3WXBA

Crystal structure of nadph bound carbonyl reductase from chicken fatty liver
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
269
structure length
269
Chain Sequence
b'SSGLVPRGSHMGELRVRSVLVTGANRGIGLGFVQHLLALSNPPEWVFATCRDPKGQRAQELQKLASKHPNLVIVPLEVTDPASIKAAAASVGERLKGSGLNLLINNAGIARANTIDNETLKDMSEVYTTNTIAPLLLSQAFLPMLKKAAQENPGSGLSCSKAAIINISSTAGSIQDLYLWQYGQALSYRCSKAALNMLTRCQSMGYREHGIFCVALHPGWVKTDMGGTLEDKSRVTVDESVGGMLKVLSNLSEKDSGAFLNWEGKVMAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title A novel NAD(P)H-dependent carbonyl reductase specifically expressed in the thyroidectomized chicken fatty liver: catalytic properties and crystal structure.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase activator
total genus 88
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wxbA00
5A4DA 3INRA 3M1AA 1DSSG 5A9SB 4H16A 3SXPA 3S2IA 1Q0LA 4D46A 7MDHA 1U7TA 3JSAA 5H83A 1B26A 3O8QB 4YTEA 1ZEMA 4JCOA 3UGKA 3NRCA 2DM6A 3VH3A 2D8AA 4MOWA 4KDFA 2B36A 2BH9A 3CPSA 4NFHA 3ZWBA 4E0BA 1R4NA 3ZWOA 1G6KA 2ZTLA 4M49A 1W6UA 1F8GA 1JAXA 2DTDA 4J3FA 4BO6A 3WGIA 3WQQA 2GYYA 2J3IA 2PGLA 4J1NA 3OJ0A 3ADOA 2VWHA 3HQ4O 4MO2A 2NNLD 3HG7A 4BGEA 4DREA 4RGBA 4DQUA 3K6JA 5CHEA 1LRKA 5EMHA 4B79A 2B4RO 1Q7CA 5JYDA 5JMPA 1CETA 3DZHA 3EY4A 1I01A 1GUYA 4PN3A 3GEGA 3EHEA 4MVJA 3X2FA 4EEXA 2XAAA 1RPNA 1HYGA 3WOHA 1HLPA 3I1JA 1LLUA 1PJBA 3AU8A 3UVEA 1IUKA 5T57A 2Y1GA 1TEHA 5TJHA 3L9WA 4OKNA 3NT5A 4HP8A 1WLYA 4IMRA 5AQ1A 3C1AA 3QLJA 4AJIA 1T2AA 3SLGA 3CMMA 1O89A 1PJSA 1ZO8A 4WJZA 1YJ8A 1KVRA 2PZKA 2YFQA 4NNJA 4M54A 5G0UA 4A26A 1HKUA 2X86A 2O3TA 1CEQA 5FF9A 1KERA 2WD7B 4YRBA 3TFOA 4O5OA 1A4IA 2AEJA 4K6FA 4PRKA 5U4QA 3UW3A 3WICA 4BV9A 2E6UX 4CM9A 4WEQA 5CDUA 1NPDA 3TDKA 2A4KA 4UUPA 3C1OA 3KETA 3W8FA 2DU8A 3JQGA 3DONA 1CWUA 4QUKA 1GADO 1Y9EA 4ZQBA 3U62A 3ZWCA 1F0YA 1NFQA 1MG0A 3K30A 4ZU3A 1P1HA 1T25A 3LLVA 4BS9A 4NK4A 1T1RA 5THQA 4FOSA 1KEPA 4ND2A 1UDCA 4GGOA 3NX4A 3TL2A 3LT4A 1R16A 4Q39A 4GWGA 4YACA 1U8FO 3WFIA 2DBVO 4TZKA 2DQ4A 4LW8A 2Y1OA 4J1SA 4OAQA 1H6CA 4D42A 3PDUA 3ZV6A 3UAGA 2OMEA 1XWFA 1Z7EA 2DBRA 3KBOA 4D44A 1Y8QB 3WGZA 2ZYDA 4BMVA 1DRUA 1NWCA 4EUEA 5L4SA 3FF4A 3DQPA 3ANLA 5GY7A 4YJHB 4WLVA 9LDTA 3PI7A 3RAJA 2VHZA 4EJ0A 2O2YA 2UUPA 3FPLA 3CINA 1PS9A 4D43A 4EJMA 2Q3EA 1NQ5A 1IOLA 3OJOA 4Q3EA 3RKUA 4I5GA 4XYEA 3JYOA 4L73A 3AU9A 2NADA 3EK2A 1Q1NA 1P74A 3UCXA 4OOEA 1Y8RB 1YL6A 4GGPA 3H65A 5TT1A 2BFMA 2PWZA 1ZK0A 3KYBA 2GR9A 3I4CA 4RVSA 4FB5A 1AN9A 4FD3A 3DBLA 4AJPA 3ZNOA 5JC1A 1G0NA 4FSHA 4D45A 4W9NC 2YQ5A 4R9RA 3GGOA 4NZ9A 3GEMA 2AA3A 1LDMA 3G17A 4WASA 1ADCA 3S8MA 4KWIA 1KY5A 1QYWA 3S2EA 3HDJA 3OA0A 5HS4A 4F6LA 2OXIA 3ZWMA 1LU9A 4JIGA 3QVTA 5KWEA 3I6IA 4Z9YA 3TZCA 4RPKA 1EFLA 4DA9A 2B5VA 3F1LA 1EQ2A 2I9PA 2NACA 4AJLA 3BAZA 4BNJA 4YQYA 4TKMA 2X58A 3H5NA 2EP5A 4Q3NA 1HDRA 4DYDA 1Y6JA 4TRRA 4XQ9A 2O23A 2PKQO 5JXWA 4AVYA 2FWMX 3KVOA 4XIYA 4N7RA 4NBRA 4NK5A 1L1FA 4PLGA 5DN9A 5ADHA 1UZMA 1CYDA 3W4KA 4DIBA 2IDZA 2GDZA 2IXAA 2ZB8A 3M2PA 3GHHA 1EUCA 2P5YA 3GVHA 4ZRMA 4ALNA 4CQLB 3K31A 3KOUA 1LSSA 3QVSA 2QG4A 3PFFA 4PLCA 3BXXA 1YS4A 3TZHA 4OXNA 3KEQA 5GMOA 2VN8A 3CKYA 4D3DA 1DOHA 3GN1A 3HDHA 3IQDB 5CDSA 3AFMA 3LT0A 4XZ3A 3TPCA 2PTGA 1ZIDA 3TWOA 4YT8A 3ZH2A 4CQMD 1HRDA 4MIYA 3CTMA 1UAGA 2JD1A 2QZ9A 3F4LA 4I8XA 4PLVA 3S55A 5A06A 3RIHA 1E5LA 1NTOA 1ZSNA 3Q1LA 1NASA 1XDWA 3ITDA 1BHSA 3RASA 4YT2A 5ER6A 1PJCA 5C7IO 4R68A 4RVFA 5DOVA 1HE2A 3FTPA 1ADBA 2BELA 5KNLA 4BNNA 1PU2A 4F6CA 1MC4A 2VHVA 2X8LA 1I32A 3SEFA 5I7FA 3GMSA 4JBHA 3ZHXA 4JBGA 3V2HA 3GGGA 4B7UA 1CF2O 2WD7A 3SJUA 4CL3A 2FPGA 2I5PO 3QQPA 5TRTA 3F1KA 3MTJA 1K0UA 4MVJH 3WGGA 3WMWA 2HO5A 1TXGA 2O4UX 1ZSYA 1HE3A 4IQGA 4N5LA 4XWYA 4KUGA 3TOZA 3Q2KA 2FR1A 4HFMA 5IZCA 1DJNA 1FDWA 1V3TA 2E4AA 3WMXA 3NTOA 4IJWA 1GPDG 4KQXA 4DBZA 4L76A 2FSVA 2EF1A 3AY6A 3L4BC 1AE1A 1XA0A 2G1UA 4WPGA 3BHJA 3A28A 2C2YA 1YJQA 4ZD6A 3H9GA 4FGWA 1QYXA 2PGDA 2JCYA 3KB6A 2OP1A 1AXGA 3E9NA 3SC6A 4JX8A 4B8ZA 1BVRA 3DZGA 4IIUA 3V5NA 3OSUA 1X1EA 4H3VA 4ZHSA 3DEYX 2CF6A 3IMFA 1U3WA 3NAQA 4WOKA 1DAPA 5HRUA 3Q2IA 3QV1A 1ENZA 4NBWA 4L8VA 1R6DA 2EV9A 3P5SA 4A27A 5BR7A 4JP3A 2GNAA 2AHRA 4BO9A 1Y8RA 2AE1A 3JQFA 3WS7A 1F06A 4IDAA 5L4LA 1LQUA 4U5QA 1XU9A 6ADHA 4PFJA 4FJ0A 1BTOA 5KIAA 2RBEA 3VPXA 4FS3A 3DC2A 2VUUA 4DBVO 5BSFA 5L40A 4HADA 3GUYA 5H81A 3DOOA 4UAGA 3KLPX 1QKIA 4UVDA 4E5NA 1HDGO 1DDOA 3C7DB 1MXHA 3WYEA 3WX0A 1DEHA 4W99A 1BXKA 1LDBA 1H94A 3R1IA 1FDUA 1HLDA 1HF3A 1CRWG 4NHEA 2W98A 1IHYA 3I9NA 4IS2A 5BSGA 1GQYA 2NUAA 4O59O 1NVGA 2NV6A 1BXGB 2AG8A 1OOEA 3I52A 1DBVO 3QRWA 3GN2A 4OHUA 3VZRA 1GCUA 5A02A 2IE0A 1PGOA 1NFRA 1DHTA 2D59A 3R0IA 5JLAA 3E48A 5CAEA 1C1DB 1I2ZA 1KETA 1YKFA 2DPGA 4ZQHA 4L4SA 3QWIA 3FNEA 4XB1A 2DFDA 3KYCB 2IXBA 4RZHA 4BL5A 2C20A 5CDYA 4OIMA 4CMGA 1GAEO 2GGSA 1F17A 4J4TA 3OJLA 4ID9A 4PIVA 4CQLA 1HZZA 1IY8A 4D0SA 2WMDA 5L51A 3KEOA 3T4XA 3EGOA 3DXFA 1PEDA 4FR5A 2X0NA 4LMPA 4XYBA 5EJ2A 1K3TA 4Y6PA 3KTDA 4I9HA 1QP8A 1RM0A 4J1QA 1VPDA 4WLOA 1DC5A 3GG2A 4XD2A 1ZEJA 1H6DA 3UXYA 4DGSA 1ZNQO 2NQTA 4E13A 1QR6A 1EVYA 4FQ8A 4EJ6A 1QYDA 1R0KA 1H2HA 1UP7A 1M6WA 2HQ1A 4GL4A 