3WXBA

Crystal structure of nadph bound carbonyl reductase from chicken fatty liver
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
269
structure length
269
Chain Sequence
SSGLVPRGSHMGELRVRSVLVTGANRGIGLGFVQHLLALSNPPEWVFATCRDPKGQRAQELQKLASKHPNLVIVPLEVTDPASIKAAAASVGERLKGSGLNLLINNAGIARANTIDNETLKDMSEVYTTNTIAPLLLSQAFLPMLKKAAQENPGSGLSCSKAAIINISSTAGSIQDLYLWQYGQALSYRCSKAALNMLTRCQSMGYREHGIFCVALHPGWVKTDMGGTLEDKSRVTVDESVGGMLKVLSNLSEKDSGAFLNWEGKVMAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title A novel NAD(P)H-dependent carbonyl reductase specifically expressed in the thyroidectomized chicken fatty liver: catalytic properties and crystal structure.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase activator
total genus 88
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2014-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wxbA00
3I52A 2O7SA 1D1SA 4HFJA 4GSKA 4WNIA 1JQBA 1I33A 4J1NA 4WCFC 4YACA 4D79A 3DL2A 3AW9A 4WOKA 1B8PA 4BV9A 4MDHA 4BO0A 1E7WA 1WWKA 1ULUA 4NFYA 2A92A 3ZCXA 1MA0A 4IBOA 4YAEA 1ISIA 4IDEA 2B5WA 3ZU5A 3GNSA 3KRTA 4NH4A 3UH1A 1WDKA 5ICMA 4Y9DA 2AE2A 5T5QA 5JAIA 1BGVA 4C7JA 1MG5A 2J5RA 1EUZA 1K5HA 4NI5A 3LVFO 3SC4A 1XG5A 3D4OA 4MKXA 4EEZA 3HB5X 3ZHXA 3KXDA 1ENYA 1HDYA 4Y98A 1E1MA 1H2HA 3TZKA 3GEMA 5ER6A 1O0SA 5JYEA 1YWGO 1HSOA 3RUDA 1UP4A 3MJEA 1LU9A 1YONA 3ZWPA 3L9WA 3NTQA 4G81A 3OETA 3JQCA 1AGNA 4XR9A 1JW9B 1HEUA 3NDRA 4HFNA 3WFJA 1ZSYA 4CLHA 4I8XA 4EBFA 2BMAA 3DAFA 1E3JA 3CKYA 4XRGA 4W9NC 5JAMA 3FF4A 1C14A 1E3SA 3UW3A 4AG3A 3GH3A 5DCUA 5F5NA 1NHWA 2QX7A 3ITDA 5TC4A 5B4VA 4L74A 3K5PA 1EVZA 1YB1A 4MVJI 1ADFA 3ETGA 2J5QA 3VPGA 3ZHZA 1O89A 4ZN6A 2GN6A 3E03A 4OL9A 1OC4A 4KWHA 2AG8A 4NBVA 4R5MA 3W1VA 3PFWO 2BH9A 2ET6A 2EIHA 2D1YA 1Y8QA 1YB4A 5B37A 2GZ3A 3SLKA 2B4RO 2DBZA 4BKOA 3RBVA 3DONA 1W4ZA 1UXJA 3AUSA 4KTTE 2J5KA 1BDMA 5JMPA 5TGDA 5A3JA 1WPQA 2C29D 2ILTA 3PQFA 1KS9A 4E2XA 4RF4A 2IYPA 4RVFA 1HT0A 1KIFA 1GUFA 3BHJA 2FR8A 1M6HA 3NJ4A 3RUAA 1DC3A 4DQVA 4DIOA 3VTFA 3B1JA 1O6ZA 1XEAA 2W90A 1A27A 2DBQA 4ONEA 4CMHA 1HDXA 5I7FA 3VPXA 1P77A 5C7LO 5CEJA 1P31A 3UN1A 2CMDA 4FBGA 1VSUA 3OQ1A 1A72A 3C1OA 1LNQA 3BMOB 4QT0A 4IUYA 5A9TA 3I6QA 4PLGA 4E4YA 1J49A 1NR7A 1G1AA 2WSBA 5AVOA 1JKFA 1RYEA 4GX1A 2FPGA 1A7AA 1IZ9A 4ESOA 3MZ0A 3IC5A 4OH1A 3RIHA 1IZ0A 2CF5A 5CG2A 1NHGA 4B3JA 5EPOA 3HDHA 2I3GA 4D0SA 3AK4A 5LDHA 3V2UA 2EHDA 3TFQA 1GU7A 1NFFA 7MDHA 1NX6A 2Q2QA 3DTYA 3WQQA 1F17A 4ND3A 3GVIA 4DMMA 3N58A 1ENPA 3GHHA 4Y6RA 5A5FA 1DLJA 2ZQYA 1BW9A 1MFZA 1ZMTA 2X5OA 2P9EA 1QKIA 5L4NA 4U7WA 1PQPA 1VLLA 2WYWA 3UCFA 3W8EA 4DLLA 1VL0A 3D4NA 2AE1A 1YQGA 3L9XA 4RORA 1PGNA 1Z74A 3AJRA 4D41A 4Z9FA 1A4IA 3PHGA 3O8QA 3ZI0A 3VPSA 1CYDA 2X1HA 3M6IA 3PGJA 4CLOA 4CV2A 1NVGA 1PJ4A 5FEUA 1ZK3A 1I30A 3EK2A 3NKLA 2NVUB 3NRCA 3RC1A 3VH1A 1X1EA 4XYBA 1U8FO 1ZFNA 4P22A 3RU7A 3ZDFA 4Q3AA 3L77A 2AA3A 2VWGA 5EL0A 1EMDA 3QWHA 4BNKA 1O5IA 3F1KA 2NU9A 1DOHA 4NNJA 1OFGA 2OOSA 1VPDA 1Y8RA 4R5HA 1T2FA 4B4OA 1Z7BA 3CPSA 4CM9D 3QP9A 2O4CA 4IDAA 1XR3A 4R68A 4OQYA 4Z6KA 3ANNA 4Q3BA 2RHRA 3RI3A 4RF3A 3FNGA 5FF9A 3TSCA 4RF5A 1BMDA 2G17A 1XLTA 5G0TA 3VH2A 3C7CB 4ALMA 3GF4A 2CDBA 3IUPA 5B1YA 2AQIA 1HDCA 4CV3A 2OP0A 4FPXA 4RO0A 5KVVA 2BELA 4DQXA 4GVXA 1ZO8A 1X7HA 1GQ2A 3CH6A 4IJVA 3GZ4A 3AY7A 1K0UA 5AXCA 3E5MA 2AEFA 1YL7A 3UICA 1I32A 1R4MB 4MIYA 1U9JA 5CP8A 3PHIA 3D3EA 4BV8A 3ULKA 3UFXA 1GCUA 4B4UA 2I6TA 1B3RA 1E5QA 1I3LA 3WQRA 1NAHA 4GLLA 1UDBA 5IDYA 1ONOA 4MP8A 1DO8A 2Y1OA 3CXRA 4AFNA 2ZB7A 5I8WA 1XU7A 2VRCD 2UDPA 5F1OA 4CL3A 5C5IA 4PN3A 1E1LA 4OM8A 4K6FA 1GZ4A 4CQMA 1YE3A 3GNQA 2NU6A 1NR1A 1FDSA 3DEYX 3JQEA 2VZ8A 1WZEA 4DXHA 5KVSA 3BTSA 4HY3A 1EFLA 5I7EA 2O7QA 2DBRA 3DXFA 1UP7A 3RUIA 2DAPA 2W2KA 1KVRA 2YJZA 1DPGA 1GFSA 3R6DA 4BVAA 2Q4BA 2AW5A 4E5MA 1B26A 4PLYA 2EP5A 2C0CA 2UVDA 2Y1EA 5L7YA 5A02A 2OORA 2FZEA 3IUSA 2X58A 3GN1A 3RASA 2BI7A 2PTGA 4YDRA 2QHXA 5AXBA 3UVEA 2Q2WA 2IDZA 4JP3A 5KJFA 2QYTA 3ROMA 1DIHA 3ADPA 4GWKA 4IDFA 3G17A 4NPCA 3HN2A 4BO9A 3TDKA 1QLHA 3OJEA 4TZKA 1ZMOA 5TIIA 3DBLB 2V6MA 3G79A 2X0IA 4ZVVA 4Z3DA 4EJ0A 3I3OA 4NMHA 4UUMA 3VDQA 1PJLA 2Q2VA 3NV9A 3QWFA 1PZHA 1H0KA 3PFFA 2VHXA 1EDZA 5KNLA 5DCYA 3AOEA 2Y99A 2NWQA 5IDWA 1IY8A 4BQRA 3FBTA 3NJ8A 2NQTA 2G1UA 1U2DA 4QO8A 3E1KA 5JSFA 4N54A 4AJPA 4N5MA 4TVBA 3BMNB 2R00C 4MKRA 4NU6A 3GAFA 5ENDA 4BO8A 1DJNA 1MG0A 3QHAA 1QLJA 3MJSA 4UREA 5FFFA 3VDRA 4E12A 3OA2A 3RC2A 3QJ5A 4FW8A 3RROA 4DIFA 1LRJA 1UXHA 3WJ7A 5CDGA 2HMSA 4NIMA 3U49A 3MJTA 1DXYA 1GD1O 3H3JA 1B8VA 1M2WA 4O6VA 8ADHA 4BO4A 3E48A 1N5DA 1FK8A 2NNLD 2YY7A 3HWRA 4ZQBA 3KHUA 3WQSB 4FSHA 5T64A 1JLLA 1U28A 2IZ0A 1YGYA 3EVNA 1TA4A 5DNAA 3HHPA 2C54A 3H4VA 3H8VA 2HKIA 1MXHA 3HB4X 4E5NA 4CR7A 1QRRA 4NQZA 1GV0A 1I2ZA 4IY1A 2EW8A 1O8CA 2PGJA 3PDJA 4CMEA 3GK3A 1ZSNA 1PSDA 2YYYA 5HTOA 3R0IA 3GUCA 2HAEA 5C37A 3RD5A 3E5RA 4PRLA 4ALIA 2V6FA 5G4KA 4H16A 3JQFA 4BO6A 5DP1A 5JXWA 1HDGO 5CAEA 3KEOA 4A26A 3GG9A 4ZRNA 3LSYA 1T4BA 4L4RA 3TZCA 4Y6SA 3V5NA 2Y68A 3GVXA 4U5QA 1AUPA 4HADA 2GCGA 4WUVA 1L1FA 5C7OO 2GYYA 1PL7A 1Y6JA 4XB1A 4CUZA 1ZIDA 3BIOA 3JCZA 4OXNA 1NWHA 4P4GA 4B4VA 4R16A 2C7VA 4BO1A 