3WXCA

Crystal structure of imp-1 metallo-beta-lactamase complexed with a 3-aminophtalic acid inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
217
structure length
217
Chain Sequence
LPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic analysis of IMP-1 metallo-beta-lactamase complexed with a 3-aminophthalic acid derivative, structure-based drug design, and synthesis of 3,6-disubstituted phthalic acid derivative inhibitors
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
total genus 64
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3wxcA00
2WYMC 2FHXA 4TZEA 2YNVB 4DIKA 3I0VA 4TZFA 1XTOA 2FHXB 4C1GA 3ZQ4A 5ACVA 4NQ2A 5AHOA 1P9EA 2QDSA 1KR3A 3BC2A 4TYTA 4UBQA 4BP0A 5ACSA 3SPUA 2NYPA 3H3EA 4RL2A 2FU6A 3KNRA 2AIOA 4XUKA 1X8HA 4ZO3A 2FU8A 3TP9A 5ACQA 5EHTA 2I7XA 3T9MA 5EH9A 4GCWA 3T3OA 4TYFA 3VPEA 5LSCA 5B15A 3I15A 5AXOA 1ZKPA 1L9YA 4LE6A 4KEQA 4NQ5A 2A7MA 3IE2A 5FQCA 4C1DA 1VMEA 5LMCA 2GFJA 3SFPA 4EXYA 4J5HA 5LS3A 4HL2A 5HIOA 5ACWA 2FK6A 1SMLA 2WYLA 3R2UA 1QH3A 3DHCA 2DKFA 3BK1A 2WRSA 1WUPA 4YSLA 5ACRA 5A87A 2M5DA 4Z60A 4UWRB 5B3RA 3KL7A 5LM6A 4B87A 2XF4A 2Q0JA 2GCUA 4TZ9A 4J5FA 3LVZA 2BGAA 4EFZA 2Y8BA 3PY6A 4KEPA 4WD6A 2OHIA 2AZ4A 4F6HA 3AF5A 4GYQA 4UWSB 3X2ZA 3IEKA 1WW1A 2GMNA 2OHJA 5KIKA 4YSKA 4DILA 3I13A 2M5CA 1DXKA 2QEDA 4O98A 4RAMA 1ZTCA 5HH5A 4FR7A 4HKYA 5EV8A 3P2UA 4PVTA 3Q6VA 5IQKA 2BG8A 3ADRA 4BZ3A 5K4MA 1WRAA 3AF6A 4U4LA 2Y8AA 2YNVA 2I7TA 1DDKA 2P1EA 3PG4A 3ZWFA 5EVDA 4D02A 3DH8A 5FQBA 3JXPA 1M2XA 2UYXA 3WXCA 3VQZA 3L6NA 3DHBA 2BC2A 5EVBA 2GFKA 5LE1A 4AD9A 3FCZA 2P97A 4P62A 2WYMA 5AHRA 2BG7A 3IOFA 1X8IA 2BIBA 3KNSA 1YCHA 5AYAA 1JJEA 5A0TA 1BC2A 4AX0B 3PY5A 2QJSA 5EW0A 1A7TA 3G1PA 3SBLA 1JJTA 4FSBA 2CBNA 4H0DA 1ZNBA 1WUOA 4EYBA 1A8TA 2DOOA 5LCAA 1DD6A 5B1UA 2Q42A 1YCGA 4NQ4A 2ZNBA 4C1HA 3RPCA 1HLKA 5HIQA 5LLDA 4UAMA 3IELA 2YNUA 2QDTA 4YSBA 4GYUA 4XWWA 4D1WA 4AWZA 2QINA 5KILA 5HIPA 2BTNA 4D1UA 5HH4A 4EXSA 1VJNA 5FQAA 4AX1B 4Z67A 2YNTB 4XWTA 4UWPB 5ACTA 5DPXA 3T3NA 5AEBA 4ZNBA 4Z5YA 2FU9A 2ZO4A 5A5ZA 1QH5A 4EYFA 4ZEJA 2NZEA 1X8GA 2VW8A 4C1CA 2BFZB 4C09A 1YCFA 2Y87A 2P4ZA 2BG6A 5K4NA 2E7YA 3AJ3A 2YNWA 4AWYB 3SW3A 2R2DA 4Z7RA 4C1EA 1E5DA 4JO0A 3RKKA 2BFLA 4EY2A 