1OMOA 3JQDA 4YBZA 2EGGA 1DFGA 2I76A 3D5TA 2Q4BA 1J6UA 3W4IA 3JQ9A 1P1RA 1T24A 2ZB7A 5JCJA 2HMWA 2HMSA 2NVUB 3M6IA 1IULA 3UICA 1Y7TA 3ZHYA 2B35A 4R54A 4IJVA 4D7AA 3PJFA 4NU6A 3I5MA 2OGUA 1IYZA 3GZNB 1HDCA 3FI9A 4TVOA 4KOAA 1E3WB 3RC1A 3GR6A 3RUIA 2BFAA 4B4UA 1SO8A 5DP2A 4KP7A 3O03A 1WW8A 1IL0A 1LNQA 3VZSA 2BHLA 3ONEA 3F9IA 4R51A 3ZWAA 1EUZA 4IY1A 1DC4A 4Z9XA 3IDSA 3AJRA 1LQTA 1UJMA 2JFHA 2ZTMA 3Q11A 3ZU2A 1I3MA 1X7HA 2D5AA 3QVXA 3EDMA 1TA4A 5A04A 1K89A 3D3EA 1DRWA 4CR8A 3HNPA 3ZWPA 4YWJA 4XGNA 1CQJA 4OO3A 2VCYA 4PLYA 4ESOA 4AJOA 4E32A 3ZGYA 3HJAA 3U5TA 3D64A 3K96A 3DAFA 3V1YA 1QYVA 2WWRA 2W4QA 3UHAA 3HFGA 3IUPA 4CM8B 1YBVA 4CUZA 4DIOA 2CDCA 3PRJA 3MWDB 4NU5A 2Q49A 4EGFA 4UEKA 3VTFA 4CMIA 4S3MA 3HB5X 2Q46A 5BT9A 5JAQA 3A14A 1ZVMA 5DP1A 1E3SA 2CUKA 2WD8A 3G1TA 1DIGA 4XQCA 3DBRB 1UP4A 3KYDB 2P2SA 4M8SA 5I8ZA 4HFNA 3JTMA 4RZIA 1KEUA 5BNTA 1NPYA 2A92A 1NPTO 4BO2A 4EBFA 1JN0A 5IZ4A 3WNQA 4BNXA 1RKXA 5IN5A 3EAGA 1LJ8A 1J0XO 1ENYA 3FWZA 3GT0A 1NXQA 3T4EA 5AYVA 3VPFA 3NT2A 2VZ8A 3H3JA 3FTNA 1BXGA 2EJVA 3G1UA 1J49A 3GVXA 3OIDA 1PJ4A 2HK7A 1LDNA 5G2OA 1WNTA 1WDKA 1XKQA 5EINA 1O0SA 4KUHA 3NDRA 4NH4A 5HS6A 3GRPA 4JGBA 1B8UA 4HKTA 1M76A 3WGQA 3QWHA 5CDGA 3KYCA 3AI2A 3HB4X 4P4NA 1AXEA 3DZIA 4ND5A 3VVCA 1T4BA 4BO0A 4HWKA 3O9ZA 3VKUA 3D4PA 5DCWA 1P33A 1RYEA 2J3HA 3I9OA 4BNYA 3H5RA 1NAHA 1WDMA 4IBOA 4E2ZA 3VTZA 2D5CA 1K2WA 2HLPA 1LC3A 2JKVA 1D3AA 1X7DA 1E3JA 5TJ9A 5K0ZA 1PZGA 4XR9A 1GTMA 4RVGA 1ZJYA 2PD3A 3AY3A 1UXJA 1N8KA 5EIOA 5L7WA 2ZK7A 1RYDA 3BMCB 1O6ZA 2BGLA 4BHTA 3NGXA 1HDYA 3SBOA 2VRBA 3RC2A 2A35A 2AE2A 2HUNA 3IKVA 4YDRA 2CMDA 3HE3A 3WIDA 1H2BA 3QWAA 4YJGB 4FW8A 2X5OA 1BMDA 2OO5A 5I8WA 3BMOB 3UCEA 2Q99A 3B1JA 3OM9A 3IJRA 4RVHA 2VUSA 3PJGA 1QMGA 1I8TA 1N9GA 3GZNA 1DIRA 4CLHA 4E30A 2W8ZA 4RLSA 2NU7A 1M6HA 3WJ7A 1EZ4A 3RFXA 4DC0A 3JD2A 4UREA 2IZ1A 1IZ9A 2O7SA 2ZQYA 3E9MA 1GPJA 2FR8A 3ZZNA 4PLZA 4ALLA 1VJ0A 1ADFA 3JQAD 4CMEC 3HHPA 2AQKA 3LT2A 2ET6A 5BNFA 3H5AA 3ROPA 4B4VA 4HXYA 3FHLA 2PZLA 3KM0A 4WCFC 4HFJA 1E5QA 1N5DA 4R16A 3A06A 2P9GA 4MINA 1I24A 1Y9AA 3I23A 2X9NA 3JQ8A 4YPOA 1MA0A 3DZKA 3ZWWA 3PHIA 3FNGA 3HWRA 3AOEC 2PKRA 1JTVA 1NFFA 4XEHA 1ISFA 3B20A 3F5SA 4J7UA 4LSWA 1Z7BA 3DMTC 2HDHA 3OETA 5L95A 3H6KA 4KZPA 3TSCA 4WOJA 4AICA 5AXBA 3LDHA 2Q2WA 3KLMX 3ZCXA 5JS6A 3Q6IA 5JDIC 3PIDA 3VKVA 2YHIB 3DBRA 1T1SA 3QE3A 4GVXA 1X1TA 3NV9A 4JN6B 5A3JA 4LRSB 1ZMTA 4L4XA 1Y81A 5DULA 4ALKA 4ITUA 3AI1A 2EKPA 3OQ6A 2BKAA 4JJFA 4WE3A 9LDBA 3U3XA 3JQ6A 1LTHR 3DDNA 2Y1EA 2J3JA 3TZQA 2X22A 3CXRA 2ZYGA 4QO7A 4YJDA 1O5IA 4UUOA 1VL0A 2DBQA 5AXCA 4GX2A 3WR5A 1E7MA 1EE2A 2C5AA 1X15A 1YBAA 3H9QA 3NKLA 3MOIA 4BNLA 2JCVA 3WQSB 5U1PA 4IINA 3SX2A 2JAPA 5EQFA 4BGVA 3ETDA 1IZ0A 4G5HA 1SZJG 2SCUA 4FOOA 3WJAA 1GU7A 4PLFA 1ENOA 1LEHA 1W4ZA 4IDCA 5EQDA 2RIRA 2YDYA 3N7UA 2C07A 2FRDA 3RJ9A 1DIAA 1PL7A 3H3FA 1TT5B 1V3UA 3L77A 1LLQA 4OQZA 3DFUA 3PYXA 1I0ZA 2Q1WA 4XYGA 4Z3DA 4YAJA 1HE4A 1A4UA 4R1SA 4IXWA 4L4RA 4OSOA 3I9JA 4I5EA 4YAGA 2EW8A 5CEEA 2Q50A 2Q4EA 5H82A 1B7GO 1HETA 1MB4A 3WSWA 1Q7BA 1EDOA 2ZATA 3BA1A 4BNZA 5CDTA 1UDBA 3OEWA 4YJFB 3PZBA 2Y1FA 1V0JA 5TQVA 3RVDA 5JYEA 3WYCA 2E48A 3KHUA 1OAAA 2C82A 3ST7A 3DTTA 2JD0A 4GLOA 4PLHA 4GPD1 3BMCA 2VHWA 1E1MA 1LSJA 1YWGO 3WGYA 4CM4B 4OGWA 3STHA 3D7LA 1ID1A 1Y5RA 4PG8A 4MPDA 4IPTA 1XCBA 2I67A 2OHXA 4P4LA 4YCAA 3TRIA 3DZBA 3MJSA 3DFZA 4ROSA 4U0KA 1VSVA 2HJSA 3GOHA 2VZ9A 3EVTA 3K92A 3MJCA 1U28A 4GX5A 4CQMA 3R3SA 3H9UA 1UH5A 4RPGA 1GV1A 3BMOA 2I99A 1P3DA 2H63A 5EN4A 1VKOA 2HRBA 1OC4A 2O3QA 2DPHA 3VC7A 3KXDA 4NBVA 5B12A 3BMNB 4AJHA 4ONEA 1TVEA 2VYVD 1P44A 1HSZA 1Z74A 1SCUA 4RDIA 1IHXA 1EVIA 2BI7A 4BUCA 1YOVB 4JNKA 4EUFA 4GWKA 4WLFA 1PQUA 1MG5A 4MDHA 1K6JA 4XDZA 4OXYA 3GNSA 1RJWA 5K6AC 4ND1A 1U3VA 4L9RA 1YL7A 5A1TA 3FNFA 2JCXA 4I08A 3U9LA 3RUFA 2C2XA 2GASA 4RPJA 4AJ1A 5BSEA 4Y6SA 4XJTA 5F5LA 3ZW8A 2J6IA 3CUKA 3WLFA 2P5UA 1LX6A 3GVIA 4G65A 3CEAA 4CR6A 2C5EA 2O4CA 4E5YA 3E03A 3RBZA 1GZ6A 2UDPA 4IDEA 1DC3A 2D1YA 3PK0A 1KC3A 1E3IA 3QP9A 2W2LD 3ZWVA 1JVSA 4QX6A 1XEAA 1LSUA 1WWKA 4CODB 3UH1A 2VHXA 2CDAA 2C7VA 2YHIA 5COBA 1XQ1A 8ADHA 5L4NA 3H2ZA 4PZCA 2DFVA 4YT4A 3HSKA 2Q1UA 4MIOA 4R01A 4BGIA 4CV1A 2VQ3A 1HYEA 2GN8A 2P4HX 2JHGA 3F46A 4J9VA 4RVUA 3GAZA 5F5NA 4EZBA 2J5RA 1XELA 2JHFA 5IAAA 4WLUA 2BLLA 4B8WA 3LU1A 5C37A 3PHLA 2X5JO 3E6AA 3SJ7A 1K6XA 2HJRA 3KZVA 1N1GA 1G1AA 2IEBA 3PGXA 3H7AA 2G76A 4CJXA 1A72A 4TKLA 2J8ZA 4WLEA 4D3FA 3ROQA 1XSEA 4P22A 1Y1PA 5A9SA 5I7EA 2JAHA 5ENDA 1GY8A 4PLPA 1KYQA 1E1KA 1YONA 4PG7A 4RF3A 5KOIA 4HX5A 1JKJA 2GO1A 1P77A 2HCTA 3O8QA 4GVLA 4O6VA 4U7WA 3V1UA 1J5PA 1NVTA 1VJ1A 4P38A 4MP8A 3ITKA 1TT5A 4CR7A 2OP0A 1W8DA 1MFZA 2V65A 4DXHA 1MX3A 4HUJA 3C1TA 3C7CB 3BTOA 3GA0A 4WNCA 3V8BA 3JD0A 4GSKA 4ALMA 4UUMA 4E33A 1PJ3A 3SLKA 2QQ5A 1U3UA 4BV8A 3L9XA 5EERA 3V2UA 4XYLA 1PGJA 4F3YA 2VRCD 2WTBA 5HM8A 1ISGA 2NU8A 4YJFA 4GKVA 5COQA 4GSLA 4I1IA 3IJPA 5JY6A 1H93A 2CD9A 3FSRA 4FBGA 5L53A 3CIFA 2VYND 1A7KA 2AEFA 4E2WA 3JYPA 2UAGA 4J0FA 5ES3A 3UKOA 3RBXA 3H8VA 4PG4A 2VZ0A 2C59A 4GH5A 1R12A 4NBTA 5JO9A 4FIZA 4ZQGA 1GQ2A 1C0IA 1TLTA 2O3SA 2XF8A 1B16A 4J43A 5IDXA 1GFSA 