4CMIB 3NUGA 4UEJA 2QG4A 4CM1A 4FGSA 1P1IA 4H15A 2E4AA 4KDFA 1I24A 4E5PA 1TI7A 4Y67A 3WDSA 1FDWA 3A4VA 3BA1A 2PZMA 4BKPA 4A0SA 1K6IA 2VHZA 4XDYA 4J1TA 4WEQA 4BB6A 3ADOA 5DP2A 1HDRA 2BGLA 3KETA 1V35A 3FWNA 1G6KA 3VPFA 2NVBA 2D0IA 2VUTA 5TRTA 5JDIA 1JA9A 1RM0A 4M54A 2O3SA 5JC1A 4R1UA 4ALLA 5KIAA 2OFPA 2R6JA 3LZ6A 3D7LA 5HS6A 1PR3A 1X1TA 1E92A 4N7RA 2BGKA 1X14A 1HF3A 2NACA 5TX7A 1NFQA 1ZK1A 5EESA 5JO0A 1P0CA 4CLRB 4NJMB 4CM8A 4XIYA 3ZHBA 2YHIA 1SNYA 1EEHA 1OOEA 1LRLA 4QFCA 4BGVA 5TLSA 3KB6A 3TL3A 4PCVA 3U4HA 1EVJA 4K1LA 1OMOA 3PHHA 4WLOA 1PJ3A 3WSVA 1XU9A 1I3KA 4JN6B 1HTBA 2GERA 3QA9A 2IXBA 3VZRA 2DFVA 3EW7A 5AXAA 3INGA 4Q3CA 4ND1A 3EZLA 3JQDA 4CMJA 1NQTA 3FNHA 2ZTMA 3ZW8A 1EK5A 1F12A 4EJ6A 4B7XA 4B7UA 1PIWA 5GMOA 1DLIA 5L4LA 1MFPA 1K89A 5TQVA 4X54A 1XWFA 1UUFA 3JYLA 5BSGA 1E5LA 4RZHA 1ZNQO 1E3IA 4QFDA 1Q0QA 4MP3A 3WGOA 2EKQA 3PIIA 4WCFA 3I9JA 1LQUA 3AOEC 3GGOA 1BXZA 3RFVA 4YJFB 3JQ9C 2DPGA 1BXGA 1WNTA 2IYOA 2Z1NA 3P2YA 4R54A 5IAAA 5TT1A 3KLMX 4BO3A 2IXAA 3UF0A 4HNGA 4WPGA 1T2EA 2AEMA 3VH3A 4TRJA 4FD3A 1DRUA 4K6CA 4WKGA 3ITKA 1T2DA 1ONPA 4RLHA 3VKVA 4PG8A 2B4TO 2J8ZA 4CV0A 5BNIA 2E49A 1YVEI 2FR1A 2F1KA 2NTJA 3DZJA 5DDIP 3WG9A 3PHJA 3OQBA 5KKAA 1V6AA 2XXJA 2Q49A 4TQGA 4E0BA 3DO5A 4KDEA 1E7SA 1GEEA 4WE3A 2O3TA 4C4OA 2FSSA 4QEDA 2C2YA 2C59A 3QIVA 5HBRA 4BGIA 1LI4A 1C0KA 1I3MA 1Y7TA 5IXSA 5CDTA 3X2EA 3CTMA 2FRDA 4PG4A 4IPTA 1HL3A 4CUJA 3GPDG 2AG5A 3EHEA 1E7YA 1NP3A 2E82A 3EAGA 2QW8A 4GKBA 3ZWNA 4ZJUA 4NBUA 2O3RA 3JQFC 1I0ZA 1LLCA 2PD3A 3Q3CA 3MJCA 3TL2A 4BNYA 2GUGA 3ZV5A 1H6AA 5B4TA 1TLTA 4Q3NA 1K6JA 1XKQA 3K6JA 2B0JA 1T1SA 3SX2A 1D3AA 3GFBA 2GN9A 1O9BA 1P1FA 3I5MA 4MVJE 3RJ9A 2PV7A 4ZHSA 3ON5A 4XQ9A 3ZU3A 3DWFA 1VC2A 4N18A 4LMPA 4U0JA 1KEVA 5DBGA 1YB5A 4KWIA 4XWYA 4A2CA 3G3EA 4CM5A 2Y67A 4WLUA 3OSUA 1YDEA 2E6UX 2FPPA 2Q45A 3ZWCA 5GZ6A 4YQZA 5BSFA 4IDCA 2HK9A 3G1UA 1MLDA 2FZWA 1PS9A 3WYEA 1LSJA 1HE2A 3ZU4A 5F1PA 1DHTA 2Y66A 5CDSA 1Z45A 9LDBA 3AUAA 4Z0HO 2I65A 1LDGA 1LXCA 1PJTA 3AFNA 5C7IO 3PPIA 4RPKA 3JSAA 1PS8A 2DTDA 4YYZA 5K9ZA 4BUCA 2VUUA 1F06A 4J4BA 4U8GA 3SEFA 4IINA 4CUKA 5HA5A 3FR8A 1RJWA 5L9AA 3WNQA 3WIDA 3GT0A 3H9GA 3JD4A 3WGQA 1NQ5A 3W4KA 2HMWA 2ZQZA 3ZNQA 3WJAA 2V65A 4D46A 2BI8A 4KTVE 1CWUA 1ZK4A 3HG7A 3M2TA 3HDYA 3F46A 3S2IA 4RF2A 3OFSA 3TZHA 5HRUA 2FR0A 5I8ZA 4OXYA 5A5EA 2C82A 1HYGA 2GLXA 4D43A 3T4XA 2JCVA 2XF8A 2Q4EA 3COSA 3GZNA 3MJVA 5BT9A 2GDZA 1T25A 4ID9A 3DDNA 1QYVA 1MGOA 1YOVA 1ZVMA 4UAGA 4JBIA 3ONEA 4UUNA 4JBHA 1JKIA 1J6UA 1GDHA 4R1TA 2P4HX 1I3NA 2C2XA 3DHNA 4Q3DA 1K3TA 4FFRA 3GPIA 4AJIA 1QYDA 1DRWA 3HDQA 5F21A 4F6LA 4WOJA 5KJCA 2VWQA 5K6AA 1P0FA 4I1IA 1B3BA 1E3WA 2H9IA 3PWKA 4II3A 2EP7A 4JK3A 5B12A 1KY4A 5MDHA 4J4TA 1M67A 3W4IA 1H9BA 2C07A 3F4LA 4CM4B 1LDYA 2VT3A 2P9CA 4HXYA 2YHUA 2EF1A 1EFKA 2PLAA 2P9GA 4NU5A 3TFOA 4PFJA 1RWBA 1A7KA 1SAYA 2OUIA 3K96A 1N1GA 4I5GA 3L07A 4K26A 2HK8A 1A71A 4IDGA 4R01A 3U3XA 2G0TA 5CDUA 3F47A 2PNFA 1B8UA 2CUKA 1U7TA 4GX5A 3JYOA 1YDWA 5COQA 1LQTA 4A73A 2LDXA 2RH8A 5U9CA 2PD6A 3KBOA 1N7HA 3ZWYA 1LDMA 3LT0A 3W4JA 4MVJG 4OIMA 4BMSA 3JYNA 3H6KA 1H6CA 5JDCA 3AI2A 4D3DA 4PG5A 4QX6A 5A06A 1ZW1A 3K31A 2OGUA 3D4PA 4AJ4A 4KUEA 4XGKA 1IHXA 4FCCA 3TNLA 1I5RA 4WLFA 1A9ZA 5IN4A 1T4DA 1BDBA 2FP4A 4D7AA 2NM0A 4OXKA 2UUPA 4FJ1A 4O63O 3GEGA 3OF2A 4HP8A 4E5KA 3VAZA 4GAEA 3ZN2A 3LF2A 4LSMA 4WNCA 5A1TA 4G2NA 4J4HA 3HFSA 1P1RA 4WLNA 1V0JA 2VNSA 2W4QA 2EKLA 2R2GA 5I7SA 2WYUA 3I9NA 3QWBA 4MVJD 2VNAA 4TSKA 5ILGA 1QXSA 2WTBA 2NTVA 4LGVA 2JD0A 3R3SA 3QE3A 2PFGA 4J6FA 5ES3A 1NQOA 3NT4A 1LC3A 1PX0A 4MO2A 3ICPA 3L6DA 4DL9A 3TF5A 4TKLA 3GVCA 4FFNA 3JYPA 2HO5A 1PJSA 5JY6A 4E5YA 2O23A 3B1FA 2QIOA 2FN7A 3D5QA 1ISJA 1HYHA 4J16A 4AJLA 4RLSA 1ZJZA 4XQEA 2XPCA 4CR8A 4YT2A 3IP3A 4LRTB 1PEDA 1T2CA 4KUGA 4IMRA 3RJ5A 3BHIA 4NJOA 5IF3A 3ASVA 4E21A 3GEDA 2PA3A 4J7XA 4C7KA 1Y8QB 1KBZA 3HADA 2QRKA 4TROA 4DQUA 1M6WA 3GUYA 1CRWG 2FOIA 2G5CA 5T57A 3E9QA 4LVCA 2PGDA 5BQFA 2FMUA 5DOZA 3F6YA 2X9NA 5AOVA 4EITA 4L4XA 4INAA 2X86A 1LC0A 1TT5A 2C5EA 3DTTA 1F8GA 5KVCA 3I83A 2AQHA 4FJ2A 1Q0LA 3E82A 3C24A 5U4QA 1JAYA 2JHFA 2EJWA 1IULA 1HKUA 1VKOA 2DLDA 2VZ0A 3CIFA 5G4LA 3AFMA 4KP7A 3RBXA 1B15A 2QZ9A 3ETEA 4L9RA 4ZQFA 3VZSA 3RC9A 4XGIA 4NZ9A 1ARZA 1JU9A 2WD8A 1X13A 2X8LA 1LRKA 3JD1A 4K9DA 1R16A 2CNBA 2J6IA 1DAPA 1E6UA 4W4TA 4YT5A 3NX4A 5BSHA 4ALJA 4II2A 1KVUA 4GH5A 2EGGA 4YJGA 2HUNA 2CDCA 4LSWA 3MEQA 3JQ8B 4J7CA 4MP6A 4ND4A 4M86A 2ZTUA 5K6AC 1RM4A 2X6TA 2YV3A 4DPMA 4IJWA 1U5CA 3GFGA 4A7PA 2R00A 4WASA 3FD8A 2HJSA 3T7CA 4L0QA 4OO3A 5AYVA 1UDCA 5DBIA 4XJTA 4DA9A 4EGFA 1I01A 3U4CA 3SVTA 4R1SA 3ZNNA 2GRAA 1W0CA 2ZATA 2YQ4A 1PZGA 1Z75A 3LLVA 4RDIA 5EIOA 4BKQA 4TRMA 1SBYA 1XELA 2CVQA 3KUXA 2Q99A 4R69A 1E1KA 2VWPA 3ZV6A 5L7WA 4FGWA 3F4BA 3ZWAA 4J2HA 3SBOA 1TXGA 3KOUA 2FHSA 4HKTA 2D59A 5T8KC 1A5ZA 4IDBA 4AJKA 4J9UE 2X7HA 4FQ8A 4EZBA 4L4SA 4PIVA 3WB9A 1NAIA 4YAGA 1P74A 4OJNA 3AM4A 4M1QA 2VYND 4HWKA 1MP0A 2W2LD 1B7GO 3I9MA 3B1KA 4JXKA 2OHXA 1KEWA 2OP1A 4GQAA 5JLAA 1C1XB 4BKRA 1P33A 1SOWA 2JKVA 1HYEA 3DZBA 2B35A 4CM9A 4J90A 5JDCC 3JQ7A 3RUCA 4MVJP 5TJ9A 2BLLA 3B20A 5A03A 4YAJA 2Y0CA 2W2LA 1YH3A 