3WXCA

Crystal structure of imp-1 metallo-beta-lactamase complexed with a 3-aminophtalic acid inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
217
structure length
217
Chain Sequence
LPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic analysis of IMP-1 metallo-beta-lactamase complexed with a 3-aminophthalic acid derivative, structure-based drug design, and synthesis of 3,6-disubstituted phthalic acid derivative inhibitors
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
total genus 64
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3wxcA00
4GCWA 2BFLA 2FHXB 3VPEA 1P9EA 2Y8BA 4NQ6A 1X8HA 4ZO3A 1XTOA 3IE2A 2XF4A 2FU9A 5DPXA 2Y8AA 4KEPA 4EYFA 5ACUA 1QH3A 3WXCA 3AJ3A 4TZFA 2FU6A 2BFZB 4TZBA 1X8IA 5A5ZA 3TP9A 2H6AA 1BMCA 4JO0A 3SW3A 4C09A 4Z6XA 5LCAA 3DHCA 2BG2A 3DH8A 4TYFA 2A7MA 2M5CA 5LSCA 4DILA 5LLDA 3AF5A 1YCGA 1MQOA 4HKYA 3F9OA 1SMLA 4BZ3A 4DIKA 3S0ZA 2WHGA 3I11A 1VJNA 5ACQA 5AHRA 2OHIA 4EY2A 1E5DA 2FU8A 2XR1A 4Z67A 4C1DA 2Q42A 3ZR9A 1BVTA 2WYMC 5EV6A 4YSBA 2GCUA 5EWAA 5AXOA 2ZO4A 5K4NA 3RKKA 3JXPA 2FHXA 2QDSA 4PVOA 5HH6A 5FQAA 3SFPA 2BG8B 4UWRB 2UYXA 1KO3A 2OHHA 3P2UA 2BIBA 3AF6A 3T9MA 4H0DA 4Z60A 1XM8A 4CHLA 2AZ4A 2BG8A 4AD9A 5K0WA 2M5DA 4GYQA 5B3RA 1ZKPA 1DXKA 5EVKA 2NYPA 1L9YA 3I14A 2BMIA 4EXSA 5ACWA 2BR6A 2GFJA 2Q0JA 5LS3A 2WYLA 2YZ3A 3IOGA 4D1TA 5B1UA 1A8TA 4XWTA 2BG6A 2I7XA 2YNWA 3FCZA 4NQ2A 3BK1A 2P18A 1KR3A 5A0TA 5LCHA 3BK2A 2AIOA 4Z7RA 3DHBA 1WUPA 3ZQ4A 2BG7A 4FSBA 3SRXA 3L6NA 4ZO2A 3H3EA 5AHOA 1QH5A 4C1HA 4HL1A 4B87A 4J5HA 3KL7A 2GKLA 4NQ4A 3BV6A 5EHTA 5EV8A 1JJEA 2VW8A 2FM6A 4KEQA 4RM5A 5HH5A 2WRSA 4EXYA 5KILA 3IEKA 4PVTA 2Q0IA 2YNVA 1ZTCA 2GFKA 4TZEA 4UWPB 4D1VA 3ZNBA 4WD6A 4D1WA 1VGNA 5HISA 4HL2A 5IQKA 2BGAA 4P62A 2NZFA 1X8GA 5LCFA 5A0VA 4UBQA 5EH9A 2OHJA 2ZZIA 4F6ZA 4RBSA 4EYBA 2Y87A 3KNRA 4UWOB 5A87A 5K4MA 2WYMA 5FQCA 2ZNBA 3I0VA 4RL2A 5LM6A 1DD6A 2FU7A 1JT1A 5AEBA 5HIPA 1A7TA 4FR7A 3KNSA 4YSLA 3PY5A 2FK6A 2NXAA 4RAMA 2I7TA 4U4LA 5ACTA 4XWWA 2DKFA 3A4YA 1WRAA 4LE6A 2NZEA 4D1UA 3IOFA 2I7VA 5B15A 2QJSA 5AYAA 4Z5YA 4AX0B 2YCBA 1KO2A 3SD9A 3IEMA 2E7YA 5ACRA 5HIOA 5KIKA 5ACVA 4YSKA 2YNTA 3BC2A 3SBLA 2QEDA 3FAIA 4UAMA 5K4KA 3IDZA 5ACPA 1WW1A 2P1EA 2YNTB 