1AJS A;  1H1C A;  2Z67 A;  1IAX A;  1BS0 A;  2VMR A;  1TOG A;  1YIZ A;  3COG A;  2NMP A;  3PD6 B;  4JEV A;  4WYA A;  2AY5 A;  1WYT B;  2GSA A;  1FG3 A;  1W23 A;  2O7C A;  4WP0 A;  5EUE A;  1LC7 A;  3AAT A;  3GSB A;  3KGW A;  1JS3 A;  2ORD A;  1RV4 A;  1EJI A;  2W8J A;  4WD2 A;  3ELE A;  3A9X A;  5DB5 A;  3B46 A;  4AOA A;  2C0R A;  4WB0 A;  5FT4 A;  4RJY A;  1ASE A;  3ZZJ A;  2EGY A;  3AEP A;  1CJ0 A;  1CQ7 A;  2X5D A;  3EI5 A;  3EI7 A;  1MLZ A;  4EB7 A;  1AKA A;  4M2K A;  2X8U A;  1AMS A;  3B1E A;  3AV7 A;  1G7W A;  1AHF A;  1M7Y A;  3FQ8 A;  4WLH A;  3ZRR A;  4Q6R A;  2CH2 A;  4I8A A;  4WLJ A;  1E5F A;  3PDX A;  3UAK A;  1DFO A;  2W7D A;  2GB3 A;  1SPA A;  4GDY A;  4K2M A;  4UHM A;  3MAF A;  1AX4 A;  5G2Q A;  3UWC A;  1BW0 A;  4R8D A;  3MC6 A;  2JG2 A;  4ISY A;  1G4X A;  3GR9 A;  5LHA A;  3KKI A;  1PMM A;  2AY4 A;  1J32 A;  2XH1 A;  4LW2 A;  2CB1 A;  1X0M A;  3MAD A;  1ARI A;  3WKS A;  2QLR A;  1CL2 A;  1EG5 A;  2W8U A;  4RKC A;  4AO4 A;  2WKA A;  3EI8 A;  1QZ9 A;  3BCX A;  1AHY A;  3NUI A;  9AAT A;  1C7G A;  4A6T A;  2G6W A;  5EFS A;  3WZF A;  3EI6 A;  4WYC A;  1CZE A;  2VGU A;  3CBF A;  3II0 A;  4W8I A;  3BCB A;  1VJO A;  1KMK A;  2GMU A;  1VEF A;  5HDM A;  5BJ3 A;  4F5K A;  1ASB A;  1GEW A;  2YCP A;  1KKJ A;  2DGL A;  3VK2 A;  3NRA A;  2R5C B;  3W1H A;  3P1T A;  5HXX A;  5G4J A;  1M0O A;  3TAT A;  4A0G A;  1S08 A;  3FRK A;  5BJ4 A;  1QIT A;  2F8J A;  3JZL A;  2W7L A;  5DJ9 A;  3ELP A;  4TN4 A;  1W3U A;  2DR1 A;  2QMA A;  2HP2 A;  3DYD A;  4KXK A;  4EMY A;  1V2E A;  3DR7 A;  2BI9 A;  4O6Z A;  3B1D A;  3FD0 A;  1AMA A;  2HOR A;  3NTJ A;  5FT6 A;  2W7J A;  2VMW A;  1H0C A;  4W5K A;  3BV0 A;  2AY2 A;  4WYD A;  3Q8N A;  3QBO A;  4IY7 A;  3EI9 A;  2CY8 A;  1QGN A;  1TOJ A;  2CH1 A;  5G4I A;  2JJF A;  1UU0 A;  1N2T A;  4WXF A;  3LVL B;  3EZS A;  3N0L A;  1B8G A;  3HDO A;  1YNU A;  1Y4I A;  1ART A;  2VGW A;  1OHW A;  1M0P A;  4E3Q A;  4RKD A;  5D95 A;  4Q76 A;  3TCM A;  2AY8 A;  1LW5 A;  4GE4 A;  4AO9 A;  2VMN A;  2QA3 A;  3BWN A;  3AOW A;  3EIA A;  2ZSM A;  1B5O A;  3MAU A;  1ORD A;  3IHJ A;  3ECD A;  4EFF A;  1BJO A;  1QIS A;  