3WXBA

Crystal structure of nadph bound carbonyl reductase from chicken fatty liver
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
269
structure length
269
Chain Sequence
SSGLVPRGSHMGELRVRSVLVTGANRGIGLGFVQHLLALSNPPEWVFATCRDPKGQRAQELQKLASKHPNLVIVPLEVTDPASIKAAAASVGERLKGSGLNLLINNAGIARANTIDNETLKDMSEVYTTNTIAPLLLSQAFLPMLKKAAQENPGSGLSCSKAAIINISSTAGSIQDLYLWQYGQALSYRCSKAALNMLTRCQSMGYREHGIFCVALHPGWVKTDMGGTLEDKSRVTVDESVGGMLKVLSNLSEKDSGAFLNWEGKVMAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel NAD(P)H-dependent carbonyl reductase specifically expressed in the thyroidectomized chicken fatty liver: catalytic properties and crystal structure.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase activator
molecule keywords Uncharacterized protein
total genus 88
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wxbA00
3H3JA 1QSGA 3PHGA 5DBFA 4YRAA 3VKUA 4ZD6A 3OEWA 3WJAA 3PQEA 2W2KA 5BQFA 3JQBA 1C3VA 1BXKA 3O03A 3ADPA 3VVBA 3D4NA 1K0UA 2X0RA 1HYGA 4FIZA 1EE2A 1Z7EA 1BHSA 1K5HA 4L4RA 4BGVA 4FS3A 3WSWA 1YJQA 1VSUA 2Q4BA 2X0JA 3DHEA 1NQAO 4TSKA 5DF1A 4J7UA 3ZWMA 1T1SA 5COBA 1R4MA 1DIRA 1ZZEA 3WFJA 4GAEA 4IY1A 3OICA 1HSZA 4ZU3A 4R41A 3RC7A 2X22A 4JX8A 4J6FA 3GHYA 3TL2A 1UP6A 2Q1SA 1ENYA 3UCXA 1E6UA 3IAHA 1WNTA 5T6BA 3DBLA 1FK8A 4CQMB 4YCAA 5COQA 3LC2O 4M89A 4MP8A 5I7FA 1E6EA 3WMWA 3WYBA 4FW8A 4IDAA 4E33A 2Y1CA 2ZIZA 3L6DA 1I30A 1E3SA 4E12A 3P2OA 1XU7A 4YAJA 1Q0LA 1KEVA 1EZ4A 3H5NA 2Y1GA 4U0KA 4I1IA 1XIVA 5ER9A 2BGMA 1KY4A 3D4PA 3ONEA 3GUCA 5G0UA 4Z0TA 4KUHA 5TT0A 2AW5A 4I5FA 3R0IA 3PI7A 1TXGA 3NX4A 3PYXA 3FD8A 3FWNA 5AXBA 3RBXA 4MIOA 4L76A 2FSVA 4BO4A 1GU7A 1S7CA 3RD5A 4CL3A 1IULA 2X0NA 4RPKA 2BMAA 5L4LA 4CMBA 4J9VA 4BMSA 1JDJA 4XQ9A 1GUFA 4AJ2A 4B4VA 4BO6A 4B4OA 1KYQA 1EMDA 1HWYA 3ZV3A 2O48X 1VLLA 2ZB4A 1WMAA 1Q7BA 2NTVA 3O8QB 4MIEA 1LI4A 5DOVA 4ALNA 1Q7GA 4TROA 4I5GA 3EC7A 3QSGA 4NFYA 4XQCA 3AFMA 1N92A 1PWXA 4CMEC 1T2EA 2FSSA 1M6HA 3TOXA 5HM8A 1ZK1A 4Y6SA 1K3TA 5JAQA 2SCUA 4O6VA 4RCVA 5BNTA 4IBOA 5G0VA 1F8FA 2Q1TA 1BSVA 5I7EA 5DBGA 4INAA 1M75A 2O4UX 4W6ZA 2Y0DA 3INTA 3MOIA 4QX6A 3E8XA 3V8BA 4BNIA 1HE3A 3BXXA 4J0FA 3WXBA 2EXXA 3DMTA 2TMDA 4CR6A 4YT5A 4DBZA 1F06A 4R5HA 3V5NA 4CUZA 2IYOA 4EUFA 3DWFA 1DO8A 1V3VA 2VWPA 4YACA 3PWZA 1LSJA 3GFGA 2YHIA 4HFRA 2OP1A 4BO2A 1U4SA 4FFMA 5ILOA 3NUGA 2AXQA 2ZB3A 1M2WA 1JLLA 4FSHA 3PDUA 4XJSA 3JYPA 1I3KA 3P2YA 4XR4A 4EW6A 1UXKA 1ZFNA 2R00A 5B37A 5JAZA 3VVCA 2LDBA 4RPJA 4UUMA 2AEMA 4JK3A 5L40A 4GI2A 3T7CA 2G76A 3E9NA 2GASA 1H9AA 1HE5A 3FPLA 1P0CA 4E5YA 1LUAA 3CE6A 2HU2A 5B1YA 4CLOA 4E5PA 2O7SA 5BNFA 2EF1A 5IZCA 1H2BA 4ZQFA 1IB6A 4MVJH 3KEQA 3K92A 3KLPX 4BO1A 1PR9A 2Q50A 1SBYA 1PGPA 3U3XA 1JU9A 4CL8A 3JSAA 2C59A 1OC4A 4IJWA 1PJQA 4Z0HO 3TZCA 2YYYA 4JBIA 1U1IA 4I9UA 1R0SA 3ONDA 5HS6A 4Q3NA 5KJ1A 3I6QA 2Z1MA 3K8ZA 3WGQA 1ZSYA 2VUTA 1DFIA 1JTVA 4XGNA 1F17A 1B8VA 1GADO 3GT0A 3CZRA 1M6WA 3NJ8A 4FB5A 5IFLA 4KOAA 4HX5A 2ZJ1A 4MVJG 1U3VA 2E82A 5JC8A 2YW9A 1AUPA 4PRKA 1C0LA 1O9BA 5H81A 1U3WA 2FY8A 4BV9A 4CPDA 4BMNA 2PV7A 5JDCA 1XU9A 4AJJA 3OM9A 4E4YA 4F45A 4FJ2A 4WCFB 4XB2A 3OHSX 3UUWA 2X58A 4YJFA 4PIVA 4S3MA 4WLEA 1UXJA 3GRKA 3INGA 2CUKA 1P44A 1QYVA 3U4HA 1KC1A 2O3SA 4BNHA 5KWEA 2E49A 1KIFA 3NDRA 3ITDA 4DBVO 4RPHA 2BGLA 4PG4A 4YDRA 4E13A 3ZHZA 1ZNQO 1YL7A 2PR2A 1Z45A 5T8KA 4O5OA 1HETA 1CF2O 3ZU3A 1KEPA 3LZ6A 3HHPA 4KDFA 1RM0A 2NU9A 4D45A 4OQZA 1P1KA 2JL1A 3ZZNA 3LQFA 1KVTA 2IXBA 5BSGA 4MVJF 4KUEA 2NU8A 4D42A 1I5RA 2Y67A 5TLSA 2X9VA 2IODA 1PEDA 4NK5A 4QQRA 3T7EA 2IZ0A 3DZIA 2RH8A 2H63A 3CSDA 4K9DA 1TVEA 2CVOA 3K9QO 1EDOA 1LQTA 3QVTA 1YB1A 3TZ6A 1U5AA 2PWZA 3MJSA 4JIGA 2WD8A 4MP6A 3VZRA 4CLRA 3SX2A 5AYVA 5I9NA 2BFAA 2WD7A 1NQTA 1DAOA 1U7HA 3ZHXA 1RM3A 2GCGA 1EVJA 2RBEA 5T64A 3ENNA 4H16A 3KRTA 3G17A 3SVTA 1Z6ZA 4GBJA 3MWEB 1XCBA 1LC3A 5ICSA 5LCXA 1E3WA 1Y9AA 2TMGA 3ICCA 3W4JA 3OA0A 4AG3A 2GNAA 2NU7A 1MC4A 1MXHA 4Z6KA 2CSUA 4B4WA 3ROQA 5AOVA 1HE2A 3IIEA 4FN4A 4CLRB 2EP7A 5G4KA 4YXFA 3V2UA 3LF1A 3L9WA 2BD0A 4EEXA 3FNFA 4QXMA 4MVJD 3WQQA 1B26A 1F0YA 1HTBA 2GN8A 4CMGA 4BL5A 4DA9A 3C85A 4B7XA 1HZZA 5ITVA 2EW8A 4CM3A 1E7YA 3ZHBA 3ZV4A 3PZRA 3HDYA 1LDMA 4YAIA 4U0JA 1G6KA 1TI7A 5F1OA 5K6AA 3SJ7A 1HYEA 5HA5A 4TRRA 3F1KA 1ENOA 1EVZA 3NTRA 3CINA 2Q1WA 1E6WA 3VTZA 1EK6A 1ONNA 2GRAA 3EZYA 5KVCA 2HK9A 4XDYA 2QRLA 1LLCA 1D7OA 2O23A 4JQCA 3FTNA 2J8ZA 3GDOA 1GZ3A 4UULA 1B15A 3FSRA 4ALMA 4J4HA 4OXKA 4D3SA 4YRBA 1CETA 1C1XB 3EW7A 2DUWA 1UAGA 4WPGA 5DP1A 5FYDA 2PK3A 3UXYA 4BO3A 3JQEA 1XLTA 1YL6A 1MFPA 5F5NA 4IDGA 1IHYA 4PLFA 5JMWA 1ML3A 1P45A 4UVIA 5DT9A 5GY7A 3AM5A 3WS7A 3RJ5A 4AJLA 2VRBA 3NDIA 1Y5RA 2VHVA 1GZ6A 4QO7A 4R68A 2OHXA 2DU8A 1T2AA 2Y1OA 1D1TA 3UFXA 4BKUA 3IUSA 1HL3A 2C2XA 3OEYA 4CJXA 4BGEA 5EINA 5CEEA 1WDKA 4MDHA 3G0OA 3PGXA 4EBFA 5DDIP 1FDTA 4P8RA 4ALIA 1GQYA 3ZDFA 4DMMA 3FBTA 3H5AA 5IXSA 1QG6A 1DXYA 4JCOA 4URFA 3DHYA 4D7AA 4E2XA 1ZK0A 4UAGA 3IP3A 1SOWA 1R4NA 3COSA 5IAAA 1NQ5A 1GDHA 3F47A 2W2LD 2I3GA 1VC2A 4J4BA 2VTEA 4FBGA 1YONA 2O3UA 2NVUB 2DQ4A 2P9GA 4B3IA 1NBOA 5FF9A 2YV2A 5FFFA 2CVQA 5F3RA 1V6AA 5CEFA 1KVSA 1J4AA 3OP4A 4IDEA 4NH4A 3I23A 3RASA 