3WXXA

Crystal structure of a t3ss complex from aeromonas hydrophila
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
150
structure length
150
Chain Sequence
EPAIEAFLQDGGTLAMLNDVSTDTLEQLYTLGFNQYHAGKHDEAHKIFQALCVLDHYEARFFLGLGACRQALGQFRLAIDSYSYGAMMDLQEPRFPFHAAECLLQLGELEGAESGFHSAQLLAAAKPELAELAARAGIMLEVVKTKKDME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AcrH
publication title Structure of AcrH-AopB Chaperone-Translocator Complex Reveals a Role for Membrane Hairpins in Type III Secretion System Translocon Assembly
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Membrane protein/chaperone
total genus 55
structure length 150
sequence length 150
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3wxxA00
1WM5A 3U3WA 2FEZA 4XIFA 3UQ3A 4H7XA 3CVQA 3LY7A 3ASFA 2OOEA 3UUXA 4GCOA 4BTAA 4G1TA 3URZA 5KJKA 2LSUA 4AM9A 3RKVA 1TJCA 1Y8MA 2Y4TA 3ZHEA 2XGMA 2PQRA 5G04C 5HQ8A 1PC2A 3QKYA 5DBKA 3O48A 3CEQA 3BEEA 3ZHEB 4GYWA 2VQ2A 4Y6CA 1HH8A 5FZRA 1E96B 5M72A 4IN3B 5CHEE 1QQEA 5FZQA 3AS5A 4N39A 3LCAA 3S7BA 3MKRA 5G05C 3Q47B 2WQHA 3GYZA 3ESKA 5ARGA 2PZIA 3RO3A 4N3BA 4HOTA 5AYWD 3N71A 4HORA 2VGYA 3GZ2A 3EDTB 4B94A 3FFLA 4A1SA 5HI7A 4AIFA 4ME2A 3ULQA 5C1DA 3OXFA 2IF4A 2C0LA 1WAO1 5KJLA 3ZPJA 4EQFA 2VSYA 5EX3A 3S7FA 5JJ7A 5CCMA 1FCHA 4I2ZA 2XEVA 1NA0A 5BT1A 4WNEA 1A17A 2VSNA 5JJTA 4GYYA 1QZ2A 4JA7A 5ARFA 5D0QD 2HYZA 3CK8A 3MV3B 2P58C 4RG9A 4G24A 1ELRA 3KAEA 1NZNA 1OUVA 3MA5A 2VGXA 4JA9A 2WPVA 4XI0A 4GA2A 5A6CA 4XI9A 2VGXB 2GW1A 2DBAA 1KLXA 3QOUA 3RO2A 3Q4AB 4GPKA 3LY8A 3FP3A 2HR2A 5FTPA 3CVNA 2R5SA 4G26A 3TG4A 1IHGA 4RG6A 2UY1A 3LY9A 5LCWJ 3TGOA 2UY1B 4UQXA 4N2QA 1ZBPA 3KS2A 3WXXA 2E2EA 2FBNA 3TG5A 4N5CA 3LYAA 3SZ7A 3MV2B 2IFUA 2BUGA 4J8FA 3CVPA 2JLBA 2ONDA 2YHCA 4AY6A 2NC9A 4AY5A 3AS8A 3CKCA 3FWVA 4GCNA 5DIZA 4J8DA 3ZN3A 5BW8C 4NQ0A 4CDRA 5KJNA 3ZFWA 3GW4A 2KCKA 4U0SA 4BT8A 4APOA 4U0UA 3OXGA 4G25A 2VYIA 2UWJG 3IEGA 4F3VA 4HOUA 2KC7A 4BTBA 4NRHB 3PE4A 4CGVA 5FZSA 3UPVA 3SF4A 1KT0A 1NA3A 3JYSA 4N2SA 3MEKA 2FO7A 2J9QA 4HOQA 3CK7A 5EX0A 4UI9C 3CVLA 5G04J 4KXKB 2PL2A 3OXLA 1ELWA 3QWWA 2XGSA 4J8EA 4LEUA 1W3BA 2KATA 5BNWA 2KCLA 2XGOA 3ASDA 4GZ3A 3S7JA 5KJMA 4YNDA 3QDNA 2LNIA 4BWRA 5G05J 3K9IA 4UI9K 4ABNA 4I17A 4J0UA 4WNDA 4KBQA 1HXIA 3ZGQA 3KD7A 3VTYA 5D0OD 2FF4A 2FI7A 2C0MA 3LPZA 4W9RA 3LKUA 3R9AB 4I2WA 2PQNA 4UQYA 2I6HA 2C2LA 4G23A 3HYMB 4KYOB 4WNGA 1B89A 3CK9A 4N3CA 5FJYA 4G2VA 1HZ4A 2L6JA 4HOSA 2HO1A 4JHRA 3GZ1A 2LSVA 1XNFA 4WUYA 4BT9A 4U0ZA 4GZ6A 2V5FA 2MHKA 4UQZA 1YA0A 1IYGA 3CV0A 5JJ6A 3QWPA 3CKBA 4UI9J 4H7YA 4U04A 2XPIA 3RJVA 3Q15A 2KCVA 5LCWC 2QFCA 1P5QA 3ASHA 4GA0A 4GA1A 3Q5MA 2YQ8A 2AVPA 3ASGA 3S7DA 2XCBA 2Y4UA 3QWVA 3RU0A 4YVQC 5A7DB 3VTXA 4Y6WA 4JL0A 4GZ5A 4O6FA 3U4TA 3PDNA 5EKQD 4U07A 4I9EA 4CGWA 3E4BA 5CCLA 3AS4A 2XCCA 4YVOA 3NF1A 1ZU2A 2Q7FA 4I9CA 3TAXA 4I1AA 3PE3A 4WNFA 4GYOA 3RIBA 3Q49B 1KT1A 4N3AA 5FT9A
chains in the Genus database with same CATH superfamily
1Q2ZA 4L2YA 4L2LA 4PS3A 3UQ3A 3QNKA 4A1GA 5FINA 2X6HA 3UUXA 4ZFHA 3DBSA 4DX2A 3D3MA 4Q94A 2LSUA 2MRIA 3HG0D 1Y8MA 4XKCA 3ZHEA 3GZSA 1HF8A 3QK0A 3FEYA 4GYWA 4B8CB 2PNNA 5FZRA 1E96B 3HVEA 3MGBA 4MS6A 4IN3B 1SA4A 5CHEE 1QQEA 3TWTA 4N39A 3S7BA 4KVMA 3KEZA 4K5CA 3I3NA 2A4ZA 1OWMA 4XZ4A 1UJKA 3GYZA 3ESKA 4BSXA 5ARGA 4DLOA 2LXLA 4QQIA 3EDTB 4A3VA 5AQ9A 3B13A 4I1MA 1TNBA 1Z5SC 4ME2A 4GZCA 2WM9A 3CLJA 2IF4A 2C0LA 5G2NA 4WWOA 1MX4A 5BV1A 2IOLA 5HS0A 2JABA 5ENSD 3FU3A 4JZYA 2CFUA 2KXPC 4CT0A 1TJFA 4I2ZA 3PRZA 5B3SE 4M7CA 3HRAA 1A17A 5T8IA 4IRUA 3PNLB 5JJTA 1X81A 5ARFA 3FH7A 4DI3A 2CG2A 4G24A 1ELRA 3KAEA 3CVYA 3MA5A 2VGXA 3CHQA 3PVLA 2WPVA 2CHXA 4GA2A 3BQOA 1IQRA 3B7BA 2I2OA 1LTXA 3TJPA 2DBAA 1INZA 5CERB 1PY1A 4GPKA 2P9IG 3BU8A 4TXRA 3CVNA 1X5BA 3TG4A 4L9PA 1YYHA 1S64A 2UY1A 3C72A 1ZB1A 2WXIA 3NB2A 4HLEA 3APFA 3DPDA 4N2QA 2XZTG 2YINA 2H6IA 2XPYA 3TG5A 2OCCE 4IULA 3V2XA 3PZDA 3NOCD 4NURA 2L0IA 4U95D 4RVBA 5AJLA 2IFUA 4U8VD 4CRWA 3C3RA 5ANLA 3SQVA 4YDWA 3IXEA 3G2SA 3CVPA 4A55A 2JLBA 4FC8A 4GCNA 1EF1C 4KVOA 5BW8C 3G2TA 4P29A 2IU1A 2IONA 3D9OA 5KJNA 2DCPA 3SBTB 4APOA 3OXGA 3ZRHA 2KZTB 1HS6A 1K8KG 5FQ6A 5FZSA 1E8ZA 1NA3A 3ZXSA 3JYSA 4I6GA 4MLPA 1AWCB 2F37A 3EJNA 3TWWA 2WXMA 3SGHA 1FVFA 4RQIA 4GTVA 4YDEA 1D9SA 3CVLA 4M3OA 4GZDA 2PL2A 3OXLA 2XRZA 1JCSA 1BI7B 4J7WA 1TYQG 2IY0C 4FA6A 2KATA 5BNWA 4TRQA 4YNDA 2DZOA 4ABNA 4UI9K 3R7QA 4K5AB 3EIQC 5AQBA 4IYPA 4ANVA 3VTYA 4GB9A 4FULA 5D0OD 3AJIA 2FF4A 2ETCA 3EHNA 3UMVA 4W9RA 3LKUA 4HQDA 4HFGA 5EIDA 1UG3A 2PQNA 5JHBA 1VDYA 2L0TB 2I6HA 2HM8A 3P1UA 4DX5D 1E90A 1MZCA 3LXUX 4I6JA 3U66A 3TWXA 5FJYA 3Q78A 3VLFA 5ENRD 4G2VA 2L6JA 2HO1A 3GZ1A 3UTMA 1OY3D 1OCCE 4PS7A 1XNFA 4U0ZA 4GZ6A 4CYMD 2I1JA 2X3MA 3CV0A 1OT8A 3MYVA 3S2AA 4FHKA 3V79K 1OCZE 2ZIRA 3HVEB 3QWPA 3FUHA 4FP7A 2ETBA 3CKBA 3G2VA 3UM2A 4TXQA 2XPIA 3RJVA 2BTDA 1IHBA 2P9PG 2QFCA 1N54A 1UN8A 3ABKE 3QJZA 5D2MC 3CHSA 1HX8A 3T9KA 4EZJA 2Y4UA 3QWVA 4CCAA 1UOHA 3HXDA 1EYHA 1QBQA 4LNBA 4JB8P 3D9MA 3TXNA 2A5EA 3ZYKA 3IHYA 3AAAC 4QFVA 3RRUA 3L54A 3PDNA 3FUIA 3B7SA 3MKQB 3RAUA 4HI8A 2WQ6A 4JD2G 1ZU2A 2XEHA 3UT4A 3FU5A 2Q7FA 3DSSA 1FT1A 2V4LA 4I9CA 3PE3A 4WNFA 2ZXWE 1BLXB 4BFRA 3RIBA 1H2VC 2H6GA 4AOFA 1KT1A 3DPYA 1WM5A 3L17A 4U7EB 3ULEG 1OWLA 2X6KA 4CZ2D 4Q96A 3CVQA 1WG0A 3D9JA 4O1OA 5LOZA 3E33A 3BUAA 4HBDA 2Y4TA 2XGMA 3W9FA 1N94A 5HQ8A 1PC2A 4C9BB 3E32A 1JWFA 3ZKJA 3BEEA 1MJ0A 4DJAA 5KNHD 3UT8A 3B7TA 5IY5E 