2HOZ A;  4AZJ A;  3BN1 A;  3OKS A;  4CXR A;  3JU7 A;  4JEY A;  3PA9 A;  4WXG A;  1OHV A;  1WYV B;  4XEW A;  1CS1 A;  2JGT A;  5K8B A;  2CJH A;  3H14 A;  3H7F A;  1X28 A;  4NOG A;  1DKA A;  2ZP7 A;  3B8X A;  3TFU A;  4UOY A;  5EUD A;  2WK9 A;  2Z9U A;  2AY9 A;  1DJU A;  3FCR A;  4PIW A;  1TAS A;  4RJ0 A;  3FFR A;  4Q75 A;  1B5P A;  1SZS A;  2HZP A;  2VGS A;  4JEX A;  2DOU A;  2BIE A;  3E2Y A;  1AKB A;  2HUU A;  3NYU A;  2CST A;  3A9Z A;  1SZK A;  5F8V A;  4GEB A;  4LNJ A;  2ZY3 A;  3EIB A;  1S0A A;  2W7K A;  3JTX A;  2E54 A;  2E7I A;  1CZC A;  2FQ6 A;  4R5F A;  1ASF A;  5DX5 A;  1TPL A;  2AAT A;  3AEN B;  2XBN A;  3ASA A;  3KE3 A;  3N5M A;  2AEV A;  3HMU A;  3PIU A;  3A9Y A;  2RFV A;  2YOB A;  4Y0H A;  2VMX A;  2VMV A;  4WYF A;  5G09 A;  3LVJ A;  5EIG B;  3NU8 A;  1DGE A;  4GRX A;  1WYU A;  3FTB A;  3E2Z A;  5C6U A;  1PFF A;  4FL0 A;  3H9X A;  4WYG A;  3ASB A;  3TFT A;  2EYQ A;  1V2F A;  5IWQ A;  3FDB A;  1JG8 A;  4PFN A;  2D66 A;  3ACZ A;  3AOV A;  3D6K A;  3BS8 A;  4OC9 A;  3PAA A;  1M32 A;  3LY1 A;  4R5Z A;  1CQ8 A;  3DRD A;  1WKG A;  1SZU A;  4XJP A;  2ZC0 A;  1ARH A;  1PMO A;  2DGK A;  3QHX A;  4XJM A;  2WB6 A;  2HP1 A;  1MAQ A;  2VIB A;  2VI8 A;  4IYO B;  4ZAS A;  3HBX A;  5M4D A;  5KTB A;  5E5I A;  3DOD A;  1IUG A;  4JEW A;  3FVX A;  3P6K A;  2PO3 A;  2BI1 A;  5JAY A;  1BKG A;  1SVV A;  3UE8 A;  2EO5 A;  2Z20 A;  1O61 A;  8AAT A;  1YOO A;  5J8Q A;  3GBX A;  4HVK A;  3PDB A;  2BKW A;  1X29 A;  2CTZ A;  1AAM A;  4IW7 A;  1AMQ A;  4IXS A;  2YHK A;  4J8L A;  1WKH A;  4MQR A;  1CL1 A;  4BHD A;  2AY7 A;  4LNM A;  1AJS B;  4M2M A;  4F5L A;  1QJ3 A;  3FDD A;  4ADE A;  4BA5 A;  3LVM A;  3PPL A;  1AHE A;  1WYT A;  3G0T A;  1GD9 A;  4K05 A;  3F6T A;  3G7Q A;  1AIB A;  1DJ9 A;  2D5Y A;  1AKC A;  2BI2 A;  1EQB A;  2AY3 A;  3TQX A;  2W7I A;  2YRI A;  1I43 A;  1C7N A;  4OTL A;  4F5F A;  4F5G A;  2BWN A;  1BJ4 A;  1GDE A;  3ATH A;  4PVF A;  1GC4 A;  4WB0 B;  1OXO A;  3JWB A;  2BWP A;  2AEU A;  1GC2 A;  4Y0D A;  5D5S A;  3AEM A;  4MQP A;  1MGV A;  1GEY A;  3RBL A;  1RVY A;  1P3W A;  4R2N A;  2X3L A;  3DXV A;  3DR4 A;  4E1O A;  1XI9 