2DBVO 1Y6JA 2O4CA 4MO2A 3MJCA 1GQ2A 3BTUA 2PZKA 2HRBA 4GSLA 2JAPA 1I01A 3E18A 2D8AA 3ULKA 4WUVA 4CM9D 4JBHA 4XCVA 2XOXA 4CMIB 3JQAD 1UAYA 2VUUA 2ZTVA 5K6AC 2IZ1A 3K2BA 3QWAA 1LEHA 3RIHA 2AMFA 5ENVA 3ZWYA 4NQZA 1ZBQA 1IOLA 1HDGO 4OQYA 5GZ6A 2O3TA 3D64A 4YPOA 5L7YA 5L7WA 3ROKA 1Z74A 2NVUA 5L9AA 1QLJA 3T4EA 1I3NA 1DHRA 4PG5A 5A3VA 1SEPA 2EKQA 3WGTA 3DBHA 4BKRA 4DPLA 3LT4A 3E03A 1H6AA 4OXYA 4NBUA 3ZW8A 4BVAA 2OUIA 1SNYA 3LT1A 3QQPA 3A1NA 4NI5A 4IXWA 3BMOB 3L4BC 3PJGA 1VKNA 5TRTA 3RC2A 2CMDA 1ULSA 2HMUA 1B7GO 4N5MA 2UUPA 5JCJA 2O7QA 3C24A 3VPGA 1LRLA 1VSVA 2DLDA 3HN7A 4XR9A 5JAMA 4PLTA 2E48A 3HB5X 5IJZA 3W6ZA 1YL5A 4Q39A 2NUAA 1MB4A 5F1PA 1GPDG 1P3DA 4W9NC 4WEQA 3TN7A 4A27A 4HFMA 4ZQBA 1X7HA 4DUPA 4J1QA 1XR3A 3TRIA 4XJTA 4B8WA 2J3HA 4RVDA 2P2SA 4WECA 3OJOA 3M1AA 4ILKA 2AQIA 2CD9A 2NVWA 4J90A 1XSEA 3MJVA 4PG6A 5LDHA 4XKJA 3WX0A 4WLOA 3ANNA 5CEJA 1OC2A 3SLGA 4OSOA 3H2SA 4YJHA 4HNGA 5JDCC 1NWHA 4MVJP 3PQDA 4IIVA 3U09A 4XIYA 4DLBA 1U8XX 2OZPA 3AWDA 1NNUA 3JQAB 3KYCB 2EERA 3CKYA 1MGOA 4NFHA 3GEMA 3MCVA 3Q11A 3I4FA 2B4TO 3JV7A 3JYLA 5CG2A 1MG0A 3WNQA 3Q9NA 2ZYGA 3KB6A 1YS4A 4LVUA 4B79A 4YEDA 2D0IA 2G82A 2A92A 3RCBA 4W9NA 1A4IA 3LVFO 1Q0HA 4XRGA 3E5MA 3JQ9C 3MTJA 1V9LA 3X2EA 4I5EA 3KOUA 3E6AA 4J1NA 1ARZA 1B16A 2B5VA 2J3IA 2I6TA 4F6LA 1G0OA 2D59A 1NM5A 3H65A 3HDJA 3IL2A 1UDAA 4PLWA 5U1PA 4DL9A 4ZN6A 5JCXA 2IEDA 3D4OA 1SAYA 3TFOA 3B1KA 6ADHA 2PGDA 3JQFC 1XYGA 1DIHA 2P5UA 4R3WA 2QG4A 3UVEA 3OETA 5ENDA 3IP1A 3TZHA 4E5NA 4RDIA 1KERA 1B14A 5CPBA 3UKOA 3EVNA 1HF3A 1U2GA 5A04A 2UYYA 2PLAA 1GD1O 4R5MA 4M54A 3TQHA 4RVUA 1QORA 1GCOA 1PL6A 1DC6A 4FFPA 4R1NA 3W8DA 2PZMA 3ZHYA 4PG7A 5A4DA 1UP4A 3F46A 1A5ZA 4UVHA 1T2DA 4FCCA 3OQ6A 3WDSA 1ORRA 3MEQA 4ZRNA 1JVSA 5JYEA 1NVTA 3KXDA 1IHXA 4UVGA 1HLDA 2NTNA 3QWBA 1DOHA 3KYDB 3NTOA 2NADA 1X0XA 4A03A 4NU6A 4CQLA 1X1TA 3ASUA 3BYZA 3ICPA 4J1SA 2X5KO 4YWJA 4OM8A 1LDGA 4GGPA 4YJGB 2BF7A 3EDMA 4WCFC 3UOGA 3AJRA 1P0FA 4O1MA 2NU6A 4S1VA 4E31A 1C1DB 4XQEA 1E5LA 4DIFA 4D0SA 1XQ6A 2GD1O 2HJRA 1JAYA 3JQ6A 2RIRA 2VHWA 3AY6A 5TNXA 4QTZA 2O3RA 2Q46A 4ND5A 4E3ZA 4RPLA 1ZCJA 1WMBA 1TT7A 3PFFA 1AXGA 3MJ4A 1P1JA 3DAFA 1SEVA 4Y98A 2XXJA 2AQHA 1FF9A 1GR0A 1X15A 4ZQEA 4E6PA 1J6UA 3GOHA 2WJPA 1JW9B 2X0IA 1HDRA 4P4NA 5CG1A 4PG8A 1I8TA 4FFOA 2EKPA 2VQ3A 4CM7A 3E9MA 3U9LA 5FEUA 1O94A 5C7IO 2VOJA 2QYSA 3RC9A 4A73A 3BAZA 4CM8B 1SOVA 3VC7A 3IS3A 3M1LA 4MIYA 2FOIA 5DP2A 3ZCXA 4D3FA 3L4SO 3HQ4O 1L7EA 4N5LA 4W7IA 2FPPA 2FR1A 2ZATA 1X0VA 1E1LA 3EVTA 3VHRA 2V6GA 2I65A 2RAFA 4IGFA 1NHWA 3AUSA 3ZGYA 4MVJM 1RWBA 1UZLA 1ZW1A 3EK2A 4TWRA 4Z9XA 2Y68A 3RFXA 4IJVA 5AQ1A 1EFLA 5JBIA 1I2CA 1P1RA 5H83A 1I2BA 3DR3A 4IMPA 2DKNA 3GN1A 2PA3A 4BUCA 2XAAA 4JBGA 1SMKA 1JKJA 3D0OA 3WQSB 5CDUA 1D3AA 2B4QA 5JE8A 4RF4A 4D41A 2BI8A 2JFFA 1WVGA 4YJDA 5ADHA 1BW9A 5ES3A 5EPOA 3C1TA 4E2ZA 2D1YA 1IYZA 4DPMA 1B8UA 4GSKA 1PZHA 3UICA 3RJ9A 2X7HA 3KBOA 5FI3A 1MA0A 1ADFA 2HJSA 4IDFA 4WLVA 3FR7A 3K5PA 1LC0A 4H15A 3G49A 5EJ2A 1ISHA 4O59O 1SC6A 2WEKA 1QMGA 3IKTA 3KZVA 3BZUA 4XYGA 2I3AA 2R00C 1DRVA 1Y8RA 5LC1A 3K2EA 1P1HA 3ONFA 3LYLA 5B4VA 5KJ6A 2OOSA 4J3FA 3DTTA 2VWQA 4E21A 3KEOA 4DPKA 3I5MA 3H3FA 1T1RA 3KTDA 1TB4A 1DDOA 5EERA 2CY0A 4FFNA 1YO6A 4WNIA 1U4OA 3H9QA 1UR5A 3EAGA 2HQ1A 3HN2A 1ZMTA 3GMSA 1GYQA 5JW6A 3O8QA 4KQXA 4FPXA 1HDOA 1PS0A 2HCTA 2B5WA 5TS3A 2W98A 1QR6A 4RDHA 3W4IA 3U4IA 2AQ8A 1LDEA 4E32A 2UV8A 1N7GA 3DZFA 3WGIA 2D5AA 3D3EA 3E9QA 2DTEA 2XF8A 4ND1A 3GHHA 3OIFA 1KOLA 3V1UA 4LN1A 1I2ZA 2NV6A 2Z1NA 4OOFA 3NTQA 3PHIA 1GEGA 5IG2A 3DBRB 4FOOA 2WYWA 4CV3A 1Y7TA 1VKOA 2V6FA 4RVSA 2DTXA 2VTDA 3DMTC 1BRMA 2VZ0A 1P1FA 4XEHA 1BXGA 1DRWA 1F8GA 4Z3DA 1QLHA 4RF5A 4RVGA 3UF0A 4CM1A 2X9GA 1HLPA 3WNVA 1GL3A 1QYXA 2PKRA 4NZ9A 4RZIA 1K6JA 3CTMA 2HAEA 4IJUA 5JMPA 4DQVA 3QVXA 4EGFA 2BLLA 3B1FA 4WLFA 1JKFA 1AHHA 3SXPA 3EHEA 5AXDA 1U3TA 3VPFA 3RROA 5G0TA 4H7PA 4KDEA 2EGGA 1GEEA 1X7DA 2PFGA 3WIDA 2VT3A 5L45A 1U8FO 1KBZA 5TQVA 4GVLA 4UREA 1YXMA 1NPDA 4J2HA 3ZH2A 3Q2KA 4A7PA 3GA0A 5JLAA 1OOEA 3K96A 4PN3A 5KKCA 4K6FA 3TNLA 1VI2A 4IINA 4DREA 3VZSA 1LDBA 3GFBA 4M87A 3WGHA 1LRJA 4LMPA 2EIHA 4L73A 3JQCA 3RU9A 2Q2VA 3CPSA 3JYOA 3V2GA 3IQDB 3N7UA 1P74A 2DC1A 1CDOA 4AJ4A 3EZLA 5TT1A 5JY6A 4A26A 1RPNA 2WE7A 1ID1A 3CXRA 4JGBA 4DGSA 4GMFA 1ZMOA 2YZ7A 3ZU2A 3PWKA 2UUOA 3Q6IA 5I9MA 1NAIA 3FR8A 4J4TA 1YQXA 1PR3A 1J49A 3I9MA 4ZQHA 1R4MB 2UVDA 3JQ9A 2JHFA 1SO8A 2W8ZA 5GZ1A 4U7WA 4DLLA 1LSOA 2QQ5A 3WG9A 5HTOA 5EIOA 3SLKA 2OL4A 4CMJA 3DMYA 1LA2A 1FDUA 4GPD1 3C1OA 1RJWA 1KC3A 3GGGA 2D4AA 1GCUA 1SB9A 3EUWA 4NJMB 4RV9A 3F5QA 1Y8RB 1AGNA 1PU2A 1YOVA 4L4XA 1R4NB 1O5IA 1N7HA 1IZ0A 3PPIA 4OYRA 3KM0A 3FHLA 1DSSG 5F1KA 4Y9DA 3WYEA 3ZWPA 4L9RA 5BSHA 1ZK4A 1Z73A 3JQGA 5B12A 2DBRA 2DAPA 3FN4A 1TEHA 5CP8A 4DVJA 3PHHA 4TKMA 2VCYA 2VRCA 3C1AA 4CM4B 1YWGO 4FJ1A 1T4BA 4Q3AA 2B37A 4M1QA 4Z9FA 2D3TA 1ZVMA 2YDXA 2ZJ0A 1CERA 2PZLA 4HNHA 1L1FA 5A5EA 4BNMA 4JJGA 4W82A 2H6EA 4Q3DA 2ZK7A 2VNSA 3ROPA 1HKUA 2IXAA 1T25A 4RO0A 4E2WA 4BNTA 1C1DA 3ZV5A 3JD2A 3DB2A 2VHYA 1M67A 3ABIA 5KOIA 5CPFA 4QECA 5FWNA 1IPFA 3KLMX 2FZWA 3B20A 2YFQA 3BMNA 4IMRA 3LC7O 1ZJYA 3KYBA 3NT2A 