5AJDA 3ML9A 2AWIA 3V31A 4F7AA 2F8YA 2LAHA 5J90A 5G05C 5KBAA 4G8LA 3Q73A 2PZIA 4N3BA 2AXVA 5CBNA 5T3RA 2VGYA 1H2UA 3T5XA 3JUEA 3FFLA 4U8YD 1KPSB 2EIJE 5HI7A 1Z3XA 3FTUA 4OAVB 4Z68A 3ZPJA 5EX3A 4C0EA 4XX5A 2P2CP 1LD8A 2HE0A 5CCMA 3SD5A 1DCEA 3U9WA 3UM3A 3OAWA 5ENPD 5A23A 2JEKA 2QYJA 4WNEA 3FULA 2OVFA 3SY2A 2E0IA 2VSNA 4UWKA 4BETA 3D9IA 2FULA 3CVWA 2L9BA 1JWGA 5KCMA 4FJZA 3Q7AA 4DLQA 3CK8A 1GW6A 2LXMA 4HRLA 4G8KA 4JA9A 3SNXA 3EHRA 4XI0A 4U8HA 2DZNA 5A6CA 4ANUA 5ENTD 3AG1E 1LF8A 2IEJA 3ZEFA 2WXKA 3RO2A 5FTPA 4LUNU 1OWNA 1N4QA 4G26A 3ONLA 2KM4A 2CG3A 2OEWA 3TWQA 4F1SA 2DYRE 2R02A 3EHMA 4B93B 3TGOA 4UQXA 1JCRA 1ZBPA 3IBEA 4F53A 3KS2A 1TNUA 2DYSE 4PS8A 3ZNGA 4BESA 4HB5A 1SQMA 3MV2B 2WVIA 1V54E 3RRNB 3U64A 4J8FA 3PZ3A 1AP7A 5AAOA 3MCXA 2GRMA 2ONDA 2YHCA 4UWLA 2NC9A 3ENEA 4JVSA 2Y0BG 1HO8A 3FWVA 3LDZA 3PEUB 4O60A 5B1AE 4LNGA 3ZFWA 3FHEA 4XE0A 4MKTA 4BT8A 1ELKA 1MHQA 3L13A 4G25A 2P9SG 2VYIA 2UWJG 2CFZA 3ASNE 1EDUA 4F3VA 3L08A 3PS6A 3PE4A 4X8QA 4FJYA 4CGVA 2VTBB 1WDYA 3UPVA 3C3OA 2BEDA 4DX7D 4GTQA 4BX8A 3MEKA 2FO7A 2R59A 4JHKA 5EX0A 1UJJA 4K0RA 3CVXA 4KXKB 4U63A 3TWRA 2WXPA 3RK6A 5FIOA 3BG0B 4JXTA 1DNPA 4XEIG 2XGSA 1W3BA 4LERA 1DVPA 1NFIE 3S7JA 3UXGA 3QDNA 2WXQA 2LNIA 3B7RL 3K9IA 4WNDA 2DWZA 2RFMA 2CHZA 3ZGQA 3PNTB 2FI7A 2C0MA 2EIME 4I43A 3R9AB 3ZVVA 1D8EA 4UQYA 2RFAA 1E7UA 1FT2A 1TNZA 3UIOC 4G23A 4KYOB 3CK9A 5CRUA 2NYJA 3LS8A 3L6AA 1E8WA 2IO3C 4WUYA 3FU0A 2RG8A 4BT9A 5B1BE 2MHKA 1OXJA 5BXUA 3O4ZA 3L9TA 1MX2A 4K03A 3DSVA 3W9GA 4V3IA 3SBSA 3FU6A 3C5RA 4H7YA 2QY7A 2R17C 2V5QC 3SFXA 4J8YA 5CMYA 3Q15A 3ZYQA 3ZIMA 3EIJA 3PZ2A 5JA4D 5LCWC 5JMND 1HG2A 3CR3A 4GA0A 4GTSA 1U3DA 1QNFA 5T4YA 2AVPA 3CHRA 3P2BA 4F1PA 3HXFA 2AW6A 2XCBA 4HXIA 5H7PA 4YVQC 4HI9A 1V55E 3AG4E 4AJWA 2IO2C 4UWFA 3T8MA 4ILHB 4I9EA 1Z6TA 3E4BA 5CCLA 3AS4A 2WMOA 4I6EA 3T8KA 2L6BA 3D9LA 4GYOA 5CEDB 2GRQB 2YHEA 1H6KA 1FPPA 3Q49B 4ILGA 2BKKB 2F0YA 1LD7A 2FEZA 4XIFA 3G2WA 3JQ1A 4JPSA 2LUHA 3AG2E 3LY7A 3ASFA 2OOEA 4PH4B 3C3QA 4LNUD 4PUCA 4G1TA 4PDXA 4HRNA 3URZA 5KJKA 3ZYLA 3J5QB 4AM9A 3RKVA 1TJCA 3FH5A 2P9UG 5G04C 1SA5A 3QKYA 3FUMA 5DBKA 5BXOA 3O48A 5AARA 3ZHEB 3EU9A 4Y6CA 1L5JA 4Q69A 1O1TA 1FVHA 5FZQA 3AS5A 2IJGX 3MKRA 1O1RA 5ENOD 4HVBA 3DSTA 2OVBA 2OEVA 2WQHA 2VJ8A 3UIPC 3X2QE 3HXCA 3RO3A 4EPZA 4HOTA 4A3TA 2PM7A 3GZ2A 3JCKC 3Q75A 4B94A 3TWSA 4LG6A 4AIFA 4HLLA 3ULQA 4OVUA 1WAO1 5KJLA 2AXZA 4EQFA 2VSYA 4A63B 1IKND 4U96D 3ML8A 3S7FA 4HS2A 1IXVA 2V4HC 1N0QA 1FCHA 2R2LA 3FTXA 3UINC 2XEVA 3FUNA 4FHJA 4L1BA 2PM6A 2KBXA 5ITZF 4F6RD 5J08A 5AQ7A 2VSOE 1H6OA 4TUMA 3I4RB 2WXLA 4GYYA 3LJNA 4JA7A 3FTZA 4WWPA 2Y1LE 1N4PA 4UWGA 1NZNA 1OUVA 2BF0X 1NI1A 4E6HA 3I4GA 3Q9NC 1E7VA 4GU5A 2VGXB 2ZGGA 2GW1A 1OWPA 3JXIA 2XPZA 1TN8A 1N0RA 3QOUA 4KT6B 3AU5A 3Q4AB 2XZDG 3IKOB 1QYMA 2HR2A 3PEVB 1NP7A 3FTSA 3JUIA 2P9LG 1O5MA 3JXJA 4JC8A 3SHFA 5LX8A 2J09A 3NZSA 3FTYA 2EILE 5AQAA 4BEPA 4DPRA 2ZISA 1OWOA 3F6QA 2UY1B 4YDOA 4WWNA 2J4DA 1KZPA 4LCTA 2ZU6B 3WXXA 3QC1A 3LEWA 2E2EA 2YNQA 3FUFA 5CMWA 2XENA 2EQXA 2FBNA 4N5CA 3G2UA 4GTRA 1S70B 4DUIA 5BV0A 3NQPA 2J49A 4JEUA 4O1PA 4AY5A 4GMLA 5EIBE 5AIJA 1PAQA 1SW6A 3ZN3A 4ZHBA 4NQ0A 2QC9A 4CDRA 3GW4A 3ULYA 1A5EA 2KZTA 4U0SA 4HRMB 3UM1A 2BKGA 3NZUA 2Y3AA 1DC2A 3IEGA 1O1SA 4JW1A 4TV3A 4NRHB 4OYSA 5CECB 5LFAA 1KT0A 5EILA 3QAQA 4N2SA 4CT4A 1TNYA 2AJAA 2XHEA 1D8DA 1N11A 1YMPA 4MRUA 2J9QA 1HG5A 3CK7A 4NIKA 3HHMA 4UI9C 1BI8B 4AV7A 3EU5A 2DIWA 4AP2A 4TUUA 3OTNA 4RLYA 4JEHA 4GMJA 3C98A 3E37A 4J8EA 4LEUA 3KSQA 5FQ7A 3FUEA 2XS1A 2XGOA 4AXHA 5KJMA 4BWRA 5G05J 1TNOA 1H6PA 1TEZA 4I17A 4KBQA 3PZ4A 3ZU7B 3R9MA 3L16A 3APDA 2Y69E 4KZCA 2H6FA 2J07A 4KZ0A 3SO8A 2J08A 2H6HA 4I1OB 3UX4A 4C0MA 4NACA 2EINE 2XEEA 5BPPA 1HZ4A 4HOSA 4JHRA 2LSVA 4B89A 4N5QA 1Y6IA 2J8SD 4EBAA 2DVWA 1H0AA 1IYGA 3NOGD 2VGEA 4K5BA 2LO6A 4YDYA 4CEMA 2GRNB 3QARA 5JJ6A 4AEZC 1OCOE 4WAFA 4UI9J 4UUCA 4U04A 4BX9A 2X6FA 2KCVA 2X6JA 4UWHA 2WB2A 2GRRB 4FADA 1OCRE 2QZAA 3ASHA 2FO1E 3CQCB 4XKBA 1BD8A 3ZUVB 2M63A 5CEAA 5AENA 2GROB 4DI4A 4MBGA 3ASGA 4OVVA 4B8AA 5CBOA 4TXPA 4GTMA 4JL0A 4GZ5A 3MKQA 3TL5A 5KWDA 3DXMG 2XRYA 4YVOA 3D9HA 3NF1A 5EDSA 1SZAA 4L7TA 4DX1A 3HXEA 4ANXA 3TAXA 4I1AA 4ANWA 3EHQA 1HE8A 2X6IA 4GAAA 2WXRA 4N3AA 3CHPA 3U3WA 4APFA 3ZXPA 2AXUA 3FY4A 2WXGA 4KMOA 4H7XA 5ANRA 1K1AA 3IHVA 4GCOA 4J8SA 4BTAA 3QB2A 1JPLA 1TN7A 3NBNB 3T5VA 2IQCA 2PQRA 2ETAA 2WQ7A 3VLDA 4FLHA 5G55A 3CEQA 5EN5D 2VQ2A 4ACKA 2R05A 4FU3A 3MX3A 3EUVA 1HH8A 1K3ZD 5M72A 5CRVA 2VSXE 1HU3A 1HFAA 3KSLA 3LCAA 5HKPA 3FEXA 3Q47B 3ZYMA 3B7UX 5AYWD 3N71A 4HORA 1DCQA 2WXJA 3FUKA 2I1KA 3J5PA 4A1SA 3SFYA 2MYOA 5C1DA 3OXFA 3LVQE 1MQSA 5LP0A 1N9AA 3FUJA 4DX6D 3TWUA 5JJ7A 5EYLA 4HNAD 3L22A 1BPOA 1NA0A 2WMNA 5BT1A 3UKUG 5AN8A 2ZGDA 3PZ1A 3HXBA 5JHAA 1QZ2A 4BERA 5D0QD 2HYZA 1KZOA 3MV3B 2P58C 4RG9A 2WXNA 2A5UA 2NSZA 1BU9A 3FTWA 4XI9A 3ABME 2ILRA 3ABLE 1KLXA 3L82A 3LY8A 3FP3A 4GPMA 3ISMC 1UN9A 2R5SA 1IHGA 4RG6A 1S0PA 3LY9A 1YCSB 3DEOA 2RKKA 2EIKE 4BSZB 3Q7FA 5LCWJ 2QYUA 3E34A 4R7LA 3PUJA 3CVVA 2OV8A 4LSZE 4BY6A 4RSYA 4GTOA 3LYAA 4JHJA 5KNGA 3SZ7A 2F8XK 2I9CA 1Z3YA 4ILIA 3CSTA 2BUGA 3HIZA 2GRPB 1N95A 4CDMA 2P9NG 4AY6A 3DWLG 3AS8A 3CKCA 2XQ0A 4EECA 5DIZA 4J8DA 1NL4A 1H19A 4DRXE 3CVUA 4ATGA 2V8SE 3DSUA 2KCKA 3PUKA 3PREA 3I5PA 1TR4A 1WY6A 2V0PA 4U0UA 2VTBA 4DK5A 4HOUA 2KC7A 3JQ0A 4BTBA 3APCA 3CQGB 5D66A 2B0OE 4J6IA 5EYPF 4ATZD 1U2VG 3SF4A 4ACLA 4E85A 3UM0A 4D10C 2CHWA 3DEPA 3CSFA 