A;  3F9T A;  1AHX A;  1GBN A;  1TAT A;  4RIT A;  3NU7 A;  3PJ0 A;  1LKC A;  4M2J A;  2W7F A;  4XQ2 A;  3VK3 A;  3CQ4 A;  2KFP A;  4F5M A;  2YKV A;  1JF9 A;  5G0A A;  2BWO A;  1B4X A;  3HT4 A;  1UU1 A;  1PG8 A;  4IXO A;  3QPG A;  4P7Y A;  4U1T A;  5HHY A;  4CBS A;  3M5U A;  1WST A;  2ZY5 A;  5M49 A;  4ZLV A;  3N4X A;  1BJW A;  4GE9 A;  3W1I A;  2C7T A;  4OYT A;  4EB5 A;  4E3R A;  1BQA A;  2V1P A;  2C81 A;  1OXP A;  1IX8 A;  2WK8 A;  3I4J A;  2ZSL A;  1YJY A;  1E5E A;  4E77 A;  4MSO A;  1G4V A;  4EU1 A;  1S09 A;  1D7V A;  3EUC A;  1YIY A;  1ASC A;  1ARG A;  1C7O A;  1LW4 A;  1M0N A;  2CJG A;  3E6G A;  3NYT A;  2YCT A;  1GC0 A;  3HVY A;  3PGY A;  3LG0 A;  2W8W A;  1TAR A;  3LV2 A;  2G7J A;  2Z1Z A;  2Q7W A;  5FT5 A;  4L0O A;  2ZYJ A;  3BWO A;  3T32 A;  5AX8 A;  2HUF A;  3NYS A;  4RIZ A;  4HF8 A;  3JWA A;  3GZD A;  5F9S A;  1W7L A;  1ARS A;  2QSR A;  2CAN A;  2VIA A;  4WBT A;  1Z7D A;  3A2B A;  2JJH A;  3B1C A;  3FVS A;  3WKR A;  1MDX A;  3RQ1 A;  3RCH B;  5DJ1 A;  4BMK A;  1DGD A;  3E2F A;  1ASD A;  1KL2 A;  2E7U A;  4Q31 A;  3GET A;  2W7G A;  4DQ6 A;  3FFH A;  2VMS A;  1MLY A;  1MDO A;  1ZOD A;  3G8M A;  1MAP A;  3I5T A;  2OKK A;  1I48 A;  3EZ1 A;  4OMA A;  1BJO B;  2D63 A;  5EQC A;  3WCN A;  3R4T A;  1D7S A;  4WYE A;  1LS3 A;  1N31 A;  3N7N A;  2Z9V A;  3AEJ C;  5LH9 A;  4IX8 A;  4XJO A;  2HOX A;  4TMR A;  1LK9 A;  4W1W A;  2R5E A;  3GZC A;  1FC4 A;  2ZUK A;  3QN6 A;  3RUY A;  1IX7 A;  2BYL A;  1IX6 A;  3LVK A;  4KAM A;  3N4R A;  4ZM3 A;  2YRR A;  2BIG A;  2D7Y A;  5FT8 A;  1W7M A;  3PD6 A;  2DGM A;  4ATP A;  2YKX A;  2EZ2 A;  4A72 A;  4UQV A;  1GCK A;  3IF2 A;  3USF A;  1ASL A;  1O69 A;  1S07 A;  4GSA A;  1TOK A;  3FVU A;  4CBR A;  2VMT A;  2ZJG A;  1KMJ A;  4MY5 A;  2HOY A;  1S06 A;  1OHY A;  3GZD C;  2QB3 A;  1AY4 A;  3AEN A;  4XAU A;  2CFB A;  4U2H A;  3AEL A;  4H51 A;  1B9H A;  2YKY A;  4MGR A;  3LWS A;  4W91 A;  2VGZ A;  2E7J A;  1DTY A;  5TF5 A;  1KAF A;  4N0B A;  1C4K A;  5EIG A;  1U08 A;  4ZM4 A;  2OGE A;  4A6U A;  4LC3 A;  1M6S A;  4ZSY A;  1D2F A;  4F4E A;  3CAI A;  5I92 A;  2D65 A;  3ZRP A;  4ADC A;  2VMU A;  1AHG