3WXXA

Crystal structure of a t3ss complex from aeromonas hydrophila
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
150
structure length
150
Chain Sequence
b'EPAIEAFLQDGGTLAMLNDVSTDTLEQLYTLGFNQYHAGKHDEAHKIFQALCVLDHYEARFFLGLGACRQALGQFRLAIDSYSYGAMMDLQEPRFPFHAAECLLQLGELEGAESGFHSAQLLAAAKPELAELAARAGIMLEVVKTKKDME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AcrH
publication title Structure of AcrH-AopB Chaperone-Translocator Complex Reveals a Role for Membrane Hairpins in Type III Secretion System Translocon Assembly
pubmed doi rcsb
source organism Aeromonas hydrophila
molecule tags Membrane protein/chaperone
total genus 55
structure length 150
sequence length 150
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2014-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3wxxA00
2J9QA 4N5CA 5A6CA 3QWVA 3KAEA 5G05C 4N3CA 2VSNA 5G04J 4XI0A 3KD7A 3HYMB 3U3WA 1QZ2A 4GZ3A 3Q15A 3MA5A 4JA9A 5LCWJ 5BW8C 3ZHEA 1WAO1 3FWVA 4N2QA 4CGVA 4HORA 4G1TA 2XCCA 4AIFA 5BNWA 1TJCA 3RU0A 3GZ2A 4HOUA 3LY8A 2FI7A 4GYYA 2HO1A 2KCKA 2HR2A 2UY1A 3MEKA 4GZ6A 3SF4A 2P58C 5CHEE 2UWJG 3K9IA 5G05J 4N3BA 2OOEA 4N39A 2JLBA 2Y4UA 2XEVA 1YA0A 1HH8A 4J8DA 4WNGA 3U4TA 5JJ7A 4BTAA 3TG5A 2C0MA 2WQHA 5FJYA 4BTBA 3LCAA 2BUGA 2YQ8A 3ASDA 3Q4AB 5FT9A 3LKUA 4HOSA 1WM5A 2ONDA 3CK8A 3Q5MA 3PE3A 2C2LA 3PE4A 4H7XA 4JL0A 3TAXA 3ASHA 1E96B 4J8EA 2C0LA 3CK9A 3O48A 4G25A 4G24A 1HZ4A 5DIZA 5JJTA 5C1DA 4JA7A 2XGMA 1IYGA 3SZ7A 5EX0A 3ULQA 4A1SA 3OXLA 5KJMA 4I9EA 4F3VA 2XPIA 3FFLA 3S7JA 1P5QA 3S7BA 3IEGA 3N71A 4BT8A 4Y6CA 4O6FA 2YHCA 2FEZA 5D0OD 2V5FA 4NQ0A 5EX3A 4GYWA 5FZQA 2FBNA 2AVPA 3CVQA 5KJKA 3OXFA 3QOUA 3LY9A 4AY5A 1OUVA 3ZFWA 2FF4A 4IN3B 1XNFA 4GA1A 2Y4TA 4UI9K 4I9CA 3AS5A 4N2SA 4I17A 3NF1A 3LYAA 3CVLA 3VTXA 4GCNA 1B89A 4J8FA 3AS8A 2XGOA 3CKCA 5CCLA 4EQFA 3UUXA 1PC2A 1W3BA 3ASGA 2KC7A 3GZ1A 5AYWD 3WXXA 2HYZA 3GW4A 2VYIA 4I1AA 1Y8MA 3RJVA 4CDRA 4GA0A 2KCLA 5ARGA 4XIFA 3PDNA 3ZHEB 2LNIA 4U07A 5DBKA 1IHGA 1A17A 4LEUA 2XGSA 5FZRA 2KATA 3CK7A 5HI7A 2VGYA 3EDTB 2PQNA 4RG6A 3TGOA 4U0SA 4GYOA 2L6JA 2UY1B 1ZBPA 2VSYA 3GYZA 2VGXA 2WPVA 3TG4A 4YVQC 4APOA 4WNFA 5ARFA 1NZNA 4I2ZA 3ESKA 5JJ6A 3VTYA 2KCVA 3RO3A 2LSUA 2QFCA 5FTPA 4WNDA 4UI9J 3R9AB 4YVOA 3MV3B 3BEEA 4UQXA 1ELRA 2GW1A 3URZA 3CVNA 3RKVA 4AY6A 5EKQD 1ZU2A 4ABNA 4G23A 3CVPA 3UQ3A 3FP3A 4ME2A 4GPKA 4CGWA 1ELWA 3LY7A 2PL2A 2DBAA 3CEQA 3CV0A 5M72A 3JYSA 4N3AA 4KXKB 3MKRA 4WNEA 2IFUA 2PQRA 2E2EA 3RO2A 2R5SA 2Q7FA 3RIBA 4KBQA 1KT1A 2VQ2A 4BT9A 2PZIA 1HXIA 2XCBA 4W9RA 4HOTA 3QWWA 5D0QD 4RG9A 3ZN3A 3QKYA 4H7YA 3MV2B 1NA3A 3Q47B 4U0UA 4U04A 4XI9A 4I2WA 4HOQA 4G26A 2I6HA 4GZ5A 4UI9C 4GA2A 1FCHA 2NC9A 3ZPJA 3AS4A 4GCOA 1NA0A 5A7DB 3LPZA 3CKBA 4JHRA 4Y6WA 4BWRA 3ZGQA 4G2VA 4WUYA 1QQEA 5KJNA 3QWPA 3Q49B 3S7DA 4AM9A 5CCMA 5G04C 5KJLA 4J0UA 4YNDA 5BT1A 5LCWC 1KT0A 4U0ZA 3UPVA 4UQYA 2VGXB 1KLXA 2IF4A 4UQZA 2LSVA 4NRHB 2MHKA 3E4BA 3OXGA 4B94A 5FZSA 5HQ8A 2FO7A 3QDNA 3KS2A 3ASFA 3S7FA 4KYOB
chains in the Genus database with same CATH superfamily
3LXUX 2J9QA 2OEVA 1N0RA 3ASOE 2H6HA 2R02A 3LVQE 3QWVA 4GZCA 5EYPF 4L1BA 4F53A 1MJ0A 1JUQA 5G05C 1N0QA 3TXMA 4GMJA 3U3WA 2LXLA 3Q15A 3HXDA 5KBAA 4K5AB 4FLBA 1OWNA 2EIME 1DC2A 3EU9A 4G1TA 2XCCA 4AIFA 4RQIA 2WB2A 3RU0A 4HQDA 3W9FA 2FULA 1HE8A 1MQSA 3HHMA 4TXPA 1MX2A 2X38A 3RAUA 2KCKA 1O1RA 4WAFA 3SF4A 4ACKA 3CQGB 4K5BA 4CDNA 2I1KA 2JLBA 1HH8A 2ZISA 2VTBA 4GTRA 4BTAA 3R7QA 5FJYA 4BTBA 3BUAA 2XPYA 1TNYA 4JHJA 4FHJA 5KNHD 2J4DA 3QNKA 4HOSA 4JXTA 3DBSA 4I43A 2BTDA 4BSZB 2ZGGA 1E7VA 1E96B 2P2CP 3O48A 3CK9A 4LCTA 1TN7A 4UWLA 5JJTA 4C0MA 5AQ9A 3FEXA 3UMVA 4JA7A 2XGMA 4F1PA 2OV8A 3C3RA 4OVUA 1IXVA 3ULQA 4YDOA 3AU4A 1D8DA 3FFLA 1HG5A 3E33A 3T8KA 2FO1E 2IY0C 4ANXA 3IEGA 1SZ9A 3TXNA 3JQ1A 4O6FA 2XEHA 3ZUVB 3AU5A 2AWIA 5AN8A 5D0OD 1TJFA 3FUFA 3I5PA 2HM8A 4K03A 5EX3A 4JZYA 5G55A 3HVEB 4UWHA 3CVQA 4EZKA 3ML8A 3CIAA 2FF4A 1N9AA 2OVFA 3NB2A 2J8SD 1XNFA 4FHKA 5IY5E 2NXPA 4GA1A 1UN9A 3DRAA 3QAQA 4BX8A 4MRUA 2KZTA 3FH8A 2RG8A 3NF1A 4GCNA 4FADA 3CKCA 5CCLA 4EQFA 1PC2A 1W3BA 3ASGA 4HS2A 4L9PA 1SZAA 3CQCB 4DPRA 3KEAA 4I1AA 4ZFHA 2WXMA 3J5PA 3ULYA 4GA0A 4XIFA 4O1OA 3ZHEB 4XKBA 1N4RA 2DYRE 2X6HA 2V0PA 4YDWA 2XGSA 5ENSD 3C72A 1O1TA 1HU3A 2LXMA 3UIOC 2VGYA 3EDTB 3FULA 3FUHA 3O4ZA 4U0SA 3ZEFA 3AAAC 3L17A 2UY1B 3GYZA 3Q7AA 2WXQA 4I2ZA 3U66A 2WXOA 2KCVA 1LD7A 5B1BE 4X8QA 2DVWA 2IO3C 5FTPA 4GTQA 4AXHA 4MLPA 3ABKE 2VSXE 1JCQA 1U3DA 2AXUA 3BEEA 3I3NA 2J4BA 1Z5SC 2Y1LE 3D9KA 5AQBA 3AG1E 2F0YA 5EKQD 4JW1A 4AP2A 3NOGD 4PS8A 3LDZA 4G23A 1N4QA 1NI1A 3FP3A 3FTYA 4ME2A 4DX6D 3KEZA 1ELWA 3LY7A 3EU5A 3D9IA 3CEQA 3PZ4A 4HFGA 3B7SA 3EHNA 3MKRA 1BI7B 3ZYQA 2PQRA 2E2EA 5KNGA 3MX3A 4KZ0A 2V5QC 5C2YA 4AVXA 2PZIA 1HXIA 2XCBA 4W9RA 2WQ7A 3ZN3A 2KM4A 4H7YA 3D9LA 2R17C 1OWMA 3CR3A 1E8WA 2GRLA 2RFAA 3D9JA 2PNNA 2BEDA 4TXRA 2WVIA 1UJJA 4UI9C 4GU5A 2AW6A 3ML9A 