3VZPA 4CL8A 2CNBA 3DBVO 3F6YA 3M1LA 3AM4A 5A3VA 1M75A 1YQDA 4DC1A 4NDNE 3JD3A 4OJNA 3IL2A 1NBOA 2R00A 2Q2QA 1S6YA 3JYQA 1E7SA 4WKGA 4Y67A 4FN4A 3GPDG 1E3LA 2FN7A 3BMNA 4YB8A 3RUHA 3PLRA 3P19A 5FWNA 3CE6A 3WIEA 1LUAA 4J7CA 4JROA 3AWDA 1I10A 3SC4A 1YOVA 2OUIA 4GI2A 3DZJA 5IDQA 3ORFA 4PZEA 5T5QA 3GK3A 4LGVA 5ENVA 4BNGA 3K9QO 4IJKA 2RHRA 2IEDA 4OL9A 4C7KA 3ZNPA 3ZWNA 3AI3A 2GN9A 3MEQA 3PQFA 4XQGA 4BB5A 2AW5A 3UUWA 4BOYA 4BQPA 3QY9A 5FI5A 1R66A 2O3UA 1WMAA 3KRTA 3PDJA 3WWYA 1NX6A 1MFPA 2AMFA 3BTUA 4IUYA 4D3SA 5HA5A 4IM7A 2I6TA 2PZJA 1D7OA 4J16A 3JQAB 4R41A 5F3RA 4TMFA 4GX0A 2NM0A 4ALJA 3JYLA 4GBJA 5C3MA 1VL8A 4L0QA 5JW6A 4CUKA 4E5MA 4HFRA 4Y98A 2PH3A 1EQUA 1GYPA 3DHNA 1T4DA 4MVJP 1Y8QA 3E8XA 2GUGA 2VWQA 3Q3CA 4J1TA 4KMSA 3NJ4A 4RV9A 2QW8A 4Y8VA 2PD6A 3GAFA 4I5DA 5G0TA 4YJHA 4NFYA 3LZ6A 4UVGA 5KKCA 1X7GA 1D4FA 3LC1O 1V6AA 3VHRA 3PFWO 4RJTA 4GMFA 1PIWA 2V6MA 3EC7A 4CMHA 1R4MB 1A27A 2FY8A 3GDGA 3HFSA 5ICMA 1LRLA 3JCZA 3DAPA 5JO0A 1ADGA 2V6BA 5EESA 4DLLA 2NTJA 1VI2A 3W8DA 2O2SA 4BB6A 3DHEA 4W7IA 2YHUA 2FPIA 1DB3A 2D2IA 3PGJA 1U4SA 2JD2A 4HV4A 1DIHA 4NFSA 3INGA 4URFA 3VVBA 4J2HA 1MXFA 3GRKA 4CMCA 1FDVA 3AOGA 3QHAA 1B3RA 1ZK2A 3RU9A 4FCCA 2G17A 5B1YA 2JJYA 4AJJA 3A4VA 5L9AA 4E12A 2P4QA 1WMBA 2BGKA 4WUVA 3UFXA 1B0AA 4CUJA 1VC2A 1XIVA 3WGHA 2E49A 2FP4A 4DLAA 1ONPA 4CLOB 5IXYA 4BNMA 1KC1A 1HE5A 1WZIA 3DTYA 2YDXA 1JQBA 4FFLA 1TT7A 2CVQA 2HRZA 4MVJG 3ZHBA 4HY3A 2BI8A 2A94A 1FJHA 5JAZA 1S7CA 4UEJA 1UXGA 5MGBA 5A05A 3FD8A 5DT9A 5EL0A 3C7AA 4BQRA 3JQBA 1SC6A 5C5IA 2PZMA 1ENPA 4K26A 5T64A 1E6WA 2WJPA 3T7CA 3RFTA 3F47A 4A0SA 4JXKA 3IS3A 3KSUA 4DPKA 4DWVA 3GGPA 4DRYA 2PGJA 5DBFA 2Y66A 1JU9A 2FPPA 4JK3A 1EUDA 4Q3BA 3UN1A 4HNHA 1P31A 1MLDA 1ZCJA 4IZHA 3ZV3A 3B1FA 4ALIA 1PGNA 5I9LA 1JWAB 4BKRA 1ISMA 1YQGA 3FBGA 4J0EA 4D0RA 4KQWA 3PQEA 4CLRB 2DUUA 4TZTA 2O50A 4OMUA 2WE8A 4I9NA 1BVUA 2BFOA 1BRMA 5IF3A 5IZCC 4BNHA 5DNAA 1DPGA 1KVTA 5TSDA 1QLJA 2QRLA 1C3VA 1KIFA 2IODA 3D1LA 1DIBA 1C1XB 1ZSVA 5T8KA 1RM3A 3W4JA 1JAYA 5CPBA 3ENNA 2Y05A 4TWRA 4XDYA 2P68A 4XA8A 2VOEA 2XXBA 1FDSA 3K2BA 4AL4A 1GD1O 1L7DA 2QYSA 4AJ2A 4BO5A 1X13A 2B69A 2NVWA 1NR1A 2LDBA 5L7TA 4P8RA 4IS3A 4H15A 1X0XA 5AXDA 2PK3A 3GHYA 4OXKA 3L0DA 5T6BA 5A5EA 2CDBA 3N58A 5B4UA 4RORA 4W82A 4JQCA 1GEGA 3IP3A 3G3EA 1DFIA 3NTRA 3F5QA 1UXKA 4WLNA 3JQEA 1PJLA 1SEPA 3DB2A 3FNHA 3JQFC 4YRAA 1LC0A 3ADPA 3WG9A 1WZEA 1DAOA 1N2SA 1C0LA 1XR3A 4PZDA 5TF4A 4TRJA 4A7PA 5CG1A 1R4MA 3D3WB 4TRNA 3RQSA 1ZK4A 2F1KA 3LT1A 1KS9A 7ADHA 3I6QA 1N1EA 3E82A 3FPCA 2FOIA 4LRTB 5JSFA 5JAIA 3VZQA 2CFCA 2GPTA 3AY7A 4UVHA 3WTBA 4WGGA 3W1VA 4J7XA 5A9TA 4CV0A 4Q9NA 1N92A 4GMGA 5JDCA 1LRJA 2XPCA 4R69A 1IPFA 3K73O 1I3KA 4OKIA 1FXSA 2OL4A 3RWBA 3GDFA 3L6OO 4FFMA 1GDHA 4XB2A 2BMAA 2QZZA 5T67A 3BHIA 3PYMA 3QWFA 1YGYA 4XRGA 1EFKA 1NYTA 2QYTA 1C14A 2JL1A 4IDGA 3PQDA 5EPOA 3LC7O 1RWBA 2H1SA 2R2GA 1C1DA 3WBBA 2EEZA 1PJQA 3U49A 4WK6A 3ABIA 1ZXBA 3WSVA 2GF2A 3NUGA 2CVOA 1D8AA 4ND3A 4U0JA 3IOYA 2Y93A 3WGTA 3M2TA 2Y0CA 3QVWA 5A5FA 1B8VA 3C85A 3DHYA 1LI4A 4RF5A 5AXAA 1KY4A 3ZWYA 4RPLA 2B0JA 5TGDA 1KEVA 5I9MA 4LVUA 5DDIP 1LBEA 3D4OA 3ZWXA 3WFJA 4QQRA 1T2DA 3RD5A 3JQ9C 2VUTA 3FR8A 2X1HA 1UZNA 2QRKA 1U3TA 4J49A 4B3IA 1PL8A 5J23A 1PR9A 1U2GA 2TMDA 1T26A 3DWFA 4TQGA 4ZA2A 2NTNA 1YRLA 2I66A 4UUNA 3EUWA 5IDWA 5AVOA 3DOJA 5G0VA 2FR0A 3GVCA 1WP4A 4CLRA 4RL6A 2XOXA 1CQIA 2GN6A 2NVUA 3K8ZA 4F46A 3LLSA 1WVGA 5CEJA 4QTZA 5F21A 1LSOA 4C4OA 2IYOA 4R1UA 3HN2A 5G0WA 5IXSA 2YV1A 1I2CA 3AUTA 2I3GA 3S2FA 1M2WA 3ROKA 4DQXA 3PEFA 4IDFA 1E3WA 2QIOA 1A5ZA 2AG5A 4YQZA 5KJ6A 3OEYA 1O9BA 1T2EA 3DOCA 5KVCA 2X0RA 3ONFA 3E18A 3IIEA 1YQXA 2VYVA 4A10A 1NHWA 3C8MA 3O38A 2GZ3A 1QSGA 2EHDA 1I2BA 1ZH8A 1EK6A 1TI7A 2A9FA 3RI3A 4BIIA 5L45A 2XXJA 3IP1A 4DLBA 2IRWA 2ZQZA 4R5HA 1UDAA 4RQUA 3T7EA 4Z6KA 4FFNA 2O3JA 4IGFA 2X5KO 4XCVA 3HUDA 1GUZA 5KVVA 1PTJA 4W4TA 1GZ4A 3H9JA 4K6CA 4M86A 2GSDA 1ARZA 5FI3A 5CFZA 4CM8A 1EK5A 2AXQA 4XIJA 1QG6A 3VDRA 2WE7A 2Y0EA 1QV6A 1EVZA 3JQGB 1F8FA 1H0KA 4M89A 4PVDA 4Y6RA 1O95A 4XGIA 2I65A 3R3JA 4ZQEA 3WNVA 1FF9A 1R37A 2GZ2A 4AJEA 3D3WA 2JFFA 4R5MA 5A9RA 4J4BA 2W2LA 1MV8A 3FN4A 4MVJE 3KYDA 3QVOA 1ML3A 5FYDA 3E5MA 2NTVA 3MOGA 3OMLA 5IJZA 3OJFA 2ZJ1A 3GC6A 5G0SA 4E2YA 4QO8A 2YUTA 5KKAA 3OBBA 4B3JA 4RDHA 3CMCO 3RU7A 1ZW1A 3P2YA 1V8BA 1I36A 5L7YA 1JA9A 4XGKA 1SOVA 5BSHA 3SVTA 1GUFA 1UP6A 4BGUA 5HWSA 1V9LA 3OJEA 2X0IA 3MJTA 2YJZA 3P7MA 4PG5A 4DPMA 1JVBA 2WYUA 1SOWA 1ONNA 3GY0A 3B6ZA 3IKTA 4GAEA 3DBLB 1GEEA 3ZNNA 1P0FA 3V1TC 5G4LA 2V6FA 3AK4A 3L6DA 3NEPX 2C7GA 3EZYA 3ZU3A 5ILOA 2NWQA 4IQ0A 2OBYA 1QORA 2WYVA 2EGHA 2VTDA 4RPHA 4Z0TA 2HAEA 1NQAO 3F3SA 2D0IA 4CMJA 3G49A 4W9NA 2ZJ0A 2IZZA 1SPXA 4BNTA 2QX7A 2AQ8A 3FR7A 4Z9FA 4LK3A 4KTTE 1HL3A 4B7XA 3INTA 3I9LA 3I83A 4Z3KA 5CP8A 4LSMA 3GFGA 4GQAA 4NMHA 4O1MA 5LCXA 1U5AA 2VRCA 5KTKA 2B83A 1E77A 4OSPA 3AUAA 1EBFA 1XYGA 2CZCA 1CERA 3MZ0A 3LVFO 3A1NA 2BFPA 2VYNA 4I9UA 3TZKA 5JC8A 3ANNA 1U1IA 4E5PA 3BYZA 3JQ7B 4AJKA 4IGEA 4YRDA 4YJGA 2DTEA 1A9YA 5JMWA 1YB5A 4UULA 4B4OA 4AG3A 2BGMA 2EJWA 5B4VA 4M55A 3H4VA 2H5LA 3G0OA 1NHGA 4ZGWA 2GD1O 5DF1A 3B1KA 2X6TA 3KSDO 