A;  3NDN A;  3R9A A;  3FZ6 A;  1B9I A;  1AAW A;  5EAV A;  3AEM C;  2BI5 A;  3FZ8 A;  1JS6 A;  2CIN A;  3MAF B;  4ZDP A;  3WLX A;  2QBT A;  4WXB A;  4ATQ A;  1AJR A;  2PB2 A;  2Z61 A;  2DKJ A;  3AEJ A;  3FQA A;  3QI6 A;  4IYO A;  4W1X A;  1ZOB A;  3NNK A;  5M46 A;  4DGT A;  1RV3 A;  2VMZ A;  3ISL A;  3GJU A;  1X2A A;  1I29 A;  3DC1 A;  3WGC A;  1BQD A;  4K2I A;  1YAA A;  1KL1 A;  3CQ5 A;  4KYO A;  3PDB B;  2VMO A;  2D61 A;  3VAX A;  4MKK A;  3NX3 A;  3FKD A;  2W8T A;  2ZY2 A;  1CQ6 A;  3RI6 A;  4UHN A;  2C44 A;  2JJE A;  2R5C A;  4JE5 D;  4JF1 A;  1YJZ A;  1IAY A;  1XEY A;  1TOI A;  1ASA A;  1M0Q A;  3K28 A;  3DZZ A;  4MKJ A;  1W7N A;  4OBU A;  4ZWV A;  3NUB A;  1QIR A;  2Z9X A;  3L44 A;  3VP6 A;  2A1V A;  2VGT A;  4H63 Q;  3BCA A;  4Y0I A;  2BHX A;  4F5J A;  2O1B A;  1OAT A;  2VLH A;  3MBB A;  2TPL A;  4RAE A;  4ITG A;  1FG7 A;  5E3K A;  2OAT A;  1ELU A;  3K7Y A;  5E4Z A;  1C9C A;  1BT4 A;  1GC3 A;  3BB8 A;  3W1J A;  3WY7 A;  1SFF A;  2VLF A;  1IVR A;  3K40 A;  4LNL A;  2OKJ A;  4B9B A;  4BA4 A;  1SF2 A;  2D7Z A;  5EAA A;  1QJ5 A;  4A0R A;  4RM1 A;  2W7H A;  2GQN A;  3MC6 C;  1D7U A;  4OT8 A;  3WGB A;  2R2N A;  3HLM A;  4K2B A;  3DU4 A;  2FKI A;  1Z3Z A;  2FN6 A;  2Z1Y A;  3WX9 A;  2FYF A;  2BI3 A;  3AEO A;  3N75 A;  1M4N A;  1V2D A;  1AIA A;  1LC5 A;  1ZC9 A;  3E9K A;  3MKJ A;  1N8P A;  1UKJ A;  1WYV A;  2OGA A;  4J5U A;  1AY5 A;  2R0T A;  2VGV A; 
#chains in the Genus database with same CATH homology
 4BQ0 A;  3HQT A;  2W7M A;  2AY1 A;  1IJI A;  1AY8 A;  3FZ7 A;  4OCA A;  4XJL A;  4N0W A;  2BIA A;  4A0F A;  1C0N A;  1G7X A;  2BYJ A;  2OQX A;  3F0H A;  4F5H A;  2VMQ A;  3A8U X;  3GWP A;  3CQ6 A;  1DJE A;  3JW9 A;  2VI9 A;  2DKB A;  4FFC A;  4QGR A;  4ZSW A;  4ADD A;  1RVU A;  2VYC A;  2D64 A;  3OP7 A;  2FM1 A;  2YKU A;  4JEZ A;  2ZY4 A;  3QM2 A;  3VOM A;  7AAT A;  2JJG A;  2YCN A;  4JF0 A;  1O62 A;  1T3I A;  3VK4 A;  1MDZ A;  4RLG A;  3HL2 A;  5G2P A;  4OBV A;  1GEX A;  2V0Y A;  2EPJ A;  2Z9W A;  3KGX A;  4XK1 A;  2X5F A;  1WYU B;  2W7E A;  1UU2 A;  2WK7 A;  1AMR A;  3E2Z B;  3N4S A;  4PFF A;  3RCH A;  4ZDO A;  3E77 A;  