1KPSB 3AS4A 3B7BA 1KZOA 4PH4B 4GCOA 3LPZA 3B95A 4LSZE 2XS8A 4M7CA 1HX8A 4JHRA 4HVBA 4GPMA 5LFAA 4Q96A 2X6IA 4A1GA 1QQEA 5FIOA 5T8IA 1K1BA 2ETAA 3EIJA 4LNGA 2IO2C 2EIJE 3L6AA 2QYUA 1SQMA 3ZNGA 1BLXB 5HS0A 5KJLA 2YHEA 3FUEA 1OCOE 2XS1A 4CEMA 1FT2A 2F8YA 2IF4A 3E4BA 3OXGA 5LP0A 1H2TC 4HRMB 4CT4A 5AARA 3TWRA 5BXOA 3ZYLA 2DYSE 3CSFA 3UM2A 2X6KA 4GZDA 3KAEA 1V55E 4JEUA 3G2UA 4XI0A 3Q7FA 4K5CA 4DK5A 3ESLA 4JA9A 4DRXE 5CECB 1Z3YA 4AEZC 4N2QA 3EHMA 1N4SA 3B7UX 1MX6A 2BKGA 2XQ0A 4URKA 2IQCA 1PAQA 4A63B 4L2LA 3UX4A 3E34A 5J90A 4BEPA 2ZXWE 4LNBA 3RRUA 2UWJG 4ANUA 3K9IA 5LX8A 4N3BA 5B3SE 1YA0A 1OWLA 4JC8A 5JJ7A 2Y3AA 2AJAA 3TG5A 3TWVA 3LCAA 3PZ2A 1H2VC 5FT9A 4I6EA 4RSYA 1WM5A 2GGFA 1FPPA 1HF8A 2C2LA 4C9BB 3ASHA 4J8EA 4G25A 2GRMA 3TWXA 1HZ4A 1VDYA 5DIZA 4L23A 4FU3A 4ZHBA 5E76A 3IHYA 3UM3A 4I1OB 1IYGA 3L54A 1LTXA 2J49A 1HS6A 2WMOA 2A5EA 2L6BA 3R9MA 3FU0A 3CSTA 4O60A 1OWOA 2IJGX 2WXFA 2KBXA 3G2WA 4Q94A 4CDMA 4WWNA 4F7AA 5BV1A 3EUVA 4HB5A 4NQ0A 2WXHA 2OVBA 4U8VD 4GYWA 5FZQA 2AVPA 5KJKA 3OXFA 3QOUA 3SHFA 3HG0D 2WQ6A 1YCSB 3ZFWA 3L22A 3HXFA 2PM6A 4ILIA 3Q75A 4UI9K 4I9CA 3AS5A 3SGHA 4J8FA 2WXKA 3PZDA 2EILE 3VLDA 1OCCE 3DEPA 3UUXA 1IHBA 2KC7A 2NYJA 3E30A 1E8XA 3GZ1A 2HYZA 4FA6A 4V3IA 1N52A 3RJVA 4CDRA 4XE0A 2KCLA 5ARGA 4CYMD 3CHSA 4XEIG 2LNIA 2P9UG 4U07A 5AAOA 3VLEA 4JHKA 3TWTA 3FU6A 2KATA 2RFMA 2LO6A 3NAWA 3CK7A 1N54A 5HI7A 4RG6A 2ZGDA 5ITZF 1XGWA 1UN8A 3FU5A 4I6GA 4GYOA 5EDSA 2L6JA 5CEAA 3PNTB 2IONA 2LAIA 4HNAD 3SFYA 3V79K 2WPVA 3BG0B 4DX5D 5JHBA 4YVQC 3EHRA 4EPZA 2VTBB 5JJ6A 3RO3A 2LSUA 4I6JA 2AXVA 4DX7D 1OY3D 4WNDA 4JEHA 2B0OE 3FTUA 1TNZA 3CHPA 4EBAG 3PREA 2P9LG 3UINC 4BSXA 2CHXA 1K3ZD 4EECA 2GW1A 2V8SE 2WXRA 1WDYA 3DXMG 2I9CA 4AY6A 1N4PA 2WMNA 5CBNA 4FC8A 1S63A 4ABNA 3FUDA 4DUIA 3AJIA 3TWSA 3RRMB 4DX2A 3DEOA 2DIWA 1IQRA 5J08A 3Q9UC 4FULA 4HBDA 3GZSA 2PL2A 3JYSA 3MYVA 3V2OA 1H19A 2CFUA 4KXKB 5AQ7A 2IFUA 3D9HA 5EIBE 3SBTB 3X2QE 4E6HA 1UOHA 4E85A 2VQ2A 4HOTA 2RKKA 4J8SA 4GTSA 3PUKA 1H6OA 1NA3A 3TJPA 3Q47B 4PUCA 5CMWA 1UW4B 4J8YA 1G3NB 3UT7A 2VSOE 3SFXA 5LOZA 3Q79A 4XI9A 4FP7A 4HOQA 1N95A 4A3VA 3C98A 4MKTA 2KZTB 4Z68A 1FCHA 5CERB 3ZPJA 1NA0A 4CZ2D 1FT1A 4U8YD 1SVXA 2P9NG 3ASNE 3R7RA 3CKBA 3APDA 5FQ8A 3QB2A 2IEJA 1TNBA 3L82A 4Y6WA 2GRNB 4IYPA 2GRQB 1TR4A 4G2VA 4G8KA 5KJNA 4TUUA 3T5XA 3Q49B 1H6PA 3UTMA 3AG2E 4AM9A 3VLFA 2F8XK 1SA4A 5CCMA 3FUMA 1K8KG 3UKRG 1WG0A 1EPUA 4YNDA 3MJWA 4GTOA 1KT0A 3CVYA 1IKND 2XRZA 1H0AA 2VJ8A 5CBOA 4EZLA 3P2BA 4KT6B 3ONKA 4APFA 4UQZA 4EZJA 2LSVA 4NRHB 5HQ8A 2P9KG 3QDNA 3L9TA 1SW6A 4QFVA 4LRZA 3V31A 3KS2A 2YINA 3ASFA 1X81A 3S7FA 4YDEA 3BU8A 5H7PA 3UT8A 3ZKJA 2P9IG 4RLYA 4J7WA 4ATZD 3FHEA 5G04J 3G2SA 3HYMB 1QZ2A 4GZ3A 2OCCE 1PY1A 5AJDA 2A5UA 5BW8C 5AENA 1WAO1 2QYJA 4UWKA 4CGVA 3UI2A 4G8LA 4LUNU 2GROB 4OVVA 4HORA 4B0ZA 3MKQA 5BNWA 1TJCA 4UUCA 3D9OA 4L2YA 3D3MA 3GZ2A 3EHQA 3NBNB 3LY8A 2FI7A 3DSVA 2WXLA 2HO1A 4YDYA 2HR2A 1X5BA 1YMPA 3MEKA 4UWGA 3SI5A 4GZ6A 2DZOA 1QYMA 1JWFA 4ATGA 2L9BA 3UKUG 3SQVA 3PNLB 1Q2ZA 5AQAA 4WNGA 3U4TA 5CMYA 3FUJA 2A4ZA 2C0MA 3BQOA 1S0PA 2BUGA 2YQ8A 4WWOA 3ZVVA 4FJZA 3CVVA 3PH0C 3LKUA 1SA5A 3ZXPA 3UM0A 1OCRE 2M63A 3HIZA 3SO8A 3CHRA 3V2XA 3PE3A 4H7XA 3TAXA 1TN8A 2C0LA 3TWWA 1H6KA 4G24A 1TYQG 2DCPA 2DZNA 2R59A 5C1DA 4DLOA 2J08A 3IKOB 4AOFA 3EJNA 1NL4A 3ZIMA 3ABLE 3SZ7A 5EX0A 1O5MA 3L13A 3WG7E 3CVWA 3OXLA 4F3VA 5T3RA 3S7JA 3CLJA 4ILHB 3FUKA 2IOSA 4BERA 3MZLB 3E37A 1D8EA 5A23A 2V5FA 2V4LA 3D9NA 2BKKB 4XKCA 3ZYKA 1RW2A 5JA4D 5FWQA 2IOLA 2J07A 5EYLA 3LY9A 1HG2A 3T9KA 1NFIE 4GMLA 3DSSA 4IN3B 1EF1C 2E0IA 2R05A 4CRWA 4DI4A 3KSLA 2Y4TA 2Y0BG 4I17A 3LYAA 2I1JA 3TL5A 4ILGA 2XGOA 2XENA 2CG3A 4PDXA 3WXXA 3T8MA 3FTXA 2XZDG 4BETA 3PDNA 3ENEA 3Q73A 4U96D 1A17A 1E8ZA 5FZRA 3FH5A 3LS8A 1MYOA 3FY4A 3FUNA 3PZ1A 2PQNA 4ACLA 4GTTA 5D66A 2BF0X 2VSYA 2VGXA 3B13A 2I2OA 3FTWA 3AG4E 3NZSA 3TG4A 4APOA 5KCMA 3RK6A 4WNFA 4AJWA 5ENNA 3VTYA 4PS3A 3DWLG 4ANVA 2EINE 4Q69A 3LJ3A 4UI9J 5JMND 1E90A 4WWPA 4KMOA 1AP7A 4YVOA 5ENOD 2PM7A 1ELRA 1OCZE 3URZA 3RKVA 3C3OA 1ZU2A 3G2TA 1TN6A 3UQ3A 3QK0A 1LF8A 4GPKA 4B8CB 3T5VA 2CHZA 3CV0A 1V54E 3B7TA 5M72A 3L08A 5HKPA 2CFZA 4N3AA 3FUIA 3TWQA 3PEUB 2GRRB 1OWPA 4WNEA 4IRUA 2QZAA 3RO2A 1TNUA 4GTPA 4RVBA 3DSTA 3KSQA 2R5SA 3CHOA 4KBQA 5FQ7A 5BUZA 1H2UA 3QWWA 4U63A 3W9GA 5D0QD 4RG9A 3CGHA 3QKYA 4DI3A 2EIKE 3MV2B 3TWUA 4AV7A 4U0UA 2XZTG 3BG1B 4U7EB 3DPYA 1QNFA 4HRLA 4U04A 2WXPA 3ONLA 2X6JA 1E7UA 1IQUA 2NC9A 3DPDA 3PS6A 1Z3XA 4MBGA 4D10C 4FLHA 3B7RL 5T4YA 4BWRA 4NACA 3ZGQA 4JPSA 2QY7A 4B89A 4HXIA 3UXGA 3HXBA 1AWCB 3DSWA 2VGEA 3ZU7B 3S7DA 2YNQA 2RD0A 3SY2A 4LG6A 3I4RB 4MS6A 5G04C 4GTMA 4NIKA 2LUHA 3HXCA 3HVEA 4LNUD 3UPVA 4HI8A 4LERA 4M3OA 5BXUA 1KZPA 1MX4A 4NURA 2MHKA 5FZSA 1BI8B 2FO7A 3PUJA 1N94A 4A55A 1HFAA 5D2MC 1HO8A 3ULEG 5AJLA 4TXQA 4KYOB 3NQPA 4TRQA 2JEKA 4N5CA 3CVUA 5A6CA 1DCQA 3IV0A 4N3CA 3V30A 2VSNA 3JXJA 