3WXXA

Crystal structure of a t3ss complex from aeromonas hydrophila
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
150
structure length
150
Chain Sequence
EPAIEAFLQDGGTLAMLNDVSTDTLEQLYTLGFNQYHAGKHDEAHKIFQALCVLDHYEARFFLGLGACRQALGQFRLAIDSYSYGAMMDLQEPRFPFHAAECLLQLGELEGAESGFHSAQLLAAAKPELAELAARAGIMLEVVKTKKDME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of AcrH-AopB Chaperone-Translocator Complex Reveals a Role for Membrane Hairpins in Type III Secretion System Translocon Assembly
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Membrane protein/chaperone
molecule keywords AcrH
total genus 55
structure length 150
sequence length 150
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3wxxA00
3GZ2A 2WPVA 4CGVA 1P5QA 4J8EA 2LSUA 4IN3B 3S7FA 3CVLA 5KJKA 4B94A 5JJ7A 3QDNA 3QWPA 4GPKA 2PL2A 2LNIA 1NZNA 4N39A 3WXXA 5M72A 2VGXB 1HZ4A 4I2ZA 2IFUA 4WUYA 5A6CA 2PQRA 1HH8A 4G25A 4RG6A 5AYWD 4JA7A 3E4BA 3N71A 1B89A 3OXGA 4HOUA 3S7BA 4AY5A 1HXIA 4KYOB 5FZSA 1ELRA 2I6HA 5CHEE 3PE4A 5LCWC 4HOQA 1KLXA 2IF4A 3FWVA 4U0SA 2VYIA 4APOA 1WM5A 3QOUA 2XGSA 2C0LA 2GW1A 2V5FA 3QWWA 4EQFA 5KJMA 4H7XA 4BWRA 3O48A 4CGWA 1ELWA 2PQNA 3ESKA 2R5SA 3OXFA 1FCHA 4HOTA 4N3BA 4O6FA 4N5CA 3BEEA 3ZFWA 4J8DA 2LSVA 2Y4TA 3ASGA 2VGXA 5JJ6A 3GZ1A 4GA0A 3CKCA 3TGOA 4I9CA 1YA0A 4WNGA 2DBAA 2KCLA 3KS2A 3LCAA 5FJYA 2XGOA 4WNEA 5HQ8A 2NC9A 4BT8A 4N2QA 4U0ZA 1OUVA 2KCVA 2FF4A 4NQ0A 4A1SA 3RIBA 4N3CA 4UI9C 5FZRA 1ZU2A 3RO2A 4JA9A 2OOEA 3MV2B 4WNDA 3URZA 4GYYA 4YVOA 4AM9A 4WNFA 3LY7A 1W3BA 2L6JA 5KJNA 3SZ7A 1IHGA 4UI9K 5G05J 1NA3A 3Q47B 3ZGQA 2BUGA 3UPVA 3ASFA 4G23A 4J8FA 2AVPA 4YVQC 2J9QA 5JJTA 2VQ2A 2VGYA 4UQYA 3RJVA 3MA5A 3MV3B 5G04C 4I9EA 5CCLA 3CK9A 3CKBA 2C2LA 2VSYA 3EDTB 3FP3A 1Y8MA 4GCOA 4H7YA 4GZ3A 3CK8A 4N3AA 3SF4A 4Y6WA 3ZHEB 3CVQA 1TJCA 4N2SA 4U04A 3AS4A 2HR2A 2YHCA 4G24A 1PC2A 5D0QD 4GZ6A 1A17A 5EX3A 3RO3A 2FEZA 2E2EA 3R9AB 2XCBA 4HORA 3Q5MA 3LY8A 3NF1A 4XI0A 4XI9A 3CK7A 2KCKA 4YNDA 5EX0A 3GW4A 2UWJG 2HO1A 3VTYA 4AIFA 2KC7A 2YQ8A 2VSNA 2JLBA 3PE3A 3QKYA 2XEVA 2UY1A 4KXKB 4G1TA 3U3WA 4LEUA 1E96B 5BW8C 5FT9A 4BTBA 3VTXA 2QFCA 3PDNA 4J0UA 3CVPA 4G26A 4I2WA 3ASDA 3ULQA 4BTAA 5LCWJ 4CDRA 4UQZA 4ABNA 4KBQA 3Q49B 5BNWA 5C1DA 2XCCA 4I1AA 5CCMA 4U0UA 4HOSA 2WQHA 5EKQD 2FBNA 2FI7A 4GZ5A 5FTPA 3S7DA 3UUXA 2XGMA 3ZHEA 3AS5A 2ONDA 5KJLA 3UQ3A 2PZIA 1KT0A 1WAO1 3CV0A 3LPZA 3LY9A 1XNFA 1ZBPA 3TG4A 3CVNA 4W9RA 1QQEA 3MKRA 3QWVA 5BT1A 4AY6A 3LKUA 2HYZA 5HI7A 3GYZA 3JYSA 4GYWA 4NRHB 4UQXA 3RU0A 4JHRA 3KD7A 2XPIA 4GYOA 5G05C 3ZPJA 4I17A 5DBKA 2UY1B 3ZN3A 1IYGA 1NA0A 3IEGA 4UI9J 5A7DB 4BT9A 1KT1A 4Y6CA 4RG9A 3RKVA 3MEKA 4JL0A 5FZQA 5D0OD 2MHKA 4XIFA 3CEQA 4GA2A 3S7JA 3TG5A 3TAXA 3AS8A 4U07A 1QZ2A 3U4TA 2P58C 4G2VA 5DIZA 2Q7FA 3KAEA 3ASHA 5ARGA 3Q4AB 3FFLA 4ME2A 2KATA 5ARFA 2Y4UA 3OXLA 4GA1A 4GCNA 4F3VA 3Q15A 2FO7A 3HYMB 3K9IA 2C0MA 5G04J 3LYAA
chains in the Genus database with same CATH superfamily
3DPDA 4J8EA 1TN6A 4JEUA 1FVFA 3QARA 4I1MA 4A3TA 1HZ4A 3L22A 2KXPC 3SY2A 3Q7FA 3FU0A 2ZXWE 3FH8A 2IF4A 4DLOA 3ISMC 4U8HA 4JC8A 5AENA 2Y69E 3FUKA 3CSTA 4L9PA 4HXIA 3DPYA 1IKND 3SD5A 4L2YA 5JJTA 3CKBA 4GCOA 1H6OA 4LERA 3APFA 1WY6A 3RK6A 4XI9A 4FHKA 3T9KA 4ANWA 4GMRA 4U7EB 4BETA 2Y1LE 3HIZA 5T4YA 3ULQA 1YMPA 3FTYA 4HOSA 2FI7A 5CMYA 2XGMA 3CV0A 2WXQA 4W9RA 3LKUA 5HI7A 3JCKC 1S0PA 3TWXA 3RKVA 1JCRA 4J8YA 4GTRA 1TNZA 3EIJA 2R2LA 2R05A 3ABKE 4CGVA 2FO1E 3QDNA 2PL2A 2WVIA 5FQ8A 4WUYA 4DX6D 3JQ1A 3FEXA 2E0IA 4HRLA 4H7XA 3D9NA 4N3BA 3NAWA 3C72A 3LCAA 1S70B 3PEVB 2ILRA 4UI9C 2R17C 4ATGA 3ZEFA 4EZKA 3Q79A 3UMVA 4ZHBA 4L1BA 3DSXA 4JD2G 3MA5A 3MV3B 4LSZE 1OWMA 3ZXSA 4U04A 1TYQG 3BUAA 2YHCA 5JHBA 2DZNA 3JXIA 3QNKA 4N5QA 4I6EA 4FJYA 3NQPA 2P9PG 4C0MA 2NSZA 2QFCA 1BD8A 1XGWA 4I2WA 4CDMA 1LD8A 2F37A 5BNWA 3CHMA 5KJLA 5ENTD 4HFGA 4CT0A 1HU3A 4UQXA 1N4RA 3U66A 3UKRG 4JL0A 3ONLA 3CEQA 3TG5A 2IU1A 1QZ2A 2OEWA 2Y4UA 4A1GA 3V31A 4IULA 1UN8A 4GZCA 3B7SA 3FTZA 3FUIA 5A6CA 3T8KA 4G25A 3TWRA 1Z3YA 1ELRA 4HOQA 3T5VA 2QYJA 3CIAA 3APDA 2A4ZA 4A3VA 3OXFA 2AW6A 4GA0A 3FH7A 5FJYA 4BSXA 2XGOA 2WQ6A 4CCAA 4FULA 4FADA 4NQ0A 1O1RA 1H19A 4OYSA 5KBAA 2M63A 5AQ7A 3TJPA 2DZOA 3EU9A 4U8YD 1NA3A 3ZGQA 4DX5D 2IONA 3DSVA 2VGYA 2B6CA 2CFUA 1A17A 3PZ3A 3L08A 3R9AB 1INZA 4U95D 3LY8A 3QC1A 4TXQA 3PE3A 4G1TA 3LS8A 2RFMA 3ZKJA 4I6JA 4WWNA 4FP7A 3HHMA 5ENNA 3FUEA 1JWFA 2IO3C 4PDXA 1QQEA 4OVUA 3SFYA 3KSQA 5G05C 1BLXB 3APCA 1IYGA 3IEGA 5A7DB 3EHRA 4O60A 1H2VC 1SQMA 4F53A 3PZDA 5KNHD 4UUCA 3S7FA 3QWPA 5JA4D 3C98A 2LXLA 2XENA 3L54A 4YDOA 1KZPA 5HRYA 1TN7A 2IQCA 3KEAA 3ABME 2GRLA 3X2QE 1OY3D 3EJNA 3L9TA 3PRZA 3CHOA 3BEEA 3CHRA 1MHQA 2KCLA 2WXLA 3EHQA 4WNEA 2NC9A 4BT8A 4XZ4A 4Q96A 4WNDA 2H6FA 3E34A 4AXHA 1OT8A 4NIKA 4BFRA 4OVVA 4DK5A 3ML9A 3D9MA 2HM8A 4IRUA 4Y6WA 2MYOA 5B3SE 4N2SA 3MCXA 3TL5A 3DSWA 5BV1A 4DJAA 2HO1A 4AIFA 2VSNA 3CSFA 2XS1A 2P9NG 3VLFA 3PH0C 4KBQA 3C5RA 1MX6A 3L16A 5ANRA 3QK0A 5EYLA 3FTWA 3ONKA 2I1JA 2A5UA 2WMOA 3S7JA 3UT7A 1BU9A 4DX7D 3HVEB 1OWOA 2MRIA 4GTMA 2C0MA 4JPSA 1UN9A 1NL4A 3RAUA 4B94A 3AAAC 1TNBA 3RSEG 3E4BA 4U63A 3R7RA 4AY5A 2X6KA 3QJZA 3UT8A 1ELWA 4JHKA 3B7TA 2F0YA 2CG3A 4CEMA 2KZTB 4JXTA 2NYJA 4I9CA 3UM2A 2J09A 2BKKB 1OUVA 4A1SA 3UX4A 4JEHA 3DBSA 4JZYA 3D9HA 3LY7A 2WXPA 3TWWA 5EILA 3ZU7B 3L82A 4UQYA 3RJVA 3EDTB 3TWSA 1OWLA 3CVQA 3D3MA 4HLLA 5ENQD 5FINA 3IBEA 2MOWA 3CGHA 2WXKA 2KCKA 3MGBA 3G2VA 4EBAA 2EIME 