4B98 A;  4CVQ A;  4TV7 A;  4ZAH A;  3FQ7 A;  1ASN A;  3BWN C;  1VP4 A;  4UHO A;  4CXQ A;  3BC8 A;  4A6R A;  4AZK A;  3ZZK A;  1I41 A;  2EH6 A;  3QGU A;  2O0R A;  4F5I A;  2CJD A;  3MEB A;  4A00 A;  3RBF A;  4ITX A;  4JE5 A;  5M4B A;  2AY6 A;  2QB2 A;  1KKP A;  1LC8 A;  4DBC A;  4LW4 A;  2VMP A;  1V72 A;  1D7R A;  2GMS A;  1O4S A;  2VMY A;  1TOE A;  4IXZ A;  4ADB A;  1ELQ A;  2HUI A;  3DXW A;  2FNU A;  1ASM A;  4A0H A;  3ZRQ A;  4P3M A;  3FSL A;  1IBJ A;  1AIC A;  1BJN A;  1YJS A;  3I16 A;  1ECX A;  4GE7 A;  2PB0 A;  3L8A A;  2JIS A;  4AH3 A;  1J04 A;  5EUN A;  2EZ1 A;  4MQQ A;  4W1V A;  4ZWM A;  3WCO A;  1ASG A;  4ZDL A;  2W8V A;  2FNI A;  1AJS A;  1H1C A;  2Z67 A;  1IAX A;  1BS0 A;  2VMR A;  1TOG A;  1YIZ A;  3COG A;  2NMP A;  3PD6 B;  4JEV A;  4WYA A;  2AY5 A;  1WYT B;  2GSA A;  1FG3 A;  1W23 A;  2O7C A;  4WP0 A;  5EUE A;  1LC7 A;  3AAT A;  3GSB A;  3KGW A;  1JS3 A;  2ORD A;  1RV4 A;  1EJI A;  2W8J A;  4WD2 A;  3ELE A;  3A9X A;  5DB5 A;  3B46 A;  4AOA A;  2C0R A;  4WB0 A;  5FT4 A;  4RJY A;  1ASE A;  3ZZJ A;  2EGY A;  3AEP A;  1CJ0 A;  1CQ7 A;  2X5D A;  3EI5 A;  3EI7 A;  1MLZ A;  4EB7 A;  1AKA A;  4M2K A;  2X8U A;  1AMS A;  3B1E A;  3AV7 A;  1G7W A;  1AHF A;  1M7Y A;  3FQ8 A;  4WLH A;  3ZRR A;  4Q6R A;  2CH2 A;  4I8A A;  4WLJ A;  1E5F A;  3PDX A;  3UAK A;  1DFO A;  2W7D A;  2GB3 A;  1SPA A;  4GDY A;  4K2M A;  4UHM A;  3MAF A;  1AX4 A;  5G2Q A;  3UWC A;  1BW0 A;  4R8D A;  3MC6 A;  2JG2 A;  4ISY A;  1G4X A;  3GR9 A;  5LHA A;  3KKI A;  1PMM A;  2AY4 A;  1J32 A;  2XH1 A;  4LW2 A;  2CB1 A;  1X0M A;  3MAD A;  1ARI A;  3WKS A;  2QLR A;  1CL2 A;  1EG5 A;  2W8U A;  4RKC A;  4AO4 A;  2WKA A;  3EI8 A;  1QZ9 A;  3BCX A;  1AHY A;  3NUI A;  9AAT A;  1C7G A;  4A6T A;  2G6W A;  5EFS A;  3WZF A;  3EI6 A;  4WYC A;  1CZE A;  2VGU A;  3CBF A;  3II0 A;  4W8I A;  3BCB A;  1VJO A;  1KMK A;  2GMU A;  1VEF A;  5HDM A;  5BJ3 A;  4F5K A;  1ASB A;  1GEW A;  2YCP A;  1KKJ A;  2DGL A;  3VK2 A;  3NRA A;  2R5C B;  3W1H A;  3P1T A;  5HXX A;  5G4J A;  1M0O A;  3TAT A;  4A0G A;  1S08 A;  3FRK A;  5BJ4 A;  1QIT A;  2F8J A;  3JZL A;  2W7L A;  5DJ9 A;  3ELP A;  