4LCEA 4CMAA 2DUWA 3TOXA 3UCFA 2OFPA 4YEDA 1SB8A 4OOFA 5KVQA 1LDEA 3OA2A 3QW2A 1O94A 5JPIA 4J4HA 2Y67A 2EXXA 3N74A 3ASVA 3EMKA 3PXXA 3TNLA 1NQOA 2HKIA 3GZ4A 4YYZA 1ULUA 4QFCA 5LDGA 4YA6A 3AW9A 4R3WA 2VNSA 3OQ1A 1H6AA 3PJDA 5GZ3A 2CVZA 2C54A 3VOSA 3C3XA 4DPLA 5B37A 1VLLA 1PS8A 4ZQFA 1IPEA 4YVFA 4TROA 2YV2A 3RUDA 3OH8A 4FFRA 3I9MA 2YW9A 5ITWA 4II3A 5LDHA 3L6EA 3FBTA 1HEUA 1F12A 1GR0A 1AHHA 1NP3A 3DBHB 4R3NA 5DCYA 1Q0HA 3AFNA 3PIIA 2UUOA 3ZU4A 4HNGA 3TZ6A 3JYNA 4MJLA 3TJRA 1M67A 3DZFA 5BQFA 3JD1A 1YDWA 2HU2A 1P1FA 1KVSA 3O4RA 5ER9A 2FHSA 2W90A 3RCBA 5U9CA 3VH4A 3RC7A 2G82A 1XQ6A 5KJFA 2RH4A 3CZMA 2ZYAA 1E1LA 1K6IA 5CPFA 2POQX 1GYQA 2YFHA 3DO5A 4RQTA 3WTCA 3ZV4A 3IUSA 3ENKA 8LDHA 2Z1MA 3K5PA 1VE9A 1P9LA 2BD0A 4K9DA 2DTXA 4EUHA 1I33A 1WDLA 3L4BA 3S2GA 4KWHA 4BKOA 4XJSA 2EIHA 1E6EA 4MVJM 2H9IA 5AOVA 3MCVA 1ZMOA 4RF2A 4WCDA 3AM3A 5KVSA 2I3AA 2Z5LA 2PKQP 1XHLA 5JAMA 3K2EA 4UEOA 4I5FA 5JE8A 1Q0QA 4K28A 4NBUA 1B3BA 4ZN6A 1E7YA 3IC5A 1GQQA 2HMUA 1DLIA 1A7AA 4H7PA 1SB9A 2TMGA 3PHGA 4OM8A 1YDEA 1N7HA 3GDOA 4QEDA 4A03A 4BNUA 1NWHA 1R15A 3DR3A 1OBFO 2LDXA 3DAGA 4F45A 2R6JA 3RFVA 4BKUA 2JFGA 1VKNA 1E7RA 4E3ZA 3QSGA 2HSDA 5F1OA 3PHJA 2EKLA 2ZIZA 1GV0A 4ZJUA 4IIVA 4MKZA 5THKA 3U4CA 3EVNA 5IDYA 4INAA 3ZN2A 1KEWA 3GG9A 4GX1A 3RUAA 4PG6A 1EBUA 4Q3CA 3NDIA 4CM4A 1ZUD1 1Z73A 3RUCA 3KO8A 3GNTA 3WDSA 3JQ7A 5F1PA 2PV7A 3BHMA 2VT2A 1UZLA 2DT5A 2PLAA 2NU6A 3VDQA 1EVJA 2GLXA 3WLEA 5G4KB 2X7HA 3GLQA 4LN1A 4NJMB 4S1VA 2X4GA 1BXZA 1MUUA 5L3ZA 1D1TA 3OP4A 1RM5A 2HMVA 4MP6A 4L74A 4MVJD 4E5KA 1JW9B 3NJ8A 4QSMA 5GZ6A 1ZZEA 3PJEA 4RCVA 4JP2A 2O48X 1NNUA 2OZPA 1PSDA 4MKRA 4XX0A 1MP0A 2AQIA 2IZ0A 3I9KA 4IZIA 4EI2A 1GCOA 2C0CA 1Q7GA 1ISHA 3LSYA 4PLTA 1PWXA 4R1NA 1VJTA 2RH8A 1PGQA 4DMMA 3E5RA 2BF7A 1HYHA 1TB4A 4NQZA 2D3TA 1U9JA 3LQFA 4U6QA 4WNIA 4DTIA 3CH6A 3BTVA 5CG2A 4PRLA 5I7VA 2Y99A 2G5CA 3A9WA 5FFFA 4YT5A 1P1IA 2ZKLA 2ZTUA 2EERA 1WPQA 4FFPA 4TSKA 4N5MA 1DJQA 4E4YA 5DOZA 1E3EA 4QT0A 4CM9D 4XKJA 4LMRA 5F1KA 3ETEA 3PHHA 1ISJA 4CM1A 3Q0EA 4GLLA 1PWZA 4A73A 2NQ8A 1JKFA 4KTVE 1HWYA 3KSZO 3L07A 4J9UE 3WQRA 4NG5A 4CLXA 3QJ5A 4NPCA 1UXHA 1NM5A 1Q2XA 2O7QA 1HTBA 3GQVA 4OH1A 2PA3A 3DBHA 4J2OA 4BO4A 2GERA 3FWNA 1PJ2A 4CV2A 4CPDA 1PGPA 5LC1A 2GRAA 3EW7A 1YH3A 1V35A 1U7HA 2PD4A 3QIVA 4L75A 3NYWA 3Q9NA 4AJ4A 5IFLA 4WECA 3AUSA 4A5OA 2Q2VA 4IDDA 4R4JA 3VPGA 5DZSA 3PYLA 1HSOA 4WEOA 3FCOA 4EDFA 2ILTA 2X9VA 5FEUA 4ZICA 1N7GA 1E0DA 4JLWA 1ORRA 1F14A 2EWMA 3S1LA 2RAFA 1PZEA 1QLHA 4PGFA 5ITVA 4WCFB 2UVDA 2ZB4A 4NR0A 5DBIA 3GPIA 2DC1A 2HK9A 3NT4A 3WYBA 4CMIB 5K9ZA 4FJ1A 3OIGA 5JNLA 4Y9DA 1C0PA 4CM3A 1G0OA 4TRMA 1ZXLA 4P4GA 3B70A 1IB6A 5JBIA 2EG9A 3U4DA 1DO8A 3UF0A 1LLCA 4BO7A 3LYLA 2Q1TA 3RBVA 3GMDA 4U6SA 1W0CA 5I7SA 4MIEA 3U4IA 1R0LA 1GL3A 2OOSA 3RUEA 1FK8A 4IDBA 4HBGA 4O63O 4QFDA 3ULKA 2Y1CA 4CLDA 3WGOA 2O3RA 1T2FA 3GNQA 4JJIA 1OI7A 3MJEA 1UUFA 1BW9B 4EW6A 2WDZA 3PWZA 2RHCA 1Z82A 4G2NA 1JLLA 4OQYA 6LDHA 3HADA 4OYRA 1BDBA 1H9AA 4YAKA 3G79A 1X14A 2P9EA 3VH2A 1XLTA 4BO1A 1YL5A 1PZHA 3JD4A 1AGNA 4M1QA 1U4OA 1HZJA 1JKIA 4JBIA 4B3HA 2NU9A 3ON5A 3PLNA 4UVIA 4B4WA 2FZEA 4XR4A 1K5HA 4IQ8A 1H9BA 1GZ3A 1XGKA 2R00C 2RCYA 1UR5A 3BMQB 3O26A 2NSDA 5KCZA 1CJCA 1I3NA 2PR2A 2WSBA 3ASUA 4A2CA 5G4KA 5KJEA 4YAEA 4NJMA 4IJUA 1KBZA 2G0TA 2YYYA 3LF2A 1ULSA 2EP7A 3VAZA 2Y0DA 2Z95A 4B7CA 1PX0A 1EDZA 2ZCVA 3JQCA 2CY0A 1SEVA 1Z75A 3KUXA 3QWBA 4R9SA 4CV3A 1H5QA 5IG2A 4CM5A 3R6DA 3AM5A 5TC4A 4DQVA 1PR3A 4D41A 4XYMA 2J3KA 3ANMA 2J5KA 4BKPA 4BO3A 2WM3A 3GFBA 4RF4A 1BDMA 1BSVA 4DUPA 1SBYA 2YZ7A 3OF2A 4YXFA 1V3VA 5KJ1A 1LXCA 1HT0A 4KUEA 4IXTA 3VH1A 2B5WA 4E2XA 1E7WA 4J90A 3OQBA 3RSHA 4RLHA 3X2EA 3NDJA 4W7HA 4CMKA 3JQAA 3ICCA 1YO6A 2ZCUA 4C7JA 1N9GB 4K1LA 1ZK1A 1AHIA 2VOJA 3COSA 3Q9UA 3I4FA 4J91A 4O0LA 4DL9A 1VL6A 1CIVA 3OICA 5B4TA 4CLEA 1PQWA 2QRJA 1SAYA 3U09A 1PJTA 2E82A 4XQEA 3EYWA 4MKXA 4ND4A 4BVAA 3GF4A 1YE3A 3DMYA 1Y5MA 1X0VA 3D0OA 1NAIA 2V6GA 1ZKMA 4U8GA 1PL6A 3GVPA 2B37A 4FC7A 4FGSA 5HTOA 1SMKA 4BNIA 3LK7A 3BZUA 1VM6A 5COAA 1A9ZA 4QXMA 4ZRNA 2VWPA 3PWSA 4CMEA 3TL3A 4JJGA 2GCGA 1XU7A 4TVBA 3NTQA 1I30A 1U8XX 2YQ4A 1CDOA 2DVMA 3JQ8B 1U2DA 4YR9A 1FDTA 3E1KA 4LCJA 1HDZA 3ZV5A 2CSUA 4QECA 4WCFA 3ICPA 5ILGA 3ROMA 2VWGA 3V2GA 1P0CA 1AUPA 5DCUA 2UV8A 1LDYA 1B2LA 1WAMA 2FMUA 3P2OA 5TNXA 2PH5A 4BKQA 4E6PA 5TT0A 1ZJZA 1M66A 3FRJA 4BNKA 1YB1A 2FZWA 3AOEA 3JV7A 2YV3A 4AJNA 1NR7A 3GEDA 4FC6A 4MP3A 2BRUA 1QYCA 4LVCA 4N18A 3DMTA 3HN7A 4UVEA 1QV7A 1EE9A 2P9CA 1JDJA 2ZTVA 2Y68A 1PQPA 3ZU5A 1C0KA 1R0SA 4FFOA 1KOLA 4XRRA 3MJVA 5I9NA 5JDIA 2DAPA 4PVCA 4CM7A 4CLOA 1B8PA 2W2KB 1BWSA 2C29D 3IAHA 3PZRA 1YVEI 3KV3O 4FDAA 3JQBC 4DIFA 1DRVA 1BW9A 1E6UA 1LLDA 2VTEA 5KJCA 1WXDA 1Z6ZA 3TN7A 1YBMA 1NQTA 5TS3A 4Q3AA 1OZAA 1MGOA 4G81A 2F00A 4BNVA 2EW2A 4Q3DA 3VPSA 1IE3A 2H6EA 3MTGA 1OFGA 4EEZA 2FSSA 3ZHZA 3MWEB 4EITA 3OECA 2V7PA 2NLOA 4RVDA 3BMQA 3RROA 4MVJF 2YY7A 4R1TA 4RO0A 2VHYA 2B4TO 1B15A 4BO8A 3PWKA 3HDYA 5JFOA 4D79A 1W73A 3U0BA 1Z45A 3W6ZA 1RM4A 1R4NB 3GUCA 1ONOA 5ICSA 3ETGA 1E7QA 4N5NA 2VT3A 4LISA 1I5RA 4ILKA 4NI5A 3WBFA 3WXBA 4GKBA 5MDHA 4MVJI 1QRRA 2AQHA 2X9GA 5C7LO 