3CVUA 3VLDA 5EYPF 4UWGA 4ACLA 4Z68A 5BXUA 4LG6A 5AN8A 3LJNA 4GYOA 4JHRA 3B95A 3ASNE 1HS6A 3HXDA 2WMNA 4G8LA 4F1PA 4KVMA 3KAEA 2WXFA 5ARFA 1OCRE 3EU5A 3W9GA 1FVHA 4U8VD 4GPKA 5LX8A 4KZCA 4XEIG 1DNPA 1UJJA 1OCOE 3FTVA 3EUVA 2I9CA 2R03A 1KLXA 2C0LA 3ZYLA 4D10C 4HOTA 3E32A 3RRNB 2Y4TA 1YA0A 3S2AA 3CQGB 4N3CA 3RO2A 3EIQC 5CRUA 4LUNU 2BUGA 4F6RD 2KBXA 1D8DA 2OV8A 3O4ZA 1QYMA 2GGFA 2YINA 5ITZF 4RSYA 2GRMA 1SZAA 3ZYMA 4BTBA 5FT9A 4PS3A 4BTAA 2P9LG 2VJ8A 3Q49B 4APFA 3GZSA 4HI9A 1HO8A 2LXMA 3ZW3A 3ABLE 3V79K 3LY9A 5BT1A 2J4BA 3MZLB 1K1AA 3P2BA 5HKPA 4GTQA 3QAQA 4I6GA 5CERB 4MBGA 4GU5A 2Q7FA 3ASHA 1N0QA 3DSSA 3LYAA 2WPVA 1SVXA 5JJ7A 1UJKA 2H6IA 3TXNA 4N39A 3V30A 5M72A 1HG2A 3OXGA 4KYOB 4BX9A 4U0SA 3HVEA 1AP7A 2PQNA 3MJWA 1N52A 3ASGA 3BQOA 2ZIRA 1N0RA 4RVBA 5HQ8A 2KCVA 3Q73A 3QB2A 4CZ2D 2L0IA 3SFXA 1IHGA 5G05J 3PZ4A 3Q47B 1FPPA 5EDSA 4YVQC 3CVYA 2I2OA 3FUNA 1Q2ZA 3NOGD 1K1BA 4JW1A 5D0QD 4A55A 2DYRE 2FEZA 3P1UA 4BERA 2XCBA 3RRUA 5EIBE 4ANXA 5EX0A 2UWJG 3FTXA 3FTSA 4RLYA 2UY1A 3U3WA 1E7UA 1ELKA 4EPZA 4O1PA 2XZTG 4LCTA 5C1DA 5CBNA 3DEOA 5AJDA 2FBNA 2ZISA 5FTPA 5CBOA 3Q9UC 1KT0A 1WAO1 4QFVA 4R7LA 3TG4A 3J5QB 2ZU6B 2CG2A 2UY1B 4MLPA 1TEZA 3KSLA 1EYHA 2AWIA 5ARGA 2VTBB 1D8EA 5ENSD 2XHEA 2P2CP 1OXJA 5G04J 3CLJA 4GMLA 2WQ7A 4DX1A 4IN3B 2X6FA 3D9KA 4I43A 4I2ZA 4LNUD 2EIJE 4J7WA 4L23A 4U96D 2IO2C 4ACKA 2A5EA 3CQCB 4EQFA 4AV7A 4JHJA 4CGWA 4HS2A 3ZUVB 2L6BA 2WXOA 1IQRA 4XKBA 5AARA 3HXBA 4JA9A 4L7TA 2XEEA 3PREA 3EHMA 2J9QA 1KZOA 3DXMG 5FQ7A 4E6HA 5J08A 3CK8A 4TRQA 3ZHEB 3MKQB 1WDYA 4V3IA 4M7CA 2LO6A 3HDXA 2RFAA 2XRYA 4JVSA 3SO8A 4TXPA 1E8ZA 2P9SG 2WXRA 2YQ8A 2ETCA 4GTOA 2RD0A 4EECA 3D9IA 3VLEA 4NRHB 3ZPJA 1E8XA 2B0OE 3KD7A 5DBKA 1NA0A 3IHYA 5T8IA 3LEWA 2X6HA 1S64A 3SBTB 2CHWA 4GB9A 3SQVA 4F3VA 1IXVA 2XEHA 2LSUA 4AP2A 1N94A 3T8MA 1NFIE 5ENPD 1PAQA 3OTNA 2H6HA 4CYMD 2VTBA 4NURA 4B93B 3FU6A 2ZGGA 4BSZB 1HE8A 2J08A 1TR4A 2P9IG 1SZ9A 3Q75A 5JJ6A 3ENEA 3TGOA 1TNYA 4UWKA 4N2QA 1OWPA 5H7PA 4Q94A 4XE0A 2QY7A 1HF8A 4K5AB 3ESLA 5BUZA 4C0EA 3IXEA 5LP0A 2XQ0A 4GTSA 2XS8A 3LXUX 3CK9A 1EDUA 3JXJA 1EPUA 3AS4A 4G24A 4GZ6A 4DLQA 2RG8A 5JMND 4A63B 3GW4A 2GRQB 2WXJA 3AG1E 5FWQA 4G26A 4CDRA 2XCCA 1PY1A 4I1AA 4IYPA 3SI5A 1JCSA 3UUXA 3SBSA 1ZBPA 3FDHA 1LTXA 3UPVA 3LJ3A 4UI9J 5FZQA 5D0OD 3CHSA 3U4TA 2XRZA 1U2VG 3Q4AB 1TNOA 3FFLA 3HG0D 3Q15A 2EINE 3E30A 4TUUA 2R59A 1NZNA 5B1BE 1KPSB 3AU4A 3UM3A 4EZJA 1B89A 3DWLG 2LAHA 2XGSA 5EN5D 2V5FA 1FCHA 3FU3A 5CRVA 2VGXA 1WG0A 1S63A 3MYVA 4RQIA 3MV2B 4YVOA 3UINC 5AQBA 4K5BA 4K03A 4GTVA 4AOFA 3PZ2A 4FC8A 1RZ4A 3UIOC 2CFZA 3NF1A 3R9MA 4B8CB 3QKYA 2XEVA 3B7BA 2V0PA 3Q78A 4CT4A 5D66A 2V4HC 5C2YA 5CCMA 4AEZC 1DC2A 4GZ5A 2ONDA 2PZIA 2CHZA 2LAIA 4FHJA 5G55A 2X3MA 2XZDG 3FH5A 3RU0A 4O1OA 1JPLA 4PH4B 3AS8A 4ME2A 4YDYA 1SW6A 2BKGA 2BF0X 1JCQA 3RRMB 3GZ2A 1TN8A 1BI8B 2KZTA 1YYHA 5KJKA 4J6IA 3DSUA 4I1OB 3PEUB 5CEAA 4EZLA 1A5EA 5LCWC 2I6HA 2VSXE 5CHEE 2WB2A 2IY0C 3FWVA 3FU5A 1WM5A 3QOUA 4BY6A 2DYSE 1Z5SC 4PS7A 4PS8A 3ESKA 1FT1A 5FQ6A 2P9KG 2LSVA 4F1SA 5KNGA 1E7VA 4DRXE 1EF1C 3UI2A 3J5PA 4G8KA 3TXMA 2OOEA 3UIPC 1JWGA 2L6JA 1H6PA 5KJNA 1TNUA 4F7AA 2CHXA 4GAAA 2VQ2A 1E90A 4GTPA 3LDZA 3I4RB 5CECB 4OAVB 3D9PA 4KMOA 2YHEA 5AAOA 1OWNA 4M3OA 3FUJA 3FHEA 4BEPA 3FEYA 4TV3A 4YNDA 3VTYA 4C9BB 1QBQA 3AJIA 3CVWA 3VTXA 4CDNA 3CVPA 3CVVA 5EKQD 3Q9NC 5KCMA 2OCCE 3UQ3A 2OEVA 3SFZA 3CVNA 4YDEA 3PUJA 3GYZA 3ZYKA 4GYWA 2XPIA 1QNFA 4OAUC 1MYOA 5IY5E 1Y6IA 3TWTA 3JUEA 3E37A 3G2WA 2GRRB 1N4SA 1P5QA 2P9UG 3LVQE 5FZSA 2VYIA 2OVBA 5HS0A 2F8YA 1HFAA 4O6FA 3L17A 3AG2E 3NZSA 1IQUA 4HBDA 4WAFA 2ETBA 4U0ZA 3PNLB 1H2UA 5FZRA 3UT4A 3URZA 2WM9A 1SA4A 4DI4A 1N95A 3B7RL 4UI9K 3FUFA 1NP7A 4FLBA 5CCLA 5BXOA 3NOCD 2C2LA 4N3AA 4DX2A 3FP3A 1Y8MA 1TJCA 2X6IA 4LRZA 3ZRHA 3U9WA 4BESA 2QYUA 2WXHA 4ILIA 3EHNA 4ATZD 3UKUG 3Q5MA 4HB5A 1L5JA 4P29A 4XI0A 2F8XK 2WXMA 3IKOB 3CR3A 3FULA 4HVBA 4HNAD 2RKKA 5B1AE 2VSOE 1XNFA 2J4DA 4GMJA 3MKRA 3JYSA 3ULYA 4URKA 4I17A 4K5CA 1KT1A 2IJGX 3FUMA 2P58C 5ANLA 1AWCB 3FUHA 4XX5A 2AJAA 4G11A 2H6GA 5T3RA 4AVXA 3BG0B 2PQRA 4YDWA 3W9FA 4JA7A 4TUMA 3C3OA 3IHVA 3SNXA 5AQAA 2R5SA 1SA5A 1UOHA 4HRNA 4J8DA 2DCPA 4UWHA 3CKCA 4WNGA 1Z3XA 3HXCA 2X38A 1ZU2A 5E75A 3MKQA 4GYYA 4AM9A 3V2OA 3FTUA 2Y3AA 3AU5A 2PM7A 4WWPA 3PUKA 4BX8A 4H7YA 4QQIA 5A23A 2PNNA 4NACA 5LFAA 4ILHB 3ZIMA 4ILGA 2BEDA 2OVFA 3B7UX 3RO3A 2E2EA 1N11A 2XPYA 2EIKE 4KXKB 2YNQA 2AXZA 4LEUA 5BW8C 1O1SA 3ASDA 3G2TA 3T5XA 4ABNA 1UG3A 4KT6B 1HX8A 3AS5A 3UXGA 4AY6A 2HYZA 1OCZE 3CHQA 3CHPA 3B13A 1N9AA 2MHKA 2KM4A 4GA2A 4UWFA 3TAXA 4U07A 2ETAA 4J8SA 4C48B 2KATA 3LVRE 3K9IA 2WXGA 1K3ZD 3U64A 5AQ9A 1H2TC 3WXXA 2IFUA 1HH8A 4RG6A 3PZ1A 3FUDA 3N71A 3C3RA 4MRUA 3ULEG 4K0RA 2WXNA 3QWWA 2GW1A 1V55E 3MX3A 4BWRA 3WG7E 2GRNB 3BU8A 1V54E 2AXVA 4HI8A 3GZ1A 3ZVVA 2DBAA 4PUCA 5ENRD 4FLHA 5KWDA 1BI7B 1DVPA 3RIBA 2JEKA 4WNFA 1W3BA 4DUIA 4G23A 3TWUA 1VDYA 2AVPA 3HRAA 4KZ0A 2HR2A 5FIOA 1PC2A 5EX3A 3D9OA 2WXIA 3D9JA 2JABA 4FU3A 1ZB1A 4GTTA 4HORA 4WWOA 3I5PA 3NB2A 1RW2A 2JLBA 4CRWA 1E96B 2I1KA 1U3DA 5LCWJ 3NZUA 1TJFA 2IOSA 3JQ0A 4UQZA 3PVLA 1LD7A 4B89A 3C3QA 4ANVA 3LPZA 5LOZA 5JHAA 2X6JA 2R02A 2J07A 1G3NB 4BT9A 1DCEA 1U3CA 3I3NA 2HE0A 3DSTA 1DCQA 3E33A 2BTDA 3OXLA 4GA1A 2QZAA 3FY4A 1D9SA 3D9LA 3G2SA 3PS6A 3F6QA 4E85A 1O5MA 1X81A 2DIWA 2LNIA 1N4PA 2VGXB 2DWZA 4L2LA 4HOUA 1HXIA 3JUIA 1JUQA 3PE4A 5EIDA 3G2UA 4UWLA 4KVOA 2L9BA 4EHMA 4GZDA 5AIJA 3KS2A 