2FM6A 3S0ZA 2BG8B 4HL1A 4NQ6A 1XM8A 3DHAA 4F6ZA 3ZNBA 3X30A 3IDZA 4PVOA 4CHLA 3X2YA 2GKLA 2BG2A 5A0VA 5EV6A 4TZBA 3A4YA 3F9OA 3ESHA 2ZWRA 3RKJA 3I14A 3QH8A 3BV6A 2Q0IA 4EYLA 1BVTA 2FU7A 2HB9A 4RM5A 1KO3A 5EWAA 1Y44A 2I7VA 3IE0A 1KO2A 3BK2A 4UA4A 2WHGA 4V0HA 4D1VA 4RL0A 2H6AA 3FAIA 1MQOA 5ACPA 4UWOB 5LCHA 2Q9UA 5K0WA 2P18A 4ZO2A 2NZFA 5EVKA 4Z6XA 5HISA 2BFZA 2OHHA 3IOGA 2BFKA 4C1FA 2XR1A 4RAWA 3ZR9A 2YZ3A 2ZZIA 1JT1A 5LCFA 5ACUA 3SRXA 2YNTA 1VGNA 3I11A 5AXRA 4Z5ZA 3SD9A 2NXAA 2YCBA 3X2XA 1BMCA 3MD7A 5ACXA 1K07A 3IE1A 2BMIA 3IEMA 4D1TA 4RBSA 2BR6A 4FEKA 5K4KA 5HH6A
chains in the Genus database with same CATH superfamily
2WYMC 2FHXA 4TZEA 2YNVB 4DIKA 3I0VA 4TZFA 1XTOA 2FHXB 4C1GA 3ZQ4A 5ACVA 4NQ2A 5AHOA 1P9EA 2QDSA 1KR3A 3BC2A 4TYTA 4UBQA 4BP0A 5ACSA 3SPUA 2NYPA 3H3EA 4RL2A 2FU6A 3KNRA 2AIOA 4XUKA 1X8HA 4ZO3A 4AXHA 2FU8A 3TP9A 5ACQA 5EHTA 5AIJA 2I7XA 3T9MA 5EH9A 4GCWA 3T3OA 4TYFA 3VPEA 5LSCA 5B15A 3I15A 5AXOA 1ZKPA 1L9YA 4LE6A 4KEQA 2CFUA 4NQ5A 2A7MA 3IE2A 5FQCA 4C1DA 2YHEA 1VMEA 5LMCA 2GFJA 3SFPA 4EXYA 4J5HA 4PDXA 5LS3A 4HL2A 5HIOA 5ACWA 2FK6A 1SMLA 2WYLA 3R2UA 1QH3A 3DHCA 2DKFA 3BK1A 2WRSA 1WUPA 4YSLA 5ACRA 5A87A 2M5DA 4Z60A 4UWRB 5B3RA 3KL7A 5LM6A 4B87A 2XF4A 2Q0JA 2GCUA 4TZ9A 4J5FA 3LVZA 2BGAA 4EFZA 2Y8BA 3PY6A 4KEPA 4WD6A 2OHIA 2AZ4A 4F6HA 3AF5A 4GYQA 4UWSB 3X2ZA 3IEKA 1WW1A 2GMNA 2OHJA 5KIKA 4YSKA 4DILA 3I13A 2M5CA 1DXKA 2QEDA 4O98A 4RAMA 1ZTCA 5HH5A 4FR7A 4HKYA 5EV8A 3P2UA 4PVTA 2CFZA 3Q6VA 5IQKA 2BG8A 3ADRA 4BZ3A 5K4MA 1WRAA 3AF6A 4U4LA 2Y8AA 2YNVA 2I7TA 1DDKA 2P1EA 3PG4A 3ZWFA 5EVDA 4D02A 3DH8A 5FQBA 3JXPA 1M2XA 2UYXA 3WXCA 3VQZA 3L6NA 3DHBA 2BC2A 5EVBA 2GFKA 5LE1A 4AD9A 3FCZA 2P97A 4P62A 2WYMA 5AHRA 2BG7A 3IOFA 5A23A 1X8IA 2BIBA 3KNSA 1YCHA 5AYAA 1JJEA 5A0TA 1BC2A 4AX0B 3PY5A 2QJSA 5EW0A 1A7TA 3G1PA 3SBLA 1JJTA 4FSBA 2CBNA 4H0DA 1ZNBA 1WUOA 4EYBA 1A8TA 2DOOA 5LCAA 1DD6A 5B1UA 2Q42A 1YCGA 4NQ4A 2ZNBA 4C1HA 3RPCA 1HLKA 5HIQA 5LLDA 4UAMA 3IELA 2YNUA 2QDTA 4YSBA 4GYUA 4XWWA 4D1WA 4AWZA 2QINA 5KILA 5HIPA 4AV7A 2BTNA 4D1UA 5HH4A 4EXSA 1VJNA 5FQAA 4AX1B 4Z67A 2YNTB 4XWTA 4UWPB 5ACTA 5DPXA 3T3NA 5AEBA 4ZNBA 4Z5YA 2FU9A 2ZO4A 5A5ZA 1QH5A 4EYFA 4ZEJA 2NZEA 1X8GA 2VW8A 4C1CA 5AJLA 2BFZB 4C09A 