1YCHA 3T3NA 4V0HA 2QDTA 4AWYB 1YCFA 3LVZA 5EW0A 3SPUA 5FQBA 3PG4A 5ACXA 2DOOA 3R2UA 3RKJA 4RAWA 4C1EA 2GMNA 3RPCA 5LMCA 4UWSB 4J5FA 5AXRA 2QINA 1K07A 3DHAA 3Q6VA 4RL0A 4BP0A 1JJTA 1WUOA 3X2ZA 4UA4A 4ZEJA 2Q9UA 2CBNA 1BC2A 4C1GA 3IE0A 5LE1A 4EYLA 5ACSA 5HIQA 1Y44A 2BFZA 4F6HA 4TZ9A 2P97A 1DDKA 4TYTA 1HLKA 3I13A 3X2YA 3IELA 5EVDA 4C1CA 2BTNA 2YNUA 3X2XA 4AX1B 3I15A 5HH4A 2HB9A 3ZWFA 4C1FA 3X30A 2ZWRA 4ZNBA 1M2XA 4GYUA 3ADRA 4AWZA 2R2DA 3G1PA 4D02A 4FEKA 3VQZA 3PY6A 4O98A 4Z5ZA 3T3OA 1VMEA 4NQ5A 3QH8A 4XUKA 2BC2A 2P4ZA 3IE1A 3MD7A 1ZNBA 3ESHA 2YNVB 5EVBA 4EFZA 2BFKA
chains in the Genus database with same CATH superfamily
4GCWA 2BFLA 2FHXB 3VPEA 1P9EA 2Y8BA 4NQ6A 1X8HA 4ZO3A 1XTOA 3IE2A 2XF4A 2FU9A 5DPXA 2Y8AA 4KEPA 4EYFA 5ACUA 1QH3A 3WXCA 3AJ3A 4TZFA 2FU6A 2BFZB 4TZBA 1X8IA 5A5ZA 3TP9A 2H6AA 1BMCA 4JO0A 3SW3A 4C09A 4Z6XA 5LCAA 3DHCA 2BG2A 3DH8A 4TYFA 2A7MA 2M5CA 5LSCA 4DILA 5LLDA 3AF5A 1YCGA 1MQOA 4HKYA 3F9OA 1SMLA 4BZ3A 4AXHA 4DIKA 3S0ZA 2WHGA 3I11A 1VJNA 5ACQA 5AHRA 2OHIA 4EY2A 1E5DA 2FU8A 2XR1A 4Z67A 4C1DA 2CG3A 2Q42A 3ZR9A 1BVTA 2WYMC 5EV6A 4YSBA 2GCUA 5EWAA 5AXOA 2ZO4A 5K4NA 3RKKA 3JXPA 2FHXA 4NURA 2QDSA 4PVOA 5HH6A 5FQAA 3SFPA 2BG8B 4UWRB 2UYXA 1KO3A 2OHHA 3P2UA 2BIBA 3AF6A 3T9MA 4H0DA 4Z60A 1XM8A 4CHLA 2AZ4A 2BG8A 4AD9A 5K0WA 2M5DA 4GYQA 5B3RA 2CG2A 1ZKPA 1DXKA 5EVKA 2NYPA 1L9YA 3I14A 2BMIA 4EXSA 5ACWA 2BR6A 2GFJA 2Q0JA 5LS3A 2WYLA 2YZ3A 3IOGA 4D1TA 5B1UA 1A8TA 4XWTA 2BG6A 2I7XA 2YNWA 3FCZA 4NQ2A 3BK1A 2P18A 1KR3A 5A0TA 5LCHA 3BK2A 2AIOA 4Z7RA 3DHBA 1WUPA 3ZQ4A 2BG7A 4FSBA 3SRXA 3L6NA 4ZO2A 3H3EA 5AHOA 1QH5A 4C1HA 4HL1A 4B87A 4J5HA 3KL7A 2GKLA 4NQ4A 3BV6A 5EHTA 5EV8A 1JJEA 2VW8A 2FM6A 4KEQA 4RM5A 5HH5A 2WRSA 4EXYA 5KILA 3IEKA 4PVTA 2Q0IA 2YNVA 1ZTCA 2GFKA 4TZEA 5AIJA 5A23A 4UWPB 4D1VA 3ZNBA 4WD6A 4D1WA 1VGNA 5HISA 4HL2A 5IQKA 2BGAA 4P62A 2NZFA 2YHEA 1X8GA 5LCFA 5A0VA 4UBQA 5EH9A 2OHJA 2ZZIA 4F6ZA 4RBSA 4EYBA 2Y87A 3KNRA 4UWOB 5A87A 5K4MA 2WYMA 5FQCA 2ZNBA 3I0VA 4RL2A 5LM6A 1DD6A 2FU7A 1JT1A 5AEBA 5HIPA 1A7TA 4FR7A 3KNSA 4YSLA 3PY5A 2FK6A 2NXAA 4AV7A 4RAMA 2I7TA 4U4LA 5ACTA 4XWWA 2DKFA 3A4YA 1WRAA 4LE6A 2NZEA 4D1UA 3IOFA 2CFUA 2I7VA 5B15A 2QJSA 5AYAA 4Z5YA 4AX0B 2YCBA 1KO2A 3SD9A 3IEMA 