5CMWA 2NXPA 4LNBA 1K8KG 2EQXA 1H6KA 3Q7AA 4I9EA 3ZFWA 4GZ3A 2VGEA 4ZFHA 4HRMB 5J90A 2FULA 4AJWA 3UM1A 4XKCA 4HQDA 3V2XA 1YCSB 1X5BA 3CK7A 5D2MC 4ANUA 2KC7A 2L0TB 3UM0A 2PM6A 4LNGA 2EILE 4Q69A 3NBNB 4U0UA 4HLEA 2WQHA 3S7DA 3ZHEA 2XPZA 3L6AA 5BV0A 2GRPB 3QWVA 1OCCE 3CVXA 3SHFA 4RG9A 4XIFA 5BPPA 3BG1B 3I4GA 5DIZA 1IHBA 4MS6A 1NI1A 5ENOD 4EBAG 1UW4B 4GCNA 3HYMB 1MJ0A 2GROB 3HXFA 3OAWA 4TXRA 3CVLA 1HG5A 1H0AA 2IOLA 5FQ4A 5AYWD 2J49A 3DXKG 3S7BA 2IEJA 3SGHA 3R7QA 4X8QA 4APOA 2Y0BG 3L13A 4FA6A 5KJMA 3O48A 4B0ZA 1E8YA 4N5CA 2ZGDA 3AG3E 2QC9A 5CEDB 4DI3A 4FJZA 2FF4A 1MX4A 1BPOA 1Z6TA 3TWVA 3SZ7A 3AG4E 3ASFA 4J8FA 5E76A 2J8SD 5G04C 2DVWA 2VSYA 3SF4A 4DPRA 5G2NA 2V4LA 5AJLA 3DRAA 2LUHA 3ZXPA 3HXEA 1GW6A 2V8SE 3PNTB 2V5QC 3KEZA 3TWQA 1N54A 2AXUA 3PDNA 4J0UA 4GPMA 3UTMA 1E8WA 1N4QA 1MZCA 4JB8P 3ASOE 4B8AA 1MX2A 3ML8A 1O1TA 3DEPA 3IV0A 3ZYQA 3ZN3A 4Y6CA 3MEKA 4MKTA 3ZNGA 1LF8A 4G2VA 1FT2A 2FO7A 1MQSA
chains in the Genus database with same CATH topology
1UN9A 3DPDA 4J8EA 2LSUA 5T3RA 4JEUA 4B94A 4AP2A 1FVFA 3QARA 4I1MA 4AVXA 4A3TA 1HZ4A 3L22A 3BG0B 2PQRA 3T8MA 4JA7A 3E4BA 1PAQA 3OTNA 4U63A 3R7RA 3IHVA 3FU0A 4AY5A 2VTBA 3SNXA 3FH8A 2IF4A 4NURA 4DLOA 2X6KA 3QJZA 3FU6A 3UT8A 1ELWA 4JHKA 2R5SA 4U8HA 3B7TA 1HE8A 2J08A 4JC8A 2CG3A 4CEMA 4J8DA 2KZTB 4JXTA 2DCPA 4UWHA 1SZ9A 5JJ6A 5AENA 3ENEA 3CKCA 3TGOA 4I9CA 4WNGA 3FUKA 3CSTA 2J09A 4UWKA 1Z3XA 4N2QA 1OUVA 1OWPA 4A1SA 4Q94A 4HXIA 4XE0A 2X38A 3UX4A 1ZU2A 4JEHA 2QY7A 3DBSA 5E75A 3MKQA 1HF8A 3SD5A 4JZYA 4GYYA 4AM9A 3ESLA 3LY7A 3FTUA 2Y3AA 2WXPA 3AU5A 5BUZA 4C0EA 2PM7A 4L2YA 5LP0A 2XQ0A 5JJTA 3LXUX 3PUKA 4UQYA 4WWPA 3RJVA 4BX8A 3CK9A 3CKBA 3EDTB 4GCOA 4H7YA 1EDUA 1OWLA 4LERA 5A23A 3CVQA 1EPUA 3APFA 4NACA 5LFAA 4ILHB 3AS4A 3D3MA 4ILGA 4G24A 3ZIMA 2OVFA 4GZ6A 3B7UX 3RO3A 4DLQA 2E2EA 2RG8A 3IBEA 1WY6A 2MOWA 3RK6A 3CGHA 2XPYA 4XI9A 2WXKA 4FHKA 2KCKA 3GW4A 3MGBA 2WXJA 3G2VA 4ANWA 4EBAA 4KXKB 2YNQA 2AXZA 4LEUA 3CVUA 5BW8C 5FWQA 4G26A 3HIZA 5T4YA 3ASDA 4UWGA 3ULQA 3VLDA 4CDRA 3G2TA 4ACLA 3T5XA 4ABNA 3FTYA 1UG3A 4HOSA 2XCCA 1PY1A 4I1AA 4IYPA 3SI5A 4KT6B 1HX8A 2FI7A 5CMYA 3UUXA 2XGMA 3AS5A 3SBSA 3CV0A 1ZBPA 2WXQA 4W9RA 4AY6A 3LKUA 2HYZA 3FDHA 5HI7A 3CHQA 3UPVA 3CHPA 3JCKC 3LJ3A 4GYOA 1S0PA 4JHRA 4UI9J 1HS6A 3B13A 3RKVA 5FZQA 2WMNA 5D0OD 2MHKA 2KM4A 4GA2A 4UWFA 3TAXA 3CHSA 4U07A 4KVMA 3U4TA 4J8SA 2XRZA 3KAEA 3Q4AB 3FFLA 3EIJA 2KATA 2WXFA 3LVRE 5ARFA 3Q15A 3K9IA 1FVHA 2WXGA 3U64A 4TUUA 2R59A 4CGVA 5LCWC 3QDNA 4GPKA 2PL2A 5LX8A 1NZNA 4KZCA 1H2TC 2WVIA 1DNPA 1UJJA 3WXXA 5FQ8A 2IFUA 4WUYA 1HH8A 4RG6A 3FTVA 3FUDA 3AU4A 3N71A 4EZJA 1B89A 3JQ1A 2I9CA 3FEXA 4MRUA 4K0RA 1KLXA 2WXNA 2LAHA 2E0IA 3QWWA 2XGSA 2C0LA 2GW1A 2V5FA 3MX3A 4H7XA 4BWRA 3D9NA 3ZYLA 4D10C 1FCHA 4HOTA 4N3BA 3FU3A 2AXVA 3RRNB 2Y4TA 2VGXA 3GZ1A 3ZVVA 1YA0A 2DBAA 3LCAA 3S2AA 4PUCA 3MYVA 3PEVB 4FLHA 2ILRA 3CQGB 1DVPA 3RIBA 4N3CA 4UI9C 2R17C 3RO2A 3EIQC 2JEKA 3MV2B 4ATGA 3ZEFA 4YVOA 4EZKA 4WNFA 3UMVA 1W3BA 4L1BA 4LUNU 2BUGA 4G23A 1VDYA 2AVPA 4K03A 3MA5A 3MV3B 4KZ0A 4AOFA 4FC8A 1OWMA 3ZXSA 4U04A 2HR2A 2YHCA 1PC2A 5EX3A 3D9OA 2OV8A 2WXIA 3D9JA 5JHBA 3O4ZA 3QNKA 2GGFA 4FU3A 2YINA 4HORA 4WWOA 2CFZA 3I5PA 4RSYA 3NF1A 2GRMA 1SZAA 4I6EA 4B8CB 2JLBA 3QKYA 4CRWA 2XEVA 4FJYA 3NQPA 1E96B 3ZYMA 5FT9A 2V0PA 4PS3A 4BTBA 2I1KA 1U3DA 4C0MA 2NSZA 2QFCA 4CT4A 1XGWA 4I2WA 5LCWJ 4BTAA 2VJ8A 3NZUA 1TJFA 2IOSA 3JQ0A 4UQZA 4CDMA 3PVLA 5C2YA 5BNWA 3Q49B 5CCMA 4AEZC 4APFA 3GZSA 3CHMA 1HO8A 4GZ5A 4B89A 2ONDA 5KJLA 4ANVA 3ZW3A 2PZIA 2CHZA 3LPZA 3LY9A 2LAIA 4HFGA 4FHJA 5G55A 5LOZA 2X3MA 5JHAA 5BT1A 4CT0A 2J4BA 1HU3A 3MZLB 4UQXA 3FH5A 2X6JA 3RU0A 2J07A 3U66A 3P2BA 4BT9A 1JPLA 4JL0A 1U3CA 3I3NA 3ONLA 4PH4B 3CEQA 3QAQA 4I6GA 3TG5A 2IU1A 3AS8A 1QZ2A 4GU5A 2Q7FA 3ASHA 4ME2A 2BTDA 2Y4UA 3OXLA 4GA1A 4A1GA 4IULA 2BF0X 1UN8A 3LYAA 3GZ2A 4GZCA 3RRMB 3FY4A 2WPVA 3D9LA 3B7SA 2KZTA 3G2SA 3PS6A 5KJKA 3FTZA 4E85A 5JJ7A 2DIWA 4J6IA 3FUIA 1UJKA 2LNIA 3TXNA 4N39A 5M72A 2VGXB 5A6CA 4G25A 4I1OB 3PEUB 1HG2A 1Z3YA 4L2LA 3OXGA 4HOUA 4EZLA 1HXIA 4KYOB 3JUIA 1ELRA 1JUQA 2I6HA 2VSXE 3PE4A 5CHEE 4HOQA 4U0SA 3G2UA 3FWVA 4BX9A 3T5VA 3FU5A 1WM5A 3HVEA 3QOUA 3CIAA 4BY6A 3APDA 4UWLA 4PS7A 4PS8A 4KVOA 2PQNA 2A4ZA 2L9BA 3ESKA 4A3VA 3OXFA 3MJWA 4GZDA 5FQ6A 5AIJA 1N52A 2LSVA 3ASGA 2AW6A 4F1SA 4GA0A 3FH7A 1E7VA 4RVBA 3KS2A 5FJYA 4BSXA 2XGOA 2WQ6A 5HQ8A 4CCAA 4FULA 4FADA 2KCVA 4NQ0A 5CMWA 1EF1C 3TXMA 1H19A 4OYSA 2NXPA 2OOEA 2M63A 3QB2A 1JWGA 2L0IA 3TJPA 2L6JA 5KJNA 1IHGA 2EQXA 5G05J 1H6KA 1NA3A 3Q47B 3ZGQA 4F7AA 2IONA 5EDSA 2CHXA 4GAAA 4YVQC 3CVYA 2I2OA 2VQ2A 1E90A 2VGYA 3FUNA 2CFUA 4I9EA 3ZFWA 4GZ3A 3LDZA 3I4RB 5J90A 3D9PA 2FULA 4JW1A 4AJWA 5D0QD 4KMOA 4A55A 1A17A 2YHEA 2FEZA 4XKCA 3P1UA 3L08A 1OWNA 3R9AB 2XCBA 3FUJA 4M3OA 1X5BA 1INZA 3FHEA 3LY8A 3RRUA 3CK7A 3FEYA 4TV3A 3QC1A 4YNDA 5EX0A 2UWJG 3FTXA 3VTYA 4ANUA 4ANXA 2KC7A 3FTSA 3PE3A 2L0TB 2UY1A 4C9BB 4G1TA 3U3WA 1E7UA 3CVWA 2PM6A 1ELKA 3VTXA 4CDNA 3LS8A 4EPZA 4Q69A 3CVPA 4I6JA 4WWNA 4LCTA 4FP7A 5C1DA 3CVVA 4U0UA 4HLEA 3HHMA 2WQHA 3FUEA 5ENNA 1JWFA 5EKQD 5AJDA 2FBNA 5FTPA 3S7DA 5KCMA 3ZHEA 2XPZA 3L6AA 1KT0A 1WAO1 4QFVA 4R7LA 3TG4A 3UQ3A 3SFZA 3CVNA 5BV0A 4PDXA 3PUJA 1QQEA 3QWVA 4OVUA 3GYZA 3ZYKA 4GYWA 5G05C 2XPIA 3CVXA 1QNFA 2ZU6B 2CG2A 3SHFA 2UY1B 3APCA 4MLPA 1IYGA 3IEGA 5A7DB 4RG9A 1TEZA 4XIFA 1Y6IA 5BPPA 3BG1B 1H2VC 3I4GA 1EYHA 1SQMA 5DIZA 4F53A 1MQSA 2AWIA 4MS6A 5ARGA 3PZDA 