1YCFA 2Y87A 2P4ZA 2BG6A 5K4NA 2E7YA 3AJ3A 2YNWA 4AWYB 3SW3A 2R2DA 4NURA 4Z7RA 4C1EA 1E5DA 4JO0A 3RKKA 2BFLA 4EY2A 2FM6A 3S0ZA 2BG8B 4HL1A 4NQ6A 1XM8A 3DHAA 4F6ZA 3ZNBA 3X30A 3IDZA 4PVOA 4CHLA 3X2YA 2GKLA 2BG2A 5A0VA 5EV6A 4TZBA 3A4YA 3F9OA 3ESHA 2ZWRA 3RKJA 3I14A 3QH8A 3BV6A 2Q0IA 4EYLA 1BVTA 2FU7A 2HB9A 4RM5A 1KO3A 5EWAA 1Y44A 2I7VA 3IE0A 1KO2A 3BK2A 4UA4A 2WHGA 4V0HA 4D1VA 4RL0A 2H6AA 3FAIA 1MQOA 5ACPA 4UWOB 5LCHA 2Q9UA 5K0WA 2P18A 4ZO2A 2NZFA 5EVKA 4Z6XA 5HISA 2BFZA 2OHHA 3IOGA 2BFKA 4C1FA 2XR1A 4RAWA 3ZR9A 2YZ3A 2ZZIA 1JT1A 5LCFA 5ACUA 3SRXA 2YNTA 1VGNA 3I11A 5AXRA 4Z5ZA 3SD9A 2NXAA 2YCBA 3X2XA 1BMCA 3MD7A 5ACXA 2CG3A 1K07A 3IE1A 2BMIA 3IEMA 4D1TA 4RBSA 2BR6A 4FEKA 5K4KA 2CG2A 5HH6A
chains in the Genus database with same CATH topology
2WYMC 2FHXA 4TZEA 2YNVB 4DIKA 3I0VA 4TZFA 1XTOA 2FHXB 4C1GA 3ZQ4A 5ACVA 4NQ2A 5AHOA 1P9EA 2QDSA 1KR3A 3BC2A 4TYTA 4UBQA 4BP0A 5ACSA 3SPUA 2NYPA 3H3EA 4RL2A 2FU6A 3KNRA 2AIOA 4XUKA 1X8HA 4ZO3A 2FU8A 3TP9A 5ACQA 5EHTA 2I7XA 3T9MA 5EH9A 4GCWA 3T3OA 4TYFA 3VPEA 5LSCA 5B15A 3I15A 5AXOA 1ZKPA 1L9YA 4LE6A 4KEQA 4NQ5A 2A7MA 3IE2A 5FQCA 4C1DA 1VMEA 5LMCA 2GFJA 3SFPA 4EXYA 4J5HA 5LS3A 4HL2A 5HIOA 5ACWA 2FK6A 1SMLA 2WYLA 3R2UA 1QH3A 3DHCA 2DKFA 3BK1A 2WRSA 1WUPA 4YSLA 5ACRA 5A87A 2M5DA 4Z60A 4UWRB 5B3RA 3KL7A 5LM6A 4B87A 2XF4A 2Q0JA 2GCUA 4TZ9A 4J5FA 3LVZA 2BGAA 4EFZA 2Y8BA 3PY6A 4KEPA 4WD6A 2OHIA 2AZ4A 4F6HA 3AF5A 4GYQA 4UWSB 3X2ZA 3IEKA 1WW1A 2GMNA 2OHJA 5KIKA 4YSKA 4DILA 3I13A 2M5CA 1DXKA 2QEDA 4O98A 4RAMA 1ZTCA 5HH5A 4FR7A 4HKYA 5EV8A 3P2UA 4PVTA 3Q6VA 5IQKA 2BG8A 3ADRA 4BZ3A 5K4MA 1WRAA 3AF6A 4U4LA 2Y8AA 2YNVA 2I7TA 1DDKA 2P1EA 3PG4A 3ZWFA 5EVDA 4D02A 3DH8A 5FQBA 3JXPA 1M2XA 2UYXA 3WXCA 3VQZA 3L6NA 3DHBA 2BC2A 5EVBA 2GFKA 5LE1A 4AD9A 3FCZA 2P97A 4P62A 2WYMA 5AHRA 2BG7A 3IOFA 1X8IA 2BIBA 3KNSA 1YCHA 5AYAA 1JJEA 5A0TA 1BC2A 4AX0B 3PY5A 2QJSA 5EW0A 1A7TA 3G1PA 3SBLA 1JJTA 4FSBA 2CBNA 4H0DA 1ZNBA 1WUOA 4EYBA 1A8TA 2DOOA 5LCAA 1DD6A 5B1UA 2Q42A 1YCGA 4NQ4A 2ZNBA 4C1HA 3RPCA 1HLKA 5HIQA 5LLDA 4UAMA 3IELA 2YNUA 2QDTA 4YSBA 4GYUA 4XWWA 4D1WA 4AWZA 2QINA 5KILA 5HIPA 2BTNA 4D1UA 5HH4A 4EXSA 1VJNA 5FQAA 4AX1B 4Z67A 2YNTB 4XWTA 4UWPB 5ACTA 5DPXA 3T3NA 5AEBA 4ZNBA 4Z5YA 