2E7YA 5ACRA 5HIOA 5KIKA 5ACVA 4YSKA 2YNTA 3BC2A 3SBLA 2QEDA 3FAIA 4UAMA 5K4KA 3IDZA 5ACPA 1WW1A 2P1EA 2YNTB 1YCHA 3T3NA 4V0HA 2QDTA 4AWYB 1YCFA 3LVZA 5EW0A 3SPUA 5FQBA 3PG4A 5ACXA 2DOOA 3R2UA 3RKJA 4RAWA 4C1EA 2GMNA 3RPCA 5LMCA 4UWSB 4J5FA 5AXRA 5AJLA 2QINA 1K07A 3DHAA 3Q6VA 4RL0A 4BP0A 1JJTA 1WUOA 3X2ZA 4UA4A 4ZEJA 2Q9UA 2CBNA 1BC2A 4C1GA 3IE0A 5LE1A 4EYLA 5ACSA 4PDXA 5HIQA 1Y44A 2BFZA 4F6HA 4TZ9A 2P97A 1DDKA 4TYTA 1HLKA 3I13A 3X2YA 3IELA 5EVDA 4C1CA 2BTNA 2YNUA 3X2XA 4AX1B 3I15A 5HH4A 2HB9A 3ZWFA 4C1FA 3X30A 2ZWRA 4ZNBA 1M2XA 4GYUA 3ADRA 4AWZA 2CFZA 2R2DA 3G1PA 4D02A 4FEKA 3VQZA 3PY6A 4O98A 4Z5ZA 3T3OA 1VMEA 4NQ5A 3QH8A 4XUKA 2BC2A 2P4ZA 3IE1A 3MD7A 1ZNBA 3ESHA 2YNVB 5EVBA 4EFZA 2BFKA
chains in the Genus database with same CATH topology
4GCWA 2BFLA 2FHXB 3VPEA 1P9EA 2Y8BA 4NQ6A 1X8HA 4ZO3A 1XTOA 3IE2A 2XF4A 2FU9A 5DPXA 2Y8AA 4KEPA 4EYFA 5ACUA 1QH3A 3WXCA 3AJ3A 4TZFA 2FU6A 2BFZB 4TZBA 1X8IA 5A5ZA 3TP9A 2H6AA 1BMCA 4JO0A 3SW3A 4C09A 4Z6XA 5LCAA 3DHCA 2BG2A 3DH8A 4TYFA 2A7MA 2M5CA 5LSCA 4DILA 5LLDA 3AF5A 1YCGA 1MQOA 4HKYA 3F9OA 1SMLA 4BZ3A 4DIKA 3S0ZA 2WHGA 3I11A 1VJNA 5ACQA 5AHRA 2OHIA 4EY2A 1E5DA 2FU8A 2XR1A 4Z67A 4C1DA 2Q42A 3ZR9A 1BVTA 2WYMC 5EV6A 4YSBA 2GCUA 5EWAA 5AXOA 2ZO4A 5K4NA 3RKKA 3JXPA 2FHXA 2QDSA 4PVOA 5HH6A 5FQAA 3SFPA 2BG8B 4UWRB 2UYXA 1KO3A 2OHHA 3P2UA 2BIBA 3AF6A 3T9MA 4H0DA 4Z60A 1XM8A 4CHLA 2AZ4A 2BG8A 4AD9A 5K0WA 2M5DA 4GYQA 5B3RA 1ZKPA 1DXKA 5EVKA 2NYPA 1L9YA 3I14A 2BMIA 4EXSA 5ACWA 2BR6A 2GFJA 2Q0JA 5LS3A 2WYLA 2YZ3A 3IOGA 4D1TA 5B1UA 1A8TA 4XWTA 2BG6A 2I7XA 2YNWA 3FCZA 4NQ2A 3BK1A 2P18A 1KR3A 5A0TA 5LCHA 3BK2A 2AIOA 4Z7RA 3DHBA 1WUPA 3ZQ4A 2BG7A 4FSBA 3SRXA 3L6NA 4ZO2A 3H3EA 5AHOA 1QH5A 4C1HA 4HL1A 4B87A 4J5HA 3KL7A 2GKLA 4NQ4A 3BV6A 5EHTA 5EV8A 1JJEA 2VW8A 2FM6A 4KEQA 4RM5A 5HH5A 2WRSA 4EXYA 5KILA 3IEKA 4PVTA 2Q0IA 2YNVA 1ZTCA 2GFKA 4TZEA 4UWPB 4D1VA 3ZNBA 4WD6A 4D1WA 1VGNA 5HISA 4HL2A 5IQKA 2BGAA 4P62A 2NZFA 1X8GA 5LCFA 5A0VA 4UBQA 5EH9A 2OHJA 2ZZIA 4F6ZA 4RBSA 4EYBA 2Y87A 3KNRA 4UWOB 5A87A 5K4MA 2WYMA 5FQCA 2ZNBA 3I0VA 4RL2A 5LM6A 1DD6A 2FU7A 1JT1A 5AEBA 5HIPA 1A7TA 4FR7A 3KNSA 4YSLA 3PY5A 2FK6A 2NXAA 4RAMA 2I7TA 4U4LA 5ACTA 4XWWA 2DKFA 3A4YA 1WRAA 4LE6A 2NZEA 