4EBAG 1UW4B 2VTBB 4GCNA 3G2WA 2XHEA 3HYMB 5G04J 3CLJA 4GMLA 2WQ7A 3OAWA 1P5QA 4IN3B 2WB2A 3S7FA 3CVLA 1HG5A 3QWPA 2X6FA 3C98A 3D9KA 4I43A 1H0AA 2IOLA 4I2ZA 5FQ4A 5AYWD 2J49A 3L54A 3LVQE 4L23A 3S7BA 5FZSA 2IQCA 3SGHA 4ACKA 3R7QA 3CQCB 2GRLA 2VYIA 2OVBA 4APOA 3L13A 4EQFA 3EJNA 4FA6A 4AV7A 4JHJA 5KJMA 3O48A 4CGWA 3PRZA 4HS2A 4B0ZA 3CHOA 1E8YA 1HFAA 4O6FA 3BEEA 3L17A 4N5CA 2WXOA 1IQRA 4XKBA 3CHRA 1MHQA 3NZSA 1IQUA 2KCLA 2WXLA 4WAFA 4DI3A 4WNEA 2NC9A 4FJZA 4BT8A 4U0ZA 3PNLB 2FF4A 1H2UA 5FZRA 4XZ4A 4JA9A 3UT4A 3URZA 4L7TA 2WM9A 4Q96A 4WNDA 4DI4A 1BPOA 1Z6TA 3SZ7A 3B7RL 4UI9K 4AXHA 3PREA 3EHMA 3FUFA 3ASFA 4J8FA 4OVVA 4BFRA 2J9QA 5E76A 1NP7A 4FLBA 5FQ7A 4DK5A 3ML9A 5CCLA 5G04C 4E6HA 2C2LA 2VSYA 4N3AA 3FP3A 1Y8MA 5J08A 3CK8A 2HM8A 3D9MA 4IRUA 3SF4A 4Y6WA 4TRQA 3ZHEB 4DPRA 1TJCA 5G2NA 4N2SA 3MCXA 3TL5A 2V4LA 3MKQB 4V3IA 2X6IA 5AJLA 2LO6A 4LRZA 3ZRHA 3HDXA 3U9WA 2XRYA 2WXHA 4JVSA 4ILIA 3EHNA 1GW6A 2V8SE 3PNTB 3Q5MA 4P29A 1L5JA 4XI0A 3KEZA 5BV1A 1E8ZA 2WXRA 2HO1A 2WXMA 4AIFA 4DJAA 3IKOB 2YQ8A 1N54A 2VSNA 3CR3A 2AXUA 3CSFA 3PDNA 3FULA 4J0UA 3VLFA 2RD0A 4HVBA 1E8WA 3PH0C 4KBQA 4EECA 3L16A 4B8AA 4XX5A 2VSOE 5ANRA 3ML8A 1XNFA 2J4DA 3D9IA 3QK0A 4GMJA 3MKRA 3VLEA 3FTWA 4NRHB 3JYSA 3ZPJA 1E8XA 3IV0A 2I1JA 3ONKA 3KD7A 4URKA 4I17A 5DBKA 3ZYQA 3ZN3A 1NA0A 1KT1A 2A5UA 4Y6CA 3IHYA 3MEKA 4MKTA 2WMOA 3S7JA 3UT7A 2IJGX 1LF8A 5T8IA 3FUMA 3LEWA 2X6HA 3HVEB 2P58C 4G2VA 3SBTB 1OWOA 2CHWA 5ANLA 4GB9A 2MRIA 4F3VA 2FO7A 3FUHA 2C0MA 4JPSA 4G11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZ2 A;  2WPV A;  4CGV A;  1P5Q A;  4J8E A;  2LSU A;  4IN3 B;  3S7F A;  3CVL A;  5KJK A;  4B94 A;  5JJ7 A;  3QDN A;  3QWP A;  4GPK A;  2PL2 A;  2LNI A;  1NZN A;  4N39 A;  3WXX A;  5M72 A;  2VGX B;  1HZ4 A;  4I2Z A;  2IFU A;  4WUY A;  5A6C A;  2PQR A;  1HH8 A;  4G25 A;  4RG6 A;  5AYW D;  4JA7 A;  3E4B A;  3N71 A;  1B89 A;  3OXG A;  4HOU A;  3S7B A;  4AY5 A;  1HXI A;  4KYO B;  5FZS A;  1ELR A;  2I6H A;  5CHE E;  3PE4 A;  5LCW C;  4HOQ A;  1KLX A;  2IF4 A;  3FWV A;  4U0S A;  2VYI A;  4APO A;  1WM5 A;  3QOU A;  2XGS A;  2C0L A;  2GW1 A;  2V5F A;  3QWW A;  4EQF A;  5KJM A;  4H7X A;  4BWR A;  3O48 A;  4CGW A;  1ELW A;  2PQN A;  3ESK A;  2R5S A;  3OXF A;  1FCH A;  4HOT A;  4N3B A;  4O6F A;  4N5C A;  3BEE A;  3ZFW A;  4J8D A;  2LSV A;  2Y4T A;  3ASG A;  2VGX A;  5JJ6 A;  3GZ1 A;  4GA0 A;  3CKC A;  3TGO A;  4I9C A;  1YA0 A;  4WNG A;  2DBA A;  2KCL A;  3KS2 A;  3LCA A;  5FJY A;  2XGO A;  4WNE A;  5HQ8 A;  2NC9 A;  4BT8 A;  4N2Q A;  4U0Z A;  1OUV A;  2KCV A;  2FF4 A;  4NQ0 A;  4A1S A;  3RIB A;  4N3C A;  4UI9 C;  5FZR A;  1ZU2 A;  3RO2 A;  4JA9 A;  2OOE A;  3MV2 B;  4WND A;  3URZ A;  4GYY A;  4YVO A;  4AM9 A;  4WNF A;  3LY7 A;  1W3B A;  2L6J A;  5KJN A;  3SZ7 A;  1IHG A;  4UI9 K;  5G05 J;  1NA3 A;  3Q47 B;  3ZGQ A;  2BUG A;  3UPV A;  3ASF A;  4G23 A;  4J8F A;  2AVP A;  4YVQ C;  2J9Q A;  5JJT A;  2VQ2 A;  2VGY A;  4UQY A;  3RJV A;  3MA5 A;  3MV3 B;  5G04 C;  4I9E A;  5CCL A;  3CK9 A;  3CKB A;  2C2L A;  2VSY A;  3EDT B;  3FP3 A;  1Y8M A;  4GCO A;  4H7Y A;  4GZ3 A;  3CK8 A;  4N3A A;  3SF4 A;  4Y6W A;  3ZHE B;  3CVQ A;  1TJC A;  4N2S A;  4U04 A;  3AS4 A;  2HR2 A;  2YHC A;  4G24 A;  1PC2 A;  5D0Q D;  4GZ6 A;  1A17 A;  5EX3 A;  3RO3 A;  2FEZ A;  2E2E A;  3R9A B;  2XCB A;  4HOR A;  3Q5M A;  3LY8 A;  3NF1 A;  4XI0 A;  4XI9 A;  3CK7 A;  2KCK A;  4YND A;  5EX0 A;  3GW4 A;  2UWJ G;  2HO1 A;  3VTY A;  4AIF A;  2KC7 A;  2YQ8 A;  2VSN A;  2JLB A;  3PE3 A;  3QKY A;  2XEV A;  2UY1 A;  4KXK B;  4G1T A;  3U3W A;  4LEU A;  1E96 B;  5BW8 C;  5FT9 A;  4BTB A;  3VTX A;  2QFC A;  3PDN A;  4J0U A;  3CVP A;  4G26 A;  4I2W A;  3ASD A;  3ULQ A;  4BTA A;  5LCW J;  4CDR A;  4UQZ A;  4ABN A;  4KBQ A;  3Q49 B;  5BNW A;  5C1D A;  2XCC A;  4I1A A;  5CCM A;  4U0U A;  4HOS A;  2WQH A;  5EKQ D;  2FBN A;  2FI7 A;  4GZ5 A;  5FTP A;  3S7D A;  3UUX A;  2XGM A;  3ZHE A;  3AS5 A;  2OND A;  5KJL A;  3UQ3 A;  2PZI A;  1KT0 A;  1WAO 1;  3CV0 A;  3LPZ A;  3LY9 A;  1XNF A;  1ZBP A;  3TG4 A;  3CVN A;  4W9R A;  1QQE A;  3MKR A;  3QWV A;  5BT1 A;  4AY6 A;  3LKU A;  2HYZ A;  5HI7 A;  3GYZ A;  3JYS A;  4GYW A;  4NRH B;  4UQX A;  3RU0 A;  4JHR A;  3KD7 A;  2XPI A;  4GYO A;  5G05 C;  3ZPJ A;  4I17 A;  5DBK A;  2UY1 B;  3ZN3 A;  1IYG A;  1NA0 A;  3IEG A;  4UI9 J;  5A7D B;  4BT9 A;  1KT1 A;  4Y6C A;  4RG9 A;  3RKV A;  3MEK A;  4JL0 A;  5FZQ A;  5D0O D;  2MHK A;  4XIF A;  3CEQ A;  4GA2 A;  3S7J A;  3TG5 A;  3TAX A;  3AS8 A;  4U07 A;  1QZ2 A;  3U4T A;  2P58 C;  4G2V A;  5DIZ A;  2Q7F A;  3KAE A;  3ASH A;  5ARG A;  3Q4A B;  3FFL A;  4ME2 A;  2KAT A;  5ARF A;  2Y4U A;  3OXL A;  4GA1 A;  4GCN A;  4F3V A;  3Q15 A;  2FO7 A;  3HYM B;  3K9I A;  2C0M A;  5G04 J;  3LYA A; 
#chains in the Genus database with same CATH topology