2FU9A 2ZO4A 5A5ZA 1QH5A 4EYFA 4ZEJA 2NZEA 1X8GA 2VW8A 4C1CA 2BFZB 4C09A 1YCFA 2Y87A 2P4ZA 2BG6A 5K4NA 2E7YA 3AJ3A 2YNWA 4AWYB 3SW3A 2R2DA 4Z7RA 4C1EA 1E5DA 4JO0A 3RKKA 2BFLA 4EY2A 2FM6A 3S0ZA 2BG8B 4HL1A 4NQ6A 1XM8A 3DHAA 4F6ZA 3ZNBA 3X30A 3IDZA 4PVOA 4CHLA 3X2YA 2GKLA 2BG2A 5A0VA 5EV6A 4TZBA 3A4YA 3F9OA 3ESHA 2ZWRA 3RKJA 3I14A 3QH8A 3BV6A 2Q0IA 4EYLA 1BVTA 2FU7A 2HB9A 4RM5A 1KO3A 5EWAA 1Y44A 2I7VA 3IE0A 1KO2A 3BK2A 4UA4A 2WHGA 4V0HA 4D1VA 4RL0A 2H6AA 3FAIA 1MQOA 5ACPA 4UWOB 5LCHA 2Q9UA 5K0WA 2P18A 4ZO2A 2NZFA 5EVKA 4Z6XA 5HISA 2BFZA 2OHHA 3IOGA 2BFKA 4C1FA 2XR1A 4RAWA 3ZR9A 2YZ3A 2ZZIA 1JT1A 5LCFA 5ACUA 3SRXA 2YNTA 1VGNA 3I11A 5AXRA 4Z5ZA 3SD9A 2NXAA 2YCBA 3X2XA 1BMCA 3MD7A 5ACXA 1K07A 3IE1A 2BMIA 3IEMA 4D1TA 4RBSA 2BR6A 4FEKA 5K4KA 5HH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WYM C;  2FHX A;  4TZE A;  2YNV B;  4DIK A;  3I0V A;  4TZF A;  1XTO A;  2FHX B;  4C1G A;  3ZQ4 A;  5ACV A;  4NQ2 A;  5AHO A;  1P9E A;  2QDS A;  1KR3 A;  3BC2 A;  4TYT A;  4UBQ A;  4BP0 A;  5ACS A;  3SPU A;  2NYP A;  3H3E A;  4RL2 A;  2FU6 A;  3KNR A;  2AIO A;  4XUK A;  1X8H A;  4ZO3 A;  2FU8 A;  3TP9 A;  5ACQ A;  5EHT A;  2I7X A;  3T9M A;  5EH9 A;  4GCW A;  3T3O A;  4TYF A;  3VPE A;  5LSC A;  5B15 A;  3I15 A;  5AXO A;  1ZKP A;  1L9Y A;  4LE6 A;  4KEQ A;  4NQ5 A;  2A7M A;  3IE2 A;  5FQC A;  4C1D A;  1VME A;  5LMC A;  2GFJ A;  3SFP A;  4EXY A;  4J5H A;  5LS3 A;  4HL2 A;  5HIO A;  5ACW A;  2FK6 A;  1SML A;  2WYL A;  3R2U A;  1QH3 A;  3DHC A;  2DKF A;  3BK1 A;  2WRS A;  1WUP A;  4YSL A;  5ACR A;  5A87 A;  2M5D A;  4Z60 A;  4UWR B;  5B3R A;  3KL7 A;  5LM6 A;  4B87 A;  2XF4 A;  2Q0J A;  2GCU A;  4TZ9 A;  4J5F A;  3LVZ A;  2BGA A;  4EFZ A;  2Y8B A;  3PY6 A;  4KEP A;  4WD6 A;  2OHI A;  2AZ4 A;  4F6H A;  3AF5 A;  4GYQ A;  4UWS B;  3X2Z A;  3IEK A;  1WW1 A;  2GMN A;  2OHJ A;  5KIK A;  4YSK A;  4DIL A;  3I13 A;  2M5C A;  1DXK A;  2QED A;  4O98 A;  4RAM A;  1ZTC A;  5HH5 A;  4FR7 A;  4HKY A;  5EV8 A;  3P2U A;  4PVT A;  3Q6V A;  5IQK A;  2BG8 A;  3ADR A;  4BZ3 A;  5K4M A;  1WRA A;  3AF6 A;  4U4L A;  2Y8A A;  2YNV A;  2I7T A;  1DDK A;  2P1E A;  3PG4 A;  3ZWF A;  5EVD A;  4D02 A;  3DH8 A;  5FQB A;  3JXP A;  1M2X A;  2UYX