1MYOA 2NXPA 4HOQA 2MOWA 4GMRA 5ENNA 3WG7E 5G04J 1N4SA 2J4BA 3DSWA 1U3CA 1G3NB 2GGFA 5FQ4A 3ONKA 1ELWA 3QWWA 5C2YA 3HDXA 5ENQD 1K1BA 3MJWA 3LVRE 2KCLA 3ASDA 4GZ3A 3AG3E 3SFZA 3MZLB 3KEAA 3B95A 4J0UA 3DXKG 3BG1B 1HXIA 3KD7A 4EHMA 3LPZA 3TWVA 3FTVA 3DSXA 4I2WA 3E30A 3RRMB 4AVXA 2C2LA 2RD0A 3SI5A 4EBAG 1E8XA 3D9PA 5E75A 3IV0A 4G11A 3HYMB 2WXHA 4WNGA 2B6CA 3ZW3A 4N3CA 3LJ3A 3V2OA 2X38A 1JCQA 3D9NA 3R7RA 3AU4A 1UW4B 3RSEG 1IQUA 2V5FA 5BUZA 4UQZA 1N52A 1YA0A 3UI2A 4CDNA 1SZ9A 3VLEA 4EZKA 1EPUA 1TN6A 1N4RA 3UKRG 2IOSA 5FQ8A 3FUDA 1RW2A 4B0ZA 2R03A 1P5QA 4EZLA 4C48B 1S63A 4L23A 4GA1A 3FH8A 1H2TC 3Q5MA 3DRAA 2YQ8A 3CHMA 4URKA 2WXFA 3ASOE 3Q79A 4FLBA 1RZ4A 3S7DA 4GTTA 3RU0A 3PH0C 2WXOA 2GRLA 5E76A 5A7DB 4LRZA 3VTXA 4Y6WA 3CIAA 2P9KG 4O6FA 3U4TA 1JUQA 4GTPA 5EKQD 4U07A 3NAWA 3D9KA 4CGWA 2XCCA 1E8YA 1MX6A 4OAUC 3CHOA 3V30A 3FDHA 2LAIA 5FWQA 2XS8A 3Q9UC 1XGWA 3TXMA 3UT7A 5HRYA 3CGHA 1SVXA 3ESLA 1B89A 5FT9A
chains in the Genus database with same CATH topology
1WM5A 3CHPA 3L17A 4L2YA 3U3WA 2FEZA 4L2LA 4XIFA 3G2WA 1OWLA 4APFA 4PS3A 3JQ1A 3UQ3A 2X6KA 3QNKA 2AXUA 3FY4A 4JPSA 4Q96A 4A1GA 2WXGA 4KMOA 4H7XA 5ANRA 2X6HA 3CVQA 3IHVA 3LY7A 3ASFA 2OOEA 3UUXA 4PH4B 3D9JA 4GCOA 4J8SA 4BTAA 4PUCA 5LOZA 4G1TA 3DBSA 4PDXA 3QB2A 1JPLA 3D3MA 4Q94A 2LSUA 2MRIA 3URZA 3ZYLA 5KJKA 4AM9A 3RKVA 1TJCA 3T5VA 1Y8MA 3FH5A 2Y4TA 4XKCA 2XGMA 3ZHEA 2IQCA 2PQRA 3GZSA 5G04C 2WQ7A 5HQ8A 1PC2A 3VLDA 3QKYA 4FLHA 4C9BB 3FUMA 1HF8A 1JWFA 5DBKA 5G55A 3O48A 3FEYA 3CEQA 3QK0A 3BEEA 3ZHEB 4GYWA 4DJAA 2VQ2A 3UT8A 3B7TA 4ACKA 4Y6CA 5AJDA 4FU3A 4B8CB 3ML9A 3MX3A 2AWIA 1L5JA 1HH8A 5FZRA 1E96B 3HVEA 3MGBA 4MS6A 4Q69A 5M72A 4F7AA 1FVHA 4IN3B 2VSXE 5CHEE 1QQEA 1HU3A 5FZQA 1HFAA 3AS5A 4N39A 3LCAA 2IJGX 2LAHA 3FEXA 3S7BA 5J90A 3MKRA 5G05C 4KVMA 3Q47B 3KEZA 4HVBA 3ZYMA 3I3NA 2OVBA 2A4ZA 1OWMA 3B7UX 4XZ4A 2WQHA 1UJKA 3GYZA 3ESKA 2VJ8A 4BSXA 5ARGA 2PZIA 3RO3A 4N3BA 4EPZA 2AXVA 4HOTA 4DLOA 5AYWD 3N71A 5T3RA 4A3TA 2PM7A 2VGYA 4HORA 2WXJA 3FUKA 3GZ2A 1H2UA 3EDTB 4A3VA 2I1KA 3JCKC 3T5XA 4B94A 3B13A 3FFLA 4A1SA 4I1MA 5HI7A 4AIFA 1Z3XA 4ME2A 3ULQA 5C1DA 3FTUA 4GZCA 4OVUA 2WM9A 3CLJA 3OXFA 2IF4A 3LVQE 2C0LA 1MQSA 1WAO1 5KJLA 5LP0A 5G2NA 3FUJA 4WWOA 5BV1A 2IOLA 3ZPJA 2AXZA 4EQFA 2VSYA 3FU3A 5EX3A 4C0EA 4XX5A 3ML8A 3S7FA 4JZYA 5JJ7A 4HS2A 5CCMA 3SD5A 3L22A 2CFUA 1FCHA 3U9WA 3FTXA 4CT0A 1TJFA 4I2ZA 3OAWA 2XEVA 3FUNA 4FHJA 5A23A 2JEKA 3PRZA 4L1BA 2PM6A 1BPOA 1NA0A 2WMNA 5BT1A 4WNEA 5J08A 3FULA 1A17A 2VSOE 5T8IA 5JHAA 2OVFA 4IRUA 2E0IA 2VSNA 3I4RB 4UWKA 3D9IA 3PNLB 2WXLA 5JJTA 4GYYA 1QZ2A 4JA7A 2FULA 3CVWA 5ARFA 3FH7A 4DI3A 2L9BA 1JWGA 5KCMA 4FJZA 3FTZA 5D0QD 4DLQA 4WWPA 2HYZA 3CK8A 3MV3B 2P58C 1GW6A 2CG2A 4RG9A 2WXNA 4G24A 1ELRA 3KAEA 4UWGA 2A5UA 3CVYA 1NZNA 1OUVA 3MA5A 2VGXA 3CHQA 4JA9A 3SNXA 2BF0X 3PVLA 2NSZA 2CHXA 2WPVA 3FTWA 4XI0A 4U8HA 4GA2A 4E6HA 5A6CA 3I4GA 4ANUA 4GAAA 1E7VA 1IQRA 4GU5A 2I2OA 4XI9A 2VGXB 1LF8A 2GW1A 1OWPA 2ILRA 2XPZA 3TJPA 3ZEFA 2DBAA 1INZA 2WXKA 1KLXA 3QOUA 3RO2A 1PY1A 4KT6B 3AU5A 3Q4AB 4GPKA 3LY8A 3FP3A 3IKOB 2HR2A 5FTPA 4LUNU 3PEVB 1NP7A 1OWNA 1UN9A 3CVNA 3FTSA 3JUIA 1X5BA 2R5SA 4G26A 4JC8A 3ONLA 3SHFA 3TG4A 2J09A 5LX8A 1IHGA 2KM4A 4RG6A 1S0PA 2UY1A 2CG3A 3NZSA 3LY9A 4F3VA 3FTYA 2WXIA 4F1SA 4DPRA 3EHMA 4HLEA 1OWOA 5LCWJ 3TGOA 3APFA 3DPDA 2UY1B 4UQXA 4N2QA 2YINA 4R7LA 1ZBPA 4WWNA 2J4DA 3IBEA 3PUJA 4F53A 3CVVA 3KS2A 2ZU6B 4LCTA 3WXXA 3QC1A 2OV8A 3LEWA 2E2EA 2YNQA 3FUFA 5CMWA 4BY6A 4RSYA 2XPYA 2EQXA 4PS8A 2FBNA 3TG5A 4IULA 3PZDA 4N5CA 3LYAA 4JHJA 3SZ7A 4NURA 1SQMA 2L0IA 3MV2B 4RVBA 2I9CA 5AJLA 1Z3YA 3G2UA 2IFUA 2WVIA 4ILIA 3CSTA 4CRWA 3RRNB 5ANLA 3U64A 2BUGA 4J8FA 3HIZA 5BV0A 4CDMA 3G2SA 3CVPA 4A55A 2JLBA 2J49A 3MCXA 2GRMA 3NQPA 4JEUA 2ONDA 2YHCA 4UWLA 4FC8A 4AY6A 2NC9A 3ENEA 4AY5A 4GMLA 4JVSA 5AIJA 3AS8A 1HO8A 3CKCA 3FWVA 2XQ0A 3LDZA 4GCNA 4EECA 1EF1C 1PAQA 5DIZA 4J8DA 3PEUB 4KVOA 3ZN3A 5BW8C 3G2TA 4P29A 2IU1A 2IONA 4NQ0A 3D9OA 1H19A 4CDRA 5KJNA 3ZFWA 3CVUA 3GW4A 4ATGA 2V8SE 2KCKA 3FHEA 3PUKA 3PREA 2DCPA 3I5PA 2KZTA 3SBTB 4XE0A 4MKTA 1WY6A 4U0SA 4BT8A 1ELKA 1MHQA 2V0PA 4APOA 3L13A 3OXGA 4G25A 4U0UA 3NZUA 3ZRHA 2Y3AA 2VYIA 2VTBA 2UWJG 2KZTB 3IEGA 2CFZA 1HS6A 4DK5A 1EDUA 4HOUA 2KC7A 3JQ0A 3L08A 4JW1A 3PS6A 4TV3A 3APCA 4NRHB 4OYSA 3CQGB 3PE4A 4J6IA 4FJYA 4CGVA 2VTBB 5LFAA 5FQ6A 5FZSA 3UPVA 3SF4A 1E8ZA 1KT0A 1NA3A 3ZXSA 4ACLA 4E85A 4D10C 3QAQA 2CHWA 3JYSA 4BX8A 3CSFA 4N2SA 3MEKA 4I6GA 4CT4A 4MLPA 2FO7A 2XHEA 2R59A 3EJNA 4MRUA 2J9QA 2WXMA 2NXPA 4HOQA 3SGHA 2MOWA 1HG5A 4JHKA 1FVFA 3CK7A 5EX0A 3HHMA 4UI9C 5ENNA 1UJJA 3CVLA 4AV7A 4K0RA 4M3OA 4GZDA 5G04J 2DIWA 2J4BA 4AP2A 4TUUA 3CVXA 1U3CA 4KXKB 2PL2A 2GGFA 5FQ4A 3OXLA 2XRZA 3ONKA 1ELWA 3OTNA 4U63A 2WXPA 4JEHA 3RK6A 4GMJA 3BG0B 4JXTA 1DNPA 3QWWA 2XGSA 5C2YA 3C98A 3HDXA 4J8EA 4LEUA 4FA6A 1W3BA 2KATA 3MJWA 3FUEA 5FQ7A 5BNWA 3LVRE 4LERA 2KCLA 4TRQA 1DVPA 2XGOA 3ASDA 4GZ3A 3S7JA 4AXHA 5KJMA 4YNDA 3QDNA 2WXQA 2LNIA 4BWRA 5G05J 3SFZA 3B7RL 3K9IA 3MZLB 4UI9K 3R7QA 4ABNA 3EIQC 4I17A 4J0UA 4WNDA 1TEZA 4KBQA 3BG1B 4IYPA 1HXIA 2CHZA 3L16A 3ZGQA 4ANVA 4BTBA 3KD7A 3APDA 3VTYA 4GB9A 4FULA 5D0OD 3PNTB 4KZCA 2FF4A 2FI7A 2J07A 4KZ0A 2J08A 2C0MA 3EHNA 3LPZA 4I1OB 4I43A 3UMVA 4W9RA 3FTVA 3LKUA 3R9AB 3UX4A 4C0MA 4HFGA 4I2WA 3ZVVA 1UG3A 3RRMB 2PQNA 4UQYA 5JHBA 1VDYA 4NACA 1E7UA 2L0TB 4AVXA 2I6HA 2HM8A 2C2LA 3P1UA 1E90A 2RD0A 3SI5A 4EBAG 4G23A 1E8XA 3D9PA 3LXUX 4I6JA 