 3DPD A;  4J8E A;  1TN6 A;  4JEU A;  1FVF A;  3QAR A;  4I1M A;  4A3T A;  1HZ4 A;  3L22 A;  2KXP C;  3SY2 A;  3Q7F A;  3FU0 A;  2ZXW E;  3FH8 A;  2IF4 A;  4DLO A;  3ISM C;  4U8H A;  4JC8 A;  5AEN A;  2Y69 E;  3FUK A;  3CST A;  4L9P A;  4HXI A;  3DPY A;  1IKN D;  3SD5 A;  4L2Y A;  5JJT A;  3CKB A;  4GCO A;  1H6O A;  4LER A;  3APF A;  1WY6 A;  3RK6 A;  4XI9 A;  4FHK A;  3T9K A;  4ANW A;  4GMR A;  4U7E B;  4BET A;  2Y1L E;  3HIZ A;  5T4Y A;  3ULQ A;  1YMP A;  3FTY A;  4HOS A;  2FI7 A;  5CMY A;  2XGM A;  3CV0 A;  2WXQ A;  4W9R A;  3LKU A;  5HI7 A;  3JCK C;  1S0P A;  3TWX A;  3RKV A;  1JCR A;  4J8Y A;  4GTR A;  1TNZ A;  3EIJ A;  2R2L A;  2R05 A;  3ABK E;  4CGV A;  2FO1 E;  3QDN A;  2PL2 A;  2WVI A;  5FQ8 A;  4WUY A;  4DX6 D;  3JQ1 A;  3FEX A;  2E0I A;  4HRL A;  4H7X A;  3D9N A;  4N3B A;  3NAW A;  3C72 A;  3LCA A;  1S70 B;  3PEV B;  2ILR A;  4UI9 C;  2R17 C;  4ATG A;  3ZEF A;  4EZK A;  3Q79 A;  3UMV A;  4ZHB A;  4L1B A;  3DSX A;  4JD2 G;  3MA5 A;  3MV3 B;  4LSZ E;  1OWM A;  3ZXS A;  4U04 A;  1TYQ G;  3BUA A;  2YHC A;  5JHB A;  2DZN A;  3JXI A;  3QNK A;  4N5Q A;  4I6E A;  4FJY A;  3NQP A;  2P9P G;  4C0M A;  2NSZ A;  2QFC A;  1BD8 A;  1XGW A;  4I2W A;  4CDM A;  1LD8 A;  2F37 A;  5BNW A;  3CHM A;  5KJL A;  5ENT D;  4HFG A;  4CT0 A;  1HU3 A;  4UQX A;  1N4R A;  3U66 A;  3UKR G;  4JL0 A;  3ONL A;  3CEQ A;  3TG5 A;  2IU1 A;  1QZ2 A;  2OEW A;  2Y4U A;  4A1G A;  3V31 A;  4IUL A;  1UN8 A;  4GZC A;  3B7S A;  3FTZ A;  3FUI A;  5A6C A;  3T8K A;  4G25 A;  3TWR A;  1Z3Y A;  1ELR A;  4HOQ A;  3T5V A;  2QYJ A;  3CIA A;  3APD A;  2A4Z A;  4A3V A;  3OXF A;  2AW6 A;  4GA0 A;  3FH7 A;  5FJY A;  4BSX A;  2XGO A;  2WQ6 A;  4CCA A;  4FUL A;  4FAD A;  4NQ0 A;  1O1R A;  1H19 A;  4OYS A;  5KBA A;  2M63 A;  5AQ7 A;  3TJP A;  2DZO A;  3EU9 A;  4U8Y D;  1NA3 A;  3ZGQ A;  4DX5 D;  2ION A;  3DSV A;  2VGY A;  2B6C A;  2CFU A;  1A17 A;  3PZ3 A;  3L08 A;  3R9A B;  1INZ A;  4U95 D;  3LY8 A;  3QC1 A;  4TXQ A;  3PE3 A;  4G1T A;  3LS8 A;  2RFM A;  3ZKJ A;  4I6J A;  4WWN A;  4FP7 A;  3HHM A;  5ENN A;  3FUE A;  1JWF A;  2IO3 C;  4PDX A;  1QQE A;  4OVU A;  3SFY A;  3KSQ A;  5G05 C;  1BLX B;  3APC A;  1IYG A;  3IEG A;  5A7D B;  3EHR A;  4O60 A;  1H2V C;  1SQM A;  4F53 A;  3PZD A;  5KNH D;  4UUC A;  3S7F A;  3QWP A;  5JA4 D;  3C98 A;  2LXL A;  2XEN A;  3L54 A;  4YDO A;  1KZP A;  5HRY A;  1TN7 A;  2IQC A;  3KEA A;  3ABM E;  2GRL A;  3X2Q E;  1OY3 D;  3EJN A;  3L9T A;  3PRZ A;  3CHO A;  3BEE A;  3CHR A;  1MHQ A;  2KCL A;  2WXL A;  3EHQ A;  4WNE A;  2NC9 A;  4BT8 A;  4XZ4 A;  4Q96 A;  4WND A;  2H6F A;  3E34 A;  4AXH A;  1OT8 A;  4NIK A;  4BFR A;  4OVV A;  4DK5 A;  3ML9 A;  3D9M A;  2HM8 A;  4IRU A;  4Y6W A;  2MYO A;  5B3S E;  4N2S A;  3MCX A;  3TL5 A;  3DSW A;  5BV1 A;  4DJA A;  2HO1 A;  4AIF A;  2VSN A;  3CSF A;  2XS1 A;  2P9N G;  3VLF A;  3PH0 C;  4KBQ A;  3C5R A;  1MX6 A;  3L16 A;  5ANR A;  3QK0 A;  5EYL A;  3FTW A;  3ONK A;  2I1J A;  2A5U A;  2WMO A;  3S7J A;  3UT7 A;  1BU9 A;  4DX7 D;  3HVE B;  1OWO A;  2MRI A;  4GTM A;  2C0M A;  4JPS A;  1UN9 A;  1NL4 A;  3RAU A;  4B94 A;  3AAA C;  1TNB A;  3RSE G;  3E4B A;  4U63 A;  3R7R A;  4AY5 A;  2X6K A;  3QJZ A;  3UT8 A;  1ELW A;  4JHK A;  3B7T A;  2F0Y A;  2CG3 A;  4CEM A;  2KZT B;  4JXT A;  2NYJ A;  4I9C A;  3UM2 A;  2J09 A;  2BKK B;  1OUV A;  4A1S A;  3UX4 A;  4JEH A;  3DBS A;  4JZY A;  3D9H A;  3LY7 A;  2WXP A;  3TWW A;  5EIL A;  3ZU7 B;  3L82 A;  4UQY A;  3RJV A;  3EDT B;  3TWS A;  1OWL A;  3CVQ A;  3D3M A;  4HLL A;  5ENQ D;  5FIN A;  3IBE A;  2MOW A;  3CGH A;  2WXK A;  2KCK A;  3MGB A;  3G2V A;  4EBA A;  2EIM E;  3CVU A;  3VLD A;  5EYP F;  4UWG A;  4ACL A;  4Z68 A;  5BXU A;  4LG6 A;  5AN8 A;  3LJN A;  4GYO A;  4JHR A;  3B95 A;  3ASN E;  1HS6 A;  3HXD A;  2WMN A;  4G8L A;  4F1P A;  4KVM A;  3KAE A;  2WXF A;  5ARF A;  1OCR E;  3EU5 A;  3W9G A;  1FVH A;  4U8V D;  4GPK A;  5LX8 A;  4KZC A;  4XEI G;  1DNP A;  1UJJ A;  1OCO E;  3FTV A;  3EUV A;  2I9C A;  2R03 A;  1KLX A;  2C0L A;  3ZYL A;  4D10 C;  4HOT A;  3E32 A;  3RRN B;  2Y4T A;  1YA0 A;  3S2A A;  3CQG B;  4N3C A;  3RO2 A;  3EIQ C;  5CRU A;  4LUN U;  2BUG A;  4F6R D;  2KBX A;  1D8D A;  2OV8 A;  3O4Z A;  1QYM A;  2GGF A;  2YIN A;  5ITZ F;  4RSY A;  2GRM A;  1SZA A;  3ZYM A;  4BTB A;  5FT9 A;  4PS3 A;  4BTA A;  2P9L G;  2VJ8 A;  3Q49 B;  4APF A;  3GZS A;  4HI9 A;  1HO8 A;  2LXM A;  3ZW3 A;  3ABL E;  3V79 K;  3LY9 A;  5BT1 A;  2J4B A;  3MZL B;  1K1A A;  3P2B A;  5HKP A;  4GTQ A;  3QAQ A;  4I6G A;  5CER B;  4MBG A;  4GU5 A;  2Q7F A;  3ASH A;  1N0Q A;  3DSS A;  3LYA A;  2WPV A;  1SVX A;  5JJ7 A;  1UJK A;  2H6I A;  3TXN A;  4N39 A;  3V30 A;  5M72 A;  1HG2 A;  3OXG A;  4KYO B;  4BX9 A;  4U0S A;  3HVE A;  1AP7 A;  2PQN A;  3MJW A;  1N52 A;  3ASG A;  3BQO A;  2ZIR A;  1N0R A;  4RVB A;  5HQ8 A;  2KCV A;  3Q73 A;  3QB2 A;  4CZ2 D;  2L0I A;  3SFX A;  1IHG A;  5G05 J;  3PZ4 A;  3Q47 B;  1FPP A;  5EDS A;  4YVQ C;  3CVY A;  2I2O A;  3FUN A;  1Q2Z A;  3NOG D;  1K1B A;  4JW1 A;  5D0Q D;  4A55 A;  2DYR E;  2FEZ A;  3P1U A;  4BER A;  2XCB A;  3RRU A;  5EIB E;  4ANX A;  5EX0 A;  2UWJ G;  3FTX A;  3FTS A;  4RLY A;  2UY1 A;  3U3W A;  1E7U A;  1ELK A;  4EPZ A;  4O1P A;  2XZT G;  4LCT A;  5C1D A;  5CBN A;  3DEO A;  5AJD A;  2FBN A;  2ZIS A;  5FTP A;  5CBO A;  3Q9U C;  1KT0 A;  1WAO 1;  4QFV A;  4R7L A;  3TG4 A;  3J5Q B;  2ZU6 B;  2CG2 A;  2UY1 B;  4MLP A;  1TEZ A;  3KSL A;  1EYH A;  2AWI A;  5ARG A;  2VTB B;  1D8E A;  5ENS D;  2XHE A;  2P2C P;  1OXJ A;  5G04 J;  3CLJ A;  4GML A;  2WQ7 A;  4DX1 A;  4IN3 B;  2X6F A;  3D9K A;  4I43 A;  4I2Z A;  4LNU D;  2EIJ E;  4J7W A;  4L23 A;  4U96 D;  2IO2 C;  4ACK A;  2A5E A;  3CQC B;  4EQF A;  4AV7 A;  4JHJ A;  4CGW A;  4HS2 A;  3ZUV B;  2L6B A;  2WXO A;  1IQR A;  4XKB A;  5AAR A;  3HXB A;  4JA9 A;  4L7T A;  2XEE A;  3PRE A;  3EHM A;  2J9Q A;  1KZO A;  3DXM G;  5FQ7 A;  4E6H A;  5J08 A;  3CK8 