A;  3WXC A;  3VQZ A;  3L6N A;  3DHB A;  2BC2 A;  5EVB A;  2GFK A;  5LE1 A;  4AD9 A;  3FCZ A;  2P97 A;  4P62 A;  2WYM A;  5AHR A;  2BG7 A;  3IOF A;  1X8I A;  2BIB A;  3KNS A;  1YCH A;  5AYA A;  1JJE A;  5A0T A;  1BC2 A;  4AX0 B;  3PY5 A;  2QJS A;  5EW0 A;  1A7T A;  3G1P A;  3SBL A;  1JJT A;  4FSB A;  2CBN A;  4H0D A;  1ZNB A;  1WUO A;  4EYB A;  1A8T A;  2DOO A;  5LCA A;  1DD6 A;  5B1U A;  2Q42 A;  1YCG A;  4NQ4 A;  2ZNB A;  4C1H A;  3RPC A;  1HLK A;  5HIQ A;  5LLD A;  4UAM A;  3IEL A;  2YNU A;  2QDT A;  4YSB A;  4GYU A;  4XWW A;  4D1W A;  4AWZ A;  2QIN A;  5KIL A;  5HIP A;  2BTN A;  4D1U A;  5HH4 A;  4EXS A;  1VJN A;  5FQA A;  4AX1 B;  4Z67 A;  2YNT B;  4XWT A;  4UWP B;  5ACT A;  5DPX A;  3T3N A;  5AEB A;  4ZNB A;  4Z5Y A;  2FU9 A;  2ZO4 A;  5A5Z A;  1QH5 A;  4EYF A;  4ZEJ A;  2NZE A;  1X8G A;  2VW8 A;  4C1C A;  2BFZ B;  4C09 A;  1YCF A;  2Y87 A;  2P4Z A;  2BG6 A;  5K4N A;  2E7Y A;  3AJ3 A;  2YNW A;  4AWY B;  3SW3 A;  2R2D A;  4Z7R A;  4C1E A;  1E5D A;  4JO0 A;  3RKK A;  2BFL A;  4EY2 A;  2FM6 A;  3S0Z A;  2BG8 B;  4HL1 A;  4NQ6 A;  1XM8 A;  3DHA A;  4F6Z A;  3ZNB A;  3X30 A;  3IDZ A;  4PVO A;  4CHL A;  3X2Y A;  2GKL A;  2BG2 A;  5A0V A;  5EV6 A;  4TZB A;  3A4Y A;  3F9O A;  3ESH A;  2ZWR A;  3RKJ A;  3I14 A;  3QH8 A;  3BV6 A;  2Q0I A;  4EYL A;  1BVT A;  2FU7 A;  2HB9 A;  4RM5 A;  1KO3 A;  5EWA A;  1Y44 A;  2I7V A;  3IE0 A;  1KO2 A;  3BK2 A;  4UA4 A;  2WHG A;  4V0H A;  4D1V A;  4RL0 A;  2H6A A;  3FAI A;  1MQO A;  5ACP A;  4UWO B;  5LCH A;  2Q9U A;  5K0W A;  2P18 A;  4ZO2 A;  2NZF A;  5EVK A;  4Z6X A;  5HIS A;  2BFZ A;  2OHH A;  3IOG A;  2BFK A;  4C1F A;  2XR1 A;  4RAW A;  3ZR9 A;  2YZ3 A;  2ZZI A;  1JT1 A;  5LCF A;  5ACU A;  3SRX A;  2YNT A;  1VGN A;  3I11 A;  5AXR A;  4Z5Z A;  3SD9 A;  2NXA A;  2YCB A;  3X2X A;  1BMC A;  3MD7 A;  5ACX A;  1K07 A;  3IE1 A;  2BMI A;  3IEM A;  4D1T A;  4RBS A;  2BR6 A;  4FEK A;  5K4K A;  5HH6 A; 
#chains in the Genus database with same CATH topology