5C7OO 4N54A 1EMDA 5HBRA 3WB9A 3I3OA 4E21A 1ZFNA 3HDQA 3UOGA 1D1SA 4Z0PA 4CMBA 5T8KC 3MJ4A 1KVUA 1VSUA 2B4QA 3VPHA 2ZB3A 1VRWA 4FPXA 3ZW9A 3BIOA 1HDOA 3ZI0A 1ISIA 2QHXA 3OIFA 4BMSA 1C1XA 4DVJA 5JCJD 1PS0A 4NIMA 5TX7A 1PZFA 3ZNQA 4J6FA 1T2CA 5TIIA 4CQMB 3LC2O 1ZBQA 3DL2A 4NJOA 2J5QA 4Z0HO 1O8CA 1A71A 2Z1NA 2GZ1A 2OORA 1BG6A 3U4HA 3AUUA 1UXIA 4DMLA 3PP8A 1ZK3A 2IYPA 3W6UA 1H6BA 1BGVA 3GH3A 4X54A 4II2A 3PTZA 3TFQA 3BTSA 3W8EA 4M87A 3H2SA 3OFSA 3CZRA 1P1JA 3QA9A 1L7EA 3ZDFA 2Y1DA 2VNAA 1EEHA 1U5CA 2CF5A 2PFGA 2NVBA 4E31A 4PLWA 3F4BA 4BNWA 1HDXA 1DC6A 2X0JA 1FMCA 4CM6A 4EYEA 2DBZA 4BNFA 2GN4A 2Q1SA 4BMNA 3PPIA 3L4SO 3ONDA 5K6AA 2P91A 5DBGA 1DFHA 5JDCC 1SNYA 2HK8A 1GYRA 4IMPA 2D4AA 1YXMA 1E1NA 3LF1A 3NGLA 3H9EO 1KVQA 3OHSX 4PCVA 3RC9A 5IN4A 1DLJA 4AFNA 2OBNA 3D5QA 3RKRA 1HXHA 3TF5A 3CSDA 1JWBB 4KDEA 3E9QA 5A03A 1NVMB 4W6ZA 4YAIA 4ZVVA 5BNIA 1P45A 2AEMA 3EZLA 3C24A 1YB4A 1XG5A 2DKNA 3WWZA 4DYVA 1B14A 5TLSA 1DXYA 1DHRA 2EKQA 1I3LA 3TQHA 2W2KA 2UYYA 2WEKA 3PVZA 5JCXA 5JY1A 1E92A 1LDGA 2E37A 3RJ5A 2PNFA 2HMTA 2WYWA 1P1KA 3D4NA 3HZZA 1J4AA 5GZ1A 4FJ2A 2PY6A 2DLDA 1UAYA 2X23A 2Q45A 5CEFA 1LA2A 1QXSA 1MC5A 1OC2A
chains in the Genus database with same CATH superfamily
1WS6A 4LYYA 2WJHA 1M1UA 4HZUB 3INRA 3VNSA 1DTEA 3QEOA 1TVMA 3M4ZA 4KB5A 3PXBA 4HGOA 3JSAA 1Z28A 3ORRA 3ADKA 4X20B 1IWOA 1TUEA 2CJPA 4IMIB 5DBEX 1ZEMA 4JCOA 3ZY5A 1E8NA 3VH3A 1TF2A 2WVJA 4KDFA 3SR0A 4LZNA 1LH0A 4X45A 4NSNA 4TTPA 3V4ZA 2CV1A 3ZWBA 4X3PA 3LOPA 4BDSA 5K5EA 4DB2A 1WCYA 3EOZA 1G6KA 2WT8A 1RHUA 2ZTLA 2EFEB 3CZPA 1QE5A 3OPYB 4M49A 3W3ZB 1JAXA 3IQHX 4BO6A 2XNKA 3WQQA 1J33A 3WB2A 4ZC1A 2PGLA 3KWMA 3KJHA 4J1NA 1FS4A 4BZWA 1T10A 4QXOA 4JR0A 4MO2A 5FA5A 2QMQA 2A86A 4UOQA 1MB2A 2FGKA 1ZOPA 2R6AA 2ZQ5A 3P27A 2QQFA 3AR4A 5CHEA 4FHCA 2B4RO 1GQOA 2JFBA 4B79A 3U7GA 5JYDA 4ZU1X 3EY4A 1NOIA 1I01A 2GK3A 4LHEA 4C0HA 2QTCA 4PN3A 2QLBA 3RT1A 4I3GA 3X2FA 1JHUA 3ACBA 5GONB 2QX6A 2GH1A 2XAAA 5GPBA 4GBGA 1KU6A 1HLPA 1ZN8A 3LUHA 3I1JA 3ZTYA 1XQYA 2AR7A 4WADA 3MS2A 2EQAA 1V8ZA 3KDPA 2Y1GA 1XE3A 3NT5A 3Q7EA 4HP8A 3T3DA 2YWDA 1J2JA 3QLJA 2Z9CA 4AJIA 3SLGA 5F78A 1JR3D 1PJSA 3EGWA 1NSFA 1SBQA 3VU9B 3RSSA 1IZ7A 3MLBA 1TCUA 2O2CA 2X86A 1CEQA 2CNKA 4YRBA 4O5OA 1VOTA 5I3ZA 4OY3A 5I9IA 1JEYA 1U80A 3KTFA 4PRKA 3C5HA 2I2CA 2E6UX 4WEQA 1NPDA 1SVKA 1M2HA 2A4KA 2JVJA 1FYXA 3C1OA 4BEJA 4BV2A 3KETA 3OTHA 2I03A 1GADO 3ZWCA 4PPYA 1NN1A 3ASYA 3D8BA 3P4UA 1PI3A 1JU4A 3WHIA 3IODA 3WWPA 1YHZA 4RY0A 2XLCA 4WJKB 1TLFA 4FOSA 2ZB2A 4ND2A 4GGOA 3LAWA 2VI5A 3NX4A 3V3TA 2GAOA 3JWIA 3MGKA 1F2VA 1DMSA 1J06A 1U8FO 2XNHA 4PX5A 3K0EA 1RAAA 4BQEA 3LFUA 2DBVO 5IFKA 3VOAA 1AUQA 1GARA 4LW8A 4MEAA 3PJRA 1NY5A 1ESEA 4MQFA 3F3YA 1UOPA 4QZVA 2P0YA 4ZT5A 1JBKA 3I28A 4Y2PA 3T5DA 3M5DA 2ZUVA 2OFFA 4XLZA 2ICAA 3UAGA 1ZUNA 3MMNA 1F3LA 2X14A 4D44A 5BRNA 4K1XA 4DFDA 1VE3A 2VDLB 3T7AA 3WGZA 3H2HA 3O21A 1DRUA 1MTOA 1NUUA 2GF0A 4FCTA 4KQJA 4GI1A 4TTQA 3DQPA 5EJIA 2WIKA 5FLEX 1AMNA 1A04A 1GSIA 1W85B 3USCS 3ZZ1A 4EJ0A 3JS5A 2DZDA 2XOEA 4TKZA 5BN1A 1DKMA 1Z8DA 2UUPA 4YRPA 1P4SA 2SECE 3S3TA 2LIPA 2X0KA 4JEMA 2ZPTX 1AU9A 1G8FA 1V4VA 5AI9A 3ROEA 3CF4A 5LYJA 3WVNA 3R9XB 2MYPA 2MYUA 3GI1A 3E3MA 4I0WB 4JMLA 3TRDA 3UCXA 2SNIE 1P74A 2ZROA 2YXLA 4OOEA 1G6Q1 1YU6A 4GGPA 3H65A 2GPAA 5HMMA 1FBTA 2D7JA 4RVSA 4BMDA 4FB5A 1COWA 1TAGA 4FD3A 4QXQA 3LQQA 5JC1A 4FSHA 4JP1A 3L7YA 4PYOA 5H02A 4D45A 2YJNA 3GIWA 3ZYZA 5AK3A 2BZGA 2FPIB 5KSOA 1C7ZA 3GGOA 1H4QA 4WASA 2JAXA 5KSPA 4Z49A 3GD7A 4KWIA 3OE7D 1O08A 1QYWA 4M6WB 5FPHA 1PSWA 5H1YA 3NBZC 2BKLA 1Y34E 1J8MF 5E1BA 3FMGA 8ATCA 3DG9A 1ZLYA 2FWAA 4C5BA 2OPHA 2QZPA 3MTIA 1PSZA 3HSSA 4LDNA 4RPKA 1EFLA 2BFCB 4R2IA 1NKTA 1OJ7A 2I9PA 2HCRA 3BAZA 3ZDZB 1ZGJA 4YP5A 3O94A 4V2IA 1KOGA 2LRHA 1W9MA 2X58A 3HLTA 2P9FA 1B74A 3I53A 4M83A 4LBZA 4P9NA 3VU1A 4TRRA 4EKEA 5A62A 3EGCA 1RCTE 4IDQA 1D5CA 2PKQO 3G9XA 4MZDA 2C2ZA 5SZJA 1GKYA 1GSOA 2PYDA 2RGEA 4BV3A 1BE8A 4NBRA 1JDSA 1WUHS 3UT6A 1M73E 4Z4FA 2EWVA 4Y1RA 2RK3A 1ZJ5A 2A6PA 3BL6A 4IUDS 1U11A 2WIJA 4P5PA 2EGUA 2IXAA 1PBNA 4ALNA 2BHSA 4ZRMA 2DSNA 2P9TA 2PX2A 1FEZA 3KOUA 4LHZA 4I14A 2QYOA 5IEBA 1GPUA 1L1EA 1NQXA 1ZGHA 2NYVA 2VNHA 2ZSUA 5E1MA 1TM2A 3RF7A 3UWDA 4OXNA 5FUQA 1OWMA 4ZVRA 4Z86A 2WM2A 4EFKA 1T4CB 3S7TA 3CKYA 4JYBA 1DOHA 4RXMA 3HDHA 5CU7A 4ZJPA 3MTQA 3IQDB 2IF2A 5H3LA 1VB3A 2ONYA 4Q34A 3ZH2A 4MIYA 3CTMA 2G09A 3FOAA 5K7SA 3VO2A 5IVDA 2BBSA 3BHNA 2PBRA 1Z4LA 3BXFA 5AKEA 1XEFA 5LU8A 1ABFA 1BHSA 2XSZD 5DTIA 4HEJA 1KE2A 4U2GA 1J56A 1PJCA 1GGEA 4NXMB 5C7IO 2M9MA 3OPQA 3OTIA 3OX2A 4RVFA 4TWBA 4WTOA 4RSMA 3L18A 5DOVA 3I2JA 2O8DA 3O95A 2W2PA 4P5EA 1RABA 3L8FA 4MUYA 3K05A 4DCOA 4LJRA 2BELA 3QVGB 5KNLA 1FRNA 1EB8A 2J3LA 3QV2A 4MWSA 1MC4A 2Q41A 3NJRA 4RY8A 3X43A 4JBHA 4K6GA 4JBGA 5D86A 3V2HA 2FZVA 1C7FA 1PLLA 3IDQA 1XMOB 5TF0A 1Z6TA 4D6XA 4DUGA 2FW7A 3SJUA 4C9BA 3B1VA 4NRDA 2P4EA 1CE8A 3F1KA 3MTJA 4HGYA 2H57A 3WMWA 4B31A 1XZHA 4MV7A 2XUGA 2HO5A 1Q19A 2NZUG 5BV0A 1G5HA 2BR3A 1ZHOA 1ZSYA 4IQGA 3MUOA 2ONZA 4R8LA 3WFZA 2FR1A 3DDOA 4HFMA 5IZCA 2C0QA 2XZLA 1A88A 3LY7A 3WIVA 5GVSA 5CBPB 4O4IA 1A8PA 2E4AA 1XPJA 4MI6A 1RRKA 4F1WA 