3KD7A 4GB9A 2MOWA 3D9PA 3MA5A 5LCWJ 2DWZA 3ZHEA 3FWVA 4P29A 4F6RD 3HDXA 1JPLA 2X3MA 2IU1A 2AXZA 4HOUA 1U3CA 4O1PA 2P9SG 4GYYA 2UY1A 2P58C 5CHEE 2XEEA 5FQ4A 2WXGA 3G2VA 1DCEA 4KZCA 4EHMA 5G05J 4B8AA 2B6CA 2OOEA 4N39A 4R7LA 2Y4UA 2XEVA 4QQIA 4J8DA 1JCSA 2WXIA 2WQHA 4F1SA 3ASDA 3JUIA 4KVMA 5EN5D 1U2VG 3Q4AB 3S2AA 3FDHA 3FU3A 1OT8A 1EDUA 3I4GA 2X6FA 1UG3A 2ONDA 4DX1A 3CK8A 3Q5MA 1FVHA 2V4HC 3PE4A 4JL0A 5BV0A 1MHQA 3SBSA 5BPPA 2WXNA 2JABA 1JWGA 4EBAA 1ZB1A 5CRVA 4HRNA 3LJNA 4JB8P 3SNXA 1K1AA 1BPOA 1ELKA 2KXPC 4A1SA 3JUEA 5KJMA 4I9EA 2XPIA 1S70B 1P5QA 3CHQA 3EIQC 3MGBA 3S7BA 3N71A 4BT8A 4L7TA 4Y6CA 3APCA 2YHCA 2FEZA 1WY6A 3SFZA 1YYHA 4PS7A 2J09A 2FBNA 3U9WA 2ETBA 4AY5A 1OUVA 2H6GA 3ZW3A 1NP7A 5ANRA 5ANLA 5JHAA 2CG2A 3RSEG 4U95D 2L0TB 4N2SA 3AG3E 2XHEA 1TNOA 3CVLA 3VTXA 1B89A 2P9PG 3JXIA 1TEZA 1D9SA 3AS8A 1BU9A 4JD2G 4N5QA 1O1SA 5AYWD 2ILRA 4KVOA 3GW4A 2VYIA 2WXJA 3J5QB 1Y8MA 2R03A 4DJAA 2R2LA 5ENRD 5CEDB 5DBKA 5AIJA 1IHGA 4GAAA 3ABME 4LEUA 3MKQB 1N11A 5EILA 3LEWA 1GW6A 3C5RA 1JCRA 3OTNA 3TGOA 4OAVB 1L5JA 1ZBPA 3Q78A 1UJKA 3OAWA 3RRNB 2L0IA 4OYSA 4IULA 4JVSA 3MCXA 4B93B 5ARFA 1NZNA 3ESKA 1RZ4A 3D9MA 4BFRA 2QFCA 3UT4A 2MYOA 4HI9A 2GRPB 3APFA 4BX9A 3JQ0A 3L16A 3R9AB 1Y6IA 3CVXA 3MV3B 4XZ4A 4C48B 4UQXA 1FVFA 3CVNA 2XRYA 3QJZA 3NOCD 2EQXA 3PRZA 5FINA 3ZRHA 2OEWA 4CCAA 3CVPA 3IBEA 3UIPC 3PEVB 2NSZA 3ZXSA 1A5EA 1MZCA 1QBQA 4G11A 3UM1A 3FH7A 2XPZA 4CGWA 1OXJA 3QARA 2DBAA 2LAHA 2ZU6B 1BD8A 4FJYA 4K0RA 3IHVA 5EIDA 1LD8A 2WM9A 4ANWA 4TV3A 4CT0A 3JCKC 5KWDA 2Q7FA 1DVPA 3RIBA 4HLLA 1KT1A 2MRIA 4BT9A 4HLEA 4TUMA 4J6IA 4I1MA 4OAUC 1EYHA 3F6QA 2H6FA 5ENTD 3FTVA 3FTSA 3FEYA 3E32A 5HRYA 3IXEA 4I2WA 4G26A 2I6HA 4GZ5A 5G2NA 4C0EA 2H6IA 3DXKG 4GA2A 3ISMC 5A7DB 1Z6TA 3FTZA 2ZIRA 3QC1A 5FQ6A 3ZYMA 1S64A 1E8YA 3CHMA 4WUYA 3Q9NC 3QWPA 4UWFA 3DSUA 5ENQD 2F37A 2HE0A 3HRAA 5B1AE 3PZ3A 2Y69E 3HXEA 3U64A 4A3TA 2CHWA 3LVRE 4DLQA 4J0UA 1INZA 5BT1A 4U8HA 5LCWC 4GMRA 4BY6A 3P1UA 4U0ZA 4XX5A 3C3QA 5ENPD 3SD5A 5E75A 2QC9A 4UQYA 2VGXB 1KLXA 3PVLA 4BESA 1DNPA 4B94A 5CRUA 3NZUA 3DSXA 4GTVA 2ETCA
chains in the Genus database with same CATH topology
3LXUX 2X6KA 3NQPA 2J9QA 4TRQA 2JEKA 4N5CA 3CVUA 3LVQE 5A6CA 3QWVA 4GZDA 3UT8A 4GZCA 4L1BA 4F53A 3KAEA 1JUQA 3IV0A 5G05C 4JEUA 3TXMA 4GMJA 4N3CA 3FHEA 2VSNA 3G2UA 5G04J 3G2SA 4XI0A 3KD7A 3HYMB 3U3WA 1QZ2A 4DK5A 4GZ3A 3Q15A 4GB9A 2MOWA 3ESLA 3D9PA 1PY1A 3MA5A 4JA9A 5AJDA 5LCWJ 2A5UA 5BW8C 3ZHEA 5AENA 1WAO1 1Z3YA 4UWKA 3FWVA 4AEZC 4FLBA 4P29A 1OWNA 4N2QA 4CGVA 3EHMA 3HDXA 4LUNU 1JPLA 4OVVA 4HORA 4B0ZA 4G1TA 2XCCA 3MKQA 4AIFA 2X3MA 3B7UX 5BNWA 1TJCA 2WB2A 3RU0A 2IU1A 2XQ0A 4URKA 3D9OA 4L2YA 2AXZA 2FULA 2IQCA 1HE8A 3D3MA 1MQSA 3GZ2A 3HHMA 4HOUA 1U3CA 3LY8A 2X38A 2FI7A 1PAQA 4L2LA 4GYYA 3UX4A 2WXLA 2HO1A 2KCKA 5J90A 2HR2A 1X5BA 2UY1A 3MEKA 4UWGA 4WAFA 3SI5A 4GZ6A 3SF4A 2P58C 5CHEE 3RRUA 1JWFA 2UWJG 5FQ4A 4ACKA 2WXGA 3K9IA 4ATGA 2L9BA 3CQGB 3G2VA 4KZCA 4ANUA 5LX8A 5G05J 4N3BA 4B8AA 4CDNA 2OOEA 2I1KA 4N39A 4R7LA 2JLBA 2Y4UA 2XEVA 3PNLB 1YA0A 1HH8A 2VTBA 1OWLA 4J8DA 4WNGA 3U4TA 4JC8A 5CMYA 3FUJA 2A4ZA 2Y3AA 4BTAA 5JJ7A 2WXIA 3TG5A 2C0MA 2WQHA 5FJYA 3R7QA 4F1SA 1S0PA 4BTBA 3LCAA 2BUGA 2YQ8A 3ASDA 3JUIA 4WWOA 3ZVVA 4FJZA 4KVMA 3CVVA 2XPYA 3Q4AB 4JHJA 1H2VC 4FHJA 3PH0C 3S2AA 5FT9A 3FDHA 3LKUA 2J4DA 3FU3A 3QNKA 4I6EA 4JXTA 4HOSA 1EDUA 3DBSA 3I4GA 2M63A 4I43A 2BTDA 2X6FA 4RSYA 1UG3A 3HIZA 1WM5A 2ONDA 3CK8A 3Q5MA 3CHRA 1FVHA 1HF8A 2GGFA 3PE3A 2C2LA 3PE4A 4H7XA 4JL0A 5BV0A 1MHQA 1E7VA 3TAXA 4C9BB 3ASHA 3SBSA 1E96B 5BPPA 4J8EA 2WXNA 2C0LA 3CK9A 3O48A 4G25A 1H6KA 4LCTA 2GRMA 4G24A 1HZ4A 2DCPA 4UWLA 1VDYA 1JWGA 5DIZA 5JJTA 4L23A 4EBAA 4FU3A 5E76A 2R59A 4C0MA 5C1DA 3FEXA 3UMVA 4DLOA 2J08A 3IKOB 4JA7A 3IHYA 3SNXA 4AOFA 3EJNA 3ZIMA 2XGMA 4I1OB 1BPOA 1IYGA 1ELKA 3SZ7A 3L54A 2OV8A 5EX0A 4OVUA 2J49A 1HS6A 2WMOA 3L13A 3ULQA 4A1SA 3AU4A 3CVWA 3FU0A 3OXLA 5KJMA 4I9EA 4F3VA 5T3RA 3CSTA 2XPIA 3FFLA 3S7JA 1HG5A 1OWOA 2IJGX 3CLJA 4ILHB 3FUKA 2IOSA 1P5QA 3CHQA 3EIQC 4ANXA 2WXFA 3MGBA 3IEGA 3N71A 3S7BA 3G2WA 4L7TA 4Q94A 1SZ9A 4Y6CA 3APCA 3TXNA 4BT8A 4CDMA 3JQ1A 4O6FA 4WWNA 3MZLB 2YHCA 2FEZA 3AU5A 4F7AA 2AWIA 5BV1A 5D0OD 1TJFA 1WY6A 3SFZA 5A23A 3FUFA 3I5PA 2HM8A 2V5FA 4K03A 4NQ0A 2WXHA 5EX3A 2V4LA 2OVBA 4JZYA 4PS7A 2J09A 3D9NA 4GYWA 5G55A 4XKCA 5FZQA 3HVEB 2FBNA 3ZYKA 2AVPA 4UWHA 3CVQA 5FWQA 5KJKA 2IOLA 3OXFA 3U9WA 4EZKA 3ML8A 3QOUA 2J07A 3CIAA 3SHFA 3LY9A 1HG2A 2WQ6A 4AY5A 1OUVA 4GMLA 3ZFWA 3ZW3A 2FF4A 1NP7A 3L22A 5ANRA 4IN3B 1EF1C 2E0IA 2OVFA 5ANLA 4FHKA 1XNFA 2CG2A 4CRWA 5JHAA 2PM6A 2NXPA 4ILIA 4GA1A 1UN9A 4DI4A 2Y4TA 4UI9K 2L0TB 3AS5A 3QAQA 4I9CA 4MRUA 4BX8A 2KZTA 4N2SA 4I17A 3SGHA 3FH8A 2XHEA 2RG8A 3NF1A 3LYAA 3CVLA 3VTXA 4GCNA 1B89A 4J8FA 2WXKA 2I1JA 4FADA 3PZDA 3TL5A 1TEZA 3AS8A 4ILGA 2XGOA 3VLDA 3CKCA 5CCLA 4EQFA 5HQ8A 3UUXA 1PC2A 1W3BA 2CG3A 3ASGA 2KC7A 4HS2A 1E8XA 