 2WYM C;  2FHX A;  4TZE A;  2YNV B;  4DIK A;  3I0V A;  4TZF A;  1XTO A;  2FHX B;  4C1G A;  3ZQ4 A;  5ACV A;  4NQ2 A;  5AHO A;  1P9E A;  2QDS A;  1KR3 A;  3BC2 A;  4TYT A;  4UBQ A;  4BP0 A;  5ACS A;  3SPU A;  2NYP A;  3H3E A;  4RL2 A;  2FU6 A;  3KNR A;  2AIO A;  4XUK A;  1X8H A;  4ZO3 A;  4AXH A;  2FU8 A;  3TP9 A;  5ACQ A;  5EHT A;  5AIJ A;  2I7X A;  3T9M A;  5EH9 A;  4GCW A;  3T3O A;  4TYF A;  3VPE A;  5LSC A;  5B15 A;  3I15 A;  5AXO A;  1ZKP A;  1L9Y A;  4LE6 A;  4KEQ A;  2CFU A;  4NQ5 A;  2A7M A;  3IE2 A;  5FQC A;  4C1D A;  2YHE A;  1VME A;  5LMC A;  2GFJ A;  3SFP A;  4EXY A;  4J5H A;  4PDX A;  5LS3 A;  4HL2 A;  5HIO A;  5ACW A;  2FK6 A;  1SML A;  2WYL A;  3R2U A;  1QH3 A;  3DHC A;  2DKF A;  3BK1 A;  2WRS A;  1WUP A;  4YSL A;  5ACR A;  5A87 A;  2M5D A;  4Z60 A;  4UWR B;  5B3R A;  3KL7 A;  5LM6 A;  4B87 A;  2XF4 A;  2Q0J A;  2GCU A;  4TZ9 A;  4J5F A;  3LVZ A;  2BGA A;  4EFZ A;  2Y8B A;  3PY6 A;  4KEP A;  4WD6 A;  2OHI A;  2AZ4 A;  4F6H A;  3AF5 A;  4GYQ A;  4UWS B;  3X2Z A;  3IEK A;  1WW1 A;  2GMN A;  2OHJ A;  5KIK A;  4YSK A;  4DIL A;  3I13 A;  2M5C A;  1DXK A;  2QED A;  4O98 A;  4RAM A;  1ZTC A;  5HH5 A;  4FR7 A;  4HKY A;  5EV8 A;  3P2U A;  4PVT A;  2CFZ A;  3Q6V A;  5IQK A;  2BG8 A;  3ADR A;  4BZ3 A;  5K4M A;  1WRA A;  3AF6 A;  4U4L A;  2Y8A A;  2YNV A;  2I7T A;  1DDK A;  2P1E A;  3PG4 A;  3ZWF A;  5EVD A;  4D02 A;  3DH8 A;  5FQB A;  3JXP A;  1M2X A;  2UYX A;  3WXC A;  3VQZ A;  3L6N A;  3DHB A;  2BC2 A;  5EVB A;  2GFK A;  5LE1 A;  4AD9 A;  3FCZ A;  2P97 A;  4P62 A;  2WYM A;  5AHR A;  2BG7 A;  3IOF A;  5A23 A;  1X8I A;  2BIB A;  3KNS A;  1YCH A;  5AYA A;  1JJE A;  5A0T A;  1BC2 A;  4AX0 B;  3PY5 A;  2QJS A;  5EW0 A;  1A7T A;  3G1P A;  3SBL A;  1JJT A;  4FSB A;  2CBN A;  4H0D A;  1ZNB A;  1WUO A;  4EYB A;  1A8T A;  2DOO A;  5LCA A;  1DD6 A;  5B1U A;  2Q42 A;  1YCG A;  4NQ4 A;  2ZNB A;  4C1H A;  3RPC A;  1HLK A;  5HIQ A;  5LLD A;  4UAM A;  3IEL A;  2YNU A;  2QDT A;  4YSB A;  4GYU A;  4XWW A;  4D1W A;  4AWZ A;  2QIN A;  5KIL A;  5HIP A;  4AV7 A;  2BTN A;  4D1U A;  5HH4 A;  4EXS A;  1VJN A;  5FQA A;  4AX1 B;  4Z67 A;  2YNT B;  4XWT A;  4UWP B;  5ACT A;  5DPX A;  3T3N A;  5AEB A;  4ZNB A;  4Z5Y A;  2FU9 A;  2ZO4 A;  5A5Z A;  1QH5 A;  4EYF A;  4ZEJ A;  2NZE A;  1X8G A;  2VW8 A;  4C1C A;  5AJL A;  2BFZ B;  4C09 A;  1YCF A;  2Y87 A;  2P4Z A;  2BG6 A;  5K4N A;  2E7Y A;  3AJ3 A;  2YNW A;  4AWY B;  3SW3 