4D1UA 3IOFA 2I7VA 5B15A 2QJSA 5AYAA 4Z5YA 4AX0B 2YCBA 1KO2A 3SD9A 3IEMA 2E7YA 5ACRA 5HIOA 5KIKA 5ACVA 4YSKA 2YNTA 3BC2A 3SBLA 2QEDA 3FAIA 4UAMA 5K4KA 3IDZA 5ACPA 1WW1A 2P1EA 2YNTB 1YCHA 3T3NA 4V0HA 2QDTA 4AWYB 1YCFA 3LVZA 5EW0A 3SPUA 5FQBA 3PG4A 5ACXA 2DOOA 3R2UA 3RKJA 4RAWA 4C1EA 2GMNA 3RPCA 5LMCA 4UWSB 4J5FA 5AXRA 2QINA 1K07A 3DHAA 3Q6VA 4RL0A 4BP0A 1JJTA 1WUOA 3X2ZA 4UA4A 4ZEJA 2Q9UA 2CBNA 1BC2A 4C1GA 3IE0A 5LE1A 4EYLA 5ACSA 5HIQA 1Y44A 2BFZA 4F6HA 4TZ9A 2P97A 1DDKA 4TYTA 1HLKA 3I13A 3X2YA 3IELA 5EVDA 4C1CA 2BTNA 2YNUA 3X2XA 4AX1B 3I15A 5HH4A 2HB9A 3ZWFA 4C1FA 3X30A 2ZWRA 4ZNBA 1M2XA 4GYUA 3ADRA 4AWZA 2R2DA 3G1PA 4D02A 4FEKA 3VQZA 3PY6A 4O98A 4Z5ZA 3T3OA 1VMEA 4NQ5A 3QH8A 4XUKA 2BC2A 2P4ZA 3IE1A 3MD7A 1ZNBA 3ESHA 2YNVB 5EVBA 4EFZA 2BFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCW A;  2BFL A;  2FHX B;  3VPE A;  1P9E A;  2Y8B A;  4NQ6 A;  1X8H A;  4ZO3 A;  1XTO A;  3IE2 A;  2XF4 A;  2FU9 A;  5DPX A;  2Y8A A;  4KEP A;  4EYF A;  5ACU A;  1QH3 A;  3WXC A;  3AJ3 A;  4TZF A;  2FU6 A;  2BFZ B;  4TZB A;  1X8I A;  5A5Z A;  3TP9 A;  2H6A A;  1BMC A;  4JO0 A;  3SW3 A;  4C09 A;  4Z6X A;  5LCA A;  3DHC A;  2BG2 A;  3DH8 A;  4TYF A;  2A7M A;  2M5C A;  5LSC A;  4DIL A;  5LLD A;  3AF5 A;  1YCG A;  1MQO A;  4HKY A;  3F9O A;  1SML A;  4BZ3 A;  4DIK A;  3S0Z A;  2WHG A;  3I11 A;  1VJN A;  5ACQ A;  5AHR A;  2OHI A;  4EY2 A;  1E5D A;  2FU8 A;  2XR1 A;  4Z67 A;  4C1D A;  2Q42 A;  3ZR9 A;  1BVT A;  2WYM C;  5EV6 A;  4YSB A;  2GCU A;  5EWA A;  5AXO A;  2ZO4 A;  5K4N A;  3RKK A;  3JXP A;  2FHX A;  2QDS A;  4PVO A;  5HH6 A;  5FQA A;  3SFP A;  2BG8 B;  4UWR B;  2UYX A;  1KO3 A;  2OHH A;  3P2U A;  2BIB A;  3AF6 A;  3T9M A;  4H0D A;  4Z60 A;  1XM8 A;  4CHL A;  2AZ4 A;  2BG8 A;  4AD9 A;  5K0W A;  2M5D A;  4GYQ A;  5B3R A;  1ZKP A;  1DXK A;  5EVK A;  2NYP A;  1L9Y A;  3I14 A;  2BMI A;  4EXS A;  5ACW A;  2BR6 A;  2GFJ A;  2Q0J A;  5LS3 A;  2WYL A;  2YZ3 A;  3IOG A;  4D1T A;  5B1U A;  1A8T A;  4XWT A;  2BG6 A;  2I7X A;  2YNW A;  3FCZ A;  4NQ2 A;  3BK1 A;  2P18 A;  1KR3 A;  5A0T A;  5LCH A;  3BK2 A;  2AIO A;  4Z7R A;  3DHB A;  1WUP A;  3ZQ4 A;  2BG7 A;  4FSB A;  3SRX A;  3L6N A;  4ZO2 A;  3H3E A;  5AHO A;  1QH5 