3A9WA 1YB4A 3INRA 2VT2A 3GZNA 2C20A 3N74A 5JAIA 3GEGA 4U6QA 4Z0PA 1EUCA 2GO1A 2Y1EA 5DBIA 4UUOA 3E1KA 4E2YA 3DHNA 2BFOA 1NR1A 3V2HA 5EQFA 2QHXA 1LU9A 3OH8A 3WGGA 4TZKA 3GK3A 3OECA 4TVBA 4GVXA 5JS6A 4GX5A 2CF6A 1X14A 2FN7A 3WGZA 1R16A 4DQXA 2X86A 1WAMA 4IZIA 2F00A 3GG9A 4J91A 1MFZA 5AXCA 3UCFA 3Q0EA 1BWSA 3AUUA 1LLDA 1NX6A 8LDHA 2B36A 3C7CB 3RBVA 1L7DA 1ZO8A 1GPJA 2JJYA 2R6JA 3L6OO 3JQFA 3RUHA 3NGXA 4L75A 1E1KA 4GKBA 4BS9A 3PYLA 2Q2QA 4B7CA 5BNIA 1HXHA 2JD0A 1PX0A 1DIAA 2J3KA 1UXGA 1K6XA 2IRWA 2O2SA 3H8VA 5JXWA 2OO5A 3D5QA 3X2FA 1E3WB 3ZWAA 1VPDA 1BXZA 2AG5A 3FWZA 4D43A 4IZHA 4YB8A 3I9JA 3S55A 4OKNA 3ZN2A 1VL0A 2FZEA 2F1KA 2HSDA 1P9LA 2WWRA 3BIOA 4ND2A 4FOSA 4PFJA 1ZJZA 5EL0A 3IOYA 1IZ9A 4L74A 4CLOB 3DL2A 3Q1LA 3DOJA 3KV3O 4XYBA 4O0LA 1A4UA 4KZPA 4BNNA 2X1HA 2Q49A 3PJFA 5JFOA 1OZAA 3QE3A 1HDYA 5JPIA 2E6UX 5L4NA 1I33A 4J16A 4BIIA 1ZEJA 1H6DA 3LT2A 1NTOA 2EP5A 1E7RA 1T4DA 2GDZA 2CDBA 1MP0A 5I8WA 3PRJA 4CMKA 2ZYAA 3BHJA 3E5RA 4DXHA 5JO0A 2QRJA 3DOOA 2C5EA 3FCOA 4R69A 3S2FA 3WQRA 2AE2A 3GRPA 5K9ZA 3W4KA 3ZWOA 3A28A 4R1UA 3PTZA 5BSEA 1N2SA 1QKIA 3ON5A 4IQ8A 3IDSA 5A3JA 4YAEA 3GNSA 1H6BA 4BO7A 2B4RO 2NVBA 4FFRA 5IDQA 1C0KA 1WZIA 1R12A 4EDFA 1G0NA 2NNLD 4BO8A 1J5PA 3TF5A 5I7VA 1E3EA 5THKA 4UEJA 2J5QA 5AVOA 5L3ZA 3BHMA 4JROA 3AI2A 2P4HX 1ONOA 2C7GA 3TL3A 4GKVA 4AJEA 4F6CA 3C7DB 3DOCA 4YA6A 3ZWXA 4CLEA 2GPTA 2DTDA 1E7MA 2HMSA 4MKXA 1PZFA 1QV6A 3SC6A 4HY3A 5IN4A 2QZZA 3ZNPA 3JYNA 1FDVA 4YT4A 5KJCA 5I9LA 1BXGB 1E5QA 4EYEA 3VTFA 4RQTA 2DM6A 4HFJA 4TRMA 1YDEA 3QA9A 4Y67A 5HBRA 3D3WA 1HT0A 4BNLA 2ZCVA 1Y81A 4K28A 1PJ2A 3GQVA 4GGOA 1GAEO 1BDBA 5BT9A 4DC1A 1RKXA 3TJRA 5GMOA 4OIMA 5EQDA 3ENKA 4J9UE 1U7TA 1D8AA 3I52A 1LNQA 3F6YA 1CYDA 3QVWA 5TGDA 3RAJA 4WCDA 4JNKA 1UXHA 2QW8A 3RBZA 4H3VA 3F4BA 1I3MA 2AE1A 3WGOA 3CEAA 1KS9A 2I99A 3JQ7A 2HMWA 3PQFA 2BI7A 3H7AA 3QJ5A 4MINA 2P5YA 3QWFA 2YHIB 4KMSA 1H93A 4PLGA 2DBZA 1PS8A 4BO5A 1E3LA 3DFUA 4XWYA 4A2CA 5MDHA 3MTGA 4G81A 4PCVA 3FTPA 3EY4A 2WDZA 5J23A 4MKZA 2OORA 3GLQA 1O8CA 4UEKA 2Z5LA 5A1TA 4BMVA 4FGWA 3AOEA 1R0KA 2JD1A 1FXSA 3DFZA 2CFCA 3HZZA 4QFDA 4WNCA 2HK7A 2NWQA 3OFSA 3DZGA 4HFNA 3STHA 3BHIA 4YRDA 3G1UA 2V6BA 3LF2A 1JWAB 1UJMA 2Q3EA 2DBQA 5F21A 2O3JA 2WYUA 2EEZA 1JA9A 3ETEA 1N1EA 2QIOA 3HNPA 4K1LA 5IN5A 1UUFA 2C2YA 2GGSA 2HDHA 4LVCA 4EZBA 1DIGA 4NDNE 1YKFA 3BMCB 3OJ0A 4D44A 2O2YA 1TA4A 1PGOA 3PJEA 3VDQA 5C7LO 4AJKA 3LDHA 5TJ9A 2BELA 3SEFA 4CV1A 1NVGA 1YOVB 4FC7A 4ITUA 3TDKA 4WCFA 4BB6A 3LT0A 1EFKA 2PZJA 1LLUA 3GAZA 4FR5A 4BO9A 2V7PA 3RQSA 4ZA2A 4BQRA 1V8BA 3OJFA 1A9YA 4KP7A 4RQUA 4ZJUA 3F3SA 3H2ZA 2O50A 2BRUA 2VUSA 5C7OO 1C1XA 5TIIA 3ANLA 3I3OA 4GL4A 1VM6A 3GGOA 1GV1A 4BNVA 1B3RA 4GX1A 2Y1FA 3PGJA 3T4XA 4TRNA 1EUDA 3HG7A 1UZNA 1BGVA 1EQ2A 2ET6A 1EVYA 3I9NA 4UUNA 1EUZA 4J2OA 4XYMA 4IS3A 4BHTA 3GG2A 3PLNA 1XDWA 2FMUA 2IDZA 4OL9A 1OI7A 3PLRA 2NQ8A 5F5LA 1PWZA 2IYPA 4R3NA 3WJ7A 2BKAA 1BDMA 3RVDA 2FHSA 1P77A 4PZEA 2J3JA 4FJ0A 4W99A 3PJDA 1YQGA 1KY5A 5CDGA 3HFSA 3WSVA 2VZ8A 4BNGA 1KVUA 5IZ4A 3TOZA 1A27A 3UW3A 1YRLA 4OJNA 4X54A 3AI1A 2FRDA 4XD2A 2EJVA 3VH4A 1JN0A 4WJZA 2I67A 4IXTA 3C8MA 1W6UA 1ENZA 3MWDB 2GYYA 4NIMA 3RKRA 2A9FA 3QY9A 2P9CA 1DJQA 1R15A 5A5FA 2CVZA 1NP3A 1QP8A 1WLYA 4TRJA 4EJ6A 1PJTA 2OMEA 5A9SA 1DAPA 3GC6A 5L95A 2J5KA 3D3WB 1JWBB 5TF4A 3KO8A 4G65A 3PHLA 4GQAA 1C0PA 3A14A 4IDBA 4OH1A 1YB5A 4MOWA 5IZCC 2Y93A 2WYVA 2A94A 1R6DA 2WTBA 3SC4A 4N54A 1ZK3A 4IS2A 3N58A 1PGQA 3FRJA 5ER6A 1N1GA 5KTKA 1NFQA 3LLVA 1PJSA 1R0LA 1GY8A 1ULUA 2POQX 3I4CA 2EV9A 3BMOA 4LRSB 4ND4A 4HADA 5A06A 5CDSA 1NR7A 3AOEC 4B7UA 2FPIA 4OO3A 2B83A 4YBZA 4II2A 3K73O 3WWZA 5A03A 3OSUA 5U9CA 3ZWVA 2GF2A 1IUKA 4LMRA 4ALJA 4A5OA 4BNUA 2X9NA 3OIDA 4P4GA 4E5MA 1MG5A 3PYMA 1RYDA 5TX7A 4XB1A 4D3DA 2W90A 1WZEA 3KSDO 1BG6A 4R9RA 3S1LA 2HLPA 3EYWA 4NNJA 4EJMA 4RGBA 2AHRA 2Q2WA 3OQBA 1DIBA 2CF5A 3DZKA 1NYTA 3RUCA 2DUUA 4CMCA 2Q99A 1HRDA 5DOZA 4Z3KA 2PH3A 3EGOA 3AUTA 1HDZA 2HUNA 3ZV6A 4BNYA 2BFPA 3GEDA 2OBYA 5BSFA 1XELA 2G17A 3PDJA 5IXYA 2UAGA 4LCJA 2H9IA 3HDHA 3DTYA 2JCYA 2NM0A 2NQTA 3WLFA 1JKIA 2GN4A 4BNXA 1BW9B 1T26A 1YBVA 4YTEA 5HRUA 3O26A 2V65A 3CZMA 5KJFA 3AU9A 3OA2A 3GZ4A 4R1TA 3OJEA 4N18A 4GLOA 3RWBA 3PIDA 2JCXA 4MJLA 3HE3A 4Q3EA 4HBGA 4NBWA 5THQA 5TJHA 4WLNA 2HMTA 5G4KB 1I36A 4QEDA 3VPXA 1K2WA 1BVUA 6LDHA 4UVDA 3H6KA 2RHRA 4RL6A 1NASA 4M55A 2GZ1A 4E5KA 3PEFA 2Y99A 9LDBA 3WWYA 1LSSA 4EJ0A 5ILGA 3VZPA 1X13A 4DTIA 1MXFA 1B3BA 5G4LA 1O0SA 5IDXA 4OHUA 3ZWWA 2B0JA 3G79A 3AM3A 1HE4A 3HFGA 5DZSA 3KHUA 1KEUA 4WLUA 8ADHA 5HS4A 3IUPA 1A9ZA 3CMMA 1KVRA 3BMNB 2IEBA 2ZB7A 1H2HA 1VRWA 1EDZA 1AHIA 4LK3A 4GLLA 4P22A 4P4LA 3L9XA 3BMQB 2DFDA 4A0SA 4BKQA 5BR7A 3NKLA 3GUYA 4QUKA 1QYCA 1SPXA 1YBMA 1KVQA 4IDDA 2ZCUA 3WBFA 3WICA 4DC0A 2Q4EA 3ZI0A 1DRUA 1T2FA 1CRWG 1UH5A 1YGYA 4LSWA 1DLJA 1X1EA 3V1TC 3P19A 1AN9A 1PTJA 3D1LA 3KVOA 2UDPA 3RUDA 2AEFA 3NJ4A 4HUJA 1Y1PA 1VL8A 1U5CA 4A10A 3DAPA 4JXKA 4CODB 1WDMA 5CAEA 3JTMA 3OMLA 2P91A 3UH1A 1NPYA 4IGEA 1TT5B 4I08A 4KWIA 2I9PA 3E48A 3LLSA 4BKOA 1CEQA 5DCYA 2EW2A 4AL4A 4KWHA 3ADOA 4EITA 1YE3A 4PGFA 3DBVO 4CM5A 2XXBA 3DO5A 4ALKA 4GX0A 2ILTA 3GPIA 