3HZZA 4CMGA 3GNTA 4GL4A 3SC6A 2X0NA 3IL2A 4ND2A 4ZICA 2I66A 4CL8A 2PR2A 5TS3A 4BNHA 2Q1WA 4QSMA 3AU9A 4L8VA 4D3SA 3GRPA 4CMAA 3KZVA 1PJ2A 1ISMA 3KYDB 3QW2A 3VVCA 1BRMA 1AHHA 3MTGA 3H65A 2V6GA 4LISA 4Y8VA 3DMTC 3NT5A 1SEPA 4RL6A 4D3FA 4ZQHA 4J1SA 3VC7A 1U3TA 4E3ZA 2E37A 1U3WA 1WLYA 3OH8A 4KZPA 4NR0A 4XR4A 3DFZA 4YAIA 5JBIA 3U4IA 3E8XA 2X9VA 4TKMA 3U62A 4DPLA 5KWEA 1PJBA 4A5OA 3AY6A 3TOXA 4U6SA 2HSDA 3PJEA 2GO1A 3DZGA 3BMQB 4O1MA 1YL5A 2BFPA 2EKPA 3O4RA 2XXBA 2CVOA 3OMLA 3RUFA 2EG9A 3PYXA 2LDBA 2YDYA 5THQA 2IEBA 3QRWA 4QQRA 3JD3A 4JROA 1EE9A 1JWAB 3B6ZA 2DU8A 2VTEA 3GVPA 4CJXA 4J49A 2DKNA 1I2CA 3P7MA 2VRCA 3HSKA 5CHEA 4A27A 4BNUA 1K2WA 2O3QA 1W73A 3DHYA 3N7UA 3NT2A 3K9QO 4MOWA 3DBVO 2GN8A 3PZBA 5IZCC 1HLPA 4HNHA 1P9LA 1AXGA 1MUUA 3KO8A 2YDXA 4B8WA 3OJ0A 4E32A 4GMFA 1AE1A 1C0IA 1YQXA 3WGHA 4CQMB 3OEYA 1U4OA 4D45A 2ZCUA 3TPCA 2X9GA 3DBHA 1HLDA 3MWDB 4FDAA 5A9SA 1B14A 4UEOA 4WK6A 1JAXA 4RJTA 2BD0A 1NM5A 1N92A 2W2KB 1XDWA 1DIRA 2Z1MA 3NTRA 1KVTA 1NYTA 1V3TA 2VUSA 3VZPA 1XHLA 2QRLA 1HDZA 3IQDB 4XRRA 5KJEA 3RCBA 2Y1DA 3ZH2A 4YPOA 1O94A 3RFXA 2JJYA 3OHSX 3KSZO 2WM3A 3ZNPA 3K92A 4YT8A 3V1YA 1N9GA 3A28A 3MJ4A 4DBZA 4LRSB 1DAOA 2O50A 3ORFA 2I5PO 1P3DA 4NBRA 4YA6A 3JQ9A 4GX2A 3I4CA 2DT5A 3UUWA 4NFHA 2VN8A 3QWIA 3PYLA 3ZGYA 3V1TC 4YT4A 3AY3A 3NDJA 4DVJA 2VT2A 4B3IA 3GRKA 1RPNA 1UZNA 3PYMA 4IXWA 4YR9A 4IMPA 4OYRA 4HX5A 4M8SA 4R3WA 5EN4A 4F3YA 3H7AA 2DVMA 1GZ6A 2IRWA 2B5VA 2WE7A 1HDOA 3INRA 4RDHA 4XQCA 4R41A 2VRBA 2VHVA 1SMKA 3TZQA 3FN4A 4BNVA 1E6EA 1WP4A 3CMMA 2CDAA 3WFIA 1PL8A 3ETDA 4XEHA 5JPIA 3BAZA 4IDDA 3QWAA 4YJHA 3VPHA 1R4NA 1GL3A 4RPLA 4IJUA 2DBVO 2POQX 3KYCA 1OAAA 3M1LA 3JQGB 3IMFA 1GY8A 3E18A 3PGXA 1GQYA 4OGWA 5FYDA 4G65A 4ZRMA 3V2GA 4S3MA 5CG1A 5ILOA 4I5FA 4EEXA 5F1KA 3C8MA 3EVTA 3K2BA 4ALKA 1E7QA 3H5NA 2EERA 2JFHA 3CZMA 3GDOA 4M55A 3OIGA 2AQ8A 2W98A 3IJPA 1PL6A 4KQWA 1UXGA 3BXXA 4ZQGA 2OBYA 1LDNA 1LA2A 3WR5A 1KVSA 2PGLA 1FDTA 4E6PA 4MIOA 4TRNA 4BQPA 2EJVA 4QTZA 1R66A 1E6WA 5KKCA 3T4EA 1PTJA 5T67A 5DOVA 1WMAA 3P5SA 3BMCA 4XQGA 1W6UA 2ZJ1A 5G4KB 3C3XA 3UCEA 3H5AA 3TJRA 2O2YA 1UR5A 3DMYA 1LDEA 1F14A 3Q1LA 4Z0TA 5DULA 2WE8A 3ZV4A 3D64A 2B4QA 3PHLA 4J0EA 4QUKA 4XYMA 3OP4A 1H6BA 1V3VA 5A05A 1T1RA 3K30A 3HJAA 1ZH8A 3GY0A 1VSVA 1ZXBA 3ENNA 4PVDA 1ADGA 3UHAA 4Q3EA 1EVYA 2D5CA 1Z82A 2X23A 4CMKA 4LVUA 2AQKA 2B37A 1LBEA 4JCOA 1J5PA 4OQZA 1MC5A 5H82A 1S7CA 2DFDA 2OL4A 3PP8A 4IQGA 2Y1GA 3NYWA 4Z3KA 2VQ3A 1D7OA 3GDGA 1PS0A 3FTNA 1C1DA 3RQSA 1CETA 1ZXLA 1U5AA 3Q9NA 3GDFA 1DRVA 3BTOA 4L76A 1WW8A 1QMGA 6ADHA 2ZYAA 3A9WA 3GN2A 4GVLA 4TZTA 1DC5A 2Y0DA 3LK7A 3CE6A 3KM0A 3JQBC 2PH5A 4R9RA 3INTA 5MGBA 3MWEB 3EDMA 4RZIA 2UUOA 4NK5A 3TZ6A 2WMDA 5G0VA 2VOEA 1VRWA 2CY0A 1MXFA 3A14A 3OBBA 3A06A 4J2OA 3V1UA 4KQXA 1Y1PA 9LDTA 1ENOA 5ENVA 5EQFA 3ZWOA 1U1IA 4CM8B 3H3FA 4QO7A 1YJ8A 1T2AA 2PZJA 3WBBA 4D44A 4LCJA 1BG6A 4MPDA 2YHIB 3L6OO 4ZD6A 1NPYA 4AJJA 1CEQA 4HFRA 1VJTA 4YWJA 1SPXA 3I9KA 1ZJYA 5ITWA 1LJ8A 4TVOA 4OKIA 3S1LA 2HRZA 3G49A 2FY8A 3DBRB 2CF6A 3GC6A 4CM7A 4DC0A 1HSZA 2VCYA 2DPHA 4CPDA 4O0LA 4IQ8A 5EQDA 3Q0EA 4FFLA 5IG2A 5CEEA 1GYPA 1PWXA 1QG6A 2WD7B 3WX0A 4EUHA 1UAYA 4O59O 2DQ4A 5JO9A 1H6DA 4FR5A 2RH4A 4BIIA 1GUYA 2YV2A 3AM5A 2PKQP 3DAGA 5GZ1A 5DF1A 3HQ4O 1B2LA 4GPD1 4ROSA 4WCFB 5F3RA 1NPTO 2G76A 3V8BA 3ZU2A 5CFZA 4PLWA 3U0BA 1C3VA 3GGPA 1CERA 5KCZA 4FFMA 5G0UA 2AMFA 2GR9A 4I5EA 1BXGB 4MJLA 4F45A 3LQFA 1HXHA 4QXMA 3OEWA 1QV6A 2A94A 2QQ5A 2D2IA 3ZWBA 1U4SA 2D8AA 4BKUA 4LCEA 4NFSA 3X2FA 4E2ZA 4CLDA 2P91A 3VTZA 2O3UA 5L3ZA 1WVGA 4YRAA 3RWBA 2CFCA 3IDSA 5EERA 5GY7A 1LDBA 3D3WA 2P5YA 3OECA 1LLQA 3IKTA 3BHMA 3R1IA 1UAGA 3NAQA 4PG7A 3VKUA 5TNXA 1HE3A 1Y9AA 3NEPX 5JNLA 4JJFA 1UXKA 3W6ZA 3O38A 1P1JA 3W6UA 3FHLA 4EUFA 3W8FA 2PKQO 5JYDA 2G82A 1IOLA 1KYQA 1PQUA 2PY6A 2PZKA 5L4SA 2VZ9A 4CQLA 3NGXA 1ZK0A 1R0LA 3CSDA 2VTDA 2A4KA 4HBGA 1MX3A 4HV4A 3WWZA 1NVTA 3WLEA 2H1SA 1FJHA 3Q9UA 4E30A 2GF2A 3U5TA 1H94A 4M89A 2P2SA 1PGPA 3PJGA 5F5LA 5LDGA 1HZZA 5JCJD 3OQ6A 3PVZA 3ABIA 3WGZA 4FS3A 5JC8A 1GAEO 3PJFA 3VOSA 2JHGA 3DOCA 3PLRA 4NBWA 2RIRA 4IZIA 2V7PA 4XGNA 4U6QA 5JS6A 1PZEA 1Q2XA 4GKVA 3KSUA 1U2GA 1G0NA 1H93A 1DFGA 2NUAA 3DR3A 1KERA 4GSLA 1H9AA 4DC1A 2Y93A 2GASA 1MV8A 1NPDA 1ZEMA 2HK7A 4BO5A 2Q50A 2EXXA 1DDOA 2DUUA 1EBFA 4OKNA 1R0SA 1T26A 4RVHA 2JAPA 5KVQA 4BNNA 4DYVA 3FNEA 1B16A 1RM5A 1I8TA 5H83A 1DB3A 2GZ1A 4PZDA 2B36A 5L45A 4OOEA 3DFUA 1LEHA 4FFPA 4PVCA 2HLPA 3WGTA 4L75A 2NADA 5I9NA 1D1TA 3QV1A 2ZKLA 4XIJA 3AM3A 4Y6PA 4LW8A 3QVTA 4AJEA 2IODA 3QSGA 2JFFA 3WTBA 1DJQA 4EUEA 5DN9A 4I9HA 3NDIA 4IIUA 2DUWA 2BFOA 1M76A 2YUTA 1E77A 1P45A 5EINA 5KTKA 1ZKMA 1RKXA 1PJCA 3EZYA 3GZNB 3PXXA 4UUPA 4DYDA 3ZWVA 4UVIA 4R1NA 4CM4A 1FXSA 3WWYA 1YOVB 2GN4A 2OO5A 3DC2A 1R15A 2VWHA 2RCYA 3AUUA 5LC1A 2ZIZA 1ZCJA 2RHCA 1UDAA 1M75A 3EGOA 4ITUA 4NK4A 5JW6A 3PI7A 1X0XA 1HE4A 1PGQA 3U4DA 2UV8A 3JQAB 3Q2IA 4YCAA 4JP2A 4AJHA 2IZ1A 4LK3A 1E3WB 5T8KA 4DIBA 3G0OA 4JGBA 5IN5A 3HDJA 3HNPA 4AJ1A 2JCXA 3PLNA 5DZSA 3Q2KA 2XOXA 1H2BA 4BNGA 1X15A 5IDXA 1DFHA 3FNFA 3P19A 5HWSA 4BNTA 4UVGA 4ILKA 4TMFA 4CLEA 2OXIA 2QYSA 1ID1A 4GGPA 4EI2A 1NVMB 4LN1A 