A;  4TRQ A;  3ZHE B;  3MKQ B;  1WDY A;  4V3I A;  4M7C A;  2LO6 A;  3HDX A;  2RFA A;  2XRY A;  4JVS A;  3SO8 A;  4TXP A;  1E8Z A;  2P9S G;  2WXR A;  2YQ8 A;  2ETC A;  4GTO A;  2RD0 A;  4EEC A;  3D9I A;  3VLE A;  4NRH B;  3ZPJ A;  1E8X A;  2B0O E;  3KD7 A;  5DBK A;  1NA0 A;  3IHY A;  5T8I A;  3LEW A;  2X6H A;  1S64 A;  3SBT B;  2CHW A;  4GB9 A;  3SQV A;  4F3V A;  1IXV A;  2XEH A;  2LSU A;  4AP2 A;  1N94 A;  3T8M A;  1NFI E;  5ENP D;  1PAQ A;  3OTN A;  2H6H A;  4CYM D;  2VTB A;  4NUR A;  4B93 B;  3FU6 A;  2ZGG A;  4BSZ B;  1HE8 A;  2J08 A;  1TR4 A;  2P9I G;  1SZ9 A;  3Q75 A;  5JJ6 A;  3ENE A;  3TGO A;  1TNY A;  4UWK A;  4N2Q A;  1OWP A;  5H7P A;  4Q94 A;  4XE0 A;  2QY7 A;  1HF8 A;  4K5A B;  3ESL A;  5BUZ A;  4C0E A;  3IXE A;  5LP0 A;  2XQ0 A;  4GTS A;  2XS8 A;  3LXU X;  3CK9 A;  1EDU A;  3JXJ A;  1EPU A;  3AS4 A;  4G24 A;  4GZ6 A;  4DLQ A;  2RG8 A;  5JMN D;  4A63 B;  3GW4 A;  2GRQ B;  2WXJ A;  3AG1 E;  5FWQ A;  4G26 A;  4CDR A;  2XCC A;  1PY1 A;  4I1A A;  4IYP A;  3SI5 A;  1JCS A;  3UUX A;  3SBS A;  1ZBP A;  3FDH A;  1LTX A;  3UPV A;  3LJ3 A;  4UI9 J;  5FZQ A;  5D0O D;  3CHS A;  3U4T A;  2XRZ A;  1U2V G;  3Q4A B;  1TNO A;  3FFL A;  3HG0 D;  3Q15 A;  2EIN E;  3E30 A;  4TUU A;  2R59 A;  1NZN A;  5B1B E;  1KPS B;  3AU4 A;  3UM3 A;  4EZJ A;  1B89 A;  3DWL G;  2LAH A;  2XGS A;  5EN5 D;  2V5F A;  1FCH A;  3FU3 A;  5CRV A;  2VGX A;  1WG0 A;  1S63 A;  3MYV A;  4RQI A;  3MV2 B;  4YVO A;  3UIN C;  5AQB A;  4K5B A;  4K03 A;  4GTV A;  4AOF A;  3PZ2 A;  4FC8 A;  1RZ4 A;  3UIO C;  2CFZ A;  3NF1 A;  3R9M A;  4B8C B;  3QKY A;  2XEV A;  3B7B A;  2V0P A;  3Q78 A;  4CT4 A;  5D66 A;  2V4H C;  5C2Y A;  5CCM A;  4AEZ C;  1DC2 A;  4GZ5 A;  2OND A;  2PZI A;  2CHZ A;  2LAI A;  4FHJ A;  5G55 A;  2X3M A;  2XZD G;  3FH5 A;  3RU0 A;  4O1O A;  1JPL A;  4PH4 B;  3AS8 A;  4ME2 A;  4YDY A;  1SW6 A;  2BKG A;  2BF0 X;  1JCQ A;  3RRM B;  3GZ2 A;  1TN8 A;  1BI8 B;  2KZT A;  1YYH A;  5KJK A;  4J6I A;  3DSU A;  4I1O B;  3PEU B;  5CEA A;  4EZL A;  1A5E A;  5LCW C;  2I6H A;  2VSX E;  5CHE E;  2WB2 A;  2IY0 C;  3FWV A;  3FU5 A;  1WM5 A;  3QOU A;  4BY6 A;  2DYS E;  1Z5S C;  4PS7 A;  4PS8 A;  3ESK A;  1FT1 A;  5FQ6 A;  2P9K G;  2LSV A;  4F1S A;  5KNG A;  1E7V A;  4DRX E;  1EF1 C;  3UI2 A;  3J5P A;  4G8K A;  3TXM A;  2OOE A;  3UIP C;  1JWG A;  2L6J A;  1H6P A;  5KJN A;  1TNU A;  4F7A A;  2CHX A;  4GAA A;  2VQ2 A;  1E90 A;  4GTP A;  3LDZ A;  3I4R B;  5CEC B;  4OAV B;  3D9P A;  4KMO A;  2YHE A;  5AAO A;  1OWN A;  4M3O A;  3FUJ A;  3FHE A;  4BEP A;  3FEY A;  4TV3 A;  4YND A;  3VTY A;  4C9B B;  1QBQ A;  3AJI A;  3CVW A;  3VTX A;  4CDN A;  3CVP A;  3CVV A;  5EKQ D;  3Q9N C;  5KCM A;  2OCC E;  3UQ3 A;  2OEV A;  3SFZ A;  3CVN A;  4YDE A;  3PUJ A;  3GYZ A;  3ZYK A;  4GYW A;  2XPI A;  1QNF A;  4OAU C;  1MYO A;  5IY5 E;  1Y6I A;  3TWT A;  3JUE A;  3E37 A;  3G2W A;  2GRR B;  1N4S A;  1P5Q A;  2P9U G;  3LVQ E;  5FZS A;  2VYI A;  2OVB A;  5HS0 A;  2F8Y A;  1HFA A;  4O6F A;  3L17 A;  3AG2 E;  3NZS A;  1IQU A;  4HBD A;  4WAF A;  2ETB A;  4U0Z A;  3PNL B;  1H2U A;  5FZR A;  3UT4 A;  3URZ A;  2WM9 A;  1SA4 A;  4DI4 A;  1N95 A;  3B7R L;  4UI9 K;  3FUF A;  1NP7 A;  4FLB A;  5CCL A;  5BXO A;  3NOC D;  2C2L A;  4N3A A;  4DX2 A;  3FP3 A;  1Y8M A;  1TJC A;  2X6I A;  4LRZ A;  3ZRH A;  3U9W A;  4BES A;  2QYU A;  2WXH A;  4ILI A;  3EHN A;  4ATZ D;  3UKU G;  3Q5M A;  4HB5 A;  1L5J A;  4P29 A;  4XI0 A;  2F8X K;  2WXM A;  3IKO B;  3CR3 A;  3FUL A;  4HVB A;  4HNA D;  2RKK A;  5B1A E;  2VSO E;  1XNF A;  2J4D A;  4GMJ A;  3MKR A;  3JYS A;  3ULY A;  4URK A;  4I17 A;  4K5C A;  1KT1 A;  2IJG X;  3FUM A;  2P58 C;  5ANL A;  1AWC B;  3FUH A;  4XX5 A;  2AJA A;  4G11 A;  2H6G A;  5T3R A;  4AVX A;  3BG0 B;  2PQR A;  4YDW A;  3W9F A;  4JA7 A;  4TUM A;  3C3O A;  3IHV A;  3SNX A;  5AQA A;  2R5S A;  1SA5 A;  1UOH A;  4HRN A;  4J8D A;  2DCP A;  4UWH A;  3CKC A;  4WNG A;  1Z3X A;  3HXC A;  2X38 A;  1ZU2 A;  5E75 A;  3MKQ A;  4GYY A;  4AM9 A;  3V2O A;  3FTU A;  2Y3A A;  3AU5 A;  2PM7 A;  4WWP A;  3PUK A;  4BX8 A;  4H7Y A;  4QQI A;  5A23 A;  2PNN A;  4NAC A;  5LFA A;  4ILH B;  3ZIM A;  4ILG A;  2BED A;  2OVF A;  3B7U X;  3RO3 A;  2E2E A;  1N11 A;  2XPY A;  2EIK E;  4KXK B;  2YNQ A;  2AXZ A;  4LEU A;  5BW8 C;  1O1S A;  3ASD A;  3G2T A;  3T5X A;  4ABN A;  1UG3 A;  4KT6 B;  1HX8 A;  3AS5 A;  3UXG A;  4AY6 A;  2HYZ A;  1OCZ E;  3CHQ A;  3CHP A;  3B13 A;  1N9A A;  2MHK A;  2KM4 A;  4GA2 A;  4UWF A;  3TAX A;  4U07 A;  2ETA A;  4J8S A;  4C48 B;  2KAT A;  3LVR E;  3K9I A;  2WXG A;  1K3Z D;  3U64 A;  5AQ9 A;  1H2T C;  3WXX A;  2IFU A;  1HH8 A;  4RG6 A;  3PZ1 A;  3FUD A;  3N71 A;  3C3R A;  4MRU A;  3ULE G;  4K0R A;  2WXN A;  3QWW A;  2GW1 A;  1V55 E;  3MX3 A;  4BWR A;  3WG7 E;  2GRN B;  3BU8 A;  1V54 E;  2AXV A;  4HI8 A;  3GZ1 A;  3ZVV A;  2DBA A;  4PUC A;  5ENR D;  4FLH A;  5KWD A;  1BI7 B;  1DVP A;  3RIB A;  2JEK A;  4WNF A;  1W3B A;  4DUI A;  4G23 A;  3TWU A;  1VDY A;  2AVP A;  3HRA A;  4KZ0 A;  2HR2 A;  5FIO A;  1PC2 A;  5EX3 A;  3D9O A;  2WXI A;  3D9J A;  2JAB A;  4FU3 A;  1ZB1 A;  4GTT A;  4HOR A;  4WWO A;  3I5P A;  3NB2 A;  1RW2 A;  2JLB A;  4CRW A;  1E96 B;  2I1K A;  1U3D A;  5LCW J;  3NZU A;  1TJF A;  2IOS A;  3JQ0 A;  4UQZ A;  3PVL A;  1LD7 A;  4B89 A;  3C3Q A;  4ANV A;  3LPZ A;  5LOZ A;  5JHA A;  2X6J A;  2R02 A;  2J07 A;  