3IV0A 4G11A 5E75A 3HYMB 2WXHA 4KYOB 4WNGA 3U66A 3CK9A 4N3CA 5FJYA 3VLFA 3LJ3A 3ZW3A 2X38A 4G2VA 5BPPA 1HZ4A 3D9NA 3LS8A 2L6JA 4HOSA 2HO1A 4JHRA 3R7RA 3GZ1A 3L6AA 3AU4A 1E8WA 1UW4B 4PS7A 2LSVA 1XNFA 4B89A 4WUYA 3FU0A 2RG8A 4BT9A 4U0ZA 1IQUA 4GZ6A 1Y6IA 2V5FA 2MHKA 5BUZA 4EBAA 4UQZA 2I1JA 1H0AA 1N52A 3O4ZA 1YA0A 2X3MA 1IYGA 3CV0A 3MYVA 3S2AA 4FHKA 4K03A 2LO6A 4CDNA 4CEMA 3QARA 1SZ9A 4V3IA 3HVEB 3VLEA 5JJ6A 3QWPA 4EZKA 4AEZC 3FUHA 4WAFA 1EPUA 4FP7A 3SBSA 3CKBA 3FU6A 4UI9J 4H7YA 2QY7A 3G2VA 4N3AA 4U04A 2R17C 2XPIA 5CMYA 2BTDA 2IOSA 3Q15A 5FQ8A 3RJVA 4BX9A 3FUDA 2X6FA 2KCVA 2X6JA 4UWHA 2WB2A 3ZYQA 4B0ZA 3EIJA 3ZIMA 4FADA 5LCWC 2QFCA 1HG2A 1N54A 1P5QA 3CR3A 3ASHA 4EZLA 1UN8A 4GA0A 3CQCB 4L23A 1U3DA 4GA1A 4XKBA 2M63A 3FH8A 1H2TC 5AENA 3Q5MA 3QJZA 1QNFA 5T4YA 4DI4A 2YQ8A 3CHMA 2AVPA 3CHSA 2WXFA 4URKA 3ASGA 3CHRA 4OVVA 1HX8A 4FLBA 4B8AA 3P2BA 2AW6A 4EZJA 3S7DA 2XCBA 2Y4UA 3QWVA 4HXIA 4CCAA 3RU0A 3PH0C 4YVQC 1EYHA 2WXOA 2GRLA 5E76A 5A7DB 4LRZA 3VTXA 4Y6WA 3CIAA 3D9MA 4JL0A 4GZ5A 4O6FA 3TXNA 3MKQA 3U4TA 3ZYKA 1JUQA 3IHYA 4QFVA 3RRUA 4AJWA 3L54A 3PDNA 4UWFA 5EKQD 3FUIA 4U07A 3B7SA 3T8MA 4ILHB 3D9KA 3MKQB 3TL5A 4I9EA 4CGWA 1Z6TA 3E4BA 2XRYA 5CCLA 3AS4A 2XCCA 2WQ6A 2WMOA 4YVOA 1E8YA 3NF1A 5EDSA 1ZU2A 1SZAA 4I6EA 3UT4A 3FU5A 4L7TA 2Q7FA 3CHOA 2V4LA 3D9LA 4I9CA 4ANXA 3TAXA 4I1AA 3FDHA 3PE3A 2LAIA 5FWQA 4WNFA 4GYOA 2YHEA 4BFRA 1H6KA 3RIBA 4ANWA 1H2VC 1XGWA 3Q49B 1HE8A 3TXMA 1KT1A 3UT7A 4AOFA 3CGHA 4ILGA 2X6IA 3ESLA 2WXRA 1B89A 5FT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WM5 A;  3U3W A;  2FEZ A;  4XIF A;  3UQ3 A;  4H7X A;  3CVQ A;  3LY7 A;  3ASF A;  2OOE A;  3UUX A;  4GCO A;  4BTA A;  4G1T A;  3URZ A;  5KJK A;  2LSU A;  4AM9 A;  3RKV A;  1TJC A;  1Y8M A;  2Y4T A;  3ZHE A;  2XGM A;  2PQR A;  5G04 C;  5HQ8 A;  1PC2 A;  3QKY A;  5DBK A;  3O48 A;  3CEQ A;  3BEE A;  3ZHE B;  4GYW A;  2VQ2 A;  4Y6C A;  1HH8 A;  5FZR A;  1E96 B;  5M72 A;  4IN3 B;  5CHE E;  1QQE A;  5FZQ A;  3AS5 A;  4N39 A;  3LCA A;  3S7B A;  3MKR A;  5G05 C;  3Q47 B;  2WQH A;  3GYZ A;  3ESK A;  5ARG A;  2PZI A;  3RO3 A;  4N3B A;  4HOT A;  5AYW D;  3N71 A;  4HOR A;  2VGY A;  3GZ2 A;  3EDT B;  4B94 A;  3FFL A;  4A1S A;  5HI7 A;  4AIF A;  4ME2 A;  3ULQ A;  5C1D A;  3OXF A;  2IF4 A;  2C0L A;  1WAO 1;  5KJL A;  3ZPJ A;  4EQF A;  2VSY A;  5EX3 A;  3S7F A;  5JJ7 A;  5CCM A;  1FCH A;  4I2Z A;  2XEV A;  1NA0 A;  5BT1 A;  4WNE A;  1A17 A;  2VSN A;  5JJT A;  4GYY A;  1QZ2 A;  4JA7 A;  5ARF A;  5D0Q D;  2HYZ A;  3CK8 A;  3MV3 B;  2P58 C;  4RG9 A;  4G24 A;  1ELR A;  3KAE A;  1NZN A;  1OUV A;  3MA5 A;  2VGX A;  4JA9 A;  2WPV A;  4XI0 A;  4GA2 A;  5A6C A;  4XI9 A;  2VGX B;  2GW1 A;  2DBA A;  1KLX A;  3QOU A;  3RO2 A;  3Q4A B;  4GPK A;  3LY8 A;  3FP3 A;  2HR2 A;  5FTP A;  3CVN A;  2R5S A;  4G26 A;  3TG4 A;  1IHG A;  4RG6 A;  2UY1 A;  3LY9 A;  5LCW J;  3TGO A;  2UY1 B;  4UQX A;  4N2Q A;  1ZBP A;  3KS2 A;  3WXX A;  2E2E A;  2FBN A;  3TG5 A;  4N5C A;  3LYA A;  3SZ7 A;  3MV2 B;  2IFU A;  2BUG A;  4J8F A;  3CVP A;  2JLB A;  2OND A;  2YHC A;  4AY6 A;  2NC9 A;  4AY5 A;  3AS8 A;  3CKC A;  3FWV A;  4GCN A;  5DIZ A;  4J8D A;  3ZN3 A;  5BW8 C;  4NQ0 A;  4CDR A;  5KJN A;  3ZFW A;  3GW4 A;  2KCK A;  4U0S A;  4BT8 A;  4APO A;  4U0U A;  3OXG A;  4G25 A;  2VYI A;  2UWJ G;  3IEG A;  4F3V A;  4HOU A;  2KC7 A;  4BTB A;  4NRH B;  3PE4 A;  4CGV A;  5FZS A;  3UPV A;  3SF4 A;  1KT0 A;  1NA3 A;  3JYS A;  4N2S A;  3MEK A;  2FO7 A;  2J9Q A;  4HOQ A;  3CK7 A;  5EX0 A;  4UI9 C;  3CVL A;  5G04 J;  4KXK B;  2PL2 A;  3OXL A;  1ELW A;  3QWW A;  2XGS A;  4J8E A;  4LEU A;  1W3B A;  2KAT A;  5BNW A;  2KCL A;  2XGO A;  3ASD A;  4GZ3 A;  3S7J A;  5KJM A;  4YND A;  3QDN A;  2LNI A;  4BWR A;  5G05 J;  3K9I A;  4UI9 K;  4ABN A;  4I17 A;  4J0U A;  4WND A;  4KBQ A;  1HXI A;  3ZGQ A;  3KD7 A;  3VTY A;  5D0O D;  2FF4 A;  2FI7 A;  2C0M A;  3LPZ A;  4W9R A;  3LKU A;  3R9A B;  4I2W A;  2PQN A;  4UQY A;  2I6H A;  2C2L A;  4G23 A;  3HYM B;  4KYO B;  4WNG A;  1B89 A;  3CK9 A;  4N3C A;  5FJY A;  4G2V A;  1HZ4 A;  2L6J A;  4HOS A;  2HO1 A;  4JHR A;  3GZ1 A;  2LSV A;  1XNF A;  4WUY A;  4BT9 A;  4U0Z A;  4GZ6 A;  2V5F A;  2MHK A;  4UQZ A;  1YA0 A;  1IYG A;  3CV0 A;  5JJ6 A;  3QWP A;  3CKB A;  4UI9 J;  4H7Y A;  4U04 A;  2XPI A;  3RJV A;  3Q15 A;  2KCV A;  5LCW C;  2QFC A;  1P5Q A;  3ASH A;  4GA0 A;  4GA1 A;  3Q5M A;  2YQ8 A;  2AVP A;  3ASG A;  3S7D A;  2XCB A;  2Y4U A;  3QWV A;  3RU0 A;  4YVQ C;  5A7D B;  3VTX A;  4Y6W A;  4JL0 A;  4GZ5 A;  4O6F A;  3U4T A;  3PDN A;  5EKQ D;  4U07 A;  4I9E A;  4CGW A;  3E4B A;  5CCL A;  3AS4 A;  2XCC A;  4YVO A;  3NF1 A;  1ZU2 A;  2Q7F A;  4I9C A;  3TAX A;  4I1A A;  3PE3 A;  4WNF A;  4GYO A;  3RIB A;  3Q49 B;  1KT1 A;  4N3A A;  5FT9 A; 
#chains in the Genus database with same CATH topology