4IS2A 4XYLA 4OMUA 3ONFA 3H2ZA 1KEUA 1DC6A 1A4UA 1N1EA 1HETA 3GGGA 2P68A 2J3JA 1LSOA 2C5AA 1YL6A 3L0DA 4FB5A 4IXTA 1XCBA 1XQ1A 2DC1A 4FIZA 4D0RA 3WGIA 1E1NA 1EVIA 3RKUA 3SJ7A 4XCVA 1SB9A 2ZTLA 3E9MA 4KUHA 3SXPA 3RFTA 3G1TA 3DMTA 2H5LA 5L51A 1Y5MA 3OIDA 5COBA 3RBZA 4GLOA 4JLWA 3D1LA 1VE9A 4RVDA 3RSHA 2Z95A 3LT4A 3IOYA 1CQJA 4PZCA 1DEHA 1PWZA 1L7DA 4RV9A 3FRJA 4U0KA 2D4AA 5BNFA 3M1AA 4B3HA 2X0JA 4PLCA 1U3VA 4MINA 5FI3A 4JQCA 3MOIA 3FWZA 3L4BC 3MCVA 4O5OA 4MVJA 1JWBB 4DPKA 4CMBA 5J23A 2CVZA 3FBGA 4PLHA 1XIVA 5KJ6A 1YXMA 1JTVA 2Y0EA 1TT7A 1SOVA 2EV9A 1AXEA 3U9LA 4Z0PA 1QYWA 2EWMA 2JD1A 4JX8A 2E48A 2WEKA 4Z9YA 4YB8A 1N7GA 3PRJA 4PLFA 4JNKA 4WJZA 3BMOA 4HFMA 3F1LA 2VOJA 2W8ZA 5IZCA 3UOGA 2PWZA 3PQEA 1EBUA 1E3EA 1D8AA 3BZUA 1YQDA 3EC7A 3UGKA 1VM6A 4YRDA 4MKZA 2Q3EA 2UYYA 1KY5A 4BNZA 1CJCA 2QZZA 1IB6A 3OICA 4BMVA 1UJMA 4BNXA 4XA8A 1VKNA 2WJPA 1VJ0A 3CZRA 4R3NA 4FC6A 1PZFA 4E2YA 1L7EA 2X4GA 3EYWA 2HMTA 2WWRA 4IM7A 4J7UA 5JFOA 1F8FA 2Y05A 4DBVO 1D4FA 4YVFA 3RUEA 4DMLA 5IZ4A 3IS3A 3OM9A 3QVXA 2NQ8A 4K28A 2VYVD 5GZ3A 3AU8A 3C7DB 4RPJA 3ASUA 4IS3A 4BO2A 1WZIA 4J91A 1E7RA 1XA0A 4EW6A 1TT5B 5CDYA 5DBFA 1N2SA 2HJRA 4KOAA 4J43A 3H9EO 3JQ8A 1AHIA 1YO6A 1TB4A 4P38A 3WMWA 1IPFA 1PQWA 2VYVA 1EE2A 2I76A 3LDHA 4MVJH 2GSDA 3QY9A 3RUHA 5L95A 3LT1A 5L7TA 3TOZA 2NVUA 1A9YA 1Q0HA 1S6YA 3CINA 1ENZA 3P2OA 5L40A 5A4DA 1DIBA 1BW9B 4AJ2A 3WS7A 1ORRA 4DREA 1JVSA 1E7MA 1BSVA 1X0VA 1WDLA 1Z6ZA 2FSVA 1QV7A 1YRLA 4IJKA 3UAGA 3Q11A 3WIEA 1SC6A 4W7IA 2ZB3A 4YJGB 1WDMA 3ROQA 3WSWA 1NNUA 3O8QB 4XJSA 1I36A 1NFRA 1QP8A 3LYLA 3MTJA 1V3UA 4NBTA 4CLOB 1NXQA 4Z9XA 2HCTA 4HUJA 2GZ2A 3KTDA 3Q6IA 1Z73A 3BTUA 3JQ6A 4BMNA 1C1XA 4F6CA 5JAZA 2Q1UA 3QVWA 2HDHA 2Q1SA 1JVBA 3NGLA 4BNIA 4W82A 2VYNA 5IFLA 1Y8RB 4BOYA 2BKAA 3WBFA 2ZK7A 4RVGA 3ZWXA 1J4AA 3N74A 2B83A 5FWNA 3DZIA 5BSEA 1B0AA 4M87A 2IEDA 2BGMA 2RAFA 3EMKA 3KYDA 5K0ZA 1LSSA 3S55A 1GR0A 3IAHA 5EJ2A 1VI2A 2CSUA 4RQUA 1R4MA 4H7PA 5DT9A 3JQ7B 3KV3O 3TN7A 2NU7A 1EQ2A 4DLAA 1UP6A 4CLXA 4MVJM 3GHYA 2D5AA 5JMWA 1OBFO 3OA0A 4GWGA 4J0FA 1LLDA 2TMGA 2NTNA 3L4SO 4PLPA 4AJOA 1V9LA 1KETA 4OOFA 3BMQA 1PGOA 2BFAA 3E6AA 2Y1CA 3IIEA 1P1KA 3GQVA 1P1HA 2ZJ0A 1MB4A 1Y5RA 1T24A 3OJFA 1SO8A 5IJZA 1LUAA 3O9ZA 3CMCO 4GX0A 2JAHA 1ADCA 3UCXA 2TMDA 1LX6A 4I5DA 4CQMD 3VHRA 3C85A 3DAPA 5HM8A 2B69A 4E31A 5TJHA 1KEPA 2X0RA 3DZFA 3ROKA 1SEVA 2PD4A 2QRJA 1Q7GA 3AI1A 4B7CA 1U3UA 1QYXA 2GD1O 1ZBQA 2I67A 4J3FA 4XZ3A 3RAJA 5HS4A 3JQBA 4AVYA 1CQIA 4YBZA 4CM3A 3KYBA 4BS9A 4RGBA 2A9FA 5A3VA 3FPLA 3KVOA 3WMXA 3TRIA 1OI7A 4BNWA 3E9NA 2YQ5A 1DIAA 3JD0A 2YW9A 3ANLA 4WGGA 4W6ZA 4D42A 5JCXA 5L53A 1X7DA 3DBLA 1PJQA 4FFOA 2CZCA 4RCVA 3PK0A 1J0XO 4YEDA 2OMEA 3JV7A 3KSDO 1ULSA 4J9VA 1ADBA 5G0SA 5JY1A 3T7EA 1GZ3A 1CIVA 1C0LA 1M66A 2PZLA 2H6EA 4IIVA 4M49A 5T6BA 3WTCA 1IUKA 3D5TA 3FSRA 3DBHB 3WOHA 1GUZA 1YKFA 3W8DA 5A04A 1I10A 5A9SB 1QORA 4H3VA 2XAAA 5A9RA 3LT2A 2IE0A 3PZRA 3BMNA 4UVHA 4S1VA 4QECA 3K8ZA 2DM6A 3RVDA 2PK3A 2NLOA 3O26A 1ISGA 4OSPA 1QYCA 4E13A 3H9UA 1N9GB 3VZQA 3DQPA 3LLSA 1KC3A 4PLVA 4I08A 2YFHA 1NTOA 3WYBA 2X5KO 4XYEA 1LSUA 2ZYGA 2HMUA 1ZEJA 3HN7A 2HU2A 2DTXA 4GMGA 3IJRA 6LDHA 1VL8A 3GOHA 3CUKA 1U7HA 3ANMA 4DRYA 1IYZA 1Z7EA 1EZ4A 3JQGA 2ZYDA 2C7GA 4BGUA 2X22A 2YFQA 1KC1A 4P8RA 4XKJA 5G2OA 2VHWA 3OJLA 3OIFA 4MVJF 3FTPA 3S2FA 1I2BA 5CPFA 4ZQEA 2J3KA 2AXQA 2UAGA 4ZU3A 3LU1A 4KMSA 4P4LA 5TF4A 3I4FA 8LDHA 2NV6A 4YJHB 3SJUA 1R4NB 3R3JA 4Q9NA 3ZW9A 4ZGWA 3DOOA 4B4WA 3FI9A 4R4JA 4RVSA 1UH5A 3C7AA 3KYCB 3ONDA 4CMIA 1FF9A 4W7HA 5KOIA 2BF7A 3KEQA 1XSEA 4XD2A 4IGFA 3S2EA 1U8XX 3QLJA 4I9UA 2NU8A 4XYGA 1FDVA 3D0OA 2D3TA 2O3JA 3F9IA 4GGOA 4BGEA 1NASA 3QVSA 3ROPA 4CM6A 3GVHA 1V8BA 1WMBA 3AOGA 5IDQA 1KOLA 5KJ1A 1HZJA 1ML3A 1GYQA 1FDUA 2JCYA 3ZZNA 3C1AA 1H5QA 1O95A 4GI2A 4UEKA 5ICSA 1HE5A 3A1NA 2SCUA 3ZWWA 1QSGA 1R0KA 4PRKA 4WCDA 4ZA2A 1XQ6A 1CF2O 4NG5A 2GPTA 1WXDA 3KLPX 5U1PA 1RYDA 2OBNA 4NDNE 1DIGA 1SZJG 5ER9A 5B4UA 4RQTA 4YRBA 4W99A 3BMCB 1F0YA 2HQ1A 3MOGA 3O03A 4RPHA 3QQPA 1RM3A 5G0WA 4PZEA 3UXYA 3K73O 3PEFA 3I6IA 4DTIA 5ITVA 1BWSA 5I9MA 1JKJA 3BYZA 3C1TA 1IE3A 1ZZEA 4NJMA 3FR7A 3AWDA 4CLRA 7ADHA 2HMVA 1EK6A 4CR6A 1VL6A 4BHTA 3HFGA 5AQ1A 1KVQA 2J3HA 1GTMA 5C3MA 3U09A 3GA0A 3WLFA 3ZV3A 3PWZA 3HUDA 1IHYA 1QR6A 3L6EA 4I9NA 5BR7A 5CEFA 3EUWA 2GNAA 4DGSA 4Q39A 5DCWA 2ZTVA 4BNJA 3ENKA 1OZAA 4WLEA 1DHRA 4NHEA 2Y1FA 1C1DB 1ZK2A 5COAA 5FI5A 1Y9EA 4JIGA 5IXYA 1W8DA 3NTOA 2O4UX 2BRUA 3F5SA 3OJOA 4FOSA 3PIDA 1SCUA 2YZ7A 1GPDG 4FOOA 1NQAO 1IPEA 3VVBA 1NWCA 3WXBA 3F5QA 3ZNOA 3WNVA 4CMCA 4L73A 1GV1A 1PGJA 1YBMA 1ISFA 2IZZA 2I99A 3DBRA 1BVUA 1EDOA 4YQYA 5BNTA 3PJDA 1OC2A 1DFIA 1SB8A 2P5UA 3I9LA 4DWVA 3S8MA 4YJFA 3LC2O 3K2EA 1UXIA 1R6DA 5THKA 2Q46A 2WD7A 4BB5A 3RC7A 3PTZA 1PU2A 1EQUA 1R37A 2C20A 4BNMA 1E0DA 4UVEA 3IP1A 1JN0A 3GMSA 3H9JA 4URFA 4JJGA 3SLGA 4BNLA 1YJQA 3WICA 2DTEA 3FCOA 5H81A 1DC4A 1DBVO 4PLZA 5I7VA 4BNFA 2EEZA 4IGEA 1E3LA 4R51A 2BFMA 2ZB8A 4FC7A 1ZSVA 1ZUD1 3GG2A 3V2HA 3UKOA 1IL0A 3CEAA 3H9QA 1GCOA 3GMDA 4EDFA 1Y81A 3PWSA 4YTEA 2ZCVA 1TEHA 4LMRA 4N5NA 4ND5A 4WEOA 3WGYA 1BHSA 3JYQA 3PQDA 3BTVA 4TRRA 4PLTA 3TQHA 2I9PA 