A;  2R2D A;  4NUR A;  4Z7R A;  4C1E A;  1E5D A;  4JO0 A;  3RKK A;  2BFL A;  4EY2 A;  2FM6 A;  3S0Z A;  2BG8 B;  4HL1 A;  4NQ6 A;  1XM8 A;  3DHA A;  4F6Z A;  3ZNB A;  3X30 A;  3IDZ A;  4PVO A;  4CHL A;  3X2Y A;  2GKL A;  2BG2 A;  5A0V A;  5EV6 A;  4TZB A;  3A4Y A;  3F9O A;  3ESH A;  2ZWR A;  3RKJ A;  3I14 A;  3QH8 A;  3BV6 A;  2Q0I A;  4EYL A;  1BVT A;  2FU7 A;  2HB9 A;  4RM5 A;  1KO3 A;  5EWA A;  1Y44 A;  2I7V A;  3IE0 A;  1KO2 A;  3BK2 A;  4UA4 A;  2WHG A;  4V0H A;  4D1V A;  4RL0 A;  2H6A A;  3FAI A;  1MQO A;  5ACP A;  4UWO B;  5LCH A;  2Q9U A;  5K0W A;  2P18 A;  4ZO2 A;  2NZF A;  5EVK A;  4Z6X A;  5HIS A;  2BFZ A;  2OHH A;  3IOG A;  2BFK A;  4C1F A;  2XR1 A;  4RAW A;  3ZR9 A;  2YZ3 A;  2ZZI A;  1JT1 A;  5LCF A;  5ACU A;  3SRX A;  2YNT A;  1VGN A;  3I11 A;  5AXR A;  4Z5Z A;  3SD9 A;  2NXA A;  2YCB A;  3X2X A;  1BMC A;  3MD7 A;  5ACX A;  2CG3 A;  1K07 A;  3IE1 A;  2BMI A;  3IEM A;  4D1T A;  4RBS A;  2BR6 A;  4FEK A;  5K4K A;  2CG2 A;  5HH6 A; 
#chains in the Genus database with same CATH homology
 2WYM C;  2FHX A;  4TZE A;  2YNV B;  4DIK A;  3I0V A;  4TZF A;  1XTO A;  2FHX B;  4C1G A;  3ZQ4 A;  5ACV A;  4NQ2 A;  5AHO A;  1P9E A;  2QDS A;  1KR3 A;  3BC2 A;  4TYT A;  4UBQ A;  4BP0 A;  5ACS A;  3SPU A;  2NYP A;  3H3E A;  4RL2 A;  2FU6 A;  3KNR A;  2AIO A;  4XUK A;  1X8H A;  4ZO3 A;  2FU8 A;  3TP9 A;  5ACQ A;  5EHT A;  2I7X A;  3T9M A;  5EH9 A;  4GCW A;  3T3O A;  4TYF A;  3VPE A;  5LSC A;  5B15 A;  3I15 A;  5AXO A;  1ZKP A;  1L9Y A;  4LE6 A;  4KEQ A;  4NQ5 A;  2A7M A;  3IE2 A;  5FQC A;  4C1D A;  1VME A;  5LMC A;  2GFJ A;  3SFP A;  4EXY A;  4J5H A;  5LS3 A;  4HL2 A;  5HIO A;  5ACW A;  2FK6 A;  1SML A;  2WYL A;  3R2U A;  1QH3 A;  3DHC A;  2DKF A;  3BK1 A;  2WRS A;  1WUP A;  4YSL A;  5ACR A;  5A87 A;  2M5D A;  4Z60 A;  4UWR B;  5B3R A;  3KL7 A;  5LM6 A;  4B87 A;  2XF4 A;  2Q0J A;  2GCU A;  4TZ9 A;  4J5F A;  3LVZ A;  2BGA A;  4EFZ A;  2Y8B A;  3PY6 A;  4KEP A;  4WD6 A;  2OHI A;  2AZ4 A;  4F6H A;  3AF5 A;  4GYQ A;  4UWS B;  3X2Z A;  3IEK A;  1WW1 A;  2GMN A;  2OHJ A;  5KIK A;  4YSK A;  4DIL A;  3I13 A;  2M5C A;  1DXK A;  2QED A;  4O98 A;  4RAM A;  1ZTC A;  5HH5 A;  4FR7 A;  4HKY A;  5EV8 A;  3P2U