3E35A 5AJWA 2FFHA 2IGTA 1AVTA 1B8NA 2IQ5A 4AN1A 2EF1A 2G9NA 2P40A 1NMXA 2GPBA 3HU2A 3WLHA 1F5NA 1Y3DE 2CLEB 2I62A 4HNUA 3OPMA 5J40A 2WYOA 5IUJC 4FMDF 5K09A 2EX1A 2C2YA 2W0SA 4RENA 1YJQA 2VQEB 4FGWA 4CG3A 1QYXA 2PGDA 1AXGA 1UQTA 4MRNA 5J2TF 1BVRA 1TO2E 2X6QA 3DZGA 4LDZA 3OFKA 4Q1VA 3TH5A 1YJAA 3V5NA 5IT0A 1WPXA 1GITA 1YASA 2H08A 4HGZA 4PQGA 4UHFA 1IIBA 3IMFA 4FEYA 2PXHA 3N8HA 1DAPA 4L0CA 4QRHA 1IUPA 2KS6A 4IHJA 4RTLA 3PNKA 1B73A 2BMJA 4NBWA 4C0WA 5K6RA 3WIBA 3EDOA 1JL3A 3ANXA 3AY0A 3IDFA 4NS1A 4PTZA 7ABPA 4MCJA 5L3VA 4PO1A 5A4FS 5BR7A 5LJLA 1WHTB 1KP2A 1PT7A 2QX8A 4HLNA 4MA4A 5A3QA 4YJKA 5CNMA 3WS7A 1F06A 1FPMA 3G6WA 1LQUA 1FUKA 4JODA 1R64A 2Y4NA 6ADHA 3MJDA 4PFJA 2VPYA 4FJ0A 4P36A 4W1PA 3LCRA 4DBVO 2OZVA 3DC2A 3EDCA 1A7JA 2H16A 4LX0A 4ZVPA 1R6XA 3EQZA 4UAGA 3VUFA 2J3EA 2R7LA 5LN1A 1HDGO 1CUHA 2QN8A 4MH0R 2J7KA 4I8DA 1MXHA 5LMZA 1YRAA 3Q72A 1I4OA 2IKSA 2RHDA 1NG9A 3GLGE 1DEHA 1TZ2A 2OZLA 1BXKA 3EUEA 2R97A 3AV3A 3IVRA 5G1PA 2NV2B 1ZA2A 1R9NA 1GU1A 1HF3A 2W98A 4QUEA 2NZWA 4U39A 1ADYA 2Q3MA 5DPMA 1OYOA 1O8BA 1T43A 3IT3A 4QLBA 1GQYA 3K94A 1NVGA 1K5PA 1UT5A 2I2AA 1BXGB 1YB7A 2AG8A 2NV6A 1OOEA 3V4FA 5ENZA 3CM0A 4DWJA 4F86A 1E2NA 3GN2A 1NVBA 2FEOA 1BMFD 2GJ4A 2OM2A 1PGOA 5EJGA 3WO0A 1AC5A 2O2XA 4NENA 4GKJB 1NU6A 3ITEA 4ZYYA 4KFSA 1WR8A 2Z04A 1LK0A 2DPGA 4ZQHA 2UXCB 3FNEA 2ZBPA 4XB1A 2DFDA 3KYCB 3FHOA 3HBFA 4YONB 3B13B 1JEOA 3ND7A 4G85A 4BL5A 4CMGA 2EKZA 2GGSA 4XWGA 3W6NA 4DLUA 4GMHA 4M9UA 4J4TA 4ID9A 3FB4A 5TGTA 1ZMRA 3FJYA 3I34X 1HZZA 3REGA 4FWTA 2WMDA 5L51A 2QLTA 3K1AA 3T4XA 4EGQA 2W11A 3LW8A 3H2KA 4FZ3A 4U7PB 3G5LA 2F48A 1ZHHA 3OZVA 4MW9A 4OB6A 3VO1A 2IX3A 1EYZA 4ZHQA 1SKMA 1K3TA 4Y6PA 2HUPA 1R6AA 3KTDA 5K0EA 1QP8A 2WIAA 4J1QA 3EEIA 5AKZA 2J4FA 2XTJA 3NIGB 3D2BA 4LOKA 3GG2A 3AYXB 5ELLA 1ZEJA 2UUCB 1H6DA 4DGSA 4KK4A 1V5EA 1EKXA 1N2EA 5EQJB 1NVKA 5KYXA 1H66A 1R0KA 3B6IA 3NRBA 4ZI7F 1EG2A 4JDPA 1OMOA 5DNWA 4EENA 4DG5A 5IK2D 2EGGA 3G7SA 1RTTA 5EYPA 5AW1A 3EB9A 1T24A 1X1QA 2ZB7A 3OU2A 5JCJA 1CQIB 3NZEA 2NVUB 2GEVA 3MYYA 3OKCA 3K6KA 1PNVA 2B35A 4ZJYA 1IN5A 5ALLA 4OA5A 1TTTA 2JIDA 1QH0A 1OWNA 3IUJA 1SCQA 1F48A 1UM9A 1P0PA 2OKGA 3LW7A 3PJFA 2OGUA 2C5SA 3Q0IA 4G4SP 1IYZA 1GA4A 3GZNB 1HDCA 5BV8A 2VJKA 4YMLA 4TVOA 1ZVJA 3PC6A 1K6MA 4KOAA 1CJUC 1DAIA 1A8QA 2KX7A 4PSUA 4F3YA 3RUIA 5KWSA 2BFAA 5DWVA 3PFHA 4GP9A 1SRRA 3O03A 2PS3A 5BWCA 3L04A 3CF0A 1XDBA 1AKMA 2G0NA 3F9IA 1LJLA 1NNSA 1ESMA 5H68A 3SQLA 3UXEA 5J4VA 1PV4A 2V58A 1IBRA 5E2BA 4DLPA 2NMVA 4Z9XA 3OO0A 1LQTA 4EMUA 2JJMA 1UJMA 2EX0A 3NFYA 2JFHA 3ZU2A 1S3FA 3EDMA 1TA4A 1E61A 1NURA 5AW2A 1M0SA 3CPEA 4YWJA 5LD2B 5DI3A 4MGHA 4KX3A 3RJTA 3MT9A 3IDAA 2X9LA 2ZEJA 4TQAA 4ZKDA 4LQCA 4DIKA 4MRMA 2PX8A 4KXUA 2ZYIA 1HURA 1TYZA 3V1YA 2PUJA 3G89A 5DJ5A 2W4QA 4MQ4A 3HFGA 1UJNA 2PL9A 4H60A 4NDZA 4Y0NA 5FPQA 3UHAA 4CUZA 2VQ6A 4AMGA 1E9AA 4LDPA 1ULHA 3HB5X 4F2GA 4D0LB 2ZUBA 5JAQA 3G8AA 5DP1A 4CI0B 1RAHA 2CUKA 4OQ4A 2ODNA 1WULS 1XTVA 2BGWA 1YHNA 3H7IA 2XUKA 5FULA 5JYCA 1DIGA 2BEUA 2W2VA 4JVMA 2CVFA 3GDHA 1UINA 3HM2A 4X94A 3I9V6 1UP4A 1WA5A 5EUCA 4HFNA 2Q5EA 1F4PA 1J0EA 3IPXA 1S2LA 1M10A 1XWIA 1U8AA 4RANA 4JXJA 4RZIA 3QUSA 1NN3A 1NPYA 3ZXYA 5C2JB 2ZJYA 2J30A 4EBFA 1S8NA 4D9IA 5IZ4A 1QOQB 1RRFA 2VSYA 4RFVA 4OHWA 1M1XB 4FKZA 1MRZA 3EAGA 1R3DA 3OUTA 1XD9A 2ST1A 3R23A 3FWZA 4EPYA 3GT0A 3AXSA 3ENZA 4HH0A 3RU3A 4DMCA 5BR8B 1SHZA 1Z0DA 3OLCX 4NYIQ 3DVQX 4G63A 3H3JA 2QD2A 3ORYA 4LJ7A 5DTJA 3CGGA 2JIQA 2PV0A 3FTNA 3G1UA 4FFBA 4V0SA 2YNMC 3TINA 4BVHA 3ESXA 4BVLA 4IVQA 1DEOA 3GVXA 2C4VA 1BZYA 4BUZA 4MRSA 4CI9A 4Z51A 4D3ZA 1JV2B 2UZ3A 2XT0A 1W94A 5HS6A 2Q5FA 4QTUB 2JW5A 1C0EA 1NP7A 5CDGA 1M76A 3GRFA 4K0KB 2ZT5A 4S35A 1IM5A 4HRAA 3HB4X 2DYKA 2YXNA 4ND5A 3VVCA 4DV1B 2C7QA 1QVRA 1U3FA 3H4IA 2PLNA 4WFJA 5AHWA 5CYOA 4BU1A 5AVWA 2MR6A 4GXRA 3EQ2A 3RFUA 1OLSA 1TX4B 3D4PA 1RWXA 1P33A 2Q4DA 1MZVA 1HX7A 1X1DA 2MSLA 1R7RA 1Q0TA 1YA4A 1RHJA 1AGYA 3C8UA 3H5RA 1G4AE 2LKDA 1S8FA 2HF2A 4J0HA 2CUTA 1K2WA 1TQ2A 1LC3A 3FFAA 2ZS9A 1D3AA 3VJMA 4IH9A 4DF3A 1RI4A 2WJYA 4XR9A 3S4YA 4RVGA 1WJGA 3IXMA 3A7DA 4L4UA 1EVKA 1AN0A 4N1AA 1XRSB 1MHTA 5JH7F 2PUFA 2UYCA 5L7WA 2I4MA 1FP4B 1S2NA 3BMCB 3EFHA 1HDYA 1Q12A 3L8MA 3Q3IA 2VRBA 3HB0A 4BMYA 3V33A 1TM1E 3BL5A 5BVHB 2AYZA 2CMDA 5EG5A 2Q3JA 2WOOA 3O8RA 1DWQA 3GEPA 3IQIX 2P1ZA 1X1SA 3O3NB 4FW8A 3R7FA 4P0QB 4CWAA 1MDBA 1QHHB 2IDJA 2ZJ6A 4GIBA 1H2FA 3OOYA 4UE3S 1AMUA 1J5XA 4OYLA 1XCJA 3B8EA 1Z3IX 3AVXA 3E61A 2GTPA 3OM9A 1Y6GA 3IJRA 3P9IA 3R0XA 4P3OA 3V97A 2AFIE 1I8TA 1N9GA 3DM9B 1U1DA 4OHFA 1XA4A 2BUAA 1DIRA 1MQ8B 3SY8A 5I3CA 4UHBA 5CXXA 3A1SA 3TSZA 3WDMA 1E5VA 1EZ4A 4LNAA 1JR3A 2I8CA 1SCUB 5KDLA 1IONA 3W79A 4RJKA 4P7GA 5BN3A 2FMXA 2IZ1A 2O7SA 2ZQYA 3E9MA 3EIWA 2FR8A 5DIFA 3OOWA 2IP1A 2DETA 3SYNA 4ZDWA 4OXXA 1VJ0A 2GVZC 2AN4A 1WV0A 4JP5A 4K6KA 3AL0C 3RRXA 4O5AA 2CYAA 3ANSA 4ES6A 2QVLA 1ZONA 3LT2A 4ZI5A 2ET6A 4OFWA 1W44A 1Z0AA 4G8CA 5CT9A 2F1IA 2RONA 4UHKA 3ZCVA 5KMGA 1SBCA 3D6AA 4ZV9A 1U0FA 1CNFA 1A97A 4WCFC 3AB7A 4R16A 3I0NA 4WV3A 4CRWB 2WSLA 2JLXA 3TTSA 2B4KA 2GCOA 1PDOA 2P9QA 2G9UA 3NOQA 2CMHA 2J1LA 4MINA 1E3QA 3JQ8A 3H18A 3F8WA 4I6EA 