1ONNA 4CODB 1CDOA 3RU9A 4DUPA 4DLBA 2AEJA 3JD2A 3LC7O 4YJDA 4AICA 4XB2A 4PGFA 2PKRA 4P4NA 3FPCA 4CMEC 3F3SA 4B79A 3AI3A 1XGKA 1DSSG 1YBAA 4G5HA 4JBGA 1NBOA 5CPBA 4E2WA 2H63A 3RKRA 4UULA 1UZLA 2J3IA 1UZMA 3D3WB 4W9NA 4PG6A 4AL4A 1HWYA 3L4BA 3STHA 3I1JA 1MC4A 3DHEA 2EW2A 4XX0A 3GAZA 2HRBA 4B8ZA 2ZB4A 1G0OA 3GR6A 3WYCA 1P44A 2NSDA 4F46A 1GEGA 4OHUA 2F00A 5ADHA 4R9SA 4IZHA 4A03A 2O2SA 1GQQA 4CV1A 2FWMX 1EUDA 4J1QA 1YBVA 1AN9A 4TWRA 4CQLB 3LF1A 1X7GA 1K6XA 2NVWA 5JCJA 2GGSA 4EYEA 5EMHA 2A35A 2VHYA 3HE3A 3DB2A 4UUOA 1PR9A 2V6BA 1LTHR 3ICCA 2JL1A 3I23A 3M2PA 5JDIC 3EY4A 1EUCA 4FJ0A 3ZWMA 1XYGA 4RVUA 3AUTA 1Q7CA 2BHLA 4OAQA 2JD2A 3H5RA 4AJNA 2OZPA 2Q1TA 4BL5A 2CD9A 1GYRA 1FMCA 2PH3A 1R12A 4E33A 1JDJA 3H2SA 1ISHA 3LC1O 1HRDA 5I9LA 5JE8A 3S2GA 1BTOA 5AXDA 4IQ0A 2I3AA 2WDZA 5TSDA 4WECA 1VJ1A 3DZHA 3WGGA 5TT0A 3ST7A 2JFGA 4WLVA 1YS4A 2X5JO 4YAKA 4BO7A 2RBEA 5JAQA 4YXFA 4JJIA 1BXKA 4RPGA 1TVEA 1BVRA 3PDUA 1GADO 3JQAD 1WAMA 4GBJA 3GLQA 2O48X 4UVDA 4XDZA 2WYVA 2YV1A 1N8KA 1Q7BA 3TWOA 2P4QA 3QVOA 4N5LA 2AHRA 3DZKA 4MIEA 4ALNA 4EJMA 3JQAA 3ZHYA 5LCXA 3I9OA 2EGHA 4A10A 4OSOA 3DOJA 1LLUA 3B70A 1C0PA 4FN4A 3VH4A 1Q1NA 2Z5LA 3JTMA 3IKVA 2FPIA 1GPJA
chains in the Genus database with same CATH superfamily
5FRDA 3CCCA 3FMPB 3VR1A 2P0AA 4HFJA 4B7ZA 1BMFA 1R0ZA 4Q24A 3BRWD 4WCFC 1DWOA 1MQAA 1S8FA 1XWWA 3C43A 3KFXA 3OM1A 4J1NA 2YWFA 4D79A 4PQFA 3WWOA 4C88A 3ICOA 1UFVA 2AH5A 2O14A 3AW9A 1G8FA 4EK9A 4MDHA 3TQOA 1E7WA 1RS0A 2WA2A 2Q3FA 4BO0A 5KYXB 5IANA 1YCFA 4NFYA 1IN6A 3A9SA 4WKPA 3ZCXA 1KIMA 4IBOA 4IXNA 3RG2A 1UOEA 3NRJA 3F0TA 2B5WA 3L7YA 3N2ZB 3ZU5A 2JDID 2I4NA 5SY4A 2C57A 1PZXA 2PS9A 4Y9DA 1CJKC 4B81A 5BYKA 1NBAA 1BDJA 3QUQA 1X87A 1A8QA 3S81A 3IE0A 5A3QA 1MG5A 1OX4B 2FEKA 2Q29A 2JAOA 2RJNA 3L1IA 4Q93A 5J2TB 1RQ2A 1NNSA 5BW8A 1ID8A 1Z0JA 4FNAA 2CE7A 2H1FA 2O8FA 2C3OA 1GPH1 1Q2UA 2PSSA 2W6CX 3PGLA 4H6XA 1P4SA 4CCSA 5JSHA 1AZWA 5DXAA 3HB5X 5LZ4A 1RWWA 2ZJ3A 5IVKA 1A76A 2XUOA 4DOMA 3KNZA 4RQBA 1WOMA 1HDYA 2C3UA 3GEMA 1O0SA 2PWYA 2OAQ1 1UP4A 3MJEA 1BHQ1 4WZ6A 1YONA 2FQWA 3ZWPA 1KF0A 2IS1A 2YXPX 3JQCA 1AGNA 3C5EA 4M8KA 4Q12A 3A04A 2D1SA 4AZ0B 3A9CA 3A11A 2C1XA 5JSQA 4OMDA 5KNCH 4N01A 1BCSA 3TIFA 4LRYA 3RHFA 3REQA 4DXAA 1E18A 3NBKA 4W9NC 4F9EA 3FF4A 4C21A 2ZJZA 3ECCA 5C1BA 4AG3A 2IEIA 4LWQA 5F5NA 1T9GR 2XVXA 2Q9AA 4XWTA 2QX7A 5HF8A 1L8XA 1T36A 2GCPA 3ITDA 2JZOA 1CK4A 1H1LA 3K5PA 5E6UB 4KMMA 4ARVA 4MUAA 1CQJB 1XCGB 2ZJFA 4MVJI 3MCZA 2F3QA 3DE3X 4PC7A 5MN6A 5DMXA 1O89A 3D7RA 3CVOA 1TJNA 3UYKA 1OC4A 2CXTA 5KNBD 3V8MA 2ZJ6A 3W1VA 2O57A 1PFQA 2D1YA 1RKBA 3PUXA 3GP5A 5B37A 3SLKA 2ZW9A 2B4RO 4BN5A 2DBZA 1T9BA 1ZVVA 2P11A 2BUAA 3K5IA 5HYVA 1HPLA 2PUFA 2J5KA 2ZUDA 5JNRA 2C29D 4JAVC 3ZKWB 1JV2B 4EO4A 4C2BA 4P0TA 5J5CA 1GUFA 4Y2XA 5D7BA 4DQVA 3WK6A 2F8SA 3R3WA 3MCTA 4DIOA 3L43A 2QPLA 1E2UA 1XEAA 3TKYA 2DBQA 3VPXA 1GQSA 3W79A 1F5NA 1OH5A 2RONA 2CMDA 4FBGA 1VSUA 4RTOA 4R8LA 1A72A 2NAFA 2WF7A 4QT0A 3PPVA 1HTWA 3RHTA 2JJMA 2P4SA 3AL2A 4AMGA 2W2QA 1IJEA 1NR7A 2QRPA 4LVNA 2I1LA 2ECFA 1JKFA 1M6EX 1RYEA 3GXBA 4OBBA 1A7AA 1OT3A 3W2EA 3W5IA 3MZ0A 4ESOA 3LGAA 1OLOA 3KTAA 4RYDA 4ZVUA 1Y63A 3RIHA 4F7WA 2G36A 4KPGA 4QDXA 2HNAA 3IPCA 1NVAA 3M8KA 5IWCA 1RZRA 1UKVY 3KD2A 3EEQA 4O2AB 4O4JF 1YZGA 2HCBA 2OSBA 3PCTA 4GE3A 1D03A 2ESRA 3U17A 4D0SA 1U90A 1JG4A 1UEXC 3TFQA 1LQ2A 1GU7A 1NFFA 2ZTHA 3QXCA 3DTYA 3H8WA 2MINB 4KLZA 2BM1A 1F17A 2HPZA 2JHAA 1OWMA 5F33A 4DMMA 4TKVB 1KAGA 5IYZB 1Y37A 1ZICA 2RIPA 1XZBA 5A5FA 1DLJA 1HV8A 2ZQYA 2RDMA 2X5OA 1DO0A 1U0OC 4FZ3A 5JS2A 2W43A 1WE2A 4U7WA 1X92A 1E89A 1VLLA 4X3PA 3UCFA 1CR4A 4JJKA 2DOKA 4X8LA 4I3HA 3W8EA 3BHNA 3JYHA 4YJKA 4RORA 2OWEA 4D8TA 1H5UA 2WRZA 3TIIA 1A4IA 2GWHA 2V4MA 3ZI0A 1Y6QA 3KWJA 3B6KA 1LPBB 3FPGA 3PGJA 5B3AA 4OQEA 5ERGB 4B87A 4CLOA 2XGOA 3L79A 3P94A 4HGYA 1SBHA 3IP6A 1NVGA 2ZIGA 1SRQA 3DEFA 5ECWA 4C0JA 4BLTA 1I30A 3KR0A 3OOJA 4CIXA 3NRCA 1XD2A 3PR3A 3VOBA 1L4NA 4B7AA 4UXJA 1VQ1A 3PU6A 3UJ8A 1GNPA 1CULC 3ZS9A 1ZGJA 4RS3A 4QDUA 3FW1A 4M1ZA 4XYBA 1VLHA 3FJ1A 5M29A 3RU7A 3ZDFA 4CEIA 2VWGA 3IFSA 1I4LD 4F7DA 1PP4A 1EMDA 3CS3A 2GDJA 3QWHA 4BNKA 1XKTA 3VNSA 1SKQA 3RS9A 3U5ZB 4IP0A 4N3AA 1SKMA 2GBIA 4E15A 2QRGA 2IP1A 4BXOB 1UKEA 2XGGA 3D1JA 4HNTA 2JRCA 3QQ5A 3INNA 4R5HA 2EBFX 3H4IA 1N0UA 5CRIA 5F76A 1FNMA 2O4CA 1XR3A 1I1QB 3QKUA 4X0EA 2F48A 2OB1A 2P2GA 2W6MA 4HLQB 3A1FA 4XVRA 1XCOA 2RHRA 3IB6A 2YWEA 4BFVA 2CVPA 1KMHA 3S44A 3VJKA 3A9VA 4W5TA 1AQ6A 2JGDB 1RVV1 1ZNZA 1GT6A 2J9RA 3AR3A 3U7JA 5CNIA 2OYCA 3U7EB 2FZ5A 1K3FA 5HKKA 3HJCA 5AVXA 2H4XA 4ALMA 2GJ8A 4AY4A 1FIUA 5DHSA 2CDBA 3GP3A 2E85A 1X2BA 3KT3A 1CQZA 1L7PA 3C48A 2VLIA 2X2FA 1HDCA 3U6KA 5HRAA 2JRLA 1S9DA 4YMSA 4D9BA 5KVVA 1KK1A 2J9FA 1F9EA 4M9SA 2A0UA 2QTAA 1ZO8A 2KYRA 3K72B 1JLMA 3GPCA 3LXMA 1JP7A 3M6VA 1D2GA 2FSGA 5CX1B 3ZBUA 5AXCA 4DLRA 5ABPA 2XNJA 1KI4A 3FB1A 3MG9A 3WB0A 3O75A 2ZI6A 3OZTA 3WK9A 4B6JA 5CP8A 2XKBA 3BK7A 2E5FA 4EG6A 3AIOA 4FYMA 5EHIA 1PZMA 2I54A 4YDSA 3UFXA 3VPDA 2PKWA 2PX8A 1G98A 1GSAA 4RTRA 1OB2A 2L17A 4HN4B 1E5QA 4C5BA 4EFKA 2FW7A 2IF2A 1WXEA 2IOYA 1GTZA 4L08A 2H08A 2J4DA 5HW0A 1UDBA 3JTEA 4QELA 2R6FA 5GONA 