A;  4C1H A;  4HL1 A;  4B87 A;  4J5H A;  3KL7 A;  2GKL A;  4NQ4 A;  3BV6 A;  5EHT A;  5EV8 A;  1JJE A;  2VW8 A;  2FM6 A;  4KEQ A;  4RM5 A;  5HH5 A;  2WRS A;  4EXY A;  5KIL A;  3IEK A;  4PVT A;  2Q0I A;  2YNV A;  1ZTC A;  2GFK A;  4TZE A;  4UWP B;  4D1V A;  3ZNB A;  4WD6 A;  4D1W A;  1VGN A;  5HIS A;  4HL2 A;  5IQK A;  2BGA A;  4P62 A;  2NZF A;  1X8G A;  5LCF A;  5A0V A;  4UBQ A;  5EH9 A;  2OHJ A;  2ZZI A;  4F6Z A;  4RBS A;  4EYB A;  2Y87 A;  3KNR A;  4UWO B;  5A87 A;  5K4M A;  2WYM A;  5FQC A;  2ZNB A;  3I0V A;  4RL2 A;  5LM6 A;  1DD6 A;  2FU7 A;  1JT1 A;  5AEB A;  5HIP A;  1A7T A;  4FR7 A;  3KNS A;  4YSL A;  3PY5 A;  2FK6 A;  2NXA A;  4RAM A;  2I7T A;  4U4L A;  5ACT A;  4XWW A;  2DKF A;  3A4Y A;  1WRA A;  4LE6 A;  2NZE A;  4D1U A;  3IOF A;  2I7V A;  5B15 A;  2QJS A;  5AYA A;  4Z5Y A;  4AX0 B;  2YCB A;  1KO2 A;  3SD9 A;  3IEM A;  2E7Y A;  5ACR A;  5HIO A;  5KIK A;  5ACV A;  4YSK A;  2YNT A;  3BC2 A;  3SBL A;  2QED A;  3FAI A;  4UAM A;  5K4K A;  3IDZ A;  5ACP A;  1WW1 A;  2P1E A;  2YNT B;  1YCH A;  3T3N A;  4V0H A;  2QDT A;  4AWY B;  1YCF A;  3LVZ A;  5EW0 A;  3SPU A;  5FQB A;  3PG4 A;  5ACX A;  2DOO A;  3R2U A;  3RKJ A;  4RAW A;  4C1E A;  2GMN A;  3RPC A;  5LMC A;  4UWS B;  4J5F A;  5AXR A;  2QIN A;  1K07 A;  3DHA A;  3Q6V A;  4RL0 A;  4BP0 A;  1JJT A;  1WUO A;  3X2Z A;  4UA4 A;  4ZEJ A;  2Q9U A;  2CBN A;  1BC2 A;  4C1G A;  3IE0 A;  5LE1 A;  4EYL A;  5ACS A;  5HIQ A;  1Y44 A;  2BFZ A;  4F6H A;  4TZ9 A;  2P97 A;  1DDK A;  4TYT A;  1HLK A;  3I13 A;  3X2Y A;  3IEL A;  5EVD A;  4C1C A;  2BTN A;  2YNU A;  3X2X A;  4AX1 B;  3I15 A;  5HH4 A;  2HB9 A;  3ZWF A;  4C1F A;  3X30 A;  2ZWR A;  4ZNB A;  1M2X A;  4GYU A;  3ADR A;  4AWZ A;  2R2D A;  3G1P A;  4D02 A;  4FEK A;  3VQZ A;  3PY6 A;  4O98 A;  4Z5Z A;  3T3O A;  1VME A;  4NQ5 A;  3QH8 A;  4XUK A;  2BC2 A;  2P4Z A;  3IE1 A;  3MD7 A;  1ZNB A;  3ESH A;  2YNV B;  5EVB A;  4EFZ A;  2BFK A; 
#chains in the Genus database with same CATH topology