 1Q2Z A;  4L2Y A;  4L2L A;  4PS3 A;  3UQ3 A;  3QNK A;  4A1G A;  5FIN A;  2X6H A;  3UUX A;  4ZFH A;  3DBS A;  4DX2 A;  3D3M A;  4Q94 A;  2LSU A;  2MRI A;  3HG0 D;  1Y8M A;  4XKC A;  3ZHE A;  3GZS A;  1HF8 A;  3QK0 A;  3FEY A;  4GYW A;  4B8C B;  2PNN A;  5FZR A;  1E96 B;  3HVE A;  3MGB A;  4MS6 A;  4IN3 B;  1SA4 A;  5CHE E;  1QQE A;  3TWT A;  4N39 A;  3S7B A;  4KVM A;  3KEZ A;  4K5C A;  3I3N A;  2A4Z A;  1OWM A;  4XZ4 A;  1UJK A;  3GYZ A;  3ESK A;  4BSX A;  5ARG A;  4DLO A;  2LXL A;  4QQI A;  3EDT B;  4A3V A;  5AQ9 A;  3B13 A;  4I1M A;  1TNB A;  1Z5S C;  4ME2 A;  4GZC A;  2WM9 A;  3CLJ A;  2IF4 A;  2C0L A;  5G2N A;  4WWO A;  1MX4 A;  5BV1 A;  2IOL A;  5HS0 A;  2JAB A;  5ENS D;  3FU3 A;  4JZY A;  2CFU A;  2KXP C;  4CT0 A;  1TJF A;  4I2Z A;  3PRZ A;  5B3S E;  4M7C A;  3HRA A;  1A17 A;  5T8I A;  4IRU A;  3PNL B;  5JJT A;  1X81 A;  5ARF A;  3FH7 A;  4DI3 A;  2CG2 A;  4G24 A;  1ELR A;  3KAE A;  3CVY A;  3MA5 A;  2VGX A;  3CHQ A;  3PVL A;  2WPV A;  2CHX A;  4GA2 A;  3BQO A;  1IQR A;  3B7B A;  2I2O A;  1LTX A;  3TJP A;  2DBA A;  1INZ A;  5CER B;  1PY1 A;  4GPK A;  2P9I G;  3BU8 A;  4TXR A;  3CVN A;  1X5B A;  3TG4 A;  4L9P A;  1YYH A;  1S64 A;  2UY1 A;  3C72 A;  1ZB1 A;  2WXI A;  3NB2 A;  4HLE A;  3APF A;  3DPD A;  4N2Q A;  2XZT G;  2YIN A;  2H6I A;  2XPY A;  3TG5 A;  2OCC E;  4IUL A;  3V2X A;  3PZD A;  3NOC D;  4NUR A;  2L0I A;  4U95 D;  4RVB A;  5AJL A;  2IFU A;  4U8V D;  4CRW A;  3C3R A;  5ANL A;  3SQV A;  4YDW A;  3IXE A;  3G2S A;  3CVP A;  4A55 A;  2JLB A;  4FC8 A;  4GCN A;  1EF1 C;  4KVO A;  5BW8 C;  3G2T A;  4P29 A;  2IU1 A;  2ION A;  3D9O A;  5KJN A;  2DCP A;  3SBT B;  4APO A;  3OXG A;  3ZRH A;  2KZT B;  1HS6 A;  1K8K G;  5FQ6 A;  5FZS A;  1E8Z A;  1NA3 A;  3ZXS A;  3JYS A;  4I6G A;  4MLP A;  1AWC B;  2F37 A;  3EJN A;  3TWW A;  2WXM A;  3SGH A;  1FVF A;  4RQI A;  4GTV A;  4YDE A;  1D9S A;  3CVL A;  4M3O A;  4GZD A;  2PL2 A;  3OXL A;  2XRZ A;  1JCS A;  1BI7 B;  4J7W A;  1TYQ G;  2IY0 C;  4FA6 A;  2KAT A;  5BNW A;  4TRQ A;  4YND A;  2DZO A;  4ABN A;  4UI9 K;  3R7Q A;  4K5A B;  3EIQ C;  5AQB A;  4IYP A;  4ANV A;  3VTY A;  4GB9 A;  4FUL A;  5D0O D;  3AJI A;  2FF4 A;  2ETC A;  3EHN A;  3UMV A;  4W9R A;  3LKU A;  4HQD A;  4HFG A;  5EID A;  1UG3 A;  2PQN A;  5JHB A;  1VDY A;  2L0T B;  2I6H A;  2HM8 A;  3P1U A;  4DX5 D;  1E90 A;  1MZC A;  3LXU X;  4I6J A;  3U66 A;  3TWX A;  5FJY A;  3Q78 A;  3VLF A;  5ENR D;  4G2V A;  2L6J A;  2HO1 A;  3GZ1 A;  3UTM A;  1OY3 D;  1OCC E;  4PS7 A;  1XNF A;  4U0Z A;  4GZ6 A;  4CYM D;  2I1J A;  2X3M A;  3CV0 A;  1OT8 A;  3MYV A;  3S2A A;  4FHK A;  3V79 K;  1OCZ E;  2ZIR A;  3HVE B;  3QWP A;  3FUH A;  4FP7 A;  2ETB A;  3CKB A;  3G2V A;  3UM2 A;  4TXQ A;  2XPI A;  3RJV A;  2BTD A;  1IHB A;  2P9P G;  2QFC A;  1N54 A;  1UN8 A;  3ABK E;  3QJZ A;  5D2M C;  3CHS A;  1HX8 A;  3T9K A;  4EZJ A;  2Y4U A;  3QWV A;  4CCA A;  1UOH A;  3HXD A;  1EYH A;  1QBQ A;  4LNB A;  4JB8 P;  3D9M A;  3TXN A;  2A5E A;  3ZYK A;  3IHY A;  3AAA C;  4QFV A;  3RRU A;  3L54 A;  3PDN A;  3FUI A;  3B7S A;  3MKQ B;  3RAU A;  4HI8 A;  2WQ6 A;  4JD2 G;  1ZU2 A;  2XEH A;  3UT4 A;  3FU5 A;  2Q7F A;  3DSS A;  1FT1 A;  2V4L A;  4I9C A;  3PE3 A;  4WNF A;  2ZXW E;  1BLX B;  4BFR A;  3RIB A;  1H2V C;  2H6G A;  4AOF A;  1KT1 A;  3DPY A;  1WM5 A;  3L17 A;  4U7E B;  3ULE G;  1OWL A;  2X6K A;  4CZ2 D;  4Q96 A;  3CVQ A;  1WG0 A;  3D9J A;  4O1O A;  5LOZ A;  3E33 A;  3BUA A;  4HBD A;  2Y4T A;  2XGM A;  3W9F A;  1N94 A;  5HQ8 A;  1PC2 A;  4C9B B;  3E32 A;  1JWF A;  3ZKJ A;  3BEE A;  1MJ0 A;  4DJA A;  5KNH D;  3UT8 A;  3B7T A;  5IY5 E;  5AJD A;  3ML9 A;  2AWI A;  3V31 A;  4F7A A;  2F8Y A;  2LAH A;  5J90 A;  5G05 C;  5KBA A;  4G8L A;  3Q73 A;  2PZI A;  4N3B A;  2AXV A;  5CBN A;  5T3R A;  2VGY A;  1H2U A;  3T5X A;  3JUE A;  3FFL A;  4U8Y D;  1KPS B;  2EIJ E;  5HI7 A;  1Z3X A;  3FTU A;  4OAV B;  4Z68 A;  3ZPJ A;  5EX3 A;  4C0E A;  4XX5 A;  2P2C P;  1LD8 A;  2HE0 A;  5CCM A;  3SD5 A;  1DCE A;  3U9W A;  3UM3 A;  3OAW A;  5ENP D;  5A23 A;  2JEK A;  2QYJ A;  4WNE A;  3FUL A;  2OVF A;  3SY2 A;  2E0I A;  2VSN A;  4UWK A;  4BET A;  3D9I A;  2FUL A;  3CVW A;  2L9B A;  1JWG A;  5KCM A;  4FJZ A;  3Q7A A;  4DLQ A;  3CK8 A;  1GW6 A;  2LXM A;  4HRL A;  4G8K A;  4JA9 A;  3SNX A;  3EHR A;  4XI0 A;  4U8H A;  2DZN A;  5A6C A;  4ANU A;  5ENT D;  3AG1 E;  1LF8 A;  2IEJ A;  3ZEF A;  2WXK A;  3RO2 A;  5FTP A;  4LUN U;  1OWN A;  1N4Q A;  4G26 A;  3ONL A;  2KM4 A;  2CG3 A;  2OEW A;  3TWQ A;  4F1S A;  2DYR E;  2R02 A;  3EHM A;  4B93 B;  3TGO A;  4UQX A;  1JCR A;  1ZBP A;  3IBE A;  4F53 A;  3KS2 A;  1TNU A;  2DYS E;  4PS8 A;  3ZNG A;  4BES A;  4HB5 A;  1SQM A;  3MV2 B;  2WVI A;  1V54 E;  3RRN B;  3U64 A;  4J8F A;  3PZ3 A;  1AP7 A;  5AAO A;  3MCX A;  2GRM A;  2OND A;  2YHC A;  4UWL A;  2NC9 A;  3ENE A;  4JVS A;  2Y0B G;  1HO8 A;  3FWV A;  3LDZ A;  3PEU B;  4O60 A;  5B1A E;  4LNG A;  3ZFW A;  3FHE A;  4XE0 A;  4MKT A;  4BT8 A;  1ELK A;  1MHQ A;  3L13 A;  4G25 A;  2P9S G;  2VYI A;  2UWJ G;  2CFZ A;  3ASN E;  1EDU A;  4F3V A;  3L08 A;  3PS6 A;  3PE4 A;  4X8Q A;  4FJY A;  4CGV A;  2VTB B;  1WDY A;  3UPV A;  3C3O A;  2BED A;  4DX7 D;  4GTQ A;  4BX8 A;  3MEK A;  2FO7 A;  2R59 A;  4JHK A;  5EX0 A;  1UJJ A;  4K0R A;  3CVX A;  4KXK B;  4U63 A;  3TWR A;  2WXP A;  3RK6 A;  5FIO A;  3BG0 B;  4JXT A;  1DNP A;  4XEI G;  2XGS A;  1W3B A;  4LER A;  1DVP A;  1NFI E;  3S7J A;  3UXG A;  3QDN A;  2WXQ A;  2LNI A;  3B7R L;  3K9I A;  4WND A;  2DWZ A;  2RFM A;  2CHZ A;  3ZGQ A;  3PNT B;  2FI7 A;  2C0M A;  2EIM E;  4I43 A;  3R9A B;  3ZVV A;  1D8E A;  4UQY A;  2RFA A;  1E7U A;  1FT2 A;  1TNZ A;  3UIO C;  4G23 A;  4KYO B;  3CK9 A;  5CRU A;  2NYJ A;  3LS8 A;  3L6A A;  1E8W A;  2IO3 C;  4WUY A;  3FU0 A;  2RG8 A;  4BT9 A;  5B1B E;  2MHK A;  1OXJ A;  5BXU A;  3O4Z A;  3L9T A;  1MX2 A;  4K03 A;  3DSV A;  3W9G A;  4V3I A;  3SBS A;  3FU6 A;  