3SSAA 1ONOA 3FPHA 4AFNA 4Z0NA 4ENPA 4DR5B 2A67A 1VLMA 1IBKB 5FORA 3F6RA 3FHTA 2ZB7A 4FNOA 4KQIA 3AVWA 2GB4A 5I8WA 3MXTA 2UDPA 1SA0A 4K9SA 1Z2AA 5F1OA 3UA4A 1H65A 2O0MA 5LLTA 1CE8B 1ESDA 4QUEA 1E1LA 3KPUA 3SY8A 1A97A 4MWOA 1D4ZA 1KO4A 1YE3A 4K9QA 3GNQA 4WOBA 1EXDA 1KYIA 2NU6A 1FDSA 3JQEA 1Z5GA 1XMOB 1FY2A 3QJGA 5KVSA 1I2AA 3NYQA 1W4BA 1M73E 3UM9A 4TYNA 3OE5A 1EFLA 4N7MA 3D6HA 2O7QA 3NB0A 2DBRA 2P90A 3A1CA 3PKJA 5J1TB 4FXPA 3RUIA 2W2KA 2BFBA 1DUIA 3EGWA 3FHCB 2JA1A 2FX5A 5TF0A 4A36A 4E07A 4B3FX 5LQKA 2Z3ZA 1E2NA 2ZR9A 1ACLA 2MYUA 2UVDA 2BFEA 5EJ8A 4OHMA 5KREA 4LJSA 1OXUA 4TMKA 4EYSA 1ETUA 1WHTB 2WNHA 5A02A 4IIBA 1R18A 4CI0B 4F8EA 3MGBA 1FXWA 1IBMB 3KOOA 4URYR 3IAUA 3EGEA 1TLFA 2IUFA 5F7ZA 1YIAA 4KODA 1PNRA 3HCFA 3NDBB 2ONKA 2PX6A 4IDFA 3G17A 4WFIA 3HN2A 5EZYA 4BO9A 1N9ZA 3LNTA 2JFVA 1OREA 1NLMA 1WW2A 2GKOA 2PSJA 3F6SA 3OJEA 4NABA 1RWXA 3IJ5A 4PZAA 4TKZA 4Z3DA 4C5AA 4EJ0A 4KN6A 1N2BA 2NZUG 2YC4C 4KFCA 3PC2A 2F4VB 1PV1A 1PL0A 4YV1A 1PJLA 2PCLA 3THOA 5DM70 1EHYA 3BWEA 4B75A 1LWNA 1XJQA 5EIHA 5KNLA 3EG9A 4WZAA 3CH5A 2Y99A 5E3JA 4RCZA 4EYQA 3FRIA 2JGLA 5IDWA 3ND7A 3THWB 4FGLA 2GRUA 1NG9A 1CF9A 2QXUA 4BQQA 2EWWA 4DSZA 2GK3A 5JSFA 4QAJA 4AJPA 3G2OA 1HFJA 4ICIA 2CLEB 1HOXA 1UOQA 3EN0A 4U7PB 4OK6A 1JLKA 4HGNA 2GPBA 2QTFA 3AHHA 3GAFA 3V1KA 1DJNA 1NBMA 5I7OA 4G0UA 3NC0C 3MJSA 5DFAA 2Y4OA 3QJ5A 1URPA 3FHOA 4DIFA 2RFLA 1XDBA 1LRJA 3L06A 4G4GA 4PZ9A 2HMSA 4WFKA 2RAUA 3W7VA 3JR7A 1E8DA 4OG2A 3VO2A 4H6VA 2AX3A 3O93A 4O6VA 1EVKA 1KSGA 3RIXA 4BO4A 3E48A 4UUBA 1YI1A 3H1BA 4ZXFA 1FK8A 2NNLD 2YY7A 3HWRA 4X94A 3WQSB 4MUNA 1GU1A 4EPRA 1YGYA 3ANXA 1V7CA 4QHTA 1ZAKA 3FH0A 1P7WA 3H8VA 4JGIA 1F2TB 3OIUA 2VSYA 5K8TA 1SXQA 3WKBA 2HU7A 4N8DA 4JSYA 3OMXA 2WB4A 2EW8A 1O8CA 3VNRA 4CMEA 2XTJA 3AFHA 3KQPA 3TGWA 5AVWA 3GK3A 1G5RA 1ZSNA 4OQNA 4ZKDA 1JG7A 2C4HA 2HAEA 3EVAA 4N8EA 1EWYA 3RD5A 1WB4A 5JH7B 3E22A 4PRLA 4ALIA 2VJDA 5CD9A 4MR7B 3ZYZA 2AWNA 4O2BF 1HDGO 1MRNA 3RYHB 5CAEA 5JXWA 3ZLJA 2C77A 1LK0A 4KB5A 1L7MA 2YMPA 4QT4A 1JXOA 4WI1A 1XZMA 3ND9A 1UOPA 1Y1KE 3O8DA 4FINA 4BZXA 4LYDA 4PEVA 4WUVA 1H3FA 1U7XA 4LXTA 1PL7A 4IWXA 1V2HE 2QF7A 1Y6JA 4EHLA 2FE4A 3C4QA 3F96A 2XJ9A 4RFVA 4RFSB 3QEKA 1DZIA 1W5AA 1ZVKA 5EJIA 2C7VA 4CMIB 3TTVA 2JGKA 2XRFA 3NUGA 4TZ6A 2DFKB 3VI4B 1VJGA 4CM1A 1N5JA 1Z2EA 2E4AA 3ESBA 1SBNE 1I24A 1VA5A 2XR1A 2F3RA 2V3CC 2PWAA 2YV4A 5AVJA 2A78A 3EXHB 3D02A 3A4VA 3BJZA 2XNDD 1CS0A 1VPTA 2ADOA 2VHZA 3AYXB 3H2BA 3PWTA 3ZHVA 4I1YA 1I1HA 1XDZA 4BE7B 1XTTA 1ZJ6A 1HDRA 2XE4A 3EWNA 5KYWB 4B84A 5GM1A 4G5SA 3FWNA 2IYFA 3PRHA 1AUVA 1G6KA 2WSSA 2OO7A 1FFEA 1GLGA 5H3LA 5JDIA 1CUJA 4QD3A 1L5VA 2QN8A 3NI2A 1KSJA 4R1UA 1U9IA 5AM0A 1UQUA 3EDQA 3D7LA 1P19A 4PS0A 1E6CA 1P60A 1PR3A 5JALA 2BLNA 3K53A 1ZRHA 4P3XA 2OC4A 1Z9BA 2ID7A 1X14A 2QU8A 3EQ6A 1U8TA 2WJ4A 3B9PA 1NFQA 4KN5A 1FTNA 2I2BA 2N0SA 2P9HA 1UT6A 4XVUA 1C3JA 3CU5A 4CM8A 2P7IA 5KKNB 3ZDEA 2QM7A 3IURA 4I14A 1OAOA 3BFJA 4ER7A 2FG7C 1OOEA 3NOOA 3WVNA 2B8EA 3RS4A 2QG9A 1UBMS 3W8NA 3GEIA 4ZVMA 2I4MA 3I1IA 4DXDA 5BYBA 2BBOA 1V43A 2QTVA 3RJTA 1OXXK 4D56A 4F21A 1K9SA 4WLOA 3RRBA 4AS1A 2VJOA 2GF9A 4JN6B 3ENQA 2HT6A 2OOKA 1JHQA 4YMTA 4O3MA 3VZRA 3QOWA 3C6MA 5AXAA 4YCSA 1J2UA 1MV5A 3EZLA 3GEEA 4KWCA 4Q3CA 1H4TA 3FNHA 1NUSA 3QLVC 4XDGA 4CFYA 5CIQA 2RGGA 3FNBA 2JARA 3DVAB 3IBYA 4CF5A 1NM5C 3IEVA 3B6IA 1D0VA 4PSVA 1OVGA 5L4LA 1EU1A 1RPTA 3DP9A 3FYHA 2B94A 1VMDA 2FWAA 1JYEA 1CUIA 1HL7A 2JIPA 1E5LA 5B53A 3F7OA 2L19A 4QFDA 4DCCA 4IEEA 3U7RA 4LDAA 1XYYA 3ZDQA 4QNNA 5AUPB 1EP3B 2QBYA 1CNMA 1VDZA 4N12A 3KJQA 4MWDA 2BR3A 2D0PB 3I9JA 4WCFA 1FFSA 4D6YA 4RM2A 1BE8A 1JFLA 1TLLA 4O8ZA 4JI4B 2DERA 2VP4A 4UBLA 5BN3B 1YJAA 5EMKA 1BXGA 2DPGA 3MBOA 4BU0A 2XODA 1K98A 4X6YA 1U2DC 3P9ZA 3SZOA 2IYOA 3ESCA 3P2YA 3GQBB 1KDOA 2QU7A 2Z2XA 2BEWA 5TT1A 5BOSA 3KLMX 1G1MA 4F1JA 1WY5A 1KKMA 2MYTA 4WPGA 3UJBA 1P5FA 2Y1LA 1LF0A 1Z22A 4K6CA 4LZOA 4WKGA 4Y18A 5EXPA 1U0JA 3I30X 5LWHA 5L6LB 2A1UA 3H7IA 2NTJA 2F1KA 2QAIA 2XIJA 4H2DA 4JASB 4LGMA 1IDN1 4PS1A 5DDIP 3W3ZB 4NENB 5KKAA 2AG1A 2XXJA 4TQGA 2F55A 2F8MA 4BX0A 1J07A 2W6ZA 1GEEA 4KDEA 4Y1EA 4WE3A 4WMLA 1EKXA 3IAEA 1QRAA 5ILQA 4DNOA 3KHKA 1SC3A 4JJ7A 1CRLA 4P31A 4KLAA 4QEDA 4BEVA 4QGAA 1AKTA 1C0KA 5IXSA 5AVRA 1DTSA 4DILA 3LHDA 1TW2A 4KXVA 3NETA 4EQZA 2W6JD 2WLTA 3RAFC 2ECPA 5BVGA 4PG4A 1CUCA 4LOKA 3EODA 1T0IA 1WNFA 1U6KA 3S0JA 4URZR 1KMIY 2CMFA 1TEVA 3T5CA 1EA5A 3PICA 4K0KB 1E7YA 3PR1A 1YZNA 3PD1A 1DEAA 2W7TA 3GJ6A 2O3RA 3JQFC 1NMSA 2BEVA 4E3WA 1T91A 3IEXA 3NH9A 3VVMA 1DCMA 2GUGA 2VPTA 3H99A 1N2EA 1C3XA 1UJBA 3P2KA 4NS4A 1NJ6A 1ORIA 2QMQA 3PD0A 4Q7EA 3T9EA 2B0JA 1R6XA 3EH2A 1T1SA 2IE8A 2R751 4Q82A 4NCNA 3UY4A 3GFBA 2GN9A 1CFJA 5K0TA 1P1FA 3I5MA 2JFBA 3RJ9A 3WJ2A 2O8BA 3T7AA 1DX4A 4XQ9A 1FUYB 4KDCA 4N18A 4WN3A 4JOBA 2ZE5A 2PNJA 1FW8A 2JGJA 4CFSA 5KO2A 1CXZA 3G7NA 5DGTA 1JDVA 1H5NA 1TKRA 3QBDA 1YDEA 3U81A 1PAUA 5A4KA 5E4YA 1P72A 2I6GA 3O95A 2OMKA 1QLWA 4D9IA 2VBCA 2Z9BA 3JR3A 1LSJA 4MB6A 2BMVA 1C7JA 3PDWA 2HGSA 3QFTA 4J1TC 4XX0B 4ZYZA 3IUEA 2K2QB 4ZEMA 1JDSA 1Z2OX 1KP2A 3IVCA 3UKJA 4PCAA 1HNZB 4GRDA 3I39X 4Z0HO 9LDBA 4Z8YA 4F2WA 2I65A 1PJTA 5B64A 