3GZ1A 5AYWD 2ILRA 1SZAA 4KVOA 4PDXA 2HYZA 3GW4A 2VYIA 3WXXA 4FA6A 3CQCB 2WXJA 4DPRA 4V3IA 3T8MA 4I1AA 3FTXA 1N52A 2WXMA 1Y8MA 3RJVA 4CDRA 4GA0A 4DJAA 4XE0A 2KCLA 3PDNA 3ENEA 4XIFA 3CHSA 5ARGA 3ZHEB 2LNIA 4U07A 4XKBA 5DBKA 5AIJA 1IHGA 1A17A 3VLEA 4JHKA 2X6HA 2V0PA 4GAAA 1E8ZA 3FU6A 2XGSA 4LEUA 5FZRA 3MKQB 2KATA 2LO6A 3FH5A 1HU3A 3LS8A 3FY4A 3CK7A 1N54A 5HI7A 3FUNA 3LEWA 2VGYA 1GW6A 3EDTB 2PQNA 4RG6A 3OTNA 4ACLA 3FULA 3FUHA 3TGOA 1XGWA 3O4ZA 1UN8A 4U0SA 3FU5A 3ZEFA 2BF0X 4GYOA 4I6GA 5EDSA 2L6JA 3L17A 1L5JA 2UY1B 4APFA 1ZBPA 3PNTB 1UJKA 2VSYA 3GYZA 2VGXA 3OAWA 2IONA 2L0IA 2LAIA 3RRNB 3B13A 2I2OA 4OYSA 2WPVA 4IULA 4JVSA 3BG0B 3FTWA 5JHBA 2WXQA 3NZSA 3MCXA 3TG4A 4YVQC 4APOA 4EPZA 5KCMA 3RK6A 2VTBB 4WNFA 5ARFA 1NZNA 4I2ZA 3ESKA 4AJWA 3U66A 5ENNA 5JJ6A 3VTYA 2WXOA 4PS3A 2KCVA 3D9MA 4BFRA 3RO3A 2LSUA 4I6JA 2AXVA 4ANVA 2QFCA 3UT4A 5FTPA 4WNDA 4Q69A 3LJ3A 4UI9J 4AXHA 4JEHA 3FTUA 3APFA 4BX9A 3JQ0A 3CHPA 1E90A 3L16A 4MLPA 3R9AB 4WWPA 4KMOA 3PREA 4EBAG 4YVOA 1Y6IA 2VSXE 3CVXA 3MV3B 4BSXA 2CHXA 4XZ4A 4EECA 2PM7A 1U3DA 2AXUA 3BEEA 3I3NA 1FVFA 4UQXA 1ELRA 2GW1A 3URZA 2J4BA 3CVNA 2V8SE 2WXRA 3RKVA 2XRYA 3D9KA 3QJZA 2I9CA 4AY6A 2EQXA 2WMNA 5EKQD 4FC8A 4JW1A 4EZJA 3PRZA 3ZRHA 1ZU2A 4ABNA 4AP2A 4PS8A 3G2TA 3LDZA 3FUDA 4G23A 4CCAA 3CVPA 3IBEA 3UQ3A 3PEVB 2NSZA 3ZXSA 3QK0A 3RRMB 3FP3A 1LF8A 3FTYA 4ME2A 4GPKA 4G11A 4B8CB 3KEZA 3FH7A 2DIWA 3T5VA 1IQRA 2XPZA 4CGWA 5J08A 4FULA 1ELWA 3LY7A 2CHZA 3GZSA 2PL2A 3QARA 3D9IA 2DBAA 3CEQA 2LAHA 3B7TA 3CV0A 5M72A 3L08A 2CFZA 2ZU6B 3JYSA 4FJYA 4HFGA 3MYVA 3FUIA 3IHVA 4K0RA 4N3AA 3B7SA 3PEUB 1H19A 2CFUA 4KXKB 2WM9A 3EHNA 3MKRA 3ZYQA 1OWPA 2IFUA 2PQRA 2E2EA 4IRUA 4WNEA 4ANWA 4TV3A 3MX3A 3RO2A 3SBTB 4CT0A 3JCKC 4RVBA 2R5SA 2Q7FA 4KZ0A 1DVPA 3RIBA 3CHOA 4KBQA 4E6HA 1KT1A 5C2YA 2MRIA 2VQ2A 4AVXA 4BT9A 2PZIA 4E85A 4HLEA 1HXIA 5FQ7A 4J6IA 4I1MA 5BUZA 2XCBA 4W9RA 2WQ7A 1H2UA 3QWWA 4U63A 4HOTA 4J8SA 5D0QD 4RG9A 2KM4A 3CGHA 3QKYA 4H7YA 3ZN3A 4DI3A 3MV2B 3D9LA 2R17C 3PUKA 1NA3A 1OWMA 3TJPA 4AV7A 3Q47B 4PUCA 5CMWA 1EYHA 1UW4B 3CR3A 1E8WA 4U0UA 2GRLA 3UT7A 3BG1B 2VSOE 3FTVA 3D9JA 3FTSA 3FEYA 1QNFA 2WVIA 4U04A 5LOZA 4XI9A 1UJJA 4FP7A 2WXPA 3ONLA 4I2WA 4HOQA 2X6JA 2I6HA 4G26A 4GZ5A 4UI9C 4GU5A 4A3VA 2AW6A 3C98A 4MKTA 1E7UA 5G2NA 4C0EA 2KZTB 1IQUA 4GA2A 1FCHA 2NC9A 3ML9A 3ZPJA 3DPDA 3AS4A 4PH4B 4GCOA 1NA0A 3PS6A 1Z3XA 5A7DB 3R7RA 3LPZA 3CKBA 3APDA 5FQ8A 3QB2A 4D10C 1Z6TA 4FLHA 3B7RL 3FTZA 5T4YA 1HX8A 3QC1A 4JHRA 4Y6WA 5FQ6A 4BWRA 3ZYMA 4NACA 4HVBA 3ZGQA 1E8YA 3CHMA 4IYPA 4JPSA 4G2VA 5LFAA 4Q96A 2X6IA 4WUYA 4A1GA 1QQEA 2QY7A 5KJNA 3QWPA 4TUUA 3T5XA 4UWFA 4B89A 3Q49B 4HXIA 5T8IA 3EIJA 3S7DA 4AM9A 3L6AA 2YNQA 3VLFA 3U64A 4A3TA 1SQMA 2CHWA 2RD0A 3FUMA 5CCMA 5G04C 3I4RB 4MS6A 5KJLA 3LVRE 1EPUA 4DLQA 4J0UA 4YNDA 1INZA 5BT1A 3MJWA 2YHEA 3FUEA 3HVEA 4U8HA 5LCWC 4BY6A 1KT0A 3P1UA 4U0ZA 3CVYA 4XX5A 3UPVA 3SD5A 5E75A 4UQYA 2XRZA 1H0AA 2VJ8A 4EZLA 2VGXB 4LERA 4M3OA 4CEMA 1KLXA 3ONKA 3P2BA 2IF4A 3PVLA 4KT6B 4UQZA 2LSVA 3E4BA 2MHKA 3OXGA 4NRHB 1DNPA 1H2TC 4NURA 5FZSA 4B94A 4CT4A 2FO7A 3PUJA 5LP0A 3QDNA 4A55A 1HFAA 4QFVA 4LRZA 1HO8A 3NZUA 3KS2A 2YINA 3ASFA 5AJLA 3S7FA 3ZYLA 3CSFA 4KYOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9Q A;  4N5C A;  5A6C A;  3QWV A;  3KAE A;  5G05 C;  4N3C A;  2VSN A;  5G04 J;  4XI0 A;  3KD7 A;  3HYM B;  3U3W A;  1QZ2 A;  4GZ3 A;  3Q15 A;  3MA5 A;  4JA9 A;  5LCW J;  5BW8 C;  3ZHE A;  1WAO 1;  3FWV A;  4N2Q A;  4CGV A;  4HOR A;  4G1T A;  2XCC A;  4AIF A;  5BNW A;  1TJC A;  3RU0 A;  3GZ2 A;  4HOU A;  3LY8 A;  2FI7 A;  4GYY A;  2HO1 A;  2KCK A;  2HR2 A;  2UY1 A;  3MEK A;  4GZ6 A;  3SF4 A;  2P58 C;  5CHE E;  2UWJ G;  3K9I A;  5G05 J;  4N3B A;  2OOE A;  4N39 A;  2JLB A;  2Y4U A;  2XEV A;  1YA0 A;  1HH8 A;  4J8D A;  4WNG A;  3U4T A;  5JJ7 A;  4BTA A;  3TG5 A;  2C0M A;  2WQH A;  5FJY A;  4BTB A;  3LCA A;  2BUG A;  2YQ8 A;  3ASD A;  3Q4A B;  5FT9 A;  3LKU A;  4HOS A;  1WM5 A;  2OND A;  3CK8 A;  3Q5M A;  3PE3 A;  2C2L A;  3PE4 A;  4H7X A;  4JL0 A;  3TAX A;  3ASH A;  1E96 B;  4J8E A;  2C0L A;  3CK9 A;  3O48 A;  4G25 A;  4G24 A;  1HZ4 A;  5DIZ A;  5JJT A;  5C1D A;  4JA7 A;  2XGM A;  1IYG A;  3SZ7 A;  5EX0 A;  3ULQ A;  4A1S A;  3OXL A;  5KJM A;  4I9E A;  4F3V A;  2XPI A;  3FFL A;  3S7J A;  1P5Q A;  3S7B A;  3IEG A;  3N71 A;  4BT8 A;  4Y6C A;  4O6F A;  2YHC A;  2FEZ A;  5D0O D;  2V5F A;  4NQ0 A;  5EX3 A;  4GYW A;  5FZQ A;  2FBN A;  2AVP A;  3CVQ A;  5KJK A;  3OXF A;  3QOU A;  3LY9 A;  4AY5 A;  1OUV A;  3ZFW A;  2FF4 A;  4IN3 B;  1XNF A;  4GA1 A;  2Y4T A;  4UI9 K;  4I9C A;  3AS5 A;  4N2S A;  4I17 A;  3NF1 A;  3LYA A;  3CVL A;  3VTX A;  4GCN A;  1B89 A;  4J8F A;  3AS8 A;  2XGO A;  3CKC A;  5CCL A;  4EQF A;  3UUX A;  1PC2 A;  1W3B A;  3ASG A;  2KC7 A;  3GZ1 A;  5AYW D;  3WXX A;  2HYZ A;  3GW4 A;  2VYI A;  4I1A A;  1Y8M A;  3RJV A;  