A;  4PVT A;  3Q6V A;  5IQK A;  2BG8 A;  3ADR A;  4BZ3 A;  5K4M A;  1WRA A;  3AF6 A;  4U4L A;  2Y8A A;  2YNV A;  2I7T A;  1DDK A;  2P1E A;  3PG4 A;  3ZWF A;  5EVD A;  4D02 A;  3DH8 A;  5FQB A;  3JXP A;  1M2X A;  2UYX A;  3WXC A;  3VQZ A;  3L6N A;  3DHB A;  2BC2 A;  5EVB A;  2GFK A;  5LE1 A;  4AD9 A;  3FCZ A;  2P97 A;  4P62 A;  2WYM A;  5AHR A;  2BG7 A;  3IOF A;  1X8I A;  2BIB A;  3KNS A;  1YCH A;  5AYA A;  1JJE A;  5A0T A;  1BC2 A;  4AX0 B;  3PY5 A;  2QJS A;  5EW0 A;  1A7T A;  3G1P A;  3SBL A;  1JJT A;  4FSB A;  2CBN A;  4H0D A;  1ZNB A;  1WUO A;  4EYB A;  1A8T A;  2DOO A;  5LCA A;  1DD6 A;  5B1U A;  2Q42 A;  1YCG A;  4NQ4 A;  2ZNB A;  4C1H A;  3RPC A;  1HLK A;  5HIQ A;  5LLD A;  4UAM A;  3IEL A;  2YNU A;  2QDT A;  4YSB A;  4GYU A;  4XWW A;  4D1W A;  4AWZ A;  2QIN A;  5KIL A;  5HIP A;  2BTN A;  4D1U A;  5HH4 A;  4EXS A;  1VJN A;  5FQA A;  4AX1 B;  4Z67 A;  2YNT B;  4XWT A;  4UWP B;  5ACT A;  5DPX A;  3T3N A;  5AEB A;  4ZNB A;  4Z5Y A;  2FU9 A;  2ZO4 A;  5A5Z A;  1QH5 A;  4EYF A;  4ZEJ A;  2NZE A;  1X8G A;  2VW8 A;  4C1C A;  2BFZ B;  4C09 A;  1YCF A;  2Y87 A;  2P4Z A;  2BG6 A;  5K4N A;  2E7Y A;  3AJ3 A;  2YNW A;  4AWY B;  3SW3 A;  2R2D A;  4Z7R A;  4C1E A;  1E5D A;  4JO0 A;  3RKK A;  2BFL A;  4EY2 A;  2FM6 A;  3S0Z A;  2BG8 B;  4HL1 A;  4NQ6 A;  1XM8 A;  3DHA A;  4F6Z A;  3ZNB A;  3X30 A;  3IDZ A;  4PVO A;  4CHL A;  3X2Y A;  2GKL A;  2BG2 A;  5A0V A;  5EV6 A;  4TZB A;  3A4Y A;  3F9O A;  3ESH A;  2ZWR A;  3RKJ A;  3I14 A;  3QH8 A;  3BV6 A;  2Q0I A;  4EYL A;  1BVT A;  2FU7 A;  2HB9 A;  4RM5 A;  1KO3 A;  5EWA A;  1Y44 A;  2I7V A;  3IE0 A;  1KO2 A;  3BK2 A;  4UA4 A;  2WHG A;  4V0H A;  4D1V A;  4RL0 A;  2H6A A;  3FAI A;  1MQO A;  5ACP A;  4UWO B;  5LCH A;  2Q9U A;  5K0W A;  2P18 A;  4ZO2 A;  2NZF A;  5EVK A;  4Z6X A;  5HIS A;  2BFZ A;  2OHH A;  3IOG A;  2BFK A;  4C1F A;  2XR1 A;  4RAW A;  3ZR9 A;  2YZ3 A;  2ZZI A;  1JT1 A;  5LCF A;  5ACU A;  3SRX A;  2YNT A;  1VGN A;  3I11 A;  5AXR A;  4Z5Z A;  3SD9 A;  2NXA A;  2YCB A;  3X2X A;  1BMC A;  3MD7 A;  5ACX A;  1K07 A;  3IE1 A;  2BMI A;  3IEM A;  4D1T A;  4RBS A;  2BR6 A;  4FEK A;  5K4K A;  5HH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...