 4GCW A;  2BFL A;  2FHX B;  3VPE A;  1P9E A;  2Y8B A;  4NQ6 A;  1X8H A;  4ZO3 A;  1XTO A;  3IE2 A;  2XF4 A;  2FU9 A;  5DPX A;  2Y8A A;  4KEP A;  4EYF A;  5ACU A;  1QH3 A;  3WXC A;  3AJ3 A;  4TZF A;  2FU6 A;  2BFZ B;  4TZB A;  1X8I A;  5A5Z A;  3TP9 A;  2H6A A;  1BMC A;  4JO0 A;  3SW3 A;  4C09 A;  4Z6X A;  5LCA A;  3DHC A;  2BG2 A;  3DH8 A;  4TYF A;  2A7M A;  2M5C A;  5LSC A;  4DIL A;  5LLD A;  3AF5 A;  1YCG A;  1MQO A;  4HKY A;  3F9O A;  1SML A;  4BZ3 A;  4AXH A;  4DIK A;  3S0Z A;  2WHG A;  3I11 A;  1VJN A;  5ACQ A;  5AHR A;  2OHI A;  4EY2 A;  1E5D A;  2FU8 A;  2XR1 A;  4Z67 A;  4C1D A;  2CG3 A;  2Q42 A;  3ZR9 A;  1BVT A;  2WYM C;  5EV6 A;  4YSB A;  2GCU A;  5EWA A;  5AXO A;  2ZO4 A;  5K4N A;  3RKK A;  3JXP A;  2FHX A;  4NUR A;  2QDS A;  4PVO A;  5HH6 A;  5FQA A;  3SFP A;  2BG8 B;  4UWR B;  2UYX A;  1KO3 A;  2OHH A;  3P2U A;  2BIB A;  3AF6 A;  3T9M A;  4H0D A;  4Z60 A;  1XM8 A;  4CHL A;  2AZ4 A;  2BG8 A;  4AD9 A;  5K0W A;  2M5D A;  4GYQ A;  5B3R A;  2CG2 A;  1ZKP A;  1DXK A;  5EVK A;  2NYP A;  1L9Y A;  3I14 A;  2BMI A;  4EXS A;  5ACW A;  2BR6 A;  2GFJ A;  2Q0J A;  5LS3 A;  2WYL A;  2YZ3 A;  3IOG A;  4D1T A;  5B1U A;  1A8T A;  4XWT A;  2BG6 A;  2I7X A;  2YNW A;  3FCZ A;  4NQ2 A;  3BK1 A;  2P18 A;  1KR3 A;  5A0T A;  5LCH A;  3BK2 A;  2AIO A;  4Z7R A;  3DHB A;  1WUP A;  3ZQ4 A;  2BG7 A;  4FSB A;  3SRX A;  3L6N A;  4ZO2 A;  3H3E A;  5AHO A;  1QH5 A;  4C1H A;  4HL1 A;  4B87 A;  4J5H A;  3KL7 A;  2GKL A;  4NQ4 A;  3BV6 A;  5EHT A;  5EV8 A;  1JJE A;  2VW8 A;  2FM6 A;  4KEQ A;  4RM5 A;  5HH5 A;  2WRS A;  4EXY A;  5KIL A;  3IEK A;  4PVT A;  2Q0I A;  2YNV A;  1ZTC A;  2GFK A;  4TZE A;  5AIJ A;  5A23 A;  4UWP B;  4D1V A;  3ZNB A;  4WD6 A;  4D1W A;  1VGN A;  5HIS A;  4HL2 A;  5IQK A;  2BGA A;  4P62 A;  2NZF A;  2YHE A;  1X8G A;  5LCF A;  5A0V A;  4UBQ A;  5EH9 A;  2OHJ A;  2ZZI A;  4F6Z A;  4RBS A;  4EYB A;  2Y87 A;  3KNR A;  4UWO B;  5A87 A;  5K4M A;  2WYM A;  5FQC A;  2ZNB A;  3I0V A;  4RL2 A;  5LM6 A;  1DD6 A;  2FU7 A;  1JT1 A;  5AEB A;  5HIP A;  1A7T A;  4FR7 A;  3KNS A;  4YSL A;  3PY5 A;  2FK6 A;  2NXA A;  4AV7 A;  4RAM A;  2I7T A;  4U4L A;  5ACT A;  4XWW A;  2DKF A;  3A4Y A;  1WRA A;  4LE6 A;  2NZE A;  4D1U A;  3IOF A;  2CFU A;  2I7V A;  5B15 A;  2QJS A;  5AYA A;  4Z5Y A;  4AX0 B;  2YCB A;  1KO2 A;  3SD9 A;  3IEM A;  2E7Y A;  5ACR A;  5HIO A;  5KIK A;  5ACV A;  4YSK A;  2YNT A;  3BC2 A;  3SBL A;  2QED