4CDR A;  4GA0 A;  2KCL A;  5ARG A;  4XIF A;  3PDN A;  3ZHE B;  2LNI A;  4U07 A;  5DBK A;  1IHG A;  1A17 A;  4LEU A;  2XGS A;  5FZR A;  2KAT A;  3CK7 A;  5HI7 A;  2VGY A;  3EDT B;  2PQN A;  4RG6 A;  3TGO A;  4U0S A;  4GYO A;  2L6J A;  2UY1 B;  1ZBP A;  2VSY A;  3GYZ A;  2VGX A;  2WPV A;  3TG4 A;  4YVQ C;  4APO A;  4WNF A;  5ARF A;  1NZN A;  4I2Z A;  3ESK A;  5JJ6 A;  3VTY A;  2KCV A;  3RO3 A;  2LSU A;  2QFC A;  5FTP A;  4WND A;  4UI9 J;  3R9A B;  4YVO A;  3MV3 B;  3BEE A;  4UQX A;  1ELR A;  2GW1 A;  3URZ A;  3CVN A;  3RKV A;  4AY6 A;  5EKQ D;  1ZU2 A;  4ABN A;  4G23 A;  3CVP A;  3UQ3 A;  3FP3 A;  4ME2 A;  4GPK A;  4CGW A;  1ELW A;  3LY7 A;  2PL2 A;  2DBA A;  3CEQ A;  3CV0 A;  5M72 A;  3JYS A;  4N3A A;  4KXK B;  3MKR A;  4WNE A;  2IFU A;  2PQR A;  2E2E A;  3RO2 A;  2R5S A;  2Q7F A;  3RIB A;  4KBQ A;  1KT1 A;  2VQ2 A;  4BT9 A;  2PZI A;  1HXI A;  2XCB A;  4W9R A;  4HOT A;  3QWW A;  5D0Q D;  4RG9 A;  3ZN3 A;  3QKY A;  4H7Y A;  3MV2 B;  1NA3 A;  3Q47 B;  4U0U A;  4U04 A;  4XI9 A;  4I2W A;  4HOQ A;  4G26 A;  2I6H A;  4GZ5 A;  4UI9 C;  4GA2 A;  1FCH A;  2NC9 A;  3ZPJ A;  3AS4 A;  4GCO A;  1NA0 A;  5A7D B;  3LPZ A;  3CKB A;  4JHR A;  4Y6W A;  4BWR A;  3ZGQ A;  4G2V A;  4WUY A;  1QQE A;  5KJN A;  3QWP A;  3Q49 B;  3S7D A;  4AM9 A;  5CCM A;  5G04 C;  5KJL A;  4J0U A;  4YND A;  5BT1 A;  5LCW C;  1KT0 A;  4U0Z A;  3UPV A;  4UQY A;  2VGX B;  1KLX A;  2IF4 A;  4UQZ A;  2LSV A;  4NRH B;  2MHK A;  3E4B A;  3OXG A;  4B94 A;  5FZS A;  5HQ8 A;  2FO7 A;  3QDN A;  3KS2 A;  3ASF A;  3S7F A;  4KYO B; 
#chains in the Genus database with same CATH topology
 3LXU X;  2J9Q A;  2OEV A;  1N0R A;  3ASO E;  2H6H A;  2R02 A;  3LVQ E;  3QWV A;  4GZC A;  5EYP F;  4L1B A;  4F53 A;  1MJ0 A;  1JUQ A;  5G05 C;  1N0Q A;  3TXM A;  4GMJ A;  3U3W A;  2LXL A;  3Q15 A;  3HXD A;  5KBA A;  4K5A B;  4FLB A;  1OWN A;  2EIM E;  1DC2 A;  3EU9 A;  4G1T A;  2XCC A;  4AIF A;  4RQI A;  2WB2 A;  3RU0 A;  4HQD A;  3W9F A;  2FUL A;  1HE8 A;  1MQS A;  3HHM A;  4TXP A;  1MX2 A;  2X38 A;  3RAU A;  2KCK A;  1O1R A;  4WAF A;  3SF4 A;  4ACK A;  3CQG B;  4K5B A;  4CDN A;  2I1K A;  2JLB A;  1HH8 A;  2ZIS A;  2VTB A;  4GTR A;  4BTA A;  3R7Q A;  5FJY A;  4BTB A;  3BUA A;  2XPY A;  1TNY A;  4JHJ A;  4FHJ A;  5KNH D;  2J4D A;  3QNK A;  4HOS A;  4JXT A;  3DBS A;  4I43 A;  2BTD A;  4BSZ B;  2ZGG A;  1E7V A;  1E96 B;  2P2C P;  3O48 A;  3CK9 A;  4LCT A;  1TN7 A;  4UWL A;  5JJT A;  4C0M A;  5AQ9 A;  3FEX A;  3UMV A;  4JA7 A;  2XGM A;  4F1P A;  2OV8 A;  3C3R A;  4OVU A;  1IXV A;  3ULQ A;  4YDO A;  3AU4 A;  1D8D A;  3FFL A;  1HG5 A;  3E33 A;  3T8K A;  2FO1 E;  2IY0 C;  4ANX A;  3IEG A;  1SZ9 A;  3TXN A;  3JQ1 A;  4O6F A;  2XEH A;  3ZUV B;  3AU5 A;  2AWI A;  5AN8 A;  5D0O D;  1TJF A;  3FUF A;  3I5P A;  2HM8 A;  4K03 A;  5EX3 A;  4JZY A;  5G55 A;  3HVE B;  4UWH A;  3CVQ A;  4EZK A;  3ML8 A;  3CIA A;  2FF4 A;  1N9A A;  2OVF A;  3NB2 A;  2J8S D;  1XNF A;  4FHK A;  5IY5 E;  2NXP A;  4GA1 A;  1UN9 A;  3DRA A;  3QAQ A;  4BX8 A;  4MRU A;  2KZT A;  3FH8 A;  2RG8 A;  3NF1 A;  4GCN A;  4FAD A;  3CKC A;  5CCL A;  4EQF A;  1PC2 A;  1W3B A;  3ASG A;  4HS2 A;  4L9P A;  1SZA A;  3CQC B;  4DPR A;  3KEA A;  4I1A A;  4ZFH A;  2WXM A;  3J5P A;  3ULY A;  4GA0 A;  4XIF A;  4O1O A;  3ZHE B;  4XKB A;  1N4R A;  2DYR E;  2X6H A;  2V0P A;  4YDW A;  2XGS A;  5ENS D;  3C72 A;  1O1T A;  1HU3 A;  2LXM A;  3UIO C;  2VGY A;  3EDT B;  3FUL A;  3FUH A;  3O4Z A;  4U0S A;  3ZEF A;  3AAA C;  3L17 A;  2UY1 B;  3GYZ A;  3Q7A A;  2WXQ A;  4I2Z A;  3U66 A;  2WXO A;  2KCV A;  1LD7 A;  5B1B E;  4X8Q A;  2DVW A;  2IO3 C;  5FTP A;  4GTQ A;  4AXH A;  4MLP A;  3ABK E;  2VSX E;  1JCQ A;  1U3D A;  2AXU A;  3BEE A;  3I3N A;  2J4B A;  1Z5S C;  2Y1L E;  3D9K A;  5AQB A;  3AG1 E;  2F0Y A;  5EKQ D;  4JW1 A;  4AP2 A;  3NOG D;  4PS8 A;  3LDZ A;  4G23 A;  1N4Q A;  1NI1 A;  3FP3 A;  3FTY A;  4ME2 A;  4DX6 D;  3KEZ A;  1ELW A;  3LY7 A;  3EU5 A;  3D9I A;  3CEQ A;  3PZ4 A;  4HFG A;  3B7S A;  3EHN A;  3MKR A;  1BI7 B;  3ZYQ A;  2PQR A;  2E2E A;  5KNG A;  3MX3 A;  4KZ0 A;  2V5Q C;  5C2Y A;  4AVX A;  2PZI A;  1HXI A;  2XCB A;  4W9R A;  2WQ7 A;  3ZN3 A;  2KM4 A;  4H7Y A;  3D9L A;  2R17 C;  1OWM A;  3CR3 A;  1E8W A;  2GRL A;  2RFA A;  3D9J A;  2PNN A;  2BED A;  4TXR A;  2WVI A;  1UJJ A;  4UI9 C;  4GU5 A;  2AW6 A;  3ML9 A;  1KPS B;  3AS4 A;  3B7B A;  1KZO A;  4PH4 B;  4GCO A;  3LPZ A;  3B95 A;  4LSZ E;  2XS8 A;  4M7C A;  1HX8 A;  4JHR A;  4HVB A;  4GPM A;  5LFA A;  4Q96 A;  2X6I A;  4A1G A;  1QQE A;  5FIO A;  5T8I A;  1K1B A;  2ETA A;  3EIJ A;  4LNG A;  2IO2 C;  2EIJ E;  3L6A A;  2QYU A;  1SQM A;  3ZNG A;  1BLX B;  5HS0 A;  5KJL A;  2YHE A;  3FUE A;  1OCO E;  2XS1 A;  4CEM A;  1FT2 A;  2F8Y A;  2IF4 A;  3E4B A;  3OXG A;  5LP0 A;  1H2T C;  4HRM B;  4CT4 A;  5AAR A;  3TWR A;  5BXO