3C5R A;  4H7Y A;  2QY7 A;  2R17 C;  2V5Q C;  3SFX A;  4J8Y A;  5CMY A;  3Q15 A;  3ZYQ A;  3ZIM A;  3EIJ A;  3PZ2 A;  5JA4 D;  5LCW C;  5JMN D;  1HG2 A;  3CR3 A;  4GA0 A;  4GTS A;  1U3D A;  1QNF A;  5T4Y A;  2AVP A;  3CHR A;  3P2B A;  4F1P A;  3HXF A;  2AW6 A;  2XCB A;  4HXI A;  5H7P A;  4YVQ C;  4HI9 A;  1V55 E;  3AG4 E;  4AJW A;  2IO2 C;  4UWF A;  3T8M A;  4ILH B;  4I9E A;  1Z6T A;  3E4B A;  5CCL A;  3AS4 A;  2WMO A;  4I6E A;  3T8K A;  2L6B A;  3D9L A;  4GYO A;  5CED B;  2GRQ B;  2YHE A;  1H6K A;  1FPP A;  3Q49 B;  4ILG A;  2BKK B;  2F0Y A;  1LD7 A;  2FEZ A;  4XIF A;  3G2W A;  3JQ1 A;  4JPS A;  2LUH A;  3AG2 E;  3LY7 A;  3ASF A;  2OOE A;  4PH4 B;  3C3Q A;  4LNU D;  4PUC A;  4G1T A;  4PDX A;  4HRN A;  3URZ A;  5KJK A;  3ZYL A;  3J5Q B;  4AM9 A;  3RKV A;  1TJC A;  3FH5 A;  2P9U G;  5G04 C;  1SA5 A;  3QKY A;  3FUM A;  5DBK A;  5BXO A;  3O48 A;  5AAR A;  3ZHE B;  3EU9 A;  4Y6C A;  1L5J A;  4Q69 A;  1O1T A;  1FVH A;  5FZQ A;  3AS5 A;  2IJG X;  3MKR A;  1O1R A;  5ENO D;  4HVB A;  3DST A;  2OVB A;  2OEV A;  2WQH A;  2VJ8 A;  3UIP C;  3X2Q E;  3HXC A;  3RO3 A;  4EPZ A;  4HOT A;  4A3T A;  2PM7 A;  3GZ2 A;  3JCK C;  3Q75 A;  4B94 A;  3TWS A;  4LG6 A;  4AIF A;  4HLL A;  3ULQ A;  4OVU A;  1WAO 1;  5KJL A;  2AXZ A;  4EQF A;  2VSY A;  4A63 B;  1IKN D;  4U96 D;  3ML8 A;  3S7F A;  4HS2 A;  1IXV A;  2V4H C;  1N0Q A;  1FCH A;  2R2L A;  3FTX A;  3UIN C;  2XEV A;  3FUN A;  4FHJ A;  4L1B A;  2PM6 A;  2KBX A;  5ITZ F;  4F6R D;  5J08 A;  5AQ7 A;  2VSO E;  1H6O A;  4TUM A;  3I4R B;  2WXL A;  4GYY A;  3LJN A;  4JA7 A;  3FTZ A;  4WWP A;  2Y1L E;  1N4P A;  4UWG A;  1NZN A;  1OUV A;  2BF0 X;  1NI1 A;  4E6H A;  3I4G A;  3Q9N C;  1E7V A;  4GU5 A;  2VGX B;  2ZGG A;  2GW1 A;  1OWP A;  3JXI A;  2XPZ A;  1TN8 A;  1N0R A;  3QOU A;  4KT6 B;  3AU5 A;  3Q4A B;  2XZD G;  3IKO B;  1QYM A;  2HR2 A;  3PEV B;  1NP7 A;  3FTS A;  3JUI A;  2P9L G;  1O5M A;  3JXJ A;  4JC8 A;  3SHF A;  5LX8 A;  2J09 A;  3NZS A;  3FTY A;  2EIL E;  5AQA A;  4BEP A;  4DPR A;  2ZIS A;  1OWO A;  3F6Q A;  2UY1 B;  4YDO A;  4WWN A;  2J4D A;  1KZP A;  4LCT A;  2ZU6 B;  3WXX A;  3QC1 A;  3LEW A;  2E2E A;  2YNQ A;  3FUF A;  5CMW A;  2XEN A;  2EQX A;  2FBN A;  4N5C A;  3G2U A;  4GTR A;  1S70 B;  4DUI A;  5BV0 A;  3NQP A;  2J49 A;  4JEU A;  4O1P A;  4AY5 A;  4GML A;  5EIB E;  5AIJ A;  1PAQ A;  1SW6 A;  3ZN3 A;  4ZHB A;  4NQ0 A;  2QC9 A;  4CDR A;  3GW4 A;  3ULY A;  1A5E A;  2KZT A;  4U0S A;  4HRM B;  3UM1 A;  2BKG A;  3NZU A;  2Y3A A;  1DC2 A;  3IEG A;  1O1S A;  4JW1 A;  4TV3 A;  4NRH B;  4OYS A;  5CEC B;  5LFA A;  1KT0 A;  5EIL A;  3QAQ A;  4N2S A;  4CT4 A;  1TNY A;  2AJA A;  2XHE A;  1D8D A;  1N11 A;  1YMP A;  4MRU A;  2J9Q A;  1HG5 A;  3CK7 A;  4NIK A;  3HHM A;  4UI9 C;  1BI8 B;  4AV7 A;  3EU5 A;  2DIW A;  4AP2 A;  4TUU A;  3OTN A;  4RLY A;  4JEH A;  4GMJ A;  3C98 A;  3E37 A;  4J8E A;  4LEU A;  3KSQ A;  5FQ7 A;  3FUE A;  2XS1 A;  2XGO A;  4AXH A;  5KJM A;  4BWR A;  5G05 J;  1TNO A;  1H6P A;  1TEZ A;  4I17 A;  4KBQ A;  3PZ4 A;  3ZU7 B;  3R9M A;  3L16 A;  3APD A;  2Y69 E;  4KZC A;  2H6F A;  2J07 A;  4KZ0 A;  3SO8 A;  2J08 A;  2H6H A;  4I1O B;  3UX4 A;  4C0M A;  4NAC A;  2EIN E;  2XEE A;  5BPP A;  1HZ4 A;  4HOS A;  4JHR A;  2LSV A;  4B89 A;  4N5Q A;  1Y6I A;  2J8S D;  4EBA A;  2DVW A;  1H0A A;  1IYG A;  3NOG D;  2VGE A;  4K5B A;  2LO6 A;  4YDY A;  4CEM A;  2GRN B;  3QAR A;  5JJ6 A;  4AEZ C;  1OCO E;  4WAF A;  4UI9 J;  4UUC A;  4U04 A;  4BX9 A;  2X6F A;  2KCV A;  2X6J A;  4UWH A;  2WB2 A;  2GRR B;  4FAD A;  1OCR E;  2QZA A;  3ASH A;  2FO1 E;  3CQC B;  4XKB A;  1BD8 A;  3ZUV B;  2M63 A;  5CEA A;  5AEN A;  2GRO B;  4DI4 A;  4MBG A;  3ASG A;  4OVV A;  4B8A A;  5CBO A;  4TXP A;  4GTM A;  4JL0 A;  4GZ5 A;  3MKQ A;  3TL5 A;  5KWD A;  3DXM G;  2XRY A;  4YVO A;  3D9H A;  3NF1 A;  5EDS A;  1SZA A;  4L7T A;  4DX1 A;  3HXE A;  4ANX A;  3TAX A;  4I1A A;  4ANW A;  3EHQ A;  1HE8 A;  2X6I A;  4GAA A;  2WXR A;  4N3A A;  3CHP A;  3U3W A;  4APF A;  3ZXP A;  2AXU A;  3FY4 A;  2WXG A;  4KMO A;  4H7X A;  5ANR A;  1K1A A;  3IHV A;  4GCO A;  4J8S A;  4BTA A;  3QB2 A;  1JPL A;  1TN7 A;  3NBN B;  3T5V A;  2IQC A;  2PQR A;  2ETA A;  2WQ7 A;  3VLD A;  4FLH A;  5G55 A;  3CEQ A;  5EN5 D;  2VQ2 A;  4ACK A;  2R05 A;  4FU3 A;  3MX3 A;  3EUV A;  1HH8 A;  1K3Z D;  5M72 A;  5CRV A;  2VSX E;  1HU3 A;  1HFA A;  3KSL A;  3LCA A;  5HKP A;  3FEX A;  3Q47 B;  3ZYM A;  3B7U X;  5AYW D;  3N71 A;  4HOR A;  1DCQ A;  2WXJ A;  3FUK A;  2I1K A;  3J5P A;  4A1S A;  3SFY A;  2MYO A;  5C1D A;  3OXF A;  3LVQ E;  1MQS A;  5LP0 A;  1N9A A;  3FUJ A;  4DX6 D;  3TWU A;  5JJ7 A;  5EYL A;  4HNA D;  3L22 A;  1BPO A;  1NA0 A;  2WMN A;  5BT1 A;  3UKU G;  5AN8 A;  2ZGD A;  3PZ1 A;  3HXB A;  5JHA A;  1QZ2 A;  4BER A;  5D0Q D;  2HYZ A;  1KZO A;  3MV3 B;  2P58 C;  4RG9 A;  2WXN A;  2A5U A;  2NSZ A;  1BU9 A;  3FTW A;  4XI9 A;  3ABM E;  2ILR A;  3ABL E;  1KLX A;  3L82 A;  3LY8 A;  3FP3 A;  4GPM A;  3ISM C;  1UN9 A;  2R5S A;  1IHG A;  4RG6 A;  1S0P A;  3LY9 A;  1YCS B;  3DEO A;  2RKK A;  2EIK E;  4BSZ B;  3Q7F A;  5LCW J;  2QYU A;  3E34 A;  4R7L A;  3PUJ A;  3CVV A;  2OV8 A;  4LSZ E;  4BY6 A;  4RSY A;  4GTO A;  3LYA A;  4JHJ A;  5KNG A;  3SZ7 A;  2F8X K;  2I9C A;  1Z3Y A;  4ILI A;  3CST A;  2BUG A;  3HIZ A;  2GRP B;  1N95 A;  4CDM A;  2P9N G;  4AY6 A;  3DWL G;  3AS8 A;  3CKC