4TN4 A;  1W3U A;  2DR1 A;  2QMA A;  2HP2 A;  3DYD A;  4KXK A;  4EMY A;  1V2E A;  3DR7 A;  2BI9 A;  4O6Z A;  3B1D A;  3FD0 A;  1AMA A;  2HOR A;  3NTJ A;  5FT6 A;  2W7J A;  2VMW A;  1H0C A;  4W5K A;  3BV0 A;  2AY2 A;  4WYD A;  3Q8N A;  3QBO A;  4IY7 A;  3EI9 A;  2CY8 A;  1QGN A;  1TOJ A;  2CH1 A;  5G4I A;  2JJF A;  1UU0 A;  1N2T A;  4WXF A;  3LVL B;  3EZS A;  3N0L A;  1B8G A;  3HDO A;  1YNU A;  1Y4I A;  1ART A;  2VGW A;  1OHW A;  1M0P A;  4E3Q A;  4RKD A;  5D95 A;  4Q76 A;  3TCM A;  2AY8 A;  1LW5 A;  4GE4 A;  4AO9 A;  2VMN A;  2QA3 A;  3BWN A;  3AOW A;  3EIA A;  2ZSM A;  1B5O A;  3MAU A;  1ORD A;  3IHJ A;  3ECD A;  4EFF A;  1BJO A;  1QIS A;  2HOZ A;  4AZJ A;  3BN1 A;  3OKS A;  4CXR A;  3JU7 A;  4JEY A;  3PA9 A;  4WXG A;  1OHV A;  1WYV B;  4XEW A;  1CS1 A;  2JGT A;  5K8B A;  2CJH A;  3H14 A;  3H7F A;  1X28 A;  4NOG A;  1DKA A;  2ZP7 A;  3B8X A;  3TFU A;  4UOY A;  5EUD A;  2WK9 A;  2Z9U A;  2AY9 A;  1DJU A;  3FCR A;  4PIW A;  1TAS A;  4RJ0 A;  3FFR A;  4Q75 A;  1B5P A;  1SZS A;  2HZP A;  2VGS A;  4JEX A;  2DOU A;  2BIE A;  3E2Y A;  1AKB A;  2HUU A;  3NYU A;  2CST A;  3A9Z A;  1SZK A;  5F8V A;  4GEB A;  4LNJ A;  2ZY3 A;  3EIB A;  1S0A A;  2W7K A;  3JTX A;  2E54 A;  2E7I A;  1CZC A;  2FQ6 A;  4R5F A;  1ASF A;  5DX5 A;  1TPL A;  2AAT A;  3AEN B;  2XBN A;  3ASA A;  3KE3 A;  3N5M A;  2AEV A;  3HMU A;  3PIU A;  3A9Y A;  2RFV A;  2YOB A;  4Y0H A;  2VMX A;  2VMV A;  4WYF A;  5G09 A;  3LVJ A;  5EIG B;  3NU8 A;  1DGE A;  4GRX A;  1WYU A;  3FTB A;  3E2Z A;  5C6U A;  1PFF A;  4FL0 A;  3H9X A;  4WYG A;  3ASB A;  3TFT A;  2EYQ A;  1V2F A;  5IWQ A;  3FDB A;  1JG8 A;  4PFN A;  2D66 A;  3ACZ A;  3AOV A;  3D6K A;  3BS8 A;  4OC9 A;  3PAA A;  1M32 A;  3LY1 A;  4R5Z A;  1CQ8 A;  3DRD A;  1WKG A;  1SZU A;  4XJP A;  2ZC0 A;  1ARH A;  1PMO A;  2DGK A;  3QHX A;  4XJM A;  2WB6 A;  2HP1 A;  1MAQ A;  2VIB A;  2VI8 A;  4IYO B;  4ZAS A;  3HBX A;  5M4D A;  5KTB A;  5E5I A;  3DOD A;  1IUG A;  4JEW A;  3FVX A;  3P6K A;  2PO3 A;  2BI1 A;  5JAY A;  1BKG A;  1SVV A;  3UE8 A;  2EO5 A;  2Z20 A;  1O61 A;  8AAT A;  1YOO A;  5J8Q A;  3GBX A;  4HVK A;  3PDB A;  2BKW A;  