A;  3ZYL A;  2DYS E;  3CSF A;  3UM2 A;  2X6K A;  4GZD A;  3KAE A;  1V55 E;  4JEU A;  3G2U A;  4XI0 A;  3Q7F A;  4K5C A;  4DK5 A;  3ESL A;  4JA9 A;  4DRX E;  5CEC B;  1Z3Y A;  4AEZ C;  4N2Q A;  3EHM A;  1N4S A;  3B7U X;  1MX6 A;  2BKG A;  2XQ0 A;  4URK A;  2IQC A;  1PAQ A;  4A63 B;  4L2L A;  3UX4 A;  3E34 A;  5J90 A;  4BEP A;  2ZXW E;  4LNB A;  3RRU A;  2UWJ G;  4ANU A;  3K9I A;  5LX8 A;  4N3B A;  5B3S E;  1YA0 A;  1OWL A;  4JC8 A;  5JJ7 A;  2Y3A A;  2AJA A;  3TG5 A;  3TWV A;  3LCA A;  3PZ2 A;  1H2V C;  5FT9 A;  4I6E A;  4RSY A;  1WM5 A;  2GGF A;  1FPP A;  1HF8 A;  2C2L A;  4C9B B;  3ASH A;  4J8E A;  4G25 A;  2GRM A;  3TWX A;  1HZ4 A;  1VDY A;  5DIZ A;  4L23 A;  4FU3 A;  4ZHB A;  5E76 A;  3IHY A;  3UM3 A;  4I1O B;  1IYG A;  3L54 A;  1LTX A;  2J49 A;  1HS6 A;  2WMO A;  2A5E A;  2L6B A;  3R9M A;  3FU0 A;  3CST A;  4O60 A;  1OWO A;  2IJG X;  2WXF A;  2KBX A;  3G2W A;  4Q94 A;  4CDM A;  4WWN A;  4F7A A;  5BV1 A;  3EUV A;  4HB5 A;  4NQ0 A;  2WXH A;  2OVB A;  4U8V D;  4GYW A;  5FZQ A;  2AVP A;  5KJK A;  3OXF A;  3QOU A;  3SHF A;  3HG0 D;  2WQ6 A;  1YCS B;  3ZFW A;  3L22 A;  3HXF A;  2PM6 A;  4ILI A;  3Q75 A;  4UI9 K;  4I9C A;  3AS5 A;  3SGH A;  4J8F A;  2WXK A;  3PZD A;  2EIL E;  3VLD A;  1OCC E;  3DEP A;  3UUX A;  1IHB A;  2KC7 A;  2NYJ A;  3E30 A;  1E8X A;  3GZ1 A;  2HYZ A;  4FA6 A;  4V3I A;  1N52 A;  3RJV A;  4CDR A;  4XE0 A;  2KCL A;  5ARG A;  4CYM D;  3CHS A;  4XEI G;  2LNI A;  2P9U G;  4U07 A;  5AAO A;  3VLE A;  4JHK A;  3TWT A;  3FU6 A;  2KAT A;  2RFM A;  2LO6 A;  3NAW A;  3CK7 A;  1N54 A;  5HI7 A;  4RG6 A;  2ZGD A;  5ITZ F;  1XGW A;  1UN8 A;  3FU5 A;  4I6G A;  4GYO A;  5EDS A;  2L6J A;  5CEA A;  3PNT B;  2ION A;  2LAI A;  4HNA D;  3SFY A;  3V79 K;  2WPV A;  3BG0 B;  4DX5 D;  5JHB A;  4YVQ C;  3EHR A;  4EPZ A;  2VTB B;  5JJ6 A;  3RO3 A;  2LSU A;  4I6J A;  2AXV A;  4DX7 D;  1OY3 D;  4WND A;  4JEH A;  2B0O E;  3FTU A;  1TNZ A;  3CHP A;  4EBA G;  3PRE A;  2P9L G;  3UIN C;  4BSX A;  2CHX A;  1K3Z D;  4EEC A;  2GW1 A;  2V8S E;  2WXR A;  1WDY A;  3DXM G;  2I9C A;  4AY6 A;  1N4P A;  2WMN A;  5CBN A;  4FC8 A;  1S63 A;  4ABN A;  3FUD A;  4DUI A;  3AJI A;  3TWS A;  3RRM B;  4DX2 A;  3DEO A;  2DIW A;  1IQR A;  5J08 A;  3Q9U C;  4FUL A;  4HBD A;  3GZS A;  2PL2 A;  3JYS A;  3MYV A;  3V2O A;  1H19 A;  2CFU A;  4KXK B;  5AQ7 A;  2IFU A;  3D9H A;  5EIB E;  3SBT B;  3X2Q E;  4E6H A;  1UOH A;  4E85 A;  2VQ2 A;  4HOT A;  2RKK A;  4J8S A;  4GTS A;  3PUK A;  1H6O A;  1NA3 A;  3TJP A;  3Q47 B;  4PUC A;  5CMW A;  1UW4 B;  4J8Y A;  1G3N B;  3UT7 A;  2VSO E;  3SFX A;  5LOZ A;  3Q79 A;  4XI9 A;  4FP7 A;  4HOQ A;  1N95 A;  4A3V A;  3C98 A;  4MKT A;  2KZT B;  4Z68 A;  1FCH A;  5CER B;  3ZPJ A;  1NA0 A;  4CZ2 D;  1FT1 A;  4U8Y D;  1SVX A;  2P9N G;  3ASN E;  3R7R A;  3CKB A;  3APD A;  5FQ8 A;  3QB2 A;  2IEJ A;  1TNB A;  3L82 A;  4Y6W A;  2GRN B;  4IYP A;  2GRQ B;  1TR4 A;  4G2V A;  4G8K A;  5KJN A;  4TUU A;  3T5X A;  3Q49 B;  1H6P A;  3UTM A;  3AG2 E;  4AM9 A;  3VLF A;  2F8X K;  1SA4 A;  5CCM A;  3FUM A;  1K8K G;  3UKR G;  1WG0 A;  1EPU A;  4YND A;  3MJW A;  4GTO A;  1KT0 A;  3CVY A;  1IKN D;  2XRZ A;  1H0A A;  2VJ8 A;  5CBO A;  4EZL A;  3P2B A;  4KT6 B;  3ONK A;  4APF A;  4UQZ A;  4EZJ A;  2LSV A;  4NRH B;  5HQ8 A;  2P9K G;  3QDN A;  3L9T A;  1SW6 A;  4QFV A;  4LRZ A;  3V31 A;  3KS2 A;  2YIN A;  3ASF A;  1X81 A;  3S7F A;  4YDE A;  3BU8 A;  5H7P A;  3UT8 A;  3ZKJ A;  2P9I G;  4RLY A;  4J7W A;  4ATZ D;  3FHE A;  5G04 J;  3G2S A;  3HYM B;  1QZ2 A;  4GZ3 A;  2OCC E;  1PY1 A;  5AJD A;  2A5U A;  5BW8 C;  5AEN A;  1WAO 1;  2QYJ A;  4UWK A;  4CGV A;  3UI2 A;  4G8L A;  4LUN U;  2GRO B;  4OVV A;  4HOR A;  4B0Z A;  3MKQ A;  5BNW A;  1TJC A;  4UUC A;  3D9O A;  4L2Y A;  3D3M A;  3GZ2 A;  3EHQ A;  3NBN B;  3LY8 A;  2FI7 A;  3DSV A;  2WXL A;  2HO1 A;  4YDY A;  2HR2 A;  1X5B A;  1YMP A;  3MEK A;  4UWG A;  3SI5 A;  4GZ6 A;  2DZO A;  1QYM A;  1JWF A;  4ATG A;  2L9B A;  3UKU G;  3SQV A;  3PNL B;  1Q2Z A;  5AQA A;  4WNG A;  3U4T A;  5CMY A;  3FUJ A;  2A4Z A;  2C0M A;  3BQO A;  1S0P A;  2BUG A;  2YQ8 A;  4WWO A;  3ZVV A;  4FJZ A;  3CVV A;  3PH0 C;  3LKU A;  1SA5 A;  3ZXP A;  3UM0 A;  1OCR E;  2M63 A;  3HIZ A;  3SO8 A;  3CHR A;  3V2X A;  3PE3 A;  4H7X A;  3TAX A;  1TN8 A;  2C0L A;  3TWW A;  1H6K A;  4G24 A;  1TYQ G;  2DCP A;  2DZN A;  2R59 A;  5C1D A;  4DLO A;  2J08 A;  3IKO B;  4AOF A;  3EJN A;  1NL4 A;  3ZIM A;  3ABL E;  3SZ7 A;  5EX0 A;  1O5M A;  3L13 A;  3WG7 E;  3CVW A;  3OXL A;  4F3V A;  5T3R A;  3S7J A;  3CLJ A;  4ILH B;  3FUK A;  2IOS A;  4BER A;  3MZL B;  3E37 A;  1D8E A;  5A23 A;  2V5F A;  2V4L A;  3D9N A;  2BKK B;  4XKC A;  3ZYK A;  1RW2 A;  5JA4 D;  5FWQ A;  2IOL A;  2J07 A;  5EYL A;  3LY9 A;  1HG2 A;  3T9K A;  1NFI E;  4GML A;  3DSS A;  4IN3 B;  1EF1 C;  2E0I A;  2R05 A;  