3DBRA 1BTOA 1SZJG 5KVQA 5JSFA 3ETGA 2GN6A 2WSBA 3ZNNA 1OBFO 2C54A 2R2GA 3B1JA 1UDBA 2Z95A 1J0XO 4WASA 1B2LA 2VYVD 1LRKA 1ZSNA 4O63O 4PLCA 4PZCA 1Q7CA 2DVMA 1Q1NA 3L0DA 3NDJA 1E77A 1B8PA 4YT2A 2A35A 5G0SA 1GTMA 4CR8A 3HSKA 1U2DA 2Y66A 3D5TA 1NFFA 3JCZA 4RF2A 3U4DA 2Y05A 1ADCA 2C7VA 3A4VA 2B69A 3M2TA 1NXQA 1XHLA 3DZBA 1QYDA 4XZ3A 1PL7A 1CJCA 4IPTA 2X23A 4DYDA 5JC1A 2YQ5A 4R54A 2VYNA 2OXIA 2EGHA 3ZWBA 4CM6A 3P5SA 3W8EA 1EBFA 1R37A 1IY8A 1ISGA 4M86A 4ZVVA 2PD6A 3RUAA 1UZMA 3RSHA 4I9HA 2Y1DA 1LQUA 4AJNA 4F3YA 4J7CA 3GGPA 3DAGA 4BOYA 3UAGA 4MKRA 3WLEA 3I9LA 4CQMA 5A05A 2VHXA 5I8ZA 3PZBA 4ZHSA 1A7AA 2GZ2A 4AJOA 1XKQA 1D1SA 1PQWA 4FC6A 4WE3A 4I9NA 1E0DA 4IIUA 4II3A 1FMCA 2I66A 3VPSA 4BO0A 3GMDA 4ONEA 1CWUA 3DXFA 3P7MA 4Q3BA 5T8KC 1VJTA 4JP2A 4U5QA 1A7KA 4WK6A 3L6EA 2PGJA 4R16A 1E92A 4KQWA 4PLVA 3AW9A 1XA0A 3GVPA 4ND3A 1UDCA 4I8XA 1V3TA 1W8DA 5EMHA 2VN8A 1ADBA 4D0RA 2JAHA 2H5LA 4N7RA 1O89A 4BKPA 3U5TA 1RM5A 1I3LA 3A06A 4WKGA 1XWFA 5IF3A 3K30A 1YJ8A 4ROSA 4AVYA 5K0ZA 3H9JA 3OF2A 4LSMA 1CQIA 3LU1A 2NSDA 3RU7A 4GWGA 4YVFA 1IPEA 7ADHA 5CDYA 1KEWA 3W8FA 3ZU5A 1Y9EA 4Y8VA 2PGLA 3AI3A 3D7LA 1E7SA 1ISJA 4CMEA 4YT8A 2ZKLA 3AFNA 3O4RA 2IZZA 2WE8A 1E3JA 3WBBA 4M8SA 4L8VA 2XPCA 4OAQA 4WOKA 2WM3A 1NWCA 2GR9A 2BHLA 3KYDA 4ESOA 2YV1A 4IQGA 4BGIA 1MLDA 5T67A 3U62A 2PNFA 2D2IA 3Q3CA 3MJTA 4RF3A 3VH2A 4BB5A 3BA1A 1W73A 4G5HA 4NFSA 5LDGA 3S2IA 3AY3A 2GZ3A 4EUEA 3ROMA 3JQ7B 4BQPA 2ZTMA 1W0CA 3WYCA 4HXYA 1XQ1A 1PS9A 4OSPA 3VZQA 3NEPX 4NJOA 1Q0QA 4PVDA 5A9TA 2DFVA 5KKAA 3DZJA 2V6MA 2PD4A 4BNFA 4NHEA 2YHUA 5G0WA 1Z75A 4RVFA 1M76A 4UUPA 1O6ZA 1E7WA 1PJCA 4LISA 4DWVA 3OBBA 4R1SA 3ETDA 1PJ3A 4B3JA 2AA3A 3QRWA 4OGWA 4TZTA 2CZCA 1D4FA 2X5OA 3KUXA 1EK5A 2HRZA 4C7JA 1Q2XA 4YQYA 4B4UA 3E82A 4CR7A 1P33A 2X8LA 4P38A 4UVEA 1A72A 1S6YA 1N8KA 2OP0A 3MOGA 3GVHA 2QZ9A 3JQBC 4U8GA 4AJHA 3F5SA 1R66A 1ISMA 4JJFA 4JP3A 4D79A 3WFIA 4DIOA 5IDWA 1H9BA 2VYND 3WB9A 1EBUA 5EESA 5C5IA 2W2LA 3QWHA 2O3QA 4CM8A 2QYTA 2PD3A 2FP4A 9LDTA 3CIFA 3DQPA 2VNAA 1T24A 4MVJA 3L4BA 4YQZA 3RUFA 3VAZA 5DCWA 1LTHR 4CMHA 3RKUA 1V35A 1V0JA 4NR0A 4QSMA 1WWKA 3TSCA 3QVSA 1DC5A 3DZHA 4PLYA 3QW2A 1N9GA 4W7HA 3S2GA 4LCEA 4CM9A 3HUDA 4XYLA 1VJ0A 4FDAA 4IJKA 4J43A 4DYVA 1DLIA 1ZH8A 5JY1A 2JKVA 3DBLB 3UN1A 3JYQA 2AQKA 1WW8A 1DEHA 1DFHA 3I6IA 4Q3CA 2YJZA 5U4QA 1PL8A 3PK0A 3Q2IA 3UCEA 1ZKMA 3LSYA 4ID9A 4IUYA 3H9EO 1U28A 2BH9A 2VHZA 4HKTA 1ZXLA 1OFGA 3KSUA 3LK7A 4YYZA 1DJNA 2AG8A 2HK8A 2HKIA 3F4LA 1N9GB 2PTGA 1EQUA 1DC4A 3JQ8A 1ZUD1 5A02A 1MC5A 3C7AA 3NT5A 4C7KA 4E30A 3OIGA 5KVSA 5JYDA 2E4AA 3MJEA 4CMIA 4HP8A 1Y5MA 1PJ4A 3QLJA 3GVCA 2G1UA 1ONPA 1P1IA 4L4SA 4R4JA 1DHTA 4JLWA 2DPGA 5ITWA 3KETA 1VE9A 5T57A 1PQUA 3RFVA 3U0BA 1ZIDA 1ZSVA 1TT5A 3G3EA 4BNZA 2WMDA 5L4SA 2JHGA 3W6UA 5L7TA 4Z9YA 4YR9A 3K6JA 1DB3A 4BV8A 3U4CA 5JDIC 1LJ8A 2YV3A 2YDYA 2D5CA 3GNQA 5COAA 2VZ9A 3W1VA 4CLHA 1FDSA 1AE1A 4DIBA 1U3UA 1DC3A 2PH5A 4OKIA 2EHDA 4DRYA 3IMFA 2WD7B 3DC2A 3GAFA 4ZQGA 2HO5A 1U9JA 2FR8A 3PHJA 1HEUA 4AICA 2GSDA 1K6IA 3BTSA 3GVIA 1ZEMA 3R3SA 5DN9A 4IM7A 4BNJA 1HDCA 5JCJD 1GYRA 2OBNA 2W2KB 2Y0CA 3I1JA 1NFRA 2PKQO 1LXCA 1NHGA 3H5RA 4AJPA 4NBRA 3ZNQA 4QO8A 1W4ZA 1NQOA 3NV9A 3PWSA 3ANMA 4K26A 1DPGA 1EVIA 2E37A 3AY7A 3DONA 1BMDA 1CIVA 5JDIA 3QWIA 2Q1UA 2EWMA 3JD0A 3NRCA 4ZICA 1FJHA 4PLPA 4J1TA 1E7QA 4ZGWA 1ISIA 3EMKA 3HDQA 1LSUA 1LX6A 3WMXA 3MZ0A 1I10A 2YY7A 4RZHA 3PFWO 1XEAA 1PJBA 3JQAA 3KYCA 4NG5A 4EI2A 3NYWA 1HYHA 5C3MA 3FNHA 2JD2A 1ZK2A 4NJMA 2YQ4A 3ZWNA 2GUGA 5ICMA 3ORFA 4XRRA 4CLXA 1O95A 4CMAA 3UHAA 3RI3A 3AOGA 3WIEA 1Z7BA 4K6CA 4J7XA 5B4UA 1YBAA 3F1LA 3G1TA 2G5CA 3ASVA 1FDWA 2ZB8A 5FI5A 1RM4A 3I9KA 2CDCA 4TQGA 3PIIA 1H6CA 4PLZA 4RPGA 4CQMD 3FPCA 3LC1O 1WP4A 1DBVO 2QX7A 4AFNA 4L0QA 3TZQA 1H94A 1P31A 5H82A 4LGVA 2LDXA 3H4VA 3VH3A 1GUYA 3ZW9A 1I0ZA 1SCUA 2HMVA 4QFCA 1B0AA 3TPCA 2G0TA 3QV1A 3L77A 3VOSA 4CV2A 1UXIA 2ZTLA 3IJPA 3M6IA 4WGGA 3WR5A 5B4TA 3U49A 5L53A 4XGKA 3AU8A 1Y8QB 3AM4A 1V3UA 1WPQA 4BGUA 4NMHA 5KVVA 2Q45A 2J5RA 4RJTA 3OQ1A 3Q9UA 1I32A 3QVOA 5G2OA 5I7SA 2DPHA 5KIAA 3DDNA 1WDLA 4WEOA 1M66A 1WXDA 3PP8A 4NK4A 1F14A 3BMQA 4NBVA 1PJLA 2B35A 4OXNA 4AJIA 1EEHA 3FNEA 4OMUA 2A4KA 3RUEA 3PXXA 3GDFA 3GVXA 1E1NA 3GR6A 3FBGA 4CUKA 2JFHA 4EUHA 1ENPA 2OGUA 3ITKA 5JO9A 5TSDA 3RUIA 4W4TA 4GWKA 1NAHA 2I5PO 4Y6PA 5L51A 4ZRMA 3UGKA 4C4OA 5MGBA 2YUTA 1GUZA 5TC4A 3JD1A 4XX0A 2P4QA 3VKVA 4F46A 4UEOA 1LBEA 2PKQP 3F9IA 4MPDA 3WTBA 4QT0A 4RORA 2BFMA 1NPTO 1OAAA 4FQ8A 4IQ0A 1IL0A 4XGIA 3R6DA 3TWOA 4WOJA 1QRRA 4CLDA 3I9OA 5KCZA 2NACA 2I76A 3NGLA 3KSZO 4FGSA 1JVBA 1PGJA 4GH5A 3NAQA 4IDCA 4XA8A 1N5DA 3AUAA 4HV4A 4GX2A 1ISFA 5C37A 2FWMX 5A9SB 1QV7A 4XQGA 4CV0A 5CFZA 1KETA 1XGKA 3HWRA 4LRTB 3IJRA 1PQPA 1PZEA 4TVOA 3TFQA 1LLQA 3FI9A 3CH6A 3VPHA 4YJHB 3AK4A 4LW8A 2IE0A 2VRCD 1YH3A 1YQDA 3C3XA 2P9EA 2RH4A 1VJ1A 4KTVE 2RHCA 5A9RA 1X7GA 4MP3A 2BGKA 3I83A 3OJLA 3FNGA 3WOHA 2H1SA 1C0IA 5JNLA 4NU5A 1JAXA 2ZQYA 3H9UA 4XDZA 3JD3A 2C0CA 4MVJE 4BNWA 1SB8A 2X6TA 3JD4A 2VWGA 4TKLA 4YAKA 3L07A 4JJIA 1JQBA 3TZKA 4J49A 4RLSA 1HSOA 1LDYA 1C14A 4R9SA 4TMFA 3ZNOA 1LDNA 3ZU4A 4DQUA 4B8ZA 3R1IA 4B3HA 1HZJA 