2QRVB 3T3HA 1DI0A 4JJ6A 3PHIA 3ZWWA 1T29A 3FNGA 4A0FA 2CJWB 1B1CA 3AOEC 3LO8A 1YQWA 3BFJA 4TWIA 1NFFA 4K9KA 4M8LA 4ZPJA 2BRUC 3KPUA 2WIDA 1E89A 3SIXA 3F5SA 2X2FA 1GNVA 4J7UA 3U3MA 1LBHA 1P5HA 1Z7BA 2AG1A 4N3BA 1P2SA 3PDCA 4WY8A 3OETA 3SBXA 4DLTA 3H6KA 5JNSA 2ZZMA 3GGDA 4WOJA 2HSWA 3SX0A 1FFAA 4GT1A 5HZKA 4NJEB 4DRXB 1AB6A 4CKWB 2Z8XA 1ZJ6A 4XQ0A 4JHXA 4CGZA 5JS6A 1CXZA 1XEXA 4RHCA 4BY9E 1GPLA 2LXNA 3FFXA 2ZDQA 1T1SA 1NDQA 2FN9A 1X1TA 3OE5A 2JNWA 2BVNA 4GVXA 1ZVQA 2GZSA 4JN6B 4K40A 4ZI3A 5JD4A 2PT6A 3AI1A 3OQ6A 4NESA 1Z6YA 1GA6A 3U3XA 3PFKA 4MA5A 3SZUA 4ASUD 1LTHR 3DDNA 2B21A 2Y1EA 3TZQA 2WUFA 2VZLA 2ZYGA 4QO7A 4D8YA 4B2IA 2K7FA 5ALSA 2WP8J 4QEZA 3P0IA 2WTXA 1F2DA 1ZITA 2PYIA 1DC7A 1EE2A 1EK2A 4KQ2A 3SAJA 5KYNA 4G0WA 1KDZA 1YQ9A 5JJIA 4L51A 3MOIA 4BNLA 5ULLA 5LP6F 4GM4A 4DCJA 1WOMA 4LHWA 2JIMA 4NEGA 1XLWA 2PRKA 2KJQA 3ETDA 3SE7A 3HDVA 1L5MA 2YQZA 4G5HA 2Q5JA 1Q0ZA 4OBEA 4ER6A 3OE7A 3WJAA 1QM5A 5CXUA 2PUDA 1ZWLA 4PLFA 4R0NA 4NG4A 3ZDEA 4IDCA 4F85A 5EXPA 2C07A 3RJ9A 1YS1X 1JDTA 1PL7A 2R79A 2F90A 4A91A 1TT5B 3C5EA 1V3UA 1GTJ1 3R6TA 3EBOA 5DGHA 2J5BA 3G9UA 2CWDA 1OV6A 1GUAA 4RBNA 2Y9MB 2VAPA 3SR4A 4YRSA 4YUZA 3OZRA 4INPA 4N7BA 2OECA 3MSCA 4IIFA 3L7DA 4F60A 4DT1A 2LCQA 1FQKA 3HN6A 4EI9A 1BS1A 4YV2A 4IXWA 1M8FA 5CK5A 4RABA 5KQMA 1FIUA 1SBIA 3I9JA 4I5EA 2EW8A 4UBOA 3HJRA 3AR7A 4HPXB 4ARCA 1H2EA 4F5WA 1MB4A 3HCNA 4PSKA 3U7HB 3BA1A 4S2UA 2ZATA 3RKSA 5KYUB 1RXVA 4MQUA 2NU8B 3MNFA 1QH8B 3PZBA 4ZCPA 3GPLA 4E03A 2Y1FA 1EWKA 3EPPA 1S2GA 5TQVA 1M7BA 1O2DA 3UJDA 3WYCA 2Q5QA 4FE3A 2QMYA 4OHPA 5C18A 3KHUA 4I4LA 5K0JA 2V0GA 3ST7A 4A23A 2ZETA 4UM9B 1JKXA 2RGCA 2V7GA 1X7ZA 3IIIA 5FBWB 4CIXA 2BGGA 2WG1A 2BL4A 4CM4B 1Q95A 4M9RA 1ID1A 3CX6A 4LXYA 1TADA 1FMTA 1TK9A 1XTZA 4O4HB 2I67A 3KZNA 1FUUA 2H52A 3AERA 3FKQA 2VA8A 4FQ5A 4HDSB 2QJWA 3ZHOA 5KC8A 2FA9A 4MKFA 2BFWA 3Q7QA 4YUAA 3K6SB 4RPGA 1LX7A 1IK6A 5IWAB 3BMOA 1AIPA 2I99A 5CLGA 3HK2A 1VKOA 1I5OA 2I4IA 2HEGA 4JJ7A 4U2BA 3V8PA 2DPHA 1E2JA 2XSZA 3KXDA 4XOUA 2FWRA 2RHMA 1A8SA 1I0IA 3AONB 1U0NA 3BMNB 3KG2A 3FFBA 4GUAA 3GJSA 4ONEA 1TVEA 1UL1X 1B23P 2DJIA 1HSZA 1Z74A 4RDIA 1IHXA 4XX0B 4OHVA 1RI2A 3K9BA 2E4VA 1NUHA 1YOVB 4LKRA 5E6UB 3UBTA 1MENA 5DYTA 3UGQA 3AP2A 1C4KA 3LCCA 3VX4A 5EKDA 4XH9B 3ZE7A 3LVRE 4WLFA 1QCYA 3CYFA 4EG3A 5JSZB 1DVRA 2O8BB 4FM9A 2DHEA 5BSTA 3TQIA 3GLFA 4D4GA 3PHCA 5KCMA 1I4TD 1Q7RA 1O96B 3BPSA 2ZTHA 2P35A 2YOHA 5DK6A 2CL6X 5C5EA 2XUJA 1XZEA 2W4MA 4L9RA 1S0UA 1RI1A 2PX0A 5TR9A 5EEGA 3FNFA 4U5XA 5DH9A 3O8NA 5HM6A 5FNZA 9MHTA 4LJ8A 5BSVA 4I50F 2RHGB 3BN3A 2C2XA 2GASA 4HDRA 4MQBA 1Y7LA 5BSEA 2NYUA 3ZVLA 3R3XA 2J6IA 1Q7TA 4RYLA 2HHJA 1Y98A 4AK9A 2PANA 2G63A 1U0SY 2C5EA 4KQIA 4AZVA 3KB1A 4YUYA 3QFTA 4GOXA 2IVZA 4XIIA 1RQXA 3KPYA 4BNDA 1GVNB 1EJ2A 1GZ6A 2J85A 1XZGA 2FHPA 4NOMA 1KC3A 3TDNA 1NVXQ 1JVSA 4QX6A 4PSAA 2GPNA 2RKOA 4B43A 2H1RA 1L3IA 3P2KA 3P4XA 4HUQB 2B25A 2WTUA 2CCKA 5E3HA 2YHIA 2CNDA 3MQ4A 4I9FA 2WHYA 1XQ1A 1ZN7A 2PUHA 3BREA 4FUTA 4COKA 4D57A 8ADHA 1P19A 3VU8A 2QLLA 3TBKA 2DFVA 2O7RA 3E27A 3TW8A 1JH8A 1FVOA 4YT4A 5IH7A 4C2UA 2ZOSA 4LBYA 5B1DA 2VQ3A 2Q7DA 4Q37A 3RYFB 1YV9A 4MHTA 4BATA 3GJZA 4PZPA 1RQLA 2WPDD 1U8TA 3ZE6A 1NV9A 4XUDA 4FNOA 2ATVA 2ONCA 2JHFA 5FO0A 5IAAA 1X9HA 3BUSA 3WK7A 5C37A 4B8WA 3EA5A 3MBKA 1GNQA 2P9BA 3Q88A 5C31A 1OV4A 1K6XA 3WK6A 4BAUA 1N1GA 2GQ0A 2H1WA 2IEBA 4MWZA 4OQMA 3H7AA 5J4HA 4N8EA 4M1TA 1U94A 3N5KA 1KJZA 3EFBA 4D3FA 3FWPA 1XSEA 1IH8A 5ED0A 2OYRA 2I78A 4GPAA 4DWOA 4F0JA 3H1GA 4ED9A 1KYQA 3EDYA 1CR1A 1TM5E 4PG7A 4Y2HA 2GM9A 2XW6A 1JKJA 1HG1A 1XYVA 3AHCA 4O6VA 3TXAA 1EFRD 3EIEA 1EX1A 1J5PA 1VJ1A 4MP8A 1Q0PA 4HXFB 3OT1A 2XNCA 1W8DA 2Y1LA 3QF7A 3UHPA 4DA7A 3PF9A 2XH8A 3B48A 1Z83A 1N5OX 5F5XA 5KX5A 4Q9HA 2HL6A 4RFLA 4GSKA 1OKKD 3LVBA 3TCKA 2EW1A 3SLKA 1SCAA 1QFJA 1UMBA 3IAS6 2OV1A 2EU8A 2J0UA 1RZRD 2D0DA 1HO3A 1BS9A 4W5OA 3S44A 4C7OA 2FFQA 1YQQA 1YHYA 5HM8A 1QZ3A 3LPNA 4GKVA 1NKVA 3FHCB 4GSLA 1H93A 4OMFG 4F91B 1JG6A 2ZR9A 2AD1A 4HAWA 5HUJA 3CBGA 2AEFA 4N8DA 2OEPA 4LXIA 5JZOA 3TTXA 1YZQA 3CZ5A 2WA2A 1NF8A 3G0IA 3H8VA 3EHDA 4GH5A 4G89A 1XZ8A 2IHJA 3VR4A 5EY5B 4ARUA 1CBUA 4ZQGA 1EUDB 1ZDMA 2XF8A 1DAEA 2Q6VA 4KZKA 5JG7A 3RRJA 1OBCA 2DBYA 4B80A 1ACLA 1QHIA 4CL8A 4DLKA 3ZGZA 2FJPA 3F6YA 3M1LA 3UMGA 1EM8A 4EFDA 2F43B 2QKYA 3MELA 3D6VA 2I4LA 3JYQA 2QQGA 1E7SA 1FFDA 3UQYS 1G3MA 4AY6A 4K9LA 2VRNA 4JI2B 3MWGA 4Q7KA 4OK3A 1YFLA 4YB8A 1WZCA 1FNCA 1J99A 2CNNA 5ABPA 5TGZA 1O94D 1Y6QA 2QVGA 2QOEA 1WD7A 3HDGA 1TL7C 4KXQA 3SC4A 2QORA 4EEKA 4EY6A 1MEJA 4F4IA 1OFTA 3D0QA 1V26A 4LGVA 4BNGA 3K9QO 4FYYA 4IJKA 5I4BA 1NVFA 3NBYC 2G4CA 5CJ2A 1NMSA 1GGNA 4OL9A 1SXHA 3ZNPA 3AI3A 4MUKA 4CDNA 3SS9X 5KC9A 3QY9A 3KQKA 4KX5A 5GWXA 2O3UA 2YJ6A 3E22B 1CUBA 1JHAA 3M89A 1MFPA 2AMFA 3BTUA 4PZZA 4ZYTA 2D7CA 5BOSB 4D3SA 2I1WA 2WWHA 5HA5A 3VBEA 3TSAA 2UZAA 3IUBA 2D74A 4AYXA 3VJRA 2IEGA 2C7RA 4J16A 4JBXA 2VH1A 2XCSB 3HVJA 2XWPA 2ZIEA 3R2JA 3HZOA 1RLOA 4GX0A 1L4GA 2NM0A 4M37A 5KAMA 4GBJA 4REMA 4EKGA 4F7DA 4PQFA 3SHOA 4MVXA 4CUKA 4TMYA 3QBEA 5K8UA 3KKLA 1TGVA 1JH9A 2FJUA 3HMQA 1Y8QA 3E8XA 3X1ZA 4J1TA 3BJZA 2E55A 2FWIA 3GAFA 1JHDA 3MLEA 