1G3N B;  4BT9 A;  1DCE A;  1U3C A;  3I3N A;  2HE0 A;  3DST A;  1DCQ A;  3E33 A;  2BTD A;  3OXL A;  4GA1 A;  2QZA A;  3FY4 A;  1D9S A;  3D9L A;  3G2S A;  3PS6 A;  3F6Q A;  4E85 A;  1O5M A;  1X81 A;  2DIW A;  2LNI A;  1N4P A;  2VGX B;  2DWZ A;  4L2L A;  4HOU A;  1HXI A;  3JUI A;  1JUQ A;  3PE4 A;  5EID A;  3G2U A;  4UWL A;  4KVO A;  2L9B A;  4EHM A;  4GZD A;  5AIJ A;  3KS2 A;  5CMW A;  2NXP A;  4LNB A;  1K8K G;  2EQX A;  1H6K A;  3Q7A A;  4I9E A;  3ZFW A;  4GZ3 A;  2VGE A;  4ZFH A;  4HRM B;  5J90 A;  2FUL A;  4AJW A;  3UM1 A;  4XKC A;  4HQD A;  3V2X A;  1YCS B;  1X5B A;  3CK7 A;  5D2M C;  4ANU A;  2KC7 A;  2L0T B;  3UM0 A;  2PM6 A;  4LNG A;  2EIL E;  4Q69 A;  3NBN B;  4U0U A;  4HLE A;  2WQH A;  3S7D A;  3ZHE A;  2XPZ A;  3L6A A;  5BV0 A;  2GRP B;  3QWV A;  1OCC E;  3CVX A;  3SHF A;  4RG9 A;  4XIF A;  5BPP A;  3BG1 B;  3I4G A;  5DIZ A;  1IHB A;  4MS6 A;  1NI1 A;  5ENO D;  4EBA G;  1UW4 B;  4GCN A;  3HYM B;  1MJ0 A;  2GRO B;  3HXF A;  3OAW A;  4TXR A;  3CVL A;  1HG5 A;  1H0A A;  2IOL A;  5FQ4 A;  5AYW D;  2J49 A;  3DXK G;  3S7B A;  2IEJ A;  3SGH A;  3R7Q A;  4X8Q A;  4APO A;  2Y0B G;  3L13 A;  4FA6 A;  5KJM A;  3O48 A;  4B0Z A;  1E8Y A;  4N5C A;  2ZGD A;  3AG3 E;  2QC9 A;  5CED B;  4DI3 A;  4FJZ A;  2FF4 A;  1MX4 A;  1BPO A;  1Z6T A;  3TWV A;  3SZ7 A;  3AG4 E;  3ASF A;  4J8F A;  5E76 A;  2J8S D;  5G04 C;  2DVW A;  2VSY A;  3SF4 A;  4DPR A;  5G2N A;  2V4L A;  5AJL A;  3DRA A;  2LUH A;  3ZXP A;  3HXE A;  1GW6 A;  2V8S E;  3PNT B;  2V5Q C;  3KEZ A;  3TWQ A;  1N54 A;  2AXU A;  3PDN A;  4J0U A;  4GPM A;  3UTM A;  1E8W A;  1N4Q A;  1MZC A;  4JB8 P;  3ASO E;  4B8A A;  1MX2 A;  3ML8 A;  1O1T A;  3DEP A;  3IV0 A;  3ZYQ A;  3ZN3 A;  4Y6C A;  3MEK A;  4MKT A;  3ZNG A;  1LF8 A;  4G2V A;  1FT2 A;  2FO7 A;  1MQS A; 
#chains in the Genus database with same CATH homology
 1UN9 A;  3DPD A;  4J8E A;  2LSU A;  5T3R A;  4JEU A;  4B94 A;  4AP2 A;  1FVF A;  3QAR A;  4I1M A;  4AVX A;  4A3T A;  1HZ4 A;  3L22 A;  3BG0 B;  2PQR A;  3T8M A;  4JA7 A;  3E4B A;  1PAQ A;  3OTN A;  4U63 A;  3R7R A;  3IHV A;  3FU0 A;  4AY5 A;  2VTB A;  3SNX A;  3FH8 A;  2IF4 A;  4NUR A;  4DLO A;  2X6K A;  3QJZ A;  3FU6 A;  3UT8 A;  1ELW A;  4JHK A;  2R5S A;  4U8H A;  3B7T A;  1HE8 A;  2J08 A;  4JC8 A;  2CG3 A;  4CEM A;  4J8D A;  2KZT B;  4JXT A;  2DCP A;  4UWH A;  1SZ9 A;  5JJ6 A;  5AEN A;  3ENE A;  3CKC A;  3TGO A;  4I9C A;  4WNG A;  3FUK A;  3CST A;  2J09 A;  4UWK A;  1Z3X A;  4N2Q A;  1OUV A;  1OWP A;  4A1S A;  4Q94 A;  4HXI A;  4XE0 A;  2X38 A;  3UX4 A;  1ZU2 A;  4JEH A;  2QY7 A;  3DBS A;  5E75 A;  3MKQ A;  1HF8 A;  3SD5 A;  4JZY A;  4GYY A;  4AM9 A;  3ESL A;  3LY7 A;  3FTU A;  2Y3A A;  2WXP A;  3AU5 A;  5BUZ A;  4C0E A;  2PM7 A;  4L2Y A;  5LP0 A;  2XQ0 A;  5JJT A;  3LXU X;  3PUK A;  4UQY A;  4WWP A;  3RJV A;  4BX8 A;  3CK9 A;  3CKB A;  3EDT B;  4GCO A;  4H7Y A;  1EDU A;  1OWL A;  4LER A;  5A23 A;  3CVQ A;  1EPU A;  3APF A;  4NAC A;  5LFA A;  4ILH B;  3AS4 A;  3D3M A;  4ILG A;  4G24 A;  3ZIM A;  2OVF A;  4GZ6 A;  3B7U X;  3RO3 A;  4DLQ A;  2E2E A;  2RG8 A;  3IBE A;  1WY6 A;  2MOW A;  3RK6 A;  3CGH A;  2XPY A;  4XI9 A;  2WXK A;  4FHK A;  2KCK A;  3GW4 A;  3MGB A;  2WXJ A;  3G2V A;  4ANW A;  4EBA A;  4KXK B;  2YNQ A;  2AXZ A;  4LEU A;  3CVU A;  5BW8 C;  5FWQ A;  4G26 A;  3HIZ A;  5T4Y A;  3ASD A;  4UWG A;  3ULQ A;  3VLD A;  4CDR A;  3G2T A;  4ACL A;  3T5X A;  4ABN A;  3FTY A;  1UG3 A;  4HOS A;  2XCC A;  1PY1 A;  4I1A A;  4IYP A;  3SI5 A;  4KT6 B;  1HX8 A;  2FI7 A;  5CMY A;  3UUX A;  2XGM A;  3AS5 A;  3SBS A;  3CV0 A;  1ZBP A;  2WXQ A;  4W9R A;  4AY6 A;  3LKU A;  2HYZ A;  3FDH A;  5HI7 A;  3CHQ A;  3UPV A;  3CHP A;  3JCK C;  3LJ3 A;  4GYO A;  1S0P A;  4JHR A;  4UI9 J;  1HS6 A;  3B13 A;  3RKV A;  5FZQ A;  2WMN A;  5D0O D;  2MHK A;  2KM4 A;  4GA2 A;  4UWF A;  3TAX A;  3CHS A;  4U07 A;  4KVM A;  3U4T A;  4J8S A;  2XRZ A;  3KAE A;  3Q4A B;  3FFL A;  3EIJ A;  2KAT A;  2WXF A;  3LVR E;  5ARF A;  3Q15 A;  3K9I A;  1FVH A;  2WXG A;  3U64 A;  4TUU A;  2R59 A;  4CGV A;  5LCW C;  3QDN A;  4GPK A;  2PL2 A;  5LX8 A;  1NZN A;  4KZC A;  1H2T C;  2WVI A;  1DNP A;  1UJJ A;  3WXX A;  5FQ8 A;  2IFU A;  4WUY A;  1HH8 A;  4RG6 A;  3FTV A;  3FUD A;  3AU4 A;  3N71 A;  4EZJ A;  1B89 A;  3JQ1 A;  2I9C A;  3FEX A;  4MRU A;  4K0R A;  1KLX A;  2WXN A;  2LAH A;  2E0I A;  3QWW A;  2XGS A;  2C0L A;  2GW1 A;  2V5F A;  3MX3 A;  4H7X A;  4BWR A;  3D9N A;  3ZYL A;  4D10 C;  1FCH A;  4HOT A;  4N3B A;  3FU3 A;  2AXV A;  3RRN B;  2Y4T A;  2VGX A;  3GZ1 A;  3ZVV A;  1YA0 A;  2DBA A;  3LCA A;  3S2A A;  4PUC A;  3MYV A;  3PEV B;  4FLH A;  2ILR A;  3CQG B;  1DVP A;  3RIB A;  4N3C A;  4UI9 C;  2R17 C;  3RO2 A;  3EIQ C;  2JEK A;  3MV2 B;  4ATG A;  3ZEF A;  4YVO A;  4EZK A;  4WNF A;  3UMV A;  1W3B A;  4L1B A;  4LUN U;  2BUG A;  4G23 A;  1VDY A;  2AVP A;  4K03 A;  3MA5 A;  3MV3 B;  4KZ0 A;  4AOF A;  4FC8 A;  1OWM A;  3ZXS A;  4U04 A;  2HR2 A;  2YHC A;  1PC2 A;  5EX3 A;  3D9O A;  2OV8 A;  2WXI A;  3D9J A;  5JHB A;  3O4Z A;  3QNK A;  2GGF A;  4FU3 A;  2YIN A;  4HOR A;  4WWO A;  2CFZ A;  3I5P A;  4RSY A;  3NF1 A;  2GRM A;  1SZA A;  4I6E A;  4B8C B;  2JLB A;  3QKY A;  4CRW A;  2XEV A;  4FJY A;  3NQP A;  1E96 B;  3ZYM A;  5FT9 A;  2V0P A;  4PS3 A;  4BTB A;  2I1K A;  1U3D A;  4C0M A;  2NSZ A;  2QFC A;  4CT4 A;  1XGW A;  4I2W A;  5LCW