1EE9A 4JN6B 4XIJA 2C82A 2JCVA 5IDYA 4YJFB 1UP7A 1GFSA 2EJWA 2YFHA 3SBOA 2P68A 3JQGB 2CNBA 2PY6A 4ALLA 1PZGA 2NLOA 3WGYA 3V1YA 4OOEA 3JQ8B 2W4QA 4KTTE 3B70A 4PZDA 4CM4A 3GDGA 3WTCA 4RVHA 3S2EA 1H5QA 2X5JO 1Y8QA 2FR0A 3QP9A 3GN2A 1IE3A 2DT5A 3DEYX 3FF4A 2Y0EA 5KJEA 3VDRA 5CDTA 2C07A 3BTOA 1T2CA 1XG5A 2ZYDA 1A71A 1NVMB 3JQDA 3SJUA 3RC1A 4NPCA 3CUKA 3HB4X 4I5DA 3NT4A 4MVJI 4Y6RA 1HDXA 3GF4A 3GH3A 3S8MA 2FPGA 3PVZA 1YDWA 2EKLA 3GY0A 3HJAA 2VYVA 5DNAA 1GQQA 4NBTA 4FFLA 4YJGA 2EG9A 3R3JA 4FD3A 5DCUA 3O9ZA 1MV8A 2GLXA 1I24A 3GPDG 2VOEA 4M49A 2VWHA 1YVEI 4PVCA 2QRKA 4G2NA 1DFGA 3H9GA 3QIVA 4EEZA 1TLTA 2AEJA 2NTJA 1PSDA 5T5QA 4KUGA 2X4GA 3DBHB 1GYPA 2C5AA 5HWSA 4GMGA 5CHEA 4BNKA 3ZWCA 2OFPA 3IC5A 4N5NA 3RFTA 3ST7A 1QXSA 4CQLB 1CQJA 4YAGA 1K89A 4R51A 1PIWA 4RLHA 4DLAA 3K31A 1BVRA 3HADA 3VH1A 4Q9NA 4E0BA 1F12A 3IKVA 2GERA 2JFGA 2ZTUA 3CMCO 4J0EA 2RCYA 4XYEA 1ADGA 1QYWA 1E1MA 1Z82A 5KNLA 3BTVA 1ZXBA 1E3IA 5EN4A 4CUJA 5GZ3A 4DMLA 1VL6A 7MDHA 3M2PA 3GNTA 4R01A 4U6SA 1GZ4A 1RYEA 4PLHA 1MX3A 1OMOA 2CDAA 4HWKA 1GV0A 3BMCA 3GZNB 2ZQZA 2J6IA 5DULA 5AXAA 4PRLA 2GN9A 2C29D 1H0KA 1PGNA 3O38A 4D46A 1MUUA 4AJ1A 1AXEA 1G1AA 3B6ZA 3QHAA
chains in the Genus database with same CATH superfamily
3H7IA 4ZAYA 3E2MA 2FFRA 1KQGA 2V9ZA 3OEWA 3UJ3X 4DLXA 4GI1A 3PQEA 3JQBA 5J47A 5D5PA 1BXKA 3O03A 4ZKDA 1W36B 3V7FA 2X0RA 2GVNA 1HYGA 2GK3A 3S70A 1BN6A 3FWKA 3REGA 3K9FC 3ZGZA 4BWVA 3OEHA 2Q3DA 3DHEA 3CLRC 4BVLA 2QT9A 1DUVG 1TUIA 3IERA 4JFAA 4LK2A 4QOEA 4BFVA 3KPYA 1ZZGA 4DCMA 3OHPA 3GLIB 2QMUA 1KGSA 1R4MA 4OHMA 3WFJA 3EG9B 3ND5A 4PXAA 1HSZA 4DNQA 4R41A 3T99A 4EHDA 4S1WA 3MM4A 4JX8A 4J6FA 3CXUA 1OX6A 2IPLA 2ZJ5A 3M1IA 4A92A 5JRJA 5IRCD 2VTBB 1YR7A 2W5UA 4BVGA 3HP7A 5I7HA 5T6BA 1QRUA 1R4AA 4RXUA 5I48A 3DC7A 3EYAA 2I54A 4CQMB 1GLGA 4YCAA 3KC2A 3PA8A 4FKZA 4M89A 4Y30A 4DIDA 3BDIA 4IDAA 1D6SA 5EE9A 2FVYA 4E33A 3SF0A 2B8WA 1BMFD 3ZWDA 4HH1A 2VSFA 4YRRA 2IYLD 1I30A 2ZRLA 4TVKA 1NULA 3CN9A 3D7NA 3K94A 1E3SA 2WT9A 3R5SA 4M0LA 2ONKA 1EZ4A 4RXTA 2AR7A 2AUTA 1OT3A 4U0KA 4EHBA 3KQYA 3MBIA 3L6BA 4KREA 1RBMA 1Q92A 4WN3A 5ER9A 1VIMA 2BGMA 1KY4A 5G0UA 3ONEA 1EFRA 4Z0TA 3T06B 2RI0A 1VFPA 3WDLA 5TVGA 1TXGA 3NX4A 2RHWA 4RH1A 1FFXA 4MMYB 3IEUA 3TM4A 5DE3A 5DM0A 5WRFA 4OQFA 5KTSA 2O19A 3WRXC 4XSVA 4G0UA 1K3FA 4DTCA 1IULA 3MWFA 3P2IA 4UFNA 3K9CA 4MA5A 3U3DA 4P3XA 2O2EA 3ZVKA 3COPA 3LRPA 3TD9A 4R05A 4BMSA 1AS3A 3L43A 1JDJA 4YP0A 4B4OA 1USGA 4K9OA 2IUUA 1OFIA 3O8QB 4MIEA 4YAOA 1SGWA 3IPYA 4LPKA 3EC7A 2Q3MA 4H3KB 1RXEA 5LM3A 4XQCA 2CL0X 1N92A 4NJEB 2PX8A 5JALA 1JE0A 3AL2A 5FQNA 3FCSB 5LOVB 1M6HA 4KO1S 4H27A 3TOXA 5LU9A 1KYIA 4RCVA 3IVGA 3PUKA 4YCNA 2HQOA 3QXHA 1OBCA 1XF9A 5I7EA 5KC8A 3EBLA 3KAKA 3QVJA 2F1RA 4IVRA 3B3FA 4F8JA 2ZZNA 2PMWB 4JP1A 2O4UX 5BMVF 2PX2A 4G24A 5LUAA 1KNXA 4ZCQA 3HKBB 3FFXA 3WE7A 3BXXA 4J0FA 3SMQA 2ES4A 3WXBA 3CQ9A 3PNOA 5AJHA 3RBAA 1YR1A 2EXXA 2G04A 4HDSA 5I45A 2OQVA 4UKDA 3THRA 5JPDA 4DBZA 2C9ZA 3QPWA 3WRXA 2C42A 1L4BA 5EP4A 1TF2A 1BCSB 4KBYA 5F2KA 3L1HA 4Q7KA 2YWXA 3S6JA 4DLTA 2VWPA 2GPJA 4MV4A 5DEOA 3FTCA 1WABA 3GFGA 3M81A 2AWOA 2HU7A 3URMA 5DHFA 3NALA 3MMZA 2XUQA 4KODA 5C4IA 2ZB3A 1O4VA 1ZOOA 2NYVA 3PDUA 1B8OA 1RWXA 1YOBA 1M8PA 3P2YA 2ID7A 4WERA 4F2WA 3RRMA 2D74A 1DXOA 2V96A 2CE2X 1UXKA 4ZZ0A 1LK5A 5E4YA 4MR8B 4C30A 1PL0A 2QN9A 1Q7RA 3WO0A 5L40A 2JI7A 3T7CA 6CHYA 4TS9A 3WQHA 2GASA 3BREA 3F73A 1TZMA 5JH7A 4G1EB 3U6BA 3CB2A 2W37A 3QKRB 4OB8A 5B1YA 3P52A 4X20B 2O7SA 4G41A 2G4CA 2Z8YM 2XT6A 3LNTA 4JASB 4RFSB 1IB6A 4WINA 4C5BA 5IZCA 2IV3A 3K92A 4BO1A 1NRWA 5A3QA 1OAOC 5CCEA 3BE8A 3P9CA 4BFZA 1TJ3A 1JVNA 1PGPA 5AVJA 1JU9A 1T0IA 4BQOA 4Q4AA 1I80A 5K45A 3E2PA 2R4QA 3IOBA 5CFQA 3R7AA 4CETA 1NN3A 3WIUA 4Z0HO 1B1AA 3TZCA 3I12A 4IYRA 3PRKE 4UNRA 4LV5B 1TMGE 3GPBA 1U1IA 3BSSA 4PYMA 4RAQA 2BIFA 2CJXA 2Z08A 4Q3NA 5J4HA 4TOIA 2N1MA 1U99A 3K8ZA 4K6OA 2P8JA 4XOIA 3UK1A 4A5SA 2LNDA 2VUHB 3OLYA 1YSCA 1DFIA 2H4HA 2VDUE 4TKVB 4XGNA 1F17A 1B8VA 2ZLBA 1GADO 3CWZA 3WK8A 4C14A 1M6WA 3NJ8A 1IVNA 1FUKA 1NLFA 2XYGA 3B36A 4FB5A 1NI3A 4HATA 4HX5A 1MV5A 1R8YA 4Q7LA 1GNVA 1HTTA 1SBHA 3AWIA 3WMXA 5B5SA 1FMTA 3LQ1A 3TXAA 2F8SA 3HJTA 2E82A 2YW9A 3HCBA 2D2FA 4LE1A 4TQ9A 3RARA 1WTCA 3T5DA 2FY8A 1PKXA 4KYVA 4FEGA 1H4VB 1VKJA 4S05A 4AJJA 4PZAA 1URPA 4NYMR 3FNRA 1SY7A 4UZEA 1TYDE 3LKZA 4YJ2A 4S3MA 2VSYA 3LQKA 1MO4A 1NUUA 1UXJA 1ZMXA 3LW7A 1DXQA 2Q07A 3V1LA 4D9IA 1P44A 1QYVA 2FK8A 1AURA 1CJUC 1SUSA 1O5OA 3AZQA 3F9RA 4M0KA 4YJ3A 4ZEVA 4E7PA 1PQ4A 1WS6A 2IYUA 3IHKA 3ITDA 4O2BF 4YDRA 4ZAGA 2ONZA 4E13A 1KQPA 1Z45A 1SVWA 2RHHA 1HETA 1CF2O 2G5TA 2W2OA 3KXKA 3QH4A 3LZ6A 4H17A 4AYXA 1RM0A 4Q3LA 1P4RA 5F9FA 3O1JC 1HGXA 3S7TA 2ZBEA 4RAOA 1M0EA 4B82A 2NUBA 3LS2A 2FOXA 5JZMA 1D2GA 2YS7A 1K8ZB 3NWPA 1VDMA 2EOAA 2IHBA 2GWRA 3KKNA 3CWCA 4HAWA 4JBNA 5BSGA 5IFKA 1XC7A 4KUEA 2XDWA 4HVAA 5LMUB 2Y67A 4EK9A 3LCJA 4RL4A 3KWMA 4CKCB 3A1TA 2QXUA 4HLCA 2QIPA 4GUAA 1DMSA 2CVOA 1LQTA 1YBFA 3G0BA 2QI9C 3FSGD 1YCHA 2QBYB 1L1QA 1U5AA 4OHWA 4CLRA 4F1KA 1DAMA 3MWLA 5I9NA 4L0DA 2Z2JA 4S35A 2NO4A 2WD7A 4WKOA 3RWOA 2PUHA 2A59A 1DJMA 2RJOA 3BQNB 2XJ9A 5D84A 5CVCA 3PDIB 1JKMA 