5G0TA 2IPNA 4YJHA 3CURA 3BH6A 3Q87B 1CNMA 1D4FA 3LC1O 3QG5A 4CIVA 3L5KA 3PFWO 4RJTA 3QXJA 4L1KA 4Y1GA 3RS2A 3UMCA 4WKCA 4X93A 1A27A 2AI2A 2FY8A 1H65A 3KR0A 3H9CA 4QG7A 2OZEA 4B40A 1Y9ZA 3K72B 5SZKB 1T9AA 4F2DA 2V6BA 5EESA 1E96A 2XXAA 4PAQA 3W8DA 2IIVA 2ZRLA 4HXGA 4L72A 1A2KC 1RP7A 1XVUA 1I9CA 3BIJA 3PQ2A 2A0XA 3NIFB 2P9JA 3F8SA 3PGJA 4HV4A 2WM8A 3UV7A 2H9AA 1RQ7A 2ERYA 3D3JA 4TV9A 3EWSA 3HYLA 4U8HA 1M2OA 2QM0A 4RA6B 1GTG1 5MGNA 2QG9A 3ETJA 5FTKA 4MS3B 2XD9A 1E62A 1IHOA 3FCXA 3QHAA 5K2MA 1ZK2A 4RJLA 3KB2A 4KN9S 3U37A 2Z3WA 4EY8A 1JXMA 1XTKA 1EI9A 3EUAA 1JEDA 5L9AA 4N40A 2QN9A 4WUVA 3DE7X 4CUJA 2OQ2A 3FETA 4Z4HA 3KQUA 1TC2A 3COZA 1B6RA 3ACDA 5AKKA 4PTLA 1VGQA 1H0HA 4DLAA 2QLJA 3UHFA 3OJCA 4AKIA 1SC1A 4AP5A 1A8IA 4J3JA 3A05A 3DTYA 9LDTA 2VP5A 2V96A 3AVOA 3G9TA 5BYJA 5EOVA 2XOKD 1PW5A 3V7UA 1PR2A 5LZ5A 1S9HA 5HFAA 5HJ5A 4NCBA 2A14A 1VKJA 2QPTA 1M1NB 1S7CA 2C61A 3TQRA 1E0SA 3HYRA 5MGBA 4CZ2A 2IUYA 1Y1LA 2R3SA 4EHAA 5HQJA 2EJTA 3CCFA 1SC6A 3HP4A 5AP9A 3GLIE 2H2DA 2HA6A 2O0JA 4Q4JB 2FPOA 2EATA 2QNIA 4AYTA 1E6WA 2IHKA 2E85A 2H8GA 2WJPA 5B1EA 2Y77A 4JXKA 3IS3A 1J0AA 4DPKA 4DWVA 4CEJB 4YRQA 3WKEA 2PGJA 4ENRA 1SIOA 2AI1A 3UT5B 3WAGA 2Y66A 1U9CA 4Q48A 2HF7A 3J81A 4FHZA 1SCJA 3BOSA 1X42A 2REQA 3H2BA 2WVGA 1V4BA 2I4NA 2FZ5A 4LDAA 5EKTA 4B75A 3ILYA 3KZMA 1GG5A 3H8SA 1JQJC 1LK5A 1YUNA 3ZOKA 4FYHA 1NBMD 1JX6A 3B1FA 1RRPA 3BGIA 4RMGA 4L0MA 5FA6A 3WV4A 5JAHA 3H1EA 3UUEA 1JWAB 1U0LA 4R2JA 2VJDA 3FBGA 3KJQA 3P94A 1O6BA 3O4IA 4B0PA 2RJOA 4F8JA 5HCNA 2WJIA 3HYTA 3C8ZA 2G4LA 2AN3A 4JUBA 2PQMA 3IMEA 5CM2Z 2O50A 3ETHA 3MM4A 2D2EA 3SZLA 4EOGA 5FTNA 4NHOA 2GD2A 2A5FA 2WE8A 1ZZGA 4YHBA 1WBDA 2KLHA 1BVUA 3B8HA 4TKUA 4FHGA 3NP9A 4C01A 3P45A 1RBMA 4BNHA 2CLIB 3J7TA 4B35A 2WTEA 1GWNA 1PUJA 4ABTA 3W2HA 3OQIB 1JR2A 5HUQA 4IG4A 3M6FA 1QLJA 3IP6A 4IKPA 3VO9A 1K4KA 3NTUA 2IODA 3VR4H 2IHTA 4H59A 1RYBA 1ZSVA 5T8KA 3LYAA 1TA0A 2MSDB 3J80A 2WICA 2PZGA 1K7FB 5K0FA 1FP6A 2E1PA 3HA3A 2W7TA 1IUOA 3PDIB 4A0HA 1BOOA 2P68A 1M74A 2XXBA 4MWCA 3T1VA 4BO5A 4DNOA 5IHPA 4PPFA 1G5TA 1C3OB 1X13A 3LRTA 1THZA 2W43A 4PPGA 1U1GA 2YUIA 2VVTA 1ZW6A 4GPEA 3EAQA 3TSOA 3K0SA 4K6OA 3F71A 4HZGA 4HWRA 1OXTA 4I66A 2PK3A 4RQBA 2RI1A 3CF4G 4NCXA 1TMOA 4Y9SA 4OXKA 4KGDA 1SOMA 4Y6LA 1OLXA 1MABA 2B6HA 2D2XA 4TYPA 5A5EA 3BWMA 4US2R 3N58A 4EG6A 2UVQA 4RORA 1FLVA 2ZUUA 5ALWA 2Q62A 3TOCA 1ZD1A 2CDNA 1P4JA 2BY4A 3F5QA 3H17A 5DSZA 3RRBA 1TZMA 3N86A 5LOVA 4KGXA 1PJLA 1YR9A 3DB2A 1Z4NA 2OZKA 3FNHA 1CY2A 1LC0A 3ADPA 4TOIA 4ZO9A 3SSNA 4AIIA 4YRAA 3THYB 3AVPA 3Q4GA 3ZGXA 5TF4A 4G4SO 2OG1A 4TRNA 3P20A 1KO4A 1ZK4A 3RQSA 4OSEA 4RK5A 3T54A 4Y0AA 1ABBA 4F6RB 4OG2A 3VNRA 1ZNYA 3IDOA 2WSMA 3QLTA 2FOIA 4JC5A 4B1FA 1US8B 4TQ9A 3T06B 2EOAA 1XZKA 5K0GA 4DV6B 5JAIA 3TI9A 2WT4A 5FX2A 2AC7A 3KT0A 2EG5A 3HLKA 4GD3Q 1PFGA 3AY7A 2E5FA 1P0QA 1LPBB 1OZHA 2IYVA 5A9TA 3MJRA 4KQHA 4ASUA 4X6UA 3ESQA 2CKDA 2X3YA 5BOVA 1M6VA 3FVWA 3A1CA 3IAUA 4LOAA 2J45A 4MAMA 1V5GA 4QJ5A 5CB0A 3TCXB 1DQRA 1S1MA 1I3KA 3PNVA 4IG9A 4JQZA 2XR1A 2R4TA 4U6NA 4FFMA 5T67A 3W7VA 1AUVA 2CE2X 1L4UA 4HRXA 5CT5A 4PBTA 3SIRA 2ZP1A 3PYMA 4ENSA 4XRGA 2REOA 1QVAA 4GBED 2ODQA 2QYTA 1KP3A 3CFYA 3V6MA 4IVNA 1X77A 5LDDC 1U8CB 4IOLA 2JL1A 1BEZA 1UBNA 2QRPA 5KTRA 4FYIA 4IWNA 3LC7O 1ZD8A 1K7CA 4NP6A 1RWBA 1IDOA 2H1SA 3Q40A 2PLWA 3B1WA 3KCNA 2R2GA 1C1DA 4DY6A 3DCNA 5H8WA 3EIUA 1L7PA 1ZRMA 3DD5A 3U49A 1KH1A 1H69A 3IXLA 1ZXBA 2BPOA 4FOLA 5BNWA 3PHBE 2V97A 3LNCA 2CVOA 2WJ4A 4TM7A 4X1KB 3PBKA 4PIPA 3WGTA 1ZRSA 1FOEB 3QVWA 5B6JA 3QY0A 1X8LA 1L5KA 1LI4A 1CW2B 5JXIA 1SBNE 2E4ZA 4H3HB 5E4FA 5AXAA 1KY4A 4CF6A 2ETVA 2H7CA 4RPLA 5DHQA 4BZZA 3E0QA 4DHWA 5CITA 1KK1A 4RD1A 3T3OA 1VRVA 1C30B 2I6SA 1M8GA 4NABA 3TLJA 4HLUA 2ZJ8A 3VRHA 2IZ6A 1XRRA 2HMYB 3GL9A 3D4OA 3PX3A 5IXJA 3ZWXA 4KYVA 5TARA 3PUJA 3W04A 1QQTA 5H3HA 3EFOA 2VUTA 1SUBA 2QRKA 1D04A 4J49A 1PL8A 1RE0A 1U2GA 2TMDA 2O59A 3ICOA 1KTIA 3ZE2B 2I66A 2R11A 4UUNA 3WYAA 4EA9A 4R0MA 3WE7A 1W581 3EUWA 2R5NA 3G0CA 1G20A 3B53X 5G0VA 1C1YA 4FXPA 4MRRA 3HCWA 1OTHA 1WP4A 2Q5OA 4OF4A 3AEKA 2HJGA 2WJZB 2XOXA 2OK8A 1FW6A 4MMZB 2P90A 3LLSA 4S0ZA 1CRQA 3TLEA 3BRQA 5G0WA 1JQ3A 1XWWA 2WFLA 4Z9BA 1I2CA 5ALJA 2H0QA 3AUTA 3HACA 3ZD9A 1BX1A 1U0EA 2KW5A 3DE6X 5SYNA 3EH2A 1UBSB 1PUXA 4NOKA 1O97C 4DQXA 3PEFA 1E3WA 3ZCUA 3TLGB 2ZXUA 3PX2A 2V8OA 3HXOA 2XMQA 5KVCA 1MVLA 5JRDS 1UCFA 3E18A 3IIEA 4P7FA 4GMKA 1YQXA 3UK0A 3H0CA 3GFSA 4C4PA 1SQFA 3O38A 4R7TA 2AMJA 1PG0A 2GZ3A 1QSGA 3M5WA 4FEGA 1I2BA 2VPQA 4DLSA 4K6MA 5KWIA 1HY3A 5EWJB 5FUBA 1AKQA 2XXJA 3IP1A 3K53A 3K8OE 4G25A 3ZXSA 4U2DA 4R5HA 2G25A 5IJWA 2C2MA 2X5KO 4GDFA 4XCVA 1OI3A 3I76A 1GUZA 1KFEB 1QAQA 5CX1A 3VJLA 1P4AA 3L0ZA 2XD4A 2C2OA 5KVVA 1DWUA 1OZGA 1GZ4A 1H3NA 2BJVA 2WTMA 3GRVA 4C14A 4G0YA 3H9JA 4K6CA 3REQB 1SULA 4M9CA 4ZAWA 4ZZ0A 1CRLA 5CFZA 1A9XA 2O5CA 2R5WA 1O4WA 2WE7A 4AZTA 3H11B 1SOAA 2XAUA 2CNWD 2VPXA 3WI7A 1WO8A 5GIOE 2OV3A 2Q6OA 2O06A 1NJ5A 2XIQA 3DZ8A 2XLBA 2O6LA 2RHTA 2ZULA 4RZXA 1T8SA 3D2LA 3RS5A 4B0OA 4BLVA 4V0KA 4MAFA 3D3WA 2JFFA 3CRW1 4I4TB 1DQNA 1FSGA 4J6EA 4QGAA 3UG7A 3VNUA 4HMOA 4EJSA 4J4BA 3OTGA 3ZY6A 2JJQA 3G5AA 4ETMA