A;  3FAI A;  4UAM A;  5K4K A;  3IDZ A;  5ACP A;  1WW1 A;  2P1E A;  2YNT B;  1YCH A;  3T3N A;  4V0H A;  2QDT A;  4AWY B;  1YCF A;  3LVZ A;  5EW0 A;  3SPU A;  5FQB A;  3PG4 A;  5ACX A;  2DOO A;  3R2U A;  3RKJ A;  4RAW A;  4C1E A;  2GMN A;  3RPC A;  5LMC A;  4UWS B;  4J5F A;  5AXR A;  5AJL A;  2QIN A;  1K07 A;  3DHA A;  3Q6V A;  4RL0 A;  4BP0 A;  1JJT A;  1WUO A;  3X2Z A;  4UA4 A;  4ZEJ A;  2Q9U A;  2CBN A;  1BC2 A;  4C1G A;  3IE0 A;  5LE1 A;  4EYL A;  5ACS A;  4PDX A;  5HIQ A;  1Y44 A;  2BFZ A;  4F6H A;  4TZ9 A;  2P97 A;  1DDK A;  4TYT A;  1HLK A;  3I13 A;  3X2Y A;  3IEL A;  5EVD A;  4C1C A;  2BTN A;  2YNU A;  3X2X A;  4AX1 B;  3I15 A;  5HH4 A;  2HB9 A;  3ZWF A;  4C1F A;  3X30 A;  2ZWR A;  4ZNB A;  1M2X A;  4GYU A;  3ADR A;  4AWZ A;  2CFZ A;  2R2D A;  3G1P A;  4D02 A;  4FEK A;  3VQZ A;  3PY6 A;  4O98 A;  4Z5Z A;  3T3O A;  1VME A;  4NQ5 A;  3QH8 A;  4XUK A;  2BC2 A;  2P4Z A;  3IE1 A;  3MD7 A;  1ZNB A;  3ESH A;  2YNV B;  5EVB A;  4EFZ A;  2BFK A; 
#chains in the Genus database with same CATH homology
 4GCW A;  2BFL A;  2FHX B;  3VPE A;  1P9E A;  2Y8B A;  4NQ6 A;  1X8H A;  4ZO3 A;  1XTO A;  3IE2 A;  2XF4 A;  2FU9 A;  5DPX A;  2Y8A A;  4KEP A;  4EYF A;  5ACU A;  1QH3 A;  3WXC A;  3AJ3 A;  4TZF A;  2FU6 A;  2BFZ B;  4TZB A;  1X8I A;  5A5Z A;  3TP9 A;  2H6A A;  1BMC A;  4JO0 A;  3SW3 A;  4C09 A;  4Z6X A;  5LCA A;  3DHC A;  2BG2 A;  3DH8 A;  4TYF A;  2A7M A;  2M5C A;  5LSC A;  4DIL A;  5LLD A;  3AF5 A;  1YCG A;  1MQO A;  4HKY A;  3F9O A;  1SML A;  4BZ3 A;  4DIK A;  3S0Z A;  2WHG A;  3I11 A;  1VJN A;  5ACQ A;  5AHR A;  2OHI A;  4EY2 A;  1E5D A;  2FU8 A;  2XR1 A;  4Z67 A;  4C1D A;  2Q42 A;  3ZR9 A;  1BVT A;  2WYM C;  5EV6 A;  4YSB A;  2GCU A;  5EWA A;  5AXO A;  2ZO4 A;  5K4N A;  3RKK A;  3JXP A;  2FHX A;  2QDS A;  4PVO A;  5HH6 A;  5FQA A;  3SFP A;  2BG8 B;  4UWR B;  2UYX A;  1KO3 A;  2OHH A;  3P2U A;  2BIB A;  3AF6 A;  3T9M A;  4H0D A;  4Z60 A;  1XM8 A;  4CHL A;  2AZ4 A;  2BG8 A;  4AD9 A;  5K0W A;  2M5D A;  4GYQ A;  5B3R A;  1ZKP A;  1DXK A;  5EVK A;  2NYP A;  1L9Y A;  3I14 A;  2BMI A;  4EXS A;  5ACW A;  2BR6 A;  2GFJ A;  2Q0J A;  5LS3 A;  2WYL A;  2YZ3 A;  3IOG A;  4D1T A;  5B1U A;  1A8T A;  4XWT