1QRAA 4GBJA 3MWEB 4G9BA 5JHHB 4U2GA 4KPEC 1YVPA 4Q24A 3W8RA 5JXGA 3IQWA 1TX4B 1Y5IA 1U9YA 3R9XA 1LPPA 1RCFA 3DULA 3VR5H 4DUYB 2BT4A 2FZVA 3LCVB 2YYSA 1E1QA 2V5VA 3TX2A 3UJNA 3QX9A 1MXHA 5E4FA 1JHPA 1ODFA 3EVEA 2WICA 1SXIA 2EP7A 3ZGXA 2MDTA 3V2UA 2N3ZA 5JSZA 3LF1A 4H0NA 3RAFC 4KMRA 2C8KA 2BD0A 2XGSA 4JS0A 2JLAA 3FNFA 4QXMA 3ZIAD 5LP6C 3WQQA 3KAPA 3RV3A 4LBYA 2QX6A 1HTBA 4CMGA 2XE8A 2VF7A 3MF4A 1WCWA 4ENSA 3UAWA 4I36A 1W5AA 1DEXA 1EJ2A 1HZZA 2WG2A 4BZXA 5ITVA 3K09A 2O8EB 2VSXA 3CCBA 3KYIB 4P84A 3ZHBA 4MKIA 5FXMA 1P6QA 2CGEA 4JHLA 5KB3A 4BBAA 4YAIA 4F4IA 1XZEA 2X8JA 2J1LA 4LYYA 4A0QA 3EBOA 5I9SA 3SD7A 3SOPA 1XZDA 4RSGA 3F1KA 2HU5A 3KLNA 1ENOA 1EVZA 2CWDA 2JGDB 3LY7A 3LXUX 3NATA 3R77A 5EPEA 1PNRA 3MTEA 4G97A 2ENWA 2OHOA 1S2DA 2QPTA 3L3BA 3HGTA 3I2YX 3ND9A 1UFRA 2OSVA 1A88A 1F8UA 1LLCA 1Y9ZA 4X7RA 1H22A 4P7BA 1I4OA 4BEJA 2G1AA 2WHPA 3FHCB 5IVDA 2DXIA 2X2PA 4D9CA 3ME5A 3FTNA 4GU5A 4UULA 2V7WA 1B15A 3FSRA 2YL2A 2OGZA 1UIMA 4ALMA 1NY5A 3EF3A 4OHRA 1B73A 3HDGA 4N9WA 1CETA 1REQB 5DP1A 4D3SA 1UAGA 5A0VA 3J7TA 2LW7A 2PK3A 2QAGB 3ZCPA 4AYWA 3JQEA 3QPVA 1EUQA 1YL6A 5LA6B 3II6X 4IDGA 1IHYA 1EAYA 4PLFA 1ML3A 2PUVA 2ZRPA 3LWZA 3HA2A 3TJZA 4C0LA 4KU4A 5GY7A 3R9XB 3AM5A 1YJAA 3LQYA 4NMXB 4Q4HA 4AP6A 3RK4A 3DT8A 2I2DA 4W7SA 4R68A 2OHXA 2DU8A 3FI0A 1D1TA 4BKUA 1SVIA 1NJ5A 1E2GA 1HL3A 3FZEA 3OEYA 4OQ4A 1NV9A 1B42A 3GJ5A 3I2IA 3KBBA 1SXJD 3OAAA 5EINA 4F2PA 1ZX1A 4W5TA 1Y1KE 1SUPA 5E6RB 4N0PA 4E1AA 1A2KC 1QC5A 3L5KA 3N0RA 3G7UA 4P8RA 1GQYA 3L8HA 2PX3A 1P7ZA 4URFA 3GQBA 3LX6A 2AX4A 2KBFA 2PCJA 4NDZA 2UKDA 1ZN7A 1HFEL 3PQ6A 4XVRA 5BN4A 2XEDA 1MD9A 3OKFA 3ZBTA 3ZJ5A 3BN3A 3FG9A 3H4MA 4J4BA 4DILA 2LIVA 2PMKA 3IT3A 4FBGA 1YONA 3SE7A 2D0DA 1QCCA 1IDN1 4JJ6A 4B3IA 4V0ME 2OZEA 4EY3A 2YV2A 1C41A 3RVNA 1Q91A 4NH4A 1J4AA 3OP4A 1IN7A 2DBVO 1OQAA 1CS4C 1GQ2A 2REXB 2PZKA 3BTUA 2HDWA 5JQGF 1UDRA 4UARA 3QXSA 2W6ID 1NR5A 1M2JA 4HWSA 4JBHA 2NV2B 4XCVA 2QBYA 4Q9KA 3EH1A 2VUUA 5AHKA 3H9CA 1FYFA 5CFLA 1F7VA 4QJ5A 2NZJA 3CZQA 2HYIC 1LEHA 4YI3A 2A0YA 6NULA 2X9LA 1W25A 2QDKA 2WWFA 1TD9A 3IMKA 4MWGA 1ZBQA 1IOLA 3FUTA 4ENWA 5AKGA 5FLKA 4IDOA 5GZ6A 4YPOA 3D64A 3C3JA 4ER5A 3GUVA 5L7YA 1XRRA 5T6MA 3T9FA 4XE5A 3ZPXA 2XADA 3T4EA 2Z30A 4PICA 1DHRA 2UXCB 2N42A 3AHHA 2EKQA 2JI9A 1YB2A 3H0KA 4JVLA 1XMQB 1A8PA 3LT4A 1WMEA 4MQLA 4OXYA 3C5WP 1GOTA 4NBUA 3TK1A 2EZ9A 3ZW8A 1ZD4A 4HS9A 3TZLA 4FINA 5KC9A 1EM6A 3VR6A 3LT1A 3ZVMA 1K75A 3T35A 5I6DA 2R6ZA 3LE8A 4NI5A 4S1OA 4GYWA 1B93A 1FC0A 1Z5OA 1PFYA 3G5TA 3PJGA 2HF7A 4WL0A 3Q5GA 5TRTA 3JQRA 3RC2A 1K63A 4LXHA 4FDVA 2CMDA 3QKRA 3TLEA 3FX2A 2X3YA 5JCJA 1FFDA 4FHGA 3C24A 1V3QE 3MSXA 1VSVA 3HN7A 4XR9A 4B75A 4PLTA 1CY8A 1JJAA 2E48A 3CWQA 1U1EA 3HB5X 3CW2A 4HYEA 1DCFA 4JB8A 4LXXA 1V8OA 2BHNA 2O1XA 2EWVA 3FE2A 3K2QA 4IYJA 4Q39A 5FUQA 1PCXA 1GPDG 1U0HC 3EUEA 5BYKA 4RY2A 4P54A 1W47A 1ZIPA 1CZHA 2YVAA 4QOHA 4JWTA 3RF7A 4TKUB 3TMKA 4A27A 2FE4A 1OI3A 4BJ6A 4CQNA 3ZD8A 4DRZA 3O3CA 2ACEA 2O0HA 3NONA 4J1QA 4OKSA 2BFFA 4F6RB 3SYKA 3WLIA 1ULHA 1ZOSA 2J3HA 2AL7A 2P2SA 1V45E 1Z0FA 3IULA 3M1AA 2QNRA 2AQIA 2C2HA 2P35A 5GWXA 4J90A 4PHHA 1XSEA 1NVWQ 3FPAA 2XCLA 2PSSA 3FYHA 4PG6A 4DV5B 3C7TA 4XKJA 3B7GA 3WNDA 4IW3B 5KOHA 1Q74A 2R1VA 4XWTA 2I03A 2ODAA 3RQIA 3K9HA 3BRWD 4GG1A 1U2ZA 3O8DA 3SQMA 3U19A 3BVPA 4WKCA 1NKVA 4FE4A 5CLGA 3V8QA 2NW6A 3UWDA 5JLJA 2AD1A 2OVBA 1SQ5A 2B4TO 2W0SA 3CBGA 3VR4A 4H31A 2QD1A 4HZGA 3SYLA 3L0BA 3S8EA 2CL7X 5FOWA 2C2BA 2GPAA 5BV8A 4GOLD 4LVUA 2FRXA 4OMCA 4YEDA 3ZR4B 5LD2B 3W0LB 1QIIA 1DQRA 3HNRA 3LFTA 3F6PA 4NBKA 2A92A 3R4CA 1XTZA 5KQPA 3LVFO 3ZCQA 1V9LA 3T7DA 4QAQA 1G6HA 4Y0VA 3E6AA 1ARZA 4N6NA 1RPTA 2GK4A 2I6TA 4ZKEA 1G8KA 2D59A 3LWBA 1Q1QA 1UDAA 3IL2A 2INGX 4X71A 3DDWA 1LV8A 1I1HA 3GCXA 3IQZA 5EP3A 4UTPA 5HXAA 3GP8A 3VR3D 3VZBA 5ANRB 3B1KA 3FIUA 1Z25A 4EA9A 1RLUA 1L7VC 4RHYA 5CCDA 4IV5A 2P5UA 4MYRA 2J7PD 4B3XA 4DAOA 5JJ5A 3TIVA 2HJWA 5GV7A 2IF2A 3KLBA 2HWXA 3RU2A 3KXPA 4OU5A 3UKOA 5AI5A 3O8NA 3EVNA 2ZANA 1HF3A 3KKKA 1DGQA 2UYYA 1K8QA 4R5MA 1HTWA 4JR2A 2WUEA 2J4FA 2YC2C 3P20A 1NW8A 1MX9A 1W4LA 4LDNA 3SHWA 1QORA 3FCYA 3EXHC 3WLSA 3R24A 5E3JA 3VAZA 3W8DA 1Z4PX 2PZMA 5JS7A 1Y89A 2PVCA 2Y1XA 5A4DA 4XWKA 1JAHA 2ZT8A 3F46A 3OX1A 1T5TA 1CJMA 2CJPA 4YAUA 3QXJA 3FMIA 4Y2TA 5AM1A 1K88A 5LBTA 1ESEA 2DLNA 4M46A 2ZT6A 3MEQA 2H3EA 5F77A 4KN6A 2GLUA 1NVTA 1X1RA 1B0UA 1X7ZB 2OE2A 3CO0S 1IHXA 3Q98A 4MUIA 4OXXA 3Q3JB 4QIHA 3V7WA 3G2LA 4JGIA 3QU9A 1QGED 1Z5ZA 3QWBA 1E60A 3KYDB 3I04A 2BGTA 3TRJA 4F9TA 2ZSUA 4EYKA 1IJKA 3L5OA 4LRXA 3PIRA 4KQ2A 4AIRA 1VGVA 2IY8A 2GAAA 5ALRA 3T4UA 2AK2A 5ALIA 4J1SA 2BFNA 3DKIA 3NBYC 4OM8A 4Q4JB 4L4UA 2BF7A 2AG6A 2LGJA 1AIPA 4OK3A 2ABWA 2LCIA 3IQEA 1VE7A 2ZYHA 4S1VA 2R8YA 2BMJA 1QVZA 3V4OA 1CU1A 1VCMA 3ONNA 4DIFA 2AIRA 1CULC 1YK0A 5AJWA 3MOSA 3LUHA 2R7AA 2P6NA 4EARA 2FPRA 3JQ6A 2RIRA 2BRUC 4G1FA 3AY6A 3RSGA 3VSCA 4W1QA 5LU8A 4JLOA 1RAEA 2Q46A 5HKKD 3OURA 1M0WA 2CBZA 2JK1A 4IKPA 3RSFA 3IQHX 3V9AA 4D5GA 1U0JA 1OB2A 3PX7A 4P0QB 1HEIA 2C5HA 2FPPB 1IVYA 1KMQA 4L6IA 3PFFA 1A8IA 4PAQA 1AXGA 1OXVA 3MJ4A 5EZ5A 1HQDA 2V8BA 5DW3A 1UZUA 4Y98A 2I29A 4FWIB 3O95A 4BVFA 4UUQA 1FF9A 