1UWLA 2EWVA 4XIFA 5K01A 4HQKA 5KYTA 2ZJYA 3UJ6A 4B76A 3BH6A 3AETB 1GGEA 3UEOA 2QQEA 4GQBA 3SOZA 3BB4A 4FHFA 1NMZA 3W5AA 3K9CA 2A1TR 4J4BA 1J7KA 4G2TA 1SKYB 1JMKC 1D6MA 4KO8A 5FOTA 3RHSA 3UJ3X 4JY7A 4RBNA 3F3YA 5BNWA 1FJ2A 1Y4AE 5TY0A 3WGQA 2ZQZA 2XAUA 3OUUA 1KI3A 3WJAA 4AXBA 5CB4A 3OIVA 1TAQA 3ZK8A 1U2TA 4QUJA 3T7RA 1IK4A 4D46A 3LZCA 1Q7TA 2XT6A 4XUGB 1SKAA 2NTEA 2PT9A 1CCWA 1P7YA 3HDYA 3F46A 1S7GA 3MWFA 3OFSA 3OO1A 3ZY3A 1Z6XA 2FR0A 3OQHA 5A5EA 2PRSA 2O8EA 1EUQA 3U19A 4N5IX 3O2QB 2O2GA 2OV8A 4WESA 1OJ7A 4Z7JA 2Q4EA 5AHKA 4EUNA 3FGNA 2VDPB 2HPVA 1T25A 3HV2A 1N36B 1Q20A 3M5PA 3KOZA 4L6AA 3K09C 3TW8A 3MW8A 1X1BA 3FSEA 1E63A 3WYDA 1ZVMA 4JT8A 2GZDA 4UZFA 2P4HX 1I3NA 3MTBA 1E2MA 3DJYA 3ZI4A 5J47A 4JXZA 3D8UA 2Q3BA 4L85A 5EHZA 5LSAA 1DRWA 3HDQA 4UHJA 4F6LA 2P78A 5FL7A 5UKDA 4CKBB 1J00A 3I8OA 4KKXB 4OJKA 1M34B 2ZPUA 3SSNA 4DY4A 4V1CA 3S40A 4YP0A 4BTVA 2YWCA 4TX1A 4DVGA 1E3WA 2PV0A 3PWKA 1WCV1 2BUBA 4EY6A 4ZI7B 1JAZA 2AIRA 2GEFA 1RI1A 3AF0A 2VK1A 3EB9A 3O1JC 5FO0A 5KNCD 1IAQA 1S5PA 1FVFA 4CM4B 1LDYA 1WXWA 1IZ8A 4DUYB 3JARB 1IAVA 1LNSA 3RVMA 4KLCA 4OIFA 3ER8A 1ECGA 5IK2D 3OE7D 1E5DA 5F1YA 4B47A 4EFLA 2ICAA 1I7SB 4PFJA 1EFPB 3U80A 2FZ4A 1BS2A 1O4VA 2DFLA 1ZG3A 2H1VA 5GINE 1A7KA 4HQ0A 3GLTA 3NHSA 3QVJA 1H0SA 4L8FA 4CGYA 3V32A 3HK2A 4K26A 3O84A 1DJPA 3FM9A 1WKVA 1A71A 1RYBA 3H0EA 3RQIA 1PK7A 4NXMB 1GUAA 3Q7IA 2Q3MA 2XADA 4LAFA 1TTHA 2PUVA 3PNSA 1OAKA 4L7QA 1G19A 5IEBA 3S27A 4QTYA 5AI9A 1LQTA 4NCKA 3SD7A 2YWJA 1DKPA 4ISCA 4NF2A 1MVNA 5JEEA 4A92A 2XE7A 4KE7A 4D9EA 1SUCA 2PD6A 3WNZA 1EHIA 2V3WA 3KBOA 1AKMA 4HF7A 3I28A 4QEKA 1SCNE 2QMEA 3VU3A 2O8VA 1I3CA 3ZWYA 2C7RA 1S0UA 4EJ6A 4BMSA 3JYNA 5FBWB 3I12A 4WXYB 3WK7A 3AI2A 1MW8X 4EF4A 4YXWA 2AJDA 3MINA 1IK6A 2CL7X 1G20E 1JEAA 3K31A 3K1AB 4C2AA 4HVLA 3H3XA 4KUEA 3TNLA 1JIXA 2DFNA 4AZ0A 1ZD5A 2O2HA 1O96A 1A9ZA 3KU4A 4FT2A 2PX3A 3TM5A 2BH2A 4O33A 1C7IA 2NM0A 4K3VA 1Q16A 4C01A 4BTLA 5ALRA 2PGOA 4P35A 2C2HA 1HFEL 3QLUC 1GNVA 1N4DA 3SQMA 3W9BA 4ENVA 3E5NA 1IEWA 1SCDA 2OCBA 2WJ3A 3TQIA 1VIDA 4HS9A 3VAZA 4GAEA 3ZN2A 1J1IA 3MHPA 2AJBA 4L9SA 1MJNA 4LSMA 1YFZA 3KQUA 5TARA 1A82A 1P1RA 4WLNA 3MRSA 1FYWA 2OCGA 3C6XA 3PC8C 3LP6A 3NYIA 1E6LA 2I2WA 4C43A 2WR8A 2VNSA 4ZP1A 1USVA 5I7SA 4L51A 2WYUA 3I9NA 1YD7A 4NOMA 4OX9Y 4MVJD 2WTBA 3LWNA 1XRNA 4JUAA 3T3MB 2FPUA 3C2QA 1QH9A 2JD0A 4EJFA 3DLIA 4Y2UA 2I29A 5JWHA 3QE3A 3WKEA 1V48A 4ZK2A 2QL6A 3PHBE 2R1ZA 5ES3A 4B3SB 5BQ3A 4Q1VA 1NQOA 3G0CA 3DKRA 1IZ7A 5FWAA 4X95A 4WN9A 4A0HA 3GVCA 3NWOA 3LMKA 3EZGA 2HO5A 3JYPA 4G8BA 4XCQA 2P9TA 4E5YA 3EPLA 3A9TA 1PR0A 4YP9A 1L7AA 3OWOA 4WV3A 1QB7A 4ZCTA 1MTZA 3OCJA 3BGWA 3OPYB 2FFJA 4CG1A 2IVZA 4XWAA 1JPNA 1CY7A 2VHUA 4ZOLF 1RP1A 2Q1XA 3SX4A 4CR8A 4YT2A 5CITA 2WJGA 1VOTA 3EH1A 2XXAA 1G9XA 4ISBA 4GI7A 5DN6A 4NJOA 2OG1A 3RJ5A 4D57A 1KE1A 1SZPA 5IF3A 2IW3A 2WTMA 3GEDA 4RTPA 4WOCA 2NYRA 1Y8QB 3VR6A 3KYIB 4A4DA 1WMFA 1XWIA 1EVQA 2JI7A 4TROA 1U2GC 2WDPA 4LPSA 1UC8A 3O8OB 4GMXA 2O5EA 3IPLA 4CYMA 3UK1A 1EM8A 3X1ZA 5DOZA 4FM9A 5FJJA 4B74A 1HUQA 3G9XA 1TT5A 3TVYA 1TAGA 2QJFA 1KEZA 5KOJB 4O2AA 2ZIFA 1A8SA 1AXRA 3NKVA 2PVPA 4BV3A 1IDOA 3E82A 3TLGA 2JHFA 4FUTA 5K8UA 2X42A 1IULA 4CI9A 3C5HA 4P5PA 4CTKA 1OILA 2V7GA 4QXOA 4KPUB 1B15A 3ETEA 3RBXA 1ISPA 4OI2A 4V3BA 4FTWA 3N3BC 1L7OA 4K9DA 3TGPA 2PBZA 1DAPA 3ABRB 2QEQA 3RYFB 1TF5A 4W4TA 3VU0A 1T9AA 4A8JB 4JT2A 4LE1A 2NT3A 1WVMA 4KVGA 3DM9B 4YT5A 4W9RA 3WLIA 4BAUA 1KVUA 1GNSA 2PT7A 3HXOA 2IPXA 1PKEA 2EGGA 1NZDA 2HUNA 4LSWA 4EMBA 2ZTUA 1RM4A 2ZRKA 3N6VA 1VG0B 4KMOA 4RA9A 4WASA 3FD8A 1A5TA 3Q12A 1UWCA 4L0QA 4MW6A 3HY4A 4I4IA 4ROTA 5D8DA 3ZLVA 1I01A 4YRGA 1CZOA 1XMIA 2GRAA 2J3MA 2OGSA 3F71A 4DCMA 1Y1LA 4WXMA 2CUNA 4NQRA 1MB3A 1Z75A 4OGFA 1E0AA 2DYKA 3AB3A 3U37A 2CHFA 2OQIA 1Z4LA 4ZVOA 1MX1A 2H52A 2O6HA 3BXHA 1L1RA 1T3LA 4R69A 5LOVB 2BE7A 4URUR 3BXOA 6ABPA 2R4UA 1G21B 1MNAA 3PD7A 4J2HA 4NMLA 4W1RA 4C4SA 1P39A 3VR6H 4HKTA 2Q07A 5FA6A 3TDMA 2D59A 5T8KC 5JVDB 4ODIA 3I6BA 1J8YF 4FEEA 1T35A 1NLZA 1IN8A 4TL7A 4YRSA 1D6JA 5DX0A 3W5BA 2XIQA 1U6JA 1TVMA 1YC2A 4CF3A 1DC8A 2Q2OA 1KP3A 4PX2A 3BE5A 4Z54A 4U00A 1N3YA 1JGTA 1AF4A 2ATXA 3I9MA 5CH8A 1O6FA 1U1CA 3AHJA 3BVPA 1KEWA 4N5DA 4GQAA 1RE0A 4JLUA 4BKRA 4F9GA 3DF9A 5F73A 1WUKS 2JHPA 1TZBA 2RI6A 2B35A 3DZBA 4B35A 4P3KA 2PWBA 3SI7A 3IHTA 2R66A 1VSTA 3P0HA 4K05A 3HA5A 1O03A 2LR0A 3GNTA 4DCJA 1A7UA 3CB2A 3ZC3A 5CA0F 2I6UA 1XQXA 3SMQA 1PNVA 2I66A 4EVSA 4OLFA 2JANA 2PR2A 1HKHA 3AR9A 5TS3A 4KQCA 2R8XA 5DSTA 4EW1A 1MC1A 3MCWA 3ZD6A 1IVYA 3JATB 1DCTA 2FXIA 3AT1A 2FCRA 3BQ9A 3SYLA 2W8BB 1JG6A 1BRMA 2G09A 3O74A 4JFRA 3SYMA 4AO6A 3W34A 5C7YA 5JXHA 4XTCS 4LISA 2V6GA 4TWAA 3SHWA 4QYIB 1SEPA 4UU0A 2G67A 4M1YA 3VC7A 4GXRA 2FLVA 5FFMA 1U3TA 1U5BB 2WOOA 4IDHA 2XQVA 4CKCB 1OFTA 2ASEA 5LBTA 2ZI9A 4NR0A 4XR4A 4YAIA 4KG7A 3KG2A 4HYTA 4TKMA 4IVNA 1QANA 1L0BA 1Z8DA 3FVQA 4G1MB 1ZQ9A 4YX9A 4JVNA 1XNRB 1JKXA 4U6SA 3NU1A 2GTPA 4BP3A 2HSDA 5FLKA 2GO1A 3R5XA 5LA6F 3RVQA 1YS9A 4EBBA 3BMQB 5DTRA 1YL5A 2BFPA 2FK7A 4LHEA 3L18A 2P65A 2IP4A 3O4RA 4YS6A 4A91A 2C0PA 2XD4A 5ARBA 3AVTA 3VDXA 3FCSB 1N5KA 3PYXA 4CHGA 3KR2A 2ZRFA 1EE9A 2QVZX 3VYVA 2VTEA 