1X29 A;  2CTZ A;  1AAM A;  4IW7 A;  1AMQ A;  4IXS A;  2YHK A;  4J8L A;  1WKH A;  4MQR A;  1CL1 A;  4BHD A;  2AY7 A;  4LNM A;  1AJS B;  4M2M A;  4F5L A;  1QJ3 A;  3FDD A;  4ADE A;  4BA5 A;  3LVM A;  3PPL A;  1AHE A;  1WYT A;  3G0T A;  1GD9 A;  4K05 A;  3F6T A;  3G7Q A;  1AIB A;  1DJ9 A;  2D5Y A;  1AKC A;  2BI2 A;  1EQB A;  2AY3 A;  3TQX A;  2W7I A;  2YRI A;  1I43 A;  1C7N A;  4OTL A;  4F5F A;  4F5G A;  2BWN A;  1BJ4 A;  1GDE A;  3ATH A;  4PVF A;  1GC4 A;  4WB0 B;  1OXO A;  3JWB A;  2BWP A;  2AEU A;  1GC2 A;  4Y0D A;  5D5S A;  3AEM A;  4MQP A;  1MGV A;  1GEY A;  3RBL A;  1RVY A;  1P3W A;  4R2N A;  2X3L A;  3DXV A;  3DR4 A;  4E1O A;  1XI9 A;  3F9T A;  1AHX A;  1GBN A;  1TAT A;  4RIT A;  3NU7 A;  3PJ0 A;  1LKC A;  4M2J A;  2W7F A;  4XQ2 A;  3VK3 A;  3CQ4 A;  2KFP A;  4F5M A;  2YKV A;  1JF9 A;  5G0A A;  2BWO A;  1B4X A;  3HT4 A;  1UU1 A;  1PG8 A;  4IXO A;  3QPG A;  4P7Y A;  4U1T A;  5HHY A;  4CBS A;  3M5U A;  1WST A;  2ZY5 A;  5M49 A;  4ZLV A;  3N4X A;  1BJW A;  4GE9 A;  3W1I A;  2C7T A;  4OYT A;  4EB5 A;  4E3R A;  1BQA A;  2V1P A;  2C81 A;  1OXP A;  1IX8 A;  2WK8 A;  3I4J A;  2ZSL A;  1YJY A;  1E5E A;  4E77 A;  4MSO A;  1G4V A;  4EU1 A;  1S09 A;  1D7V A;  3EUC A;  1YIY A;  1ASC A;  1ARG A;  1C7O A;  1LW4 A;  1M0N A;  2CJG A;  3E6G A;  3NYT A;  2YCT A;  1GC0 A;  3HVY A;  3PGY A;  3LG0 A;  2W8W A;  1TAR A;  3LV2 A;  2G7J A;  2Z1Z A;  2Q7W A;  5FT5 A;  4L0O A;  2ZYJ A;  3BWO A;  3T32 A;  5AX8 A;  2HUF A;  3NYS A;  4RIZ A;  4HF8 A;  3JWA A;  3GZD A;  5F9S A;  1W7L A;  1ARS A;  2QSR A;  2CAN A;  2VIA A;  4WBT A;  1Z7D A;  3A2B A;  2JJH A;  3B1C A;  3FVS A;  3WKR A;  1MDX A;  3RQ1 A;  3RCH B;  5DJ1 A;  4BMK A;  1DGD A;  3E2F A;  1ASD A;  1KL2 A;  2E7U A;  4Q31 A;  3GET A;  2W7G A;  4DQ6 A;  3FFH A;  2VMS A;  1MLY A;  1MDO A;  1ZOD A;  3G8M A;  1MAP A;  3I5T A;  2OKK A;  1I48 A;  3EZ1 A;  4OMA A;  1BJO B;  2D63 A;  5EQC A;  3WCN A;  3R4T A;  1D7S A;  4WYE A;  1LS3 A;  1N31 A;  3N7N A;  2Z9V A;  3AEJ C;  5LH9 A;  4IX8 A;  4XJO A;  2HOX A;  4TMR A;  1LK9 A;  4W1W A;  2R5E A;  3GZC A;  1FC4 A;  2ZUK A;  3QN6 A;  3RUY A;  1IX7 A;  2BYL