4CRW A;  4DI4 A;  3KSL A;  2Y4T A;  2Y0B G;  4I17 A;  3LYA A;  2I1J A;  3TL5 A;  4ILG A;  2XGO A;  2XEN A;  2CG3 A;  4PDX A;  3WXX A;  3T8M A;  3FTX A;  2XZD G;  4BET A;  3PDN A;  3ENE A;  3Q73 A;  4U96 D;  1A17 A;  1E8Z A;  5FZR A;  3FH5 A;  3LS8 A;  1MYO A;  3FY4 A;  3FUN A;  3PZ1 A;  2PQN A;  4ACL A;  4GTT A;  5D66 A;  2BF0 X;  2VSY A;  2VGX A;  3B13 A;  2I2O A;  3FTW A;  3AG4 E;  3NZS A;  3TG4 A;  4APO A;  5KCM A;  3RK6 A;  4WNF A;  4AJW A;  5ENN A;  3VTY A;  4PS3 A;  3DWL G;  4ANV A;  2EIN E;  4Q69 A;  3LJ3 A;  4UI9 J;  5JMN D;  1E90 A;  4WWP A;  4KMO A;  1AP7 A;  4YVO A;  5ENO D;  2PM7 A;  1ELR A;  1OCZ E;  3URZ A;  3RKV A;  3C3O A;  1ZU2 A;  3G2T A;  1TN6 A;  3UQ3 A;  3QK0 A;  1LF8 A;  4GPK A;  4B8C B;  3T5V A;  2CHZ A;  3CV0 A;  1V54 E;  3B7T A;  5M72 A;  3L08 A;  5HKP A;  2CFZ A;  4N3A A;  3FUI A;  3TWQ A;  3PEU B;  2GRR B;  1OWP A;  4WNE A;  4IRU A;  2QZA A;  3RO2 A;  1TNU A;  4GTP A;  4RVB A;  3DST A;  3KSQ A;  2R5S A;  3CHO A;  4KBQ A;  5FQ7 A;  5BUZ A;  1H2U A;  3QWW A;  4U63 A;  3W9G A;  5D0Q D;  4RG9 A;  3CGH A;  3QKY A;  4DI3 A;  2EIK E;  3MV2 B;  3TWU A;  4AV7 A;  4U0U A;  2XZT G;  3BG1 B;  4U7E B;  3DPY A;  1QNF A;  4HRL A;  4U04 A;  2WXP A;  3ONL A;  2X6J A;  1E7U A;  1IQU A;  2NC9 A;  3DPD A;  3PS6 A;  1Z3X A;  4MBG A;  4D10 C;  4FLH A;  3B7R L;  5T4Y A;  4BWR A;  4NAC A;  3ZGQ A;  4JPS A;  2QY7 A;  4B89 A;  4HXI A;  3UXG A;  3HXB A;  1AWC B;  3DSW A;  2VGE A;  3ZU7 B;  3S7D A;  2YNQ A;  2RD0 A;  3SY2 A;  4LG6 A;  3I4R B;  4MS6 A;  5G04 C;  4GTM A;  4NIK A;  2LUH A;  3HXC A;  3HVE A;  4LNU D;  3UPV A;  4HI8 A;  4LER A;  4M3O A;  5BXU A;  1KZP A;  1MX4 A;  4NUR A;  2MHK A;  5FZS A;  1BI8 B;  2FO7 A;  3PUJ A;  1N94 A;  4A55 A;  1HFA A;  5D2M C;  1HO8 A;  3ULE G;  5AJL A;  4TXQ A;  4KYO B;  3NQP A;  4TRQ A;  2JEK A;  4N5C A;  3CVU A;  5A6C A;  1DCQ A;  3IV0 A;  4N3C A;  3V30 A;  2VSN A;  3JXJ A;  3KD7 A;  4GB9 A;  2MOW A;  3D9P A;  3MA5 A;  5LCW J;  2DWZ A;  3ZHE A;  3FWV A;  4P29 A;  4F6R D;  3HDX A;  1JPL A;  2X3M A;  2IU1 A;  2AXZ A;  4HOU A;  1U3C A;  4O1P A;  2P9S G;  4GYY A;  2UY1 A;  2P58 C;  5CHE E;  2XEE A;  5FQ4 A;  2WXG A;  3G2V A;  1DCE A;  4KZC A;  4EHM A;  5G05 J;  4B8A A;  2B6C A;  2OOE A;  4N39 A;  4R7L A;  2Y4U A;  2XEV A;  4QQI A;  4J8D A;  1JCS A;  2WXI A;  2WQH A;  4F1S A;  3ASD A;  3JUI A;  4KVM A;  5EN5 D;  1U2V G;  3Q4A B;  3S2A A;  3FDH A;  3FU3 A;  1OT8 A;  1EDU A;  3I4G A;  2X6F A;  1UG3 A;  2OND A;  4DX1 A;  3CK8 A;  3Q5M A;  1FVH A;  2V4H C;  3PE4 A;  4JL0 A;  5BV0 A;  1MHQ A;  3SBS A;  5BPP A;  2WXN A;  2JAB A;  1JWG A;  4EBA A;  1ZB1 A;  5CRV A;  4HRN A;  3LJN A;  4JB8 P;  3SNX A;  1K1A A;  1BPO A;  1ELK A;  2KXP C;  4A1S A;  3JUE A;  5KJM A;  4I9E A;  2XPI A;  1S70 B;  1P5Q A;  3CHQ A;  3EIQ C;  3MGB A;  3S7B A;  3N71 A;  4BT8 A;  4L7T A;  4Y6C A;  3APC A;  2YHC A;  2FEZ A;  1WY6 A;  3SFZ A;  1YYH A;  4PS7 A;  2J09 A;  2FBN A;  3U9W A;  2ETB A;  4AY5 A;  1OUV A;  2H6G A;  3ZW3 A;  1NP7 A;  5ANR A;  5ANL A;  5JHA A;  2CG2 A;  3RSE G;  4U95 D;  2L0T B;  4N2S A;  3AG3 E;  2XHE A;  1TNO A;  3CVL A;  3VTX A;  1B89 A;  2P9P G;  3JXI A;  1TEZ A;  1D9S A;  3AS8 A;  1BU9 A;  4JD2 G;  4N5Q A;  1O1S A;  5AYW D;  2ILR A;  4KVO A;  3GW4 A;  2VYI A;  2WXJ A;  3J5Q B;  1Y8M A;  2R03 A;  4DJA A;  2R2L A;  5ENR D;  5CED B;  5DBK A;  5AIJ A;  1IHG A;  4GAA A;  3ABM E;  4LEU A;  3MKQ B;  1N11 A;  5EIL A;  3LEW A;  1GW6 A;  3C5R A;  1JCR A;  3OTN A;  3TGO A;  4OAV B;  1L5J A;  1ZBP A;  3Q78 A;  1UJK A;  3OAW A;  3RRN B;  2L0I A;  4OYS A;  4IUL A;  4JVS A;  3MCX A;  4B93 B;  5ARF A;  1NZN A;  3ESK A;  1RZ4 A;  3D9M A;  4BFR A;  2QFC A;  3UT4 A;  2MYO A;  4HI9 A;  2GRP B;  3APF A;  4BX9 A;  3JQ0 A;  3L16 A;  3R9A B;  1Y6I A;  3CVX A;  3MV3 B;  4XZ4 A;  4C48 B;  4UQX A;  1FVF A;  3CVN A;  2XRY A;  3QJZ A;  3NOC D;  2EQX A;  3PRZ A;  5FIN A;  3ZRH A;  2OEW A;  4CCA A;  3CVP A;  3IBE A;  3UIP C;  3PEV B;  2NSZ A;  3ZXS A;  1A5E A;  1MZC A;  1QBQ A;  4G11 A;  3UM1 A;  3FH7 A;  2XPZ A;  4CGW A;  1OXJ A;  3QAR A;  2DBA A;  2LAH A;  2ZU6 B;  1BD8 A;  4FJY A;  4K0R A;  3IHV A;  5EID A;  1LD8 A;  2WM9 A;  4ANW A;  4TV3 A;  4CT0 A;  3JCK C;  5KWD A;  2Q7F A;  1DVP A;  3RIB A;  4HLL A;  1KT1 A;  2MRI A;  4BT9 A;  4HLE A;  4TUM A;  4J6I A;  4I1M A;  4OAU C;  1EYH A;  3F6Q A;  2H6F A;  5ENT D;  3FTV A;  3FTS A;  3FEY A;  3E32 A;  5HRY A;  3IXE A;  4I2W A;  4G26 A;  2I6H A;  4GZ5 A;  5G2N A;  4C0E A;  2H6I A;  3DXK G;  4GA2 A;  3ISM C;  5A7D B;  1Z6T A;  3FTZ A;  2ZIR A;  3QC1 A;  5FQ6 A;  3ZYM A;  1S64 A;  1E8Y A;  3CHM A;  4WUY A;  3Q9N C;  3QWP A;  4UWF A;  3DSU A;  5ENQ D;  2F37 A;  2HE0 A;  3HRA A;  5B1A E;  3PZ3 A;  2Y69 E;  3HXE A;  3U64 A;  4A3T A;  2CHW A;  3LVR E;  4DLQ A;  4J0U A;  1INZ A;  5BT1 A;  4U8H A;  5LCW C;  4GMR A;  4BY6 A;  3P1U A;  4U0Z A;  4XX5 A;  3C3Q A;  5ENP D;  3SD5 A;  5E75 A;  2QC9 A;  4UQY A;  2VGX B;  1KLX A;  3PVL A;  4BES A;  1DNP A;  4B94 A;  5CRU A;  3NZU A;  3DSX A;  4GTV A;  2ETC A; 