4ZQEA 1X15A 3T3GA 3CUSA 2J3QA 4HDNA 4LA4A 5CG1A 1AMNA 4N3GA 1Z4MA 3KQUA 1N9ZA 1NUHA 3ET5A 1MRSA 2J9RA 3BZWA 3LPNA 4FFOA 4AWXA 3E9MA 1RHQA 4CKWB 4G6ZA 1YDMA 5F98A 3FZNA 3FAKA 1NOJA 1PR6A 2QYSA 4ZO9A 1QJ4A 4A73A 2VS1A 4IJQA 1UT8A 2NGRA 3ZTYA 1PNTA 1STOA 2UXDB 1RU3A 2BZGA 2AOWA 4MGEA 1KMCA 2Z3VA 4MUYA 1V7ZA 4QQNA 5FAXA 4AKEA 3LX8A 3F3YA 2XZTA 3DM5A 5IXJA 3EVTA 4ROTA 2J3LA 2G7MC 2AYZA 4EATA 2OHVA 3HYNA 4FNAA 5K3SA 2C00A 2J5BA 3BXHA 1Z88A 3DLBA 5AKIA 1RWBA 4WRRA 5A4AA 1IOVA 4QUAA 4F8EA 13PKA 4KGXA 1EFLA 1YBHA 3O93A 2CVHA 1P1RA 2ZIXA 3OU2A 4ME6A 5H83A 3RNOA 1CNMA 1M1YE 2DKNA 4M3NA 3GGDA 4OJQA 4MAMA 2GHIA 3FYCA 4UCWA 3KQNA 5IC6A 4NV1A 3WQSB 5CDUA 2FRDC 4L27A 5CVEA 1PQYA 2H08A 2QAIA 4YRJA 5DO9A 5KAPA 1CXZA 3DNMA 3BDAA 3RJZA 1GILA 4RS3A 3LPAA 4AF8A 2DHCA 1CRQA 1C3EA 1X7WA 3JWHA 4BAGA 4E14A 3C1TA 2CSXA 3BORA 1T5IA 3B12A 3RJ9A 3I2HA 1U3GA 5IF9A 3FR7A 3AF3A 3P2EA 1J21A 1GARA 3VU9A 4AY5A 3EMVA 1L5RA 3MBOA 1A1VA 4RLQA 1ISHA 3N6VA 4O4IA 4R2WA 2WEKA 2H1HA 3IKTA 1DINA 4XYGA 1B6RA 5FX2A 1DRVA 4XAQA 4ECEA 1ILEA 3K9NA 3ONFA 1A2BA 2HK6A 1JG3A 4HRYA 1SKUA 3L1IA 4M7PA 1J2JA 5E9WA 4G2TA 1RQNA 2J0EA 2XYQA 2Y0PA 2Z3ZA 1XQ9A 4RMNA 2XBMA 1P39A 3H3FA 1R9NA 1VHQA 3KTDA 2B25A 2CY0A 1AY0A 4MUJA 2WWGA 1V6CA 4G26A 2OCIA 3DOIA 1UR5A 2B82A 2OCYC 2ZWPA 3NUQA 1PFUA 3LH5A 2JAXA 3SDSA 4LV6A 3ORRA 1QDUA 1T9BA 2HF9A 3GL9A 5DNEA 3TCXB 3UWOA 4FPXA 5DW0A 4DJDC 3H97A 3SIWA 2HCTA 1QR6A 3PFGA 3GLFB 5LQNA 3ES9A 2ON6A 3WDMA 1F2UA 4EI7A 4MCIA 1U4NA 3ZY6A 3FKJA 4TWZA 1DXHA 2VP4A 1G7TA 3D3EA 3E9QA 4C4PA 3ZDCA 3L41A 2BKEA 4ND1A 4PQGA 5AW7A 3GHHA 5KWIA 3V1UA 2NO7A 5FA8A 4LN1A 4LX8A 1N7IA 2C03A 2FA9A 3CZCA 3RRFA 1J90A 1J20A 3GDWA 1XTQA 3DBRB 2WYWA 3EDYA 3KTAB 3NU1A 2JLYA 1NXTA 1VKOA 4MW1A 2V6FA 1PZMA 1Z0UA 2ZITA 4C0KA 1XAHA 2AX3A 2DTXA 4NXNB 1BRMA 1M2KA 1MA3A 2TRSB 2E9SA 3FKQA 2NOAA 4RVGA 4RF5A 4Z3DA 4Q7QA 4XM1A 1W30A 2X9GA 5SYMA 4RD2A 1G19A 1QS0A 3AERA 5AHRA 5EIBD 2PKRA 3CTMA 2VPTA 4CZ2A 3HP4A 1XZIA 1JKFA 1POWA 1NYLA 2O06A 2YY6A 1AHHA 1DS6A 3UMFA 4AURA 3K0CA 3EHEA 1DG9A 5AXDA 3KFLA 1G5RA 2ODEA 1FQJA 2VK8A 4H7PA 2JJ8A 3ER6A 4IVQA 4MQBA 4KDEA 3WIDA 5AUOB 5AUPB 1Z2AA 1HT2E 1W52X 2HBQA 1X1DA 4J2HA 4RE5A 5AW5A 3Q2KA 4DCOA 1NA5A 3GA0A 5JLAA 3HVUA 4PN3A 3EEIA 2OCPA 4MDYA 2ZREA 4AK9A 3HXMA 4LZOA 1US8B 4QPNA 3A58B 4IINA 3EIEA 4DREA 1KO1A 3PF9A 3T1QA 4AMUA 1IY0A 4MUMA 1JU4A 5IP5A 1LTKA 2P11A 1LWOA 3T3DA 1ZJWA 3GFBA 2FSFA 4R8KA 3UK6A 1FRQA 4LMPA 4OHFA 5DYYA 3JYOA 3IQDB 3N7UA 1P74A 1ECPA 1CDOA 2OOKA 4ZVLA 4HNAB 1RZRD 5EP1A 3TBFA 4GMFA 1AKVA 2YZ7A 3BRWA 2AFVA 1GKIA 2OKCA 1K6EA 3Q6IA 1SN7A 2OCGA 4KIFA 4KR2A 4LF7B 2NO0A 2OC9A 2Z3WA 5I9MA 2IHVA 3FR8A 4OHKA 3W5BA 1AQIA 1DQSA 1PR3A 2OUKA 3I9MA 1TYZA 1YZLA 4Q12A 3DXXA 5IAEA 1HG0A 1S5PA 2UVDA 1KO5A 2VJAA 3FVTA 3TLCA 3W2TA 1FFGA 1YUNA 2JHFA 1Z3CA 4G84A 4QHYA 3D8BA 2KX7A 3PEEA 5KOHB 1LVHA 1H2WA 3BKXA 3R20A 3ZS8A 1XB2A 5CTJA 3WG9A 3MYRA 1ZHHA 2OL4A 1J5XA 3HU1A 2VHEA 1LA2A 4RMIA 1G8PA 1YE5A 4RV5A 3KJFA 1GCUA 1T3LA 1TAGA 2P6OA 3AUYA 3EXHA 3I34X 3ESZA 5K03A 5DLDA 3H1TA 3CH4B 3WGJA 2V5UA 3DYIA 3IIMA 2VDJA 1IZ0A 3PPIA 2OECA 3OTQA 3KM0A 3KDPA 1XDDA 4OBBA 3MCWA 1P1BA 3K0FA 4Y9DA 3RS8A 5ABPA 3E4DA 1AB5A 4DANA 5CFRA 5B12A 3PSAA 1P7PA 1XP5A 4GNKA 2NUTA 2CLCX 2AC7A 1DBPA 1TEHA 3FN4A 3SMVA 3X1JA 4XFJA 5LPNA 1NW4A 4L9WA 3UOWA 4TKMA 4YLEA 5FA6A 1WY5A 4F4DA 4KQ1A 2VPYA 2GVDC 2GM3A 3G5MA 3TQOA 2I2FA 4Q3AA 5D8DA 1OROA 4GKAA 1RACA 4XASA 2GBIA 4HNHA 4B0OA 4QPPA 3ZY4A 5JVDF 2JK0A 3URKA 2AFIE 3ZJ4A 1YFJA 2H6EA 4Q3DA 5JISA 2Z6QA 3ROPA 1DADA 1FP4A 1YR9A 3MCZA 1HKUA 2RDMA 1QWOA 1NBAA 2JGAA 4ZDIA 1AVTA 1C1DA 1XN1A 3G9QA 4HDAA 4LDQA 4LDPA 1JYFA 1JJVA 3DTVD 4TMTA 2ZWMA 3JD2A 3U7FB 3EEOA 3PEVA 3BE6A 4QECA 3W8NA 5FWNA 5SZKB 1ZGZA 4AKTA 2YFQA 4RTJA 4E5SA 4TQAA 3TRKA 3ETHA 2ZSHA 3KYBA 1IQRA 1ITZA 1KEZA 1LJLA 2I0FA 3AB7A 3MT8A 3U3KA 1WQ1R 2FMKA 3JZMA 3NT2A 1BJRE 3A9WA 4L5JA 4LOIA 4FGLA 2JFWA 4YUXA 2YMQA 5LJLA 4UHFA 4KPFC 2A3NA 2RB5A 5DBIA 4MYTA 4RA9B 5JWHA 4UUOA 5DGCA 2Z58A 1O0BA 3E1KA 2Q21A 3PFKA 4DV1B 4IGAA 4E2YA 1H1LB 4NNOA 4POOA 1L5QA 2QHXA 1YVUA 5DBHX 5TDHA 3OH8A 3C5HA 4TZKA 2IW1A 4YCDA 3GZJA 2XLCA 1DQYA 2VEDA 2W6OA 5CNMA 4BMXA 2ZJFA 2WSMA 2BTEA 3WGZA 1R16A 4BX3A 5JSZB 3IAXA 2HL6A 4BX8A 1CY4A 1V7CA 3ROTA 5JZOA 2F00A 2EJUA 3D6AA 4A1FA 1LY1A 4LFBB 2VNJA 2GEJA 3NNNA 1EX1A 1BWSA 2GXSA 3BB4A 1Z4IA 4J94A 1GRQA 4MQEB 4PWZA 4GKKB 2B36A 2F3TA 1E2BA 3LBYA 4LF9B 1AX9A 4LZLA 2XITA 4CU5A 4P4SB 5KCMA 4BTLA 3S29A 1FX1A 4NAHA 1DO0A 4I8IA 2OZKA 3EAFA 1FSPA 2JD0A 3LIPA 1UXGA 2IRWA 1U04A 8GPBA 3Q3IA 1JLLB 1QFZA 2OO5A 1E3WB 2QOEA 3QUBA 4FMDB 3TMYA 3ZWAA 1VPDA 2CNDA 4WY8A 4EECA 3I9JA 1GAWA 4M36A 5ALGA 1IAQA 1VL0A 2HSDA 1ZJZA 1EM8B 3IXMA 4Y6QA 3IOYA 4L74A 4TSFD 3I8OA 5JD4A 3TSWA 3DL2A 4Q19A 1QOPB 3KV3O 4JDUA 4ZOLB 1XRJA 2XUJA 3L7JA 1NBWB 1NW9B 3DFIA 2GO7A 2WF8A 2WIJA 1UBSB 1AZTA 5BSKA 1GPH1 2XLBA 3IOCA 3L0YA 5JFOA 3EEBA 1ZICA 1W93A 1HDYA 5JPIA 1YC5A 4JKIA 1MB9A 5AOAA 1A77A 1KJJA 2YWFA 2ID4A 1H6DA 2GH1A 3LT2A 4I19A 2VDVE 5AUNB 1QKKA 2EP5A 2IBSA 4AN1A 2CVFA 3HDTA 4TLBA 2CDBA 1EH5A 1MP0A 5BV0A 3TSAA 3RLIA 3MSCA 3W1EA 1BNCA 2YJ6A 1UMBB 