A;  1IX6 A;  3LVK A;  4KAM A;  3N4R A;  4ZM3 A;  2YRR A;  2BIG A;  2D7Y A;  5FT8 A;  1W7M A;  3PD6 A;  2DGM A;  4ATP A;  2YKX A;  2EZ2 A;  4A72 A;  4UQV A;  1GCK A;  3IF2 A;  3USF A;  1ASL A;  1O69 A;  1S07 A;  4GSA A;  1TOK A;  3FVU A;  4CBR A;  2VMT A;  2ZJG A;  1KMJ A;  4MY5 A;  2HOY A;  1S06 A;  1OHY A;  3GZD C;  2QB3 A;  1AY4 A;  3AEN A;  4XAU A;  2CFB A;  4U2H A;  3AEL A;  4H51 A;  1B9H A;  2YKY A;  4MGR A;  3LWS A;  4W91 A;  2VGZ A;  2E7J A;  1DTY A;  5TF5 A;  4N0B A;  1C4K A;  5EIG A;  1U08 A;  4ZM4 A;  2OGE A;  4A6U A;  4LC3 A;  1M6S A;  4ZSY A;  1D2F A;  4F4E A;  3CAI A;  5I92 A;  2D65 A;  3ZRP A;  4ADC A;  2VMU A;  1AHG A;  3NDN A;  3R9A A;  3FZ6 A;  1B9I A;  1AAW A;  5EAV A;  3AEM C;  2BI5 A;  3FZ8 A;  1JS6 A;  2CIN A;  3MAF B;  4ZDP A;  3WLX A;  2QBT A;  4WXB A;  4ATQ A;  1AJR A;  2PB2 A;  2Z61 A;  2DKJ A;  3AEJ A;  3FQA A;  3QI6 A;  4IYO A;  4W1X A;  1ZOB A;  3NNK A;  5M46 A;  4DGT A;  1RV3 A;  2VMZ A;  3ISL A;  3GJU A;  1X2A A;  1I29 A;  3DC1 A;  3WGC A;  1BQD A;  4K2I A;  1YAA A;  1KL1 A;  3CQ5 A;  4KYO A;  3PDB B;  2VMO A;  2D61 A;  3VAX A;  4MKK A;  3NX3 A;  3FKD A;  2W8T A;  2ZY2 A;  1CQ6 A;  3RI6 A;  4UHN A;  2C44 A;  2JJE A;  2R5C A;  4JE5 D;  4JF1 A;  1YJZ A;  1IAY A;  1XEY A;  1TOI A;  1ASA A;  1M0Q A;  3K28 A;  3DZZ A;  4MKJ A;  1W7N A;  4OBU A;  4ZWV A;  3NUB A;  1QIR A;  2Z9X A;  3L44 A;  3VP6 A;  2A1V A;  2VGT A;  4H63 Q;  3BCA A;  4Y0I A;  2BHX A;  4F5J A;  2O1B A;  1OAT A;  2VLH A;  3MBB A;  2TPL A;  4RAE A;  4ITG A;  1FG7 A;  5E3K A;  2OAT A;  1ELU A;  3K7Y A;  5E4Z A;  1C9C A;  1BT4 A;  1GC3 A;  3BB8 A;  3W1J A;  3WY7 A;  1SFF A;  2VLF A;  1IVR A;  3K40 A;  4LNL A;  2OKJ A;  4B9B A;  4BA4 A;  1SF2 A;  2D7Z A;  5EAA A;  1QJ5 A;  4A0R A;  4RM1 A;  2W7H A;  2GQN A;  3MC6 C;  1D7U A;  4OT8 A;  3WGB A;  2R2N A;  3HLM A;  4K2B A;  3DU4 A;  2FKI A;  1Z3Z A;  2FN6 A;  2Z1Y A;  3WX9 A;  2FYF A;  2BI3 A;  3AEO A;  3N75 A;  1M4N A;  1V2D A;  1AIA A;  1LC5 A;  1ZC9 A;  3E9K A;  3MKJ A;  1N8P A;  1UKJ A;  1WYV A;  2OGA A;  4J5U A;  1AY5 A;  2R0T A;  2VGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...