A;  2XQ0 A;  4EEC A;  5DIZ A;  4J8D A;  1NL4 A;  1H19 A;  4DRX E;  3CVU A;  4ATG A;  2V8S E;  3DSU A;  2KCK A;  3PUK A;  3PRE A;  3I5P A;  1TR4 A;  1WY6 A;  2V0P A;  4U0U A;  2VTB A;  4DK5 A;  4HOU A;  2KC7 A;  3JQ0 A;  4BTB A;  3APC A;  3CQG B;  5D66 A;  2B0O E;  4J6I A;  5EYP F;  4ATZ D;  1U2V G;  3SF4 A;  4ACL A;  4E85 A;  3UM0 A;  4D10 C;  2CHW A;  3DEP A;  3CSF A;  1MYO A;  2NXP A;  4HOQ A;  2MOW A;  4GMR A;  5ENN A;  3WG7 E;  5G04 J;  1N4S A;  2J4B A;  3DSW A;  1U3C A;  1G3N B;  2GGF A;  5FQ4 A;  3ONK A;  1ELW A;  3QWW A;  5C2Y A;  3HDX A;  5ENQ D;  1K1B A;  3MJW A;  3LVR E;  2KCL A;  3ASD A;  4GZ3 A;  3AG3 E;  3SFZ A;  3MZL B;  3KEA A;  3B95 A;  4J0U A;  3DXK G;  3BG1 B;  1HXI A;  3KD7 A;  4EHM A;  3LPZ A;  3TWV A;  3FTV A;  3DSX A;  4I2W A;  3E30 A;  3RRM B;  4AVX A;  2C2L A;  2RD0 A;  3SI5 A;  4EBA G;  1E8X A;  3D9P A;  5E75 A;  3IV0 A;  4G11 A;  3HYM B;  2WXH A;  4WNG A;  2B6C A;  3ZW3 A;  4N3C A;  3LJ3 A;  3V2O A;  2X38 A;  1JCQ A;  3D9N A;  3R7R A;  3AU4 A;  1UW4 B;  3RSE G;  1IQU A;  2V5F A;  5BUZ A;  4UQZ A;  1N52 A;  1YA0 A;  3UI2 A;  4CDN A;  1SZ9 A;  3VLE A;  4EZK A;  1EPU A;  1TN6 A;  1N4R A;  3UKR G;  2IOS A;  5FQ8 A;  3FUD A;  1RW2 A;  4B0Z A;  2R03 A;  1P5Q A;  4EZL A;  4C48 B;  1S63 A;  4L23 A;  4GA1 A;  3FH8 A;  1H2T C;  3Q5M A;  3DRA A;  2YQ8 A;  3CHM A;  4URK A;  2WXF A;  3ASO E;  3Q79 A;  4FLB A;  1RZ4 A;  3S7D A;  4GTT A;  3RU0 A;  3PH0 C;  2WXO A;  2GRL A;  5E76 A;  5A7D B;  4LRZ A;  3VTX A;  4Y6W A;  3CIA A;  2P9K G;  4O6F A;  3U4T A;  1JUQ A;  4GTP A;  5EKQ D;  4U07 A;  3NAW A;  3D9K A;  4CGW A;  2XCC A;  1E8Y A;  1MX6 A;  4OAU C;  3CHO A;  3V30 A;  3FDH A;  2LAI A;  5FWQ A;  2XS8 A;  3Q9U C;  1XGW A;  3TXM A;  3UT7 A;  5HRY A;  3CGH A;  1SVX A;  3ESL A;  1B89 A;  5FT9 A; 
#chains in the Genus database with same CATH homology
 1WM5 A;  3CHP A;  3L17 A;  4L2Y A;  3U3W A;  2FEZ A;  4L2L A;  4XIF A;  3G2W A;  1OWL A;  4APF A;  4PS3 A;  3JQ1 A;  3UQ3 A;  2X6K A;  3QNK A;  2AXU A;  3FY4 A;  4JPS A;  4Q96 A;  4A1G A;  2WXG A;  4KMO A;  4H7X A;  5ANR A;  2X6H A;  3CVQ A;  3IHV A;  3LY7 A;  3ASF A;  2OOE A;  3UUX A;  4PH4 B;  3D9J A;  4GCO A;  4J8S A;  4BTA A;  4PUC A;  5LOZ A;  4G1T A;  3DBS A;  4PDX A;  3QB2 A;  1JPL A;  3D3M A;  4Q94 A;  2LSU A;  2MRI A;  3URZ A;  3ZYL A;  5KJK A;  4AM9 A;  3RKV A;  1TJC A;  3T5V A;  1Y8M A;  3FH5 A;  2Y4T A;  4XKC A;  2XGM A;  3ZHE A;  2IQC A;  2PQR A;  3GZS A;  5G04 C;  2WQ7 A;  5HQ8 A;  1PC2 A;  3VLD A;  3QKY A;  4FLH A;  4C9B B;  3FUM A;  1HF8 A;  1JWF A;  5DBK A;  5G55 A;  3O48 A;  3FEY A;  3CEQ A;  3QK0 A;  3BEE A;  3ZHE B;  4GYW A;  4DJA A;  2VQ2 A;  3UT8 A;  3B7T A;  4ACK A;  4Y6C A;  5AJD A;  4FU3 A;  4B8C B;  3ML9 A;  3MX3 A;  2AWI A;  1L5J A;  1HH8 A;  5FZR A;  1E96 B;  3HVE A;  3MGB A;  4MS6 A;  4Q69 A;  5M72 A;  4F7A A;  1FVH A;  4IN3 B;  2VSX E;  5CHE E;  1QQE A;  1HU3 A;  5FZQ A;  1HFA A;  3AS5 A;  4N39 A;  3LCA A;  2IJG X;  2LAH A;  3FEX A;  3S7B A;  5J90 A;  3MKR A;  5G05 C;  4KVM A;  3Q47 B;  3KEZ A;  4HVB A;  3ZYM A;  3I3N A;  2OVB A;  2A4Z A;  1OWM A;  3B7U X;  4XZ4 A;  2WQH A;  1UJK A;  3GYZ A;  3ESK A;  2VJ8 A;  4BSX A;  5ARG A;  2PZI A;  3RO3 A;  4N3B A;  4EPZ A;  2AXV A;  4HOT A;  4DLO A;  5AYW D;  3N71 A;  5T3R A;  4A3T A;  2PM7 A;  2VGY A;  4HOR A;  2WXJ A;  3FUK A;  3GZ2 A;  1H2U A;  3EDT B;  4A3V A;  2I1K A;  3JCK C;  3T5X A;  4B94 A;  3B13 A;  3FFL A;  4A1S A;  4I1M A;  5HI7 A;  4AIF A;  1Z3X A;  4ME2 A;  3ULQ A;  5C1D A;  3FTU A;  4GZC A;  4OVU A;  2WM9 A;  3CLJ A;  3OXF A;  2IF4 A;  3LVQ E;  2C0L A;  1MQS A;  1WAO 1;  5KJL A;  5LP0 A;  5G2N A;  3FUJ A;  4WWO A;  5BV1 A;  2IOL A;  3ZPJ A;  2AXZ A;  4EQF A;  2VSY A;  3FU3 A;  5EX3 A;  4C0E A;  4XX5 A;  3ML8 A;  3S7F A;  4JZY A;  5JJ7 A;  4HS2 A;  5CCM A;  3SD5 A;  3L22 A;  2CFU A;  1FCH A;  3U9W A;  3FTX A;  4CT0 A;  1TJF A;  4I2Z A;  3OAW A;  2XEV A;  3FUN A;  4FHJ A;  5A23 A;  2JEK A;  3PRZ A;  4L1B A;  2PM6 A;  1BPO A;  1NA0 A;  2WMN A;  5BT1 A;  4WNE A;  5J08 A;  3FUL A;  1A17 A;  2VSO E;  5T8I A;  5JHA A;  2OVF A;  4IRU A;  2E0I A;  2VSN A;  3I4R B;  4UWK A;  3D9I A;  3PNL B;  2WXL A;  5JJT A;  4GYY A;  1QZ2 A;  4JA7 A;  2FUL A;  3CVW A;  5ARF A;  3FH7 A;  4DI3 A;  2L9B A;  1JWG A;  5KCM A;  4FJZ A;  3FTZ A;  5D0Q D;  4DLQ A;  4WWP A;  2HYZ A;  3CK8 A;  3MV3 B;  2P58 C;  1GW6 A;  2CG2 A;  4RG9 A;  2WXN A;  4G24 A;  1ELR A;  3KAE A;  4UWG A;  2A5U A;  3CVY A;  1NZN A;  1OUV A;  3MA5 A;  2VGX A;  3CHQ A;  4JA9 A;  3SNX A;  2BF0 X;  3PVL A;  2NSZ A;  2CHX A;  2WPV A;  3FTW A;  4XI0 A;  4U8H A;  4GA2 A;  4E6H A;  5A6C A;  3I4G A;  4ANU A;  4GAA A;  1E7V A;  1IQR A;  4GU5 A;  2I2O A;  4XI9 A;  2VGX B;  1LF8 A;  2GW1 A;  1OWP A;  2ILR A;  2XPZ A;  3TJP A;  3ZEF A;  2DBA A;  1INZ A;  2WXK A;  1KLX A;  3QOU A;  3RO2 A;  1PY1 A;  4KT6 B;  3AU5 A;  3Q4A B;  4GPK A;  3LY8 A;  3FP3 A;  3IKO B;  2HR2 A;  5FTP A;  4LUN U;  3PEV B;  1NP7 A;  1OWN A;  1UN9 A;  3CVN A;  3FTS A;  3JUI A;  1X5B A;  2R5S A;  4G26 A;  4JC8 A;  3ONL A;  3SHF A;  3TG4 A;  2J09 A;  5LX8 A;  1IHG A;  2KM4 A;  4RG6 A;  1S0P A;  2UY1 A;  2CG3 A;  3NZS A;  3LY9 A;  4F3V A;  3FTY A;  2WXI A;  4F1S A;  4DPR A;  3EHM A;  4HLE A;  1OWO A;  5LCW J;  3TGO A;  3APF A;  3DPD A;  2UY1 B;  4UQX A;  4N2Q A;  2YIN A;  4R7L A;  1ZBP A;  4WWN A;  