A;  2BG6 A;  2I7X A;  2YNW A;  3FCZ A;  4NQ2 A;  3BK1 A;  2P18 A;  1KR3 A;  5A0T A;  5LCH A;  3BK2 A;  2AIO A;  4Z7R A;  3DHB A;  1WUP A;  3ZQ4 A;  2BG7 A;  4FSB A;  3SRX A;  3L6N A;  4ZO2 A;  3H3E A;  5AHO A;  1QH5 A;  4C1H A;  4HL1 A;  4B87 A;  4J5H A;  3KL7 A;  2GKL A;  4NQ4 A;  3BV6 A;  5EHT A;  5EV8 A;  1JJE A;  2VW8 A;  2FM6 A;  4KEQ A;  4RM5 A;  5HH5 A;  2WRS A;  4EXY A;  5KIL A;  3IEK A;  4PVT A;  2Q0I A;  2YNV A;  1ZTC A;  2GFK A;  4TZE A;  4UWP B;  4D1V A;  3ZNB A;  4WD6 A;  4D1W A;  1VGN A;  5HIS A;  4HL2 A;  5IQK A;  2BGA A;  4P62 A;  2NZF A;  1X8G A;  5LCF A;  5A0V A;  4UBQ A;  5EH9 A;  2OHJ A;  2ZZI A;  4F6Z A;  4RBS A;  4EYB A;  2Y87 A;  3KNR A;  4UWO B;  5A87 A;  5K4M A;  2WYM A;  5FQC A;  2ZNB A;  3I0V A;  4RL2 A;  5LM6 A;  1DD6 A;  2FU7 A;  1JT1 A;  5AEB A;  5HIP A;  1A7T A;  4FR7 A;  3KNS A;  4YSL A;  3PY5 A;  2FK6 A;  2NXA A;  4RAM A;  2I7T A;  4U4L A;  5ACT A;  4XWW A;  2DKF A;  3A4Y A;  1WRA A;  4LE6 A;  2NZE A;  4D1U A;  3IOF A;  2I7V A;  5B15 A;  2QJS A;  5AYA A;  4Z5Y A;  4AX0 B;  2YCB A;  1KO2 A;  3SD9 A;  3IEM A;  2E7Y A;  5ACR A;  5HIO A;  5KIK A;  5ACV A;  4YSK A;  2YNT A;  3BC2 A;  3SBL A;  2QED A;  3FAI A;  4UAM A;  5K4K A;  3IDZ A;  5ACP A;  1WW1 A;  2P1E A;  2YNT B;  1YCH A;  3T3N A;  4V0H A;  2QDT A;  4AWY B;  1YCF A;  3LVZ A;  5EW0 A;  3SPU A;  5FQB A;  3PG4 A;  5ACX A;  2DOO A;  3R2U A;  3RKJ A;  4RAW A;  4C1E A;  2GMN A;  3RPC A;  5LMC A;  4UWS B;  4J5F A;  5AXR A;  2QIN A;  1K07 A;  3DHA A;  3Q6V A;  4RL0 A;  4BP0 A;  1JJT A;  1WUO A;  3X2Z A;  4UA4 A;  4ZEJ A;  2Q9U A;  2CBN A;  1BC2 A;  4C1G A;  3IE0 A;  5LE1 A;  4EYL A;  5ACS A;  5HIQ A;  1Y44 A;  2BFZ A;  4F6H A;  4TZ9 A;  2P97 A;  1DDK A;  4TYT A;  1HLK A;  3I13 A;  3X2Y A;  3IEL A;  5EVD A;  4C1C A;  2BTN A;  2YNU A;  3X2X A;  4AX1 B;  3I15 A;  5HH4 A;  2HB9 A;  3ZWF A;  4C1F A;  3X30 A;  2ZWR A;  4ZNB A;  1M2X A;  4GYU A;  3ADR A;  4AWZ A;  2R2D A;  3G1P A;  4D02 A;  4FEK A;  3VQZ A;  3PY6 A;  4O98 A;  4Z5Z A;  3T3O A;  1VME A;  4NQ5 A;  3QH8 A;  4XUK A;  2BC2 A;  2P4Z A;  3IE1 A;  3MD7 A;  1ZNB A;  3ESH A;  2YNV B;  5EVB A;  4EFZ A;  2BFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...