5AM4A 5SY9A 4AK9A 5BMOA 1RZ3A 4F4JA 4K0RA 4B5KA 2O3QA 4MOWA 3UHPA 4RZXA 3S2YA 1HLPA 5JTUA 1YZKA 4H7HA 4PQEA 1QO9A 2G6BA 3E8MA 2CT8A 2GMWA 2JK1A 2M9MA 4B8WA 2ZWMA 1AE1A 1YQXA 3UAOA 2VHTA 4FMPA 4YMWA 1U4OA 3WYNA 3B6MA 1R6UA 2ZCUA 5EUQB 4CQMB 4P3OA 4LY3A 3KL4A 2I87A 3JVDA 2X9GA 4ZCSA 3DBHA 2XQJA 4ON9A 4UMVA 3T5GA 3ZYCA 3MK31 3MWDB 3QLVA 2G07A 1XZDA 2ZRJA 5DHPA 3W9YA 3IXMA 5AM3A 3EISA 2BD0A 1QQ6A 1NM5A 3LC0A 3TSZA 3HO1A 1N92A 2JGMA 4G67A 4IIXA 4TYWA 2ODEA 2IY8A 1DIRA 3UT5A 2JJ1A 5A62A 2VUSA 1NYTA 1D2NA 3EXIA 1XHLA 2QRLA 1HDZA 5KJEA 3VMMA 2Y1DA 5EXTA 4RNCA 3RFXA 1YQEA 3HXQA 4GUDA 2JJYA 4DMGA 2ZT7A 3DNMA 1ZGZA 1T4CB 2GS9A 2YJGA 2H17A 3MJ4A 4DLPA 4WWHA 4DBZA 4Q3LA 1DAOA 1YQUA 3AIKA 3BDVA 3ORFA 1P3DA 4YA6A 1NIPA 4UD2A 3OPMA 5T3YA 1XNHA 1GZSA 3E7DA 4M0DA 1UOOA 2WFLA 4NEQA 4NFHA 2VN8A 4DKJA 1FYDA 4F11A 4JUDX 5B58T 3QWIA 3JX9A 1PO7A 3O47A 2YIJA 3OJWA 3V1TC 4YT4A 5H8WA 4B85A 3BB1A 4DVJA 4DRXA 4P0QB 5CW2A 1KYVA 1Z0SA 3DJFA 3GRKA 4MRPA 4Q7KA 3AKYA 4YIKA 5HFAA 3GJ0A 4IMPA 5JZSA 1A8IA 3TGLA 4HX5A 4R3WA 1YRAA 2EL9A 4ZGBA 5KHAA 4MA0A 2IRWA 2AKYA 4ITVA 2IWRA 2HWUA 2HU8A 2NVOA 2Z2JA 3L84A 4JU9A 5IJWA 1J1UA 1PLLA 5K2OA 4KK3A 4XQCA 3NVMB 3K9LA 1QFYA 3THSA 2IX9A 4R41A 4FILA 5T6MA 1SMKA 4BNVA 4YUXA 1E6EA 5ELLA 1PZNA 5B1IA 2JIZA 2CDAA 4IFTA 1TNDA 1PL8A 1Z16A 1KKLA 4XEHA 5IVDA 3IEMA 3KP1A 4BX9A 4OI1A 2A4MA 2J0UB 2YVAA 1G3UA 2V96A 1EJ6A 1W4CA 2GYWA 1HQKA 2XYPA 5AR1A 2DBVO 5FBZA 3WIUA 2POQX 4C9BA 2OXRA 4CG3A 1SN7A 4ZK6A 2GZSA 1P7PA 1CIPA 3MAJA 1BU8A 2OWDA 2AXPA 2Z08A 4I6EA 5HZGA 2ZRNA 3E18A 3DLHA 4OGWA 1J22A 1M1YE 2YL2A 5FYDA 4ZRMA 5G3YA 1M74A 4BKMA 4JC8A 4DM7A 5LN1A 2NZWA 1AKNA 4DADA 4LSZA 4CF6A 3U3RA 3I9FA 4M1WA 4W5JA 4ALKA 3SS9X 1MKYA 2PFSA 3CW8X 1S2IA 2BE9A 2QN1A 3OIGA 1F2VA 4MARA 2W5UA 5LMZA 3BXXA 4D45A 3VR5A 1PR2A 1KVSA 2CHQA 1FTQA 4BDTA 3C14C 4BQPA 2WTNA 1M0TA 4RFSA 4COKA 2JASA 2CJWB 1E6WA 1V11A 1W94A 4RV4A 5C9ZA 5BSUA 5KKCA 2BFFB 1Q0SA 2AVNA 4MW1A 2BTOA 5EA2A 3QXHA 5HF5A 1WLSA 3FSJX 3RE1A 2ZJ1A 3RO7A 1RKQA 2IS2A 5G4KB 1RCTE 2VEDA 4M1EA 3ZBQA 5B1DA 2ZJ8A 5C8XA 3ILHA 3R9XA 2QI9F 1SXJD 2LBPA 4O29A 1LDEA 3A9UA 3Q1LA 2WE8A 2QKYA 3UWPA 1N2GA 2FV8A 3D64A 4B0PA 4HYQA 4OBWA 2CCKA 2ERYA 4LXXA 2H06A 2JGNA 5J58A 1ODJA 2I2DA 2PQ6A 4DV7B 4X63A 2R60A 4HTFA 3G8AA 1CUSA 1SHZA 2AZ4A 3FUWA 4PVDA 2FUCA 1REQA 2IPMA 4RELA 5GJWC 1T43A 3CT6A 3CZQA 3KKZA 3NNNA 4LJLA 1EVYA 1YQTA 3E7WA 2X23A 5BUQA 4LWZA 4LVUA 4DM4A 3IHLA 3O73A 1KEKA 2KB0A 3IQGX 1N2OA 1QE5A 5DHTA 1TVKB 2P3SA 2RG7A 1KAEA 3KJGA 1TYDE 2PUBA 3MMSA 2OL4A 4GWLA 1JQJC 1XXHB 2GK7A 2Y1GA 3HYLA 4IQGA 1MO2A 1SH7A 2CLCX 2VQ3A 1DBQA 3ELWA 4FEAA 3J7AC 3RQSA 4EI9A 5L7WA 1SKBA 2FPRA 1CETA 1IOVA 1MO3A 1TA9A 1ZXLA 2BFDA 2GPSA 4GZMA 3I9V6 3GDFA 2PAAA 3P52A 3QPWA 4BWVA 3ZXXA 4B6OA 3AM1A 1KI2A 3P0RA 3WKCA 1YIDA 1QMGA 3ASZA 2LRHA 2ZBDA 3AJDA 4U4AA 5K4HA 2GHIA 4MWBA 2Q8QA 4IDNA 3JQPA 2FWBA 5IW8A 3CE6A 3QXXA 4ZDIA 3DLAA 5CFMA 1WZUA 3K09A 4MEJA 3IP9A 2FDXA 2OHFA 4RE5A 2E5WA 1ZWLA 3H8SA 1PD1A 3K0AB 3FTQA 3MWEB 2OBMA 3QFFA 4IR7A 2WM9B 4RZIA 3B5JA 4EB6B 2VOEA 1VRWA 2QSJA 4J2OA 1R0RE 3OBBA 3TFWA 2B30A 3RTCA 2WT4A 4F56A 1U1IA 5DRYA 2FRXA 1NYLA 4NYMR 4QO7A 1T2AA 4XD7D 1FS4A 4MPDA 1KP9A 4DC9A 2QRZA 4U7TB 5F2EA 1GRVA 5JZVA 5EIAA 3KQKA 1EFCA 1K4YA 1T9DA 2XD9A 3L04A 4JMLA 3RRJA 3RUPA 3SYNA 1SCBA 2G1JA 1O94C 1UMDA 3MAGA 4NULA 4FB4A 3D54D 1ZJYA 4IYRA 4MUFA 2ZS8A 3NLLA 4FYPA 1KU6A 3FMIA 4Y30A 4G8CA 3Q3GE 3DBRB 2O06A 4CM7A 1VLVA 4TL8A 3EFOA 1HSZA 3OTHA 4CPDA 5KDDA 3CNBA 4R6XA 5C52B 3CVVA 2B9EA 4IQ8A 4NCXA 4P7BA 3VNQA 3C6KA 1H8HD 2C8LA 4JQZA 4R2MA 2ATCA 1JL3A 4PO8A 4DRZA 3IHKA 2DQ4A 4FDVA 1VI6A 4D9KA 2ZSAA 3EW9A 5FULA 2BZ0A 5EQJB 4HRYA 4I9FA 3HUEA 3I5AA 1NU6A 1QHYA 3ZGVA 4CT4B 1JQEA 2PKQP 3AYZB 4JYPA 2FPWA 3DAGA 4MQ6A 2ZWVA 3UMYA 3A05A 1B2LA 3FCCA 3P2IA 3EF1A 4JBLA 1NPTO 4LXQA 5K3SA 4I8IA 2I80A 2Q3HA 3V8BA 1W93A 4MB2A 1RWPA 1S01A 1CERA 3W2TA 2CHGA 2YN0A 2AMFA 2GR9A 4FGUA 2NT4A 4MQEB 1HXHA 1TEXA 4CHTA 4D9MA 1E1CA 4OM7A 3OEWA 4ZREA 2NO4A 1D0SA 2QQ5A 1OGJA 3R41A 1E3DA 3ES9A 2V8BA 2AX4A 1UK9A 4H18A 1U4SA 1W30A 5C5CA 5ITZB 1DQRA 1J8DA 1PLJA 3G9UA 1D6NA 5AW7A 2WTEA 2C97A 4J75A 1WU7A 4CLDA 5HQ3A 5IVHA 3ADDA 1MZPA 3VTZA 2HLDA 5EXEA 2CFCA 2OXFA 1NF9A 1NI4A 5CM9C 5P21A 1XHEA 3IV7A 3D3WA 4ZRDA 4LNUA 4FB5A 5JZBA 2R0QC 3FOCA 3IKTA 2Q7DA 2II6A 4JR1A 3HLTA 3R1IA 5FL3A 1UAGA 2WF5A 3NAQA 4KFSA 1HE3A 2ZIVB 3B9RA 3L0PA 3IGFA 3PC8A 3KXPA 1ESNA 5JNLA 1LPSA 1T1JA 2PO7A 4UTPA 1P1JA 3SC2A 4KBYA 4EUFA 5ETJA 3WWCA 2WJAA 3W8FA 2PKQO 4ZCRA 5JYDA 1FUKA 1MAUA 2G82A 1Z5OA 1PQUA 1EFRA 3PS9A 4OP1A 5DVZA 1Z29A 3NGXA 2HQBA 1FLNA 1RPAA 1HI9A 2HB6A 3IUYA 3WDKA 1PVOA 4OFZA 5C34B 4F06A 1P2DA 1OT5A 1T5DX 3M33A 2W4MA 3VZBA 1K06A 4HV4A 1WUYA 3L5OA 1I3OA 3WLEA 4R9NA 1FJHA 4PBRA 3U5TA 2G06A 3IMKA 4EHBA 2HFKA 4BP1A 1H94A 2P2SA 5F5LA 3MLBA 3PT5A 1Q74A 4C7VA 2F1HA 1HZZA 1M6VA 4Z86A 3S1AB 4D99A 2XYGA 3ZJ4A 1OJLA 2D74A 1C4OA 1XO1A 3TRFA 3VYWA 1YACA 1Y7IA 2F64A 3B2EA 1EDBA 1GSOA 2JHGA 3DOCA 4CIDA 1Y9JA 3DE2X 2P27A 5AT1A 2V7PA 3UW1A 4HH4A 4XGNA 1W52X 3EASA 2G08A 1F20A 1PZEA 1Q2XA 4GKVA 3WL3A 1CR6A 1SG9A 1LPAB 1U2GA 2WFAA 3SR0A 3DFMA