2J4D A;  3IBE A;  3PUJ A;  4F53 A;  3CVV A;  3KS2 A;  2ZU6 B;  4LCT A;  3WXX A;  3QC1 A;  2OV8 A;  3LEW A;  2E2E A;  2YNQ A;  3FUF A;  5CMW A;  4BY6 A;  4RSY A;  2XPY A;  2EQX A;  4PS8 A;  2FBN A;  3TG5 A;  4IUL A;  3PZD A;  4N5C A;  3LYA A;  4JHJ A;  3SZ7 A;  4NUR A;  1SQM A;  2L0I A;  3MV2 B;  4RVB A;  2I9C A;  5AJL A;  1Z3Y A;  3G2U A;  2IFU A;  2WVI A;  4ILI A;  3CST A;  4CRW A;  3RRN B;  5ANL A;  3U64 A;  2BUG A;  4J8F A;  3HIZ A;  5BV0 A;  4CDM A;  3G2S A;  3CVP A;  4A55 A;  2JLB A;  2J49 A;  3MCX A;  2GRM A;  3NQP A;  4JEU A;  2OND A;  2YHC A;  4UWL A;  4FC8 A;  4AY6 A;  2NC9 A;  3ENE A;  4AY5 A;  4GML A;  4JVS A;  5AIJ A;  3AS8 A;  1HO8 A;  3CKC A;  3FWV A;  2XQ0 A;  3LDZ A;  4GCN A;  4EEC A;  1EF1 C;  1PAQ A;  5DIZ A;  4J8D A;  3PEU B;  4KVO A;  3ZN3 A;  5BW8 C;  3G2T A;  4P29 A;  2IU1 A;  2ION A;  4NQ0 A;  3D9O A;  1H19 A;  4CDR A;  5KJN A;  3ZFW A;  3CVU A;  3GW4 A;  4ATG A;  2V8S E;  2KCK A;  3FHE A;  3PUK A;  3PRE A;  2DCP A;  3I5P A;  2KZT A;  3SBT B;  4XE0 A;  4MKT A;  1WY6 A;  4U0S A;  4BT8 A;  1ELK A;  1MHQ A;  2V0P A;  4APO A;  3L13 A;  3OXG A;  4G25 A;  4U0U A;  3NZU A;  3ZRH A;  2Y3A A;  2VYI A;  2VTB A;  2UWJ G;  2KZT B;  3IEG A;  2CFZ A;  1HS6 A;  4DK5 A;  1EDU A;  4HOU A;  2KC7 A;  3JQ0 A;  3L08 A;  4JW1 A;  3PS6 A;  4TV3 A;  3APC A;  4NRH B;  4OYS A;  3CQG B;  3PE4 A;  4J6I A;  4FJY A;  4CGV A;  2VTB B;  5LFA A;  5FQ6 A;  5FZS A;  3UPV A;  3SF4 A;  1E8Z A;  1KT0 A;  1NA3 A;  3ZXS A;  4ACL A;  4E85 A;  4D10 C;  3QAQ A;  2CHW A;  3JYS A;  4BX8 A;  3CSF A;  4N2S A;  3MEK A;  4I6G A;  4CT4 A;  4MLP A;  2FO7 A;  2XHE A;  2R59 A;  3EJN A;  4MRU A;  2J9Q A;  2WXM A;  2NXP A;  4HOQ A;  3SGH A;  2MOW A;  1HG5 A;  4JHK A;  1FVF A;  3CK7 A;  5EX0 A;  3HHM A;  4UI9 C;  5ENN A;  1UJJ A;  3CVL A;  4AV7 A;  4K0R A;  4M3O A;  4GZD A;  5G04 J;  2DIW A;  2J4B A;  4AP2 A;  4TUU A;  3CVX A;  1U3C A;  4KXK B;  2PL2 A;  2GGF A;  5FQ4 A;  3OXL A;  2XRZ A;  3ONK A;  1ELW A;  3OTN A;  4U63 A;  2WXP A;  4JEH A;  3RK6 A;  4GMJ A;  3BG0 B;  4JXT A;  1DNP A;  3QWW A;  2XGS A;  5C2Y A;  3C98 A;  3HDX A;  4J8E A;  4LEU A;  4FA6 A;  1W3B A;  2KAT A;  3MJW A;  3FUE A;  5FQ7 A;  5BNW A;  3LVR E;  4LER A;  2KCL A;  4TRQ A;  1DVP A;  2XGO A;  3ASD A;  4GZ3 A;  3S7J A;  4AXH A;  5KJM A;  4YND A;  3QDN A;  2WXQ A;  2LNI A;  4BWR A;  5G05 J;  3SFZ A;  3B7R L;  3K9I A;  3MZL B;  4UI9 K;  3R7Q A;  4ABN A;  3EIQ C;  4I17 A;  4J0U A;  4WND A;  1TEZ A;  4KBQ A;  3BG1 B;  4IYP A;  1HXI A;  2CHZ A;  3L16 A;  3ZGQ A;  4ANV A;  4BTB A;  3KD7 A;  3APD A;  3VTY A;  4GB9 A;  4FUL A;  5D0O D;  3PNT B;  4KZC A;  2FF4 A;  2FI7 A;  2J07 A;  4KZ0 A;  2J08 A;  2C0M A;  3EHN A;  3LPZ A;  4I1O B;  4I43 A;  3UMV A;  4W9R A;  3FTV A;  3LKU A;  3R9A B;  3UX4 A;  4C0M A;  4HFG A;  4I2W A;  3ZVV A;  1UG3 A;  3RRM B;  2PQN A;  4UQY A;  5JHB A;  1VDY A;  4NAC A;  1E7U A;  2L0T B;  4AVX A;  2I6H A;  2HM8 A;  2C2L A;  3P1U A;  1E90 A;  2RD0 A;  3SI5 A;  4EBA G;  4G23 A;  1E8X A;  3D9P A;  3LXU X;  4I6J A;  3IV0 A;  4G11 A;  5E75 A;  3HYM B;  2WXH A;  4KYO B;  4WNG A;  3U66 A;  3CK9 A;  4N3C A;  5FJY A;  3VLF A;  3LJ3 A;  3ZW3 A;  2X38 A;  4G2V A;  5BPP A;  1HZ4 A;  3D9N A;  3LS8 A;  2L6J A;  4HOS A;  2HO1 A;  4JHR A;  3R7R A;  3GZ1 A;  3L6A A;  3AU4 A;  1E8W A;  1UW4 B;  4PS7 A;  2LSV A;  1XNF A;  4B89 A;  4WUY A;  3FU0 A;  2RG8 A;  4BT9 A;  4U0Z A;  1IQU A;  4GZ6 A;  1Y6I A;  2V5F A;  2MHK A;  5BUZ A;  4EBA A;  4UQZ A;  2I1J A;  1H0A A;  1N52 A;  3O4Z A;  1YA0 A;  2X3M A;  1IYG A;  3CV0 A;  3MYV A;  3S2A A;  4FHK A;  4K03 A;  2LO6 A;  4CDN A;  4CEM A;  3QAR A;  1SZ9 A;  4V3I A;  3HVE B;  3VLE A;  5JJ6 A;  3QWP A;  4EZK A;  4AEZ C;  3FUH A;  4WAF A;  1EPU A;  4FP7 A;  3SBS A;  3CKB A;  3FU6 A;  4UI9 J;  4H7Y A;  2QY7 A;  3G2V A;  4N3A A;  4U04 A;  2R17 C;  2XPI A;  5CMY A;  2BTD A;  2IOS A;  3Q15 A;  5FQ8 A;  3RJV A;  4BX9 A;  3FUD A;  2X6F A;  2KCV A;  2X6J A;  4UWH A;  2WB2 A;  3ZYQ A;  4B0Z A;  3EIJ A;  3ZIM A;  4FAD A;  5LCW C;  2QFC A;  1HG2 A;  1N54 A;  1P5Q A;  3CR3 A;  3ASH A;  4EZL A;  1UN8 A;  4GA0 A;  3CQC B;  4L23 A;  1U3D A;  4GA1 A;  4XKB A;  2M63 A;  3FH8 A;  1H2T C;  5AEN A;  3Q5M A;  3QJZ A;  1QNF A;  5T4Y A;  4DI4 A;  2YQ8 A;  3CHM A;  2AVP A;  3CHS A;  2WXF A;  4URK A;  3ASG A;  3CHR A;  4OVV A;  1HX8 A;  4FLB A;  4B8A A;  3P2B A;  2AW6 A;  4EZJ A;  3S7D A;  2XCB A;  2Y4U A;  3QWV A;  4HXI A;  4CCA A;  3RU0 A;  3PH0 C;  4YVQ C;  1EYH A;  2WXO A;  2GRL A;  5E76 A;  5A7D B;  4LRZ A;  3VTX A;  4Y6W A;  3CIA A;  3D9M A;  4JL0 A;  4GZ5 A;  4O6F A;  3TXN A;  3MKQ A;  3U4T A;  3ZYK A;  1JUQ A;  3IHY A;  4QFV A;  3RRU A;  4AJW A;  3L54 A;  3PDN A;  4UWF A;  5EKQ D;  3FUI A;  4U07 A;  3B7S A;  3T8M A;  4ILH B;  3D9K A;  3MKQ B;  3TL5 A;  4I9E A;  4CGW A;  1Z6T A;  3E4B A;  2XRY A;  5CCL A;  3AS4 A;  2XCC A;  2WQ6 A;  2WMO A;  4YVO A;  1E8Y A;  3NF1 A;  5EDS A;  1ZU2 A;  1SZA A;  4I6E A;  3UT4 A;  3FU5 A;  4L7T A;  2Q7F A;  3CHO A;  2V4L A;  3D9L A;  4I9C A;  4ANX A;  3TAX A;  4I1A A;  3FDH A;  3PE3 A;  2LAI A;  5FWQ A;  4WNF A;  4GYO A;  2YHE A;  4BFR A;  1H6K A;  3RIB A;  4ANW A;  1H2V C;  1XGW A;  3Q49 B;  1HE8 A;  3TXM A;  1KT1 A;  3UT7 A;  4AOF A;  3CGH A;  4ILG A;  2X6I A;  3ESL A;  2WXR A;  1B89 A;  5FT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...