J;  4BTA A;  2VJ8 A;  3NZU A;  1TJF A;  2IOS A;  3JQ0 A;  4UQZ A;  4CDM A;  3PVL A;  5C2Y A;  5BNW A;  3Q49 B;  5CCM A;  4AEZ C;  4APF A;  3GZS A;  3CHM A;  1HO8 A;  4GZ5 A;  4B89 A;  2OND A;  5KJL A;  4ANV A;  3ZW3 A;  2PZI A;  2CHZ A;  3LPZ A;  3LY9 A;  2LAI A;  4HFG A;  4FHJ A;  5G55 A;  5LOZ A;  2X3M A;  5JHA A;  5BT1 A;  4CT0 A;  2J4B A;  1HU3 A;  3MZL B;  4UQX A;  3FH5 A;  2X6J A;  3RU0 A;  2J07 A;  3U66 A;  3P2B A;  4BT9 A;  1JPL A;  4JL0 A;  1U3C A;  3I3N A;  3ONL A;  4PH4 B;  3CEQ A;  3QAQ A;  4I6G A;  3TG5 A;  2IU1 A;  3AS8 A;  1QZ2 A;  4GU5 A;  2Q7F A;  3ASH A;  4ME2 A;  2BTD A;  2Y4U A;  3OXL A;  4GA1 A;  4A1G A;  4IUL A;  2BF0 X;  1UN8 A;  3LYA A;  3GZ2 A;  4GZC A;  3RRM B;  3FY4 A;  2WPV A;  3D9L A;  3B7S A;  2KZT A;  3G2S A;  3PS6 A;  5KJK A;  3FTZ A;  4E85 A;  5JJ7 A;  2DIW A;  4J6I A;  3FUI A;  1UJK A;  2LNI A;  3TXN A;  4N39 A;  5M72 A;  2VGX B;  5A6C A;  4G25 A;  4I1O B;  3PEU B;  1HG2 A;  1Z3Y A;  4L2L A;  3OXG A;  4HOU A;  4EZL A;  1HXI A;  4KYO B;  3JUI A;  1ELR A;  1JUQ A;  2I6H A;  2VSX E;  3PE4 A;  5CHE E;  4HOQ A;  4U0S A;  3G2U A;  3FWV A;  4BX9 A;  3T5V A;  3FU5 A;  1WM5 A;  3HVE A;  3QOU A;  3CIA A;  4BY6 A;  3APD A;  4UWL A;  4PS7 A;  4PS8 A;  4KVO A;  2PQN A;  2A4Z A;  2L9B A;  3ESK A;  4A3V A;  3OXF A;  3MJW A;  4GZD A;  5FQ6 A;  5AIJ A;  1N52 A;  2LSV A;  3ASG A;  2AW6 A;  4F1S A;  4GA0 A;  3FH7 A;  1E7V A;  4RVB A;  3KS2 A;  5FJY A;  4BSX A;  2XGO A;  2WQ6 A;  5HQ8 A;  4CCA A;  4FUL A;  4FAD A;  2KCV A;  4NQ0 A;  5CMW A;  1EF1 C;  3TXM A;  1H19 A;  4OYS A;  2NXP A;  2OOE A;  2M63 A;  3QB2 A;  1JWG A;  2L0I A;  3TJP A;  2L6J A;  5KJN A;  1IHG A;  2EQX A;  5G05 J;  1H6K A;  1NA3 A;  3Q47 B;  3ZGQ A;  4F7A A;  2ION A;  5EDS A;  2CHX A;  4GAA A;  4YVQ C;  3CVY A;  2I2O A;  2VQ2 A;  1E90 A;  2VGY A;  3FUN A;  2CFU A;  4I9E A;  3ZFW A;  4GZ3 A;  3LDZ A;  3I4R B;  5J90 A;  3D9P A;  2FUL A;  4JW1 A;  4AJW A;  5D0Q D;  4KMO A;  4A55 A;  1A17 A;  2YHE A;  2FEZ A;  4XKC A;  3P1U A;  3L08 A;  1OWN A;  3R9A B;  2XCB A;  3FUJ A;  4M3O A;  1X5B A;  1INZ A;  3FHE A;  3LY8 A;  3RRU A;  3CK7 A;  3FEY A;  4TV3 A;  3QC1 A;  4YND A;  5EX0 A;  2UWJ G;  3FTX A;  3VTY A;  4ANU A;  4ANX A;  2KC7 A;  3FTS A;  3PE3 A;  2L0T B;  2UY1 A;  4C9B B;  4G1T A;  3U3W A;  1E7U A;  3CVW A;  2PM6 A;  1ELK A;  3VTX A;  4CDN A;  3LS8 A;  4EPZ A;  4Q69 A;  3CVP A;  4I6J A;  4WWN A;  4LCT A;  4FP7 A;  5C1D A;  3CVV A;  4U0U A;  4HLE A;  3HHM A;  2WQH A;  3FUE A;  5ENN A;  1JWF A;  5EKQ D;  5AJD A;  2FBN A;  5FTP A;  3S7D A;  5KCM A;  3ZHE A;  2XPZ A;  3L6A A;  1KT0 A;  1WAO 1;  4QFV A;  4R7L A;  3TG4 A;  3UQ3 A;  3SFZ A;  3CVN A;  5BV0 A;  4PDX A;  3PUJ A;  1QQE A;  3QWV A;  4OVU A;  3GYZ A;  3ZYK A;  4GYW A;  5G05 C;  2XPI A;  3CVX A;  1QNF A;  2ZU6 B;  2CG2 A;  3SHF A;  2UY1 B;  3APC A;  4MLP A;  1IYG A;  3IEG A;  5A7D B;  4RG9 A;  1TEZ A;  4XIF A;  1Y6I A;  5BPP A;  3BG1 B;  1H2V C;  3I4G A;  1EYH A;  1SQM A;  5DIZ A;  4F53 A;  1MQS A;  2AWI A;  4MS6 A;  5ARG A;  3PZD A;  4EBA G;  1UW4 B;  2VTB B;  4GCN A;  3G2W A;  2XHE A;  3HYM B;  5G04 J;  3CLJ A;  4GML A;  2WQ7 A;  3OAW A;  1P5Q A;  4IN3 B;  2WB2 A;  3S7F A;  3CVL A;  1HG5 A;  3QWP A;  2X6F A;  3C98 A;  3D9K A;  4I43 A;  1H0A A;  2IOL A;  4I2Z A;  5FQ4 A;  5AYW D;  2J49 A;  3L54 A;  3LVQ E;  4L23 A;  3S7B A;  5FZS A;  2IQC A;  3SGH A;  4ACK A;  3R7Q A;  3CQC B;  2GRL A;  2VYI A;  2OVB A;  4APO A;  3L13 A;  4EQF A;  3EJN A;  4FA6 A;  4AV7 A;  4JHJ A;  5KJM A;  3O48 A;  4CGW A;  3PRZ A;  4HS2 A;  4B0Z A;  3CHO A;  1E8Y A;  1HFA A;  4O6F A;  3BEE A;  3L17 A;  4N5C A;  2WXO A;  1IQR A;  4XKB A;  3CHR A;  1MHQ A;  3NZS A;  1IQU A;  2KCL A;  2WXL A;  4WAF A;  4DI3 A;  4WNE A;  2NC9 A;  4FJZ A;  4BT8 A;  4U0Z A;  3PNL B;  2FF4 A;  1H2U A;  5FZR A;  4XZ4 A;  4JA9 A;  3UT4 A;  3URZ A;  4L7T A;  2WM9 A;  4Q96 A;  4WND A;  4DI4 A;  1BPO A;  1Z6T A;  3SZ7 A;  3B7R L;  4UI9 K;  4AXH A;  3PRE A;  3EHM A;  3FUF A;  3ASF A;  4J8F A;  4OVV A;  4BFR A;  2J9Q A;  5E76 A;  1NP7 A;  4FLB A;  5FQ7 A;  4DK5 A;  3ML9 A;  5CCL A;  5G04 C;  4E6H A;  2C2L A;  2VSY A;  4N3A A;  3FP3 A;  1Y8M A;  5J08 A;  3CK8 A;  2HM8 A;  3D9M A;  4IRU A;  3SF4 A;  4Y6W A;  4TRQ A;  3ZHE B;  4DPR A;  1TJC A;  5G2N A;  4N2S A;  3MCX A;  3TL5 A;  2V4L A;  3MKQ B;  4V3I A;  2X6I A;  5AJL A;  2LO6 A;  4LRZ A;  3ZRH A;  3HDX A;  3U9W A;  2XRY A;  2WXH A;  4JVS A;  4ILI A;  3EHN A;  1GW6 A;  2V8S E;  3PNT B;  3Q5M A;  4P29 A;  1L5J A;  4XI0 A;  3KEZ A;  5BV1 A;  1E8Z A;  2WXR A;  2HO1 A;  2WXM A;  4AIF A;  4DJA A;  3IKO B;  2YQ8 A;  1N54 A;  2VSN A;  3CR3 A;  2AXU A;  3CSF A;  3PDN A;  3FUL A;  4J0U A;  3VLF A;  2RD0 A;  4HVB A;  1E8W A;  3PH0 C;  4KBQ A;  4EEC A;  3L16 A;  4B8A A;  4XX5 A;  2VSO E;  5ANR A;  3ML8 A;  1XNF A;  2J4D A;  3D9I A;  3QK0 A;  4GMJ A;  3MKR A;  3VLE A;  3FTW A;  4NRH B;  3JYS A;  3ZPJ A;  1E8X A;  3IV0 A;  2I1J A;  3ONK A;  3KD7 A;  4URK A;  4I17 A;  5DBK A;  3ZYQ A;  3ZN3 A;  1NA0 A;  1KT1 A;  2A5U A;  4Y6C A;  3IHY A;  3MEK A;  4MKT A;  2WMO A;  3S7J A;  3UT7 A;  2IJG X;  1LF8 A;  5T8I A;  3FUM A;  3LEW A;  2X6H A;  3HVE B;  2P58 C;  4G2V A;  3SBT B;  1OWO A;  2CHW A;  5ANL A;  4GB9 A;  2MRI A;  4F3V A;  2FO7 A;  3FUH A;  2C0M A;  4JPS A;  4G11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...