4KLAA 1Z06A 4RFSA 3FRHA 3OKCA 4DXHA 2J0UB 3Q3GE 2AFHA 2B1GA 3FCOA 1QQ6A 3LPCA 6REQA 2WZCA 2YZGA 5KDLA 3SBXA 1KDZA 5CIQA 1WY7A 2XCUA 4ENRA 2ZJ8A 1K4MA 3TI9A 4YAEA 2H5JA 3CZAA 5BXYA 3D9QX 4K0KB 2NVBA 2HA0A 5A7GA 4F21A 1JUDA 1C0KA 2F6RA 1Q0RA 1R12A 2WQ7A 1IN6A 2NNLD 1PVVA 2O8NA 1L5NA 2V9PA 5I7VA 3GLFE 1IU9A 5THKA 4BLUA 2A33A 4UEJA 2J5QA 1NW7A 2DZDA 1E9SA 3CGWA 3CU5A 1MPXA 1ONOA 2C7GA 4TL7A 1GAJA 4BFWA 3PPWA 4GKVA 1LF0A 2P7HA 3EQ7A 1PJ8A 1JG2A 1GWNA 1TL7C 4YA6A 5C0OE 2GPTA 3CRVA 4D82A 4DJFC 2DTDA 3PGMA 1E7MA 3DEAA 2HMSA 3IBSA 3BL8A 3ID6C 2WTMA 4JUCA 4KMMA 4Y2JA 4R8LA 2QTVB 3BPSA 1SC1A 3JYNA 2FEMA 1YI8A 4W8GA 3TIXB 1JH8A 1C1YA 5K51A 2IBMA 5I9LA 3K1ZA 4C78A 4I1PA 1SKBA 4M99A 1N2IA 3RRNA 1TYEB 1YQ9A 1XHEA 2VUIB 2P0EA 1E0SA 4HFJA 4KAJA 4RHXA 3QA9A 3HY6A 4OFZA 2FW6A 4BNLA 4LHYA 4CQJA 1VLQA 1DX4A 3FY4A 4K28A 4R1QA 3RYTC 1B0PA 1FFXB 3FF1A 1YQTA 1EEXB 1XOIA 3A9TA 5EHNA 3D6MA 1DC8A 4QXRA 721PA 1XPRA 1D4AA 1FW8A 3VZCA 3BCUA 5EPUA 3NPMA 4RGQA 5T3UA 4OIMA 5EQDA 3TJRA 3HR7A 1JSRA 3ENKA 1JDBC 3TUIC 2C2MA 4EG3A 2F1OA 5EYPA 2C4NA 3A6ZA 1P2DA 5IC4A 5BPFA 4HNRA 3V8RA 2ZXUA 5BSUA 4JNKA 1UKYA 4Q4JA 2WHEA 3JVEA 4IIFA 1PN3A 1E63A 2I99A 2ZUVA 4OHXA 3PQFA 3BH0A 2X41A 2I4NA 4MINA 1XZPA 3SQWA 1OA0A 1XBTA 3QWFA 2YHIB 2ERYA 2SNIE 4UU0A 3PQ2A 1W48A 1TZCA 5NULA 3WP0A 2OHJA 3I4LA 2XNCA 2YWHA 2B8NA 2ZRHA 4JGGA 2ZRCA 2X6QA 1P4HA 2D6FA 5IJ0B 3OUTA 1G60A 1GNSA 3PX2A 4PCVA 1KMIY 3EY4A 2ZRGA 1PW5A 5AVVA 2OORA 1G5PA 3O2SB 3RTCA 1I1QB 3O74A 2Z5LA 2G7ZA 4BFUA 4Y6GB 3PE3A 1HOTA 4BMVA 3VPCA 4D6XA 2CFCA 4QFDA 5HUHA 4DB4A 1XTKA 3IRUA 5JSQA 3A26A 3MK31 1KO7A 3I8SA 2NWQA 4O4LB 1U0GA 1OV6A 2DE0X 3OOHA 2QP3A 4PPGA 4BAUA 2B34A 5F21A 2C77A 4QZVA 3R3ZA 1ZR4A 4RD3A 3R3HA 4UHBA 1JA9A 1DCMA 1F60A 3ETEA 3GIWA 2N1BA 4TQUS 4OUDA 4I1OA 3HNPA 2DF8A 1Y63A 3IV7A 1WNFA 3NNDA 1VHJA 2GGSA 2HDHA 3BIXA 3DDCA 1O8BA 3DDOA 3F49S 4LVCA 1DIGA 2Y1WA 5FWAA 3TXYA 1YKFA 2ZDGA 1QAOA 2IYXA 1CB7A 3I04M 2ZU0C 3EPPA 5AK5A 1OT5A 4ZO7A 1VIYA 1TC1A 1X39A 4C3OB 4D44A 2G28A 4FILA 1J7KA 2ZS7A 3I01M 3CNEA 3LOQA 3LDHA 3EIQA 2BELA 5TJ9A 2W2PA 2B1IA 1IDOA 4ITUA 3UMSA 3FHTA 2QE7D 4BB6A 2BGWA 3UM9A 4CDGA 2WIGA 2GT1A 5CB4F 1EFKA 3A70A 1USVA 3VR1A 1UPBA 4BO9A 2JHCA 2V7PA 2WFLA 5ALTA 2FSVC 4IIGA 2V7BA 4WA7A 2JDIA 3OJFA 1H85A 1VYTA 4L5YA 1USUA 1I4DD 1I94B 2MSDB 4LXGA 3H2ZA 2O50A 2BRUA 4HVCA 5C7OO 5LYJB 2E89A 3N70A 4GL4A 4M6WB 3LBNA 1CUSA 1BKSB 1E32A 2QF7A 5IBQA 4HNAA 3FPGA 2HN9A 5C80A 4D2IA 1JJ7A 2XMCA 3S81A 4YREA 1O96A 4QFBA 4TV8F 3U1TA 4BVEA 4UBIA 1UZNA 3NCTA 1X80A 3DOFA 4UAVA 1XTTA 3X1ZA 3UAVA 2WWWA 1NF3A 4BHTA 3RYFB 4DIMA 3PG5A 3PLRA 3UAYA 1YIAA 5F5LA 1YVRA 4Z0NA 5KHOC 1S8NA 3CJTA 1WBBA 3K1AA 5MN4A 2VKTA 5ALUA 3A7EA 4JENA 4UBMA 1P77A 5ADWA 1J2TA 2IVZA 1VCHA 2P2GA 2ZG6A 2VAVA 4FJ0A 4ZZ1A 1WDTA 4FHDA 3PC7A 1WXWA 3HFSA 4F91B 1T8UA 4KXFB 2VF4X 3SXJA 4RA6B 4R8VA 2WR8A 3MJFA 1X1SA 3ZXSA 3QYFA 2HYDA 4H4DA 3FWPA 5BR4A 2XH8A 4LZJA 2XX3A 3G0IA 3OVMA 1V26A 2JIBA 1SURA 2YFKA 3CRW1 4OJNA 4DKXA 1XCGB 5DYTA 4XD2A 3R0VA 2ZWIA 4QXOA 4N76A 1GCGA 2EJVA 2UYGA 2PH7A 4WJZA 2DR2A 3RS7A 2QTMA 3C8MA 5T41A 2GYYA 3Q12A 2NTYC 2A5DA 2P6MA 2FR8C 3W04A 1ECLA 4MB2A 1S0UA 4X1KB 3QY9A 2F3PA 4ZO8A 5A5FA 1QP8A 4JQZA 3GRVA 4BQQA 3HJFA 2OCDA 4MH0R 2ZSFA 1PJTA 1FSGA 1II8A 2PN1A 2RHGB 2OT3B 3RRZA 1W4CA 1DAPA 4EVRA 5L95A 2J5KA 2YN2A 3D3WB 5IBRA 3PNLA 2D2EA 1MNQA 3ZEAA 4YDSA 4FYXA 1M3SA 1XF1A 3IVRA 4IDBA 1OU0A 2RH5A 3IAEA 3LOUA 3T15A 2F67A 1XDUA 1ZD3A 5IZCC 1XRQA 5TY0A 2D13A 5EUCA 2GYVA 3MCTA 4CEHB 3WKEA 2A94A 3ASYA 3LBIA 1YCGA 3P71T 5DWQA 3GXBA 4F84A 2G40A 1S7GA 3SC4A 4M1WA 1ZK3A 3G6WA 3WB0A 4ASUD 1PGQA 3IIIA 3K0HA 1BYIA 3ABZA 4K9KA 4ARSA 121PA 1N1GA 1KKMA 5KTKA 3H2YA 1PJSA 5LLDA 1ULUA 1D4OA 4LRSB 4AZ0A 3L7NA 2OZLA 4WWHA 5A06A 4IDHA 5CDSA 1G7RA 1NR7A 3AOEC 4OO3A 2OXEA 3GLUA 2OGWA 5H70A 2B83A 3GP3A 3UJBA 4II2A 1A82A 3K73O 1AGXA 3PNKA 1F7UA 1IUKA 1AZSC 5FHQA 1UL1X 3MMPA 1EZ1A 4GP9A 2VLBA 3EC1A 3IURA 4KQ6A 4LNAA 2WKWA 4GYYA 1D09A 4KQJA 1RYDA 2IPNA 3X1KA 2CXTA 3NXKA 5TX7A 2VI5A 4XB1A 1QB7A 2X7XA 3KSDO 4OUDB 4R9RA 3N1UA 3EYWA 4JX9A 1AB6A 4EJMA 2IEGA 3UTDA 1WB5A 1M6VB 4FP9A 2EBUA 1YTLA 3BWEA 3RVKA 3HCRA 2AHRA 3CUTA 4CCYB 2DB3A 4WFIA 2CJYA 3OQBA 4Y9TA 4NCAA 4G37A 3I28A 2P69A 2CF5A 1H5NA 4XEUA 5JJLA 3DGFC 1ODLA 4K9RA 1JHOA 4U9IS 1Z16A 4D4IA 2FLWA 1DBIA 4HAIA 4CMCA 2W43A 2AOVA 3REFA 2IXTA 3NYRA 1ODTC 3QIAA 1EBBA 4H1HA 5FNVB 1TVKA 2XBLA 3EGOA 5JXHA 3OY7A 1XL1A 2HUNA 3W5CA 3GEDA 8OHMA 1CUYA 1Y42X 2ZIXB 3DTNA 2QP9X 4QPJC 3NB0A 3TR6A 1QIMA 5DWDA 5P21A 4Y0AA 2H9IA 1CFJA 4W8OA 1UPFA 3HDHA 4FMBB 1T3TA 1GLNA 5B1DA 3DG9A 1A9XA 1JKIA 3GJTA 3UBMA 4OVKA 1UM9A 4BNXA 4B6QA 4YTEA 3M5PA 1YBVA 3ODPA 4YNBA 2LKCA 1VLMA 2ZPAA 4EB8A 2V65A 1XDBA 2C57A 2KBEA 5KJFA 3AU9A 2OV6A 1E4VA 5DIFA 3OA2A 3GZ4A 4R1TA 2HHAA 4OPMA 2G1KA 3RWBA 1ADJA 2HSEA 2H29A 3PIDA 3SY8A 1H1TA 1P9RA 3TM5A 5B7GA 2CV0A 1LGYA 1MU0A 4HBGA 1ZU4A 3MTAA 3QELB 4C05A 2GWHA 4QEDA 1OIVA 1XD2A 1VPEA 1ZVJA 2EATA 2ZWAA 4D56A 1BVUA 4AUKA 3H6KA 4KDRA 2QMOA 4RL6A 3V34A 1ECBA 1NVVQ 1R6UA 3O82A 4UZFA 4E5KA 4X24A 1TM3E 3N07A 1W9MA 4WXPA 3WWYA 4AMZA 4QXAA 1UANA 1X13A 1H0RA 2DLCX