#chains in the Genus database with same CATH homology
 3LXU X;  2X6K A;  3NQP A;  2J9Q A;  4TRQ A;  2JEK A;  4N5C A;  3CVU A;  3LVQ E;  5A6C A;  3QWV A;  4GZD A;  3UT8 A;  4GZC A;  4L1B A;  4F53 A;  3KAE A;  1JUQ A;  3IV0 A;  5G05 C;  4JEU A;  3TXM A;  4GMJ A;  4N3C A;  3FHE A;  2VSN A;  3G2U A;  5G04 J;  3G2S A;  4XI0 A;  3KD7 A;  3HYM B;  3U3W A;  1QZ2 A;  4DK5 A;  4GZ3 A;  3Q15 A;  4GB9 A;  2MOW A;  3ESL A;  3D9P A;  1PY1 A;  3MA5 A;  4JA9 A;  5AJD A;  5LCW J;  2A5U A;  5BW8 C;  3ZHE A;  5AEN A;  1WAO 1;  1Z3Y A;  4UWK A;  3FWV A;  4AEZ C;  4FLB A;  4P29 A;  1OWN A;  4N2Q A;  4CGV A;  3EHM A;  3HDX A;  4LUN U;  1JPL A;  4OVV A;  4HOR A;  4B0Z A;  4G1T A;  2XCC A;  3MKQ A;  4AIF A;  2X3M A;  3B7U X;  5BNW A;  1TJC A;  2WB2 A;  3RU0 A;  2IU1 A;  2XQ0 A;  4URK A;  3D9O A;  4L2Y A;  2AXZ A;  2FUL A;  2IQC A;  1HE8 A;  3D3M A;  1MQS A;  3GZ2 A;  3HHM A;  4HOU A;  1U3C A;  3LY8 A;  2X38 A;  2FI7 A;  1PAQ A;  4L2L A;  4GYY A;  3UX4 A;  2WXL A;  2HO1 A;  2KCK A;  5J90 A;  2HR2 A;  1X5B A;  2UY1 A;  3MEK A;  4UWG A;  4WAF A;  3SI5 A;  4GZ6 A;  3SF4 A;  2P58 C;  5CHE E;  3RRU A;  1JWF A;  2UWJ G;  5FQ4 A;  4ACK A;  2WXG A;  3K9I A;  4ATG A;  2L9B A;  3CQG B;  3G2V A;  4KZC A;  4ANU A;  5LX8 A;  5G05 J;  4N3B A;  4B8A A;  4CDN A;  2OOE A;  2I1K A;  4N39 A;  4R7L A;  2JLB A;  2Y4U A;  2XEV A;  3PNL B;  1YA0 A;  1HH8 A;  2VTB A;  1OWL A;  4J8D A;  4WNG A;  3U4T A;  4JC8 A;  5CMY A;  3FUJ A;  2A4Z A;  2Y3A A;  4BTA A;  5JJ7 A;  2WXI A;  3TG5 A;  2C0M A;  2WQH A;  5FJY A;  3R7Q A;  4F1S A;  1S0P A;  4BTB A;  3LCA A;  2BUG A;  2YQ8 A;  3ASD A;  3JUI A;  4WWO A;  3ZVV A;  4FJZ A;  4KVM A;  3CVV A;  2XPY A;  3Q4A B;  4JHJ A;  1H2V C;  4FHJ A;  3PH0 C;  3S2A A;  5FT9 A;  3FDH A;  3LKU A;  2J4D A;  3FU3 A;  3QNK A;  4I6E A;  4JXT A;  4HOS A;  1EDU A;  3DBS A;  3I4G A;  2M63 A;  4I43 A;  2BTD A;  2X6F A;  4RSY A;  1UG3 A;  3HIZ A;  1WM5 A;  2OND A;  3CK8 A;  3Q5M A;  3CHR A;  1FVH A;  1HF8 A;  2GGF A;  3PE3 A;  2C2L A;  3PE4 A;  4H7X A;  4JL0 A;  5BV0 A;  1MHQ A;  1E7V A;  3TAX A;  4C9B B;  3ASH A;  3SBS A;  1E96 B;  5BPP A;  4J8E A;  2WXN A;  2C0L A;  3CK9 A;  3O48 A;  4G25 A;  1H6K A;  4LCT A;  2GRM A;  4G24 A;  1HZ4 A;  2DCP A;  4UWL A;  1VDY A;  1JWG A;  5DIZ A;  5JJT A;  4L23 A;  4EBA A;  4FU3 A;  5E76 A;  2R59 A;  4C0M A;  5C1D A;  3FEX A;  3UMV A;  4DLO A;  2J08 A;  3IKO B;  4JA7 A;  3IHY A;  3SNX A;  4AOF A;  3EJN A;  3ZIM A;  2XGM A;  4I1O B;  1BPO A;  1IYG A;  1ELK A;  3SZ7 A;  3L54 A;  2OV8 A;  5EX0 A;  4OVU A;  2J49 A;  1HS6 A;  2WMO A;  3L13 A;  3ULQ A;  4A1S A;  3AU4 A;  3CVW A;  3FU0 A;  3OXL A;  5KJM A;  4I9E A;  4F3V A;  5T3R A;  3CST A;  2XPI A;  3FFL A;  3S7J A;  1HG5 A;  1OWO A;  2IJG X;  3CLJ A;  4ILH B;  3FUK A;  2IOS A;  1P5Q A;  3CHQ A;  3EIQ C;  4ANX A;  2WXF A;  3MGB A;  3IEG A;  3N71 A;  3S7B A;  3G2W A;  4L7T A;  4Q94 A;  1SZ9 A;  4Y6C A;  3APC A;  3TXN A;  4BT8 A;  4CDM A;  3JQ1 A;  4O6F A;  4WWN A;  3MZL B;  2YHC A;  2FEZ A;  3AU5 A;  4F7A A;  2AWI A;  5BV1 A;  5D0O D;  1TJF A;  1WY6 A;  3SFZ A;  5A23 A;  3FUF A;  3I5P A;  2HM8 A;  2V5F A;  4K03 A;  4NQ0 A;  2WXH A;  5EX3 A;  2V4L A;  2OVB A;  4JZY A;  4PS7 A;  2J09 A;  3D9N A;  4GYW A;  5G55 A;  4XKC A;  5FZQ A;  3HVE B;  2FBN A;  3ZYK A;  2AVP A;  4UWH A;  3CVQ A;  5FWQ A;  5KJK A;  2IOL A;  3OXF A;  3U9W A;  4EZK A;  3ML8 A;  3QOU A;  2J07 A;  3CIA A;  3SHF A;  3LY9 A;  1HG2 A;  2WQ6 A;  4AY5 A;  1OUV A;  4GML A;  3ZFW A;  3ZW3 A;  2FF4 A;  1NP7 A;  3L22 A;  5ANR A;  4IN3 B;  1EF1 C;  2E0I A;  2OVF A;  5ANL A;  4FHK A;  1XNF A;  2CG2 A;  4CRW A;  5JHA A;  2PM6 A;  2NXP A;  4ILI A;  4GA1 A;  1UN9 A;  4DI4 A;  2Y4T A;  4UI9 K;  2L0T B;  3AS5 A;  3QAQ A;  4I9C A;  4MRU A;  4BX8 A;  2KZT A;  4N2S A;  4I17 A;  3SGH A;  3FH8 A;  2XHE A;  2RG8 A;  3NF1 A;  3LYA A;  3CVL A;  3VTX A;  4GCN A;  1B89 A;  4J8F A;  2WXK A;  2I1J A;  4FAD A;  3PZD A;  3TL5 A;  1TEZ A;  3AS8 A;  4ILG A;  2XGO A;  3VLD A;  3CKC A;  5CCL A;  4EQF A;  5HQ8 A;  3UUX A;  1PC2 A;  1W3B A;  2CG3 A;  3ASG A;  2KC7 A;  4HS2 A;  1E8X A;  3GZ1 A;  5AYW D;  2ILR A;  1SZA A;  4KVO A;  4PDX A;  2HYZ A;  3GW4 A;  2VYI A;  3WXX A;  4FA6 A;  3CQC B;  2WXJ A;  4DPR A;  4V3I A;  3T8M A;  4I1A A;  3FTX A;  1N52 A;  2WXM A;  1Y8M A;  3RJV A;  4CDR A;  4GA0 A;  4DJA A;  4XE0 A;  2KCL A;  3PDN A;  3ENE A;  4XIF A;  3CHS A;  5ARG A;  3ZHE B;  2LNI A;  4U07 A;  4XKB A;  5DBK A;  5AIJ A;  1IHG A;  1A17 A;  3VLE A;  4JHK A;  2X6H A;  2V0P A;  4GAA A;  1E8Z A;  3FU6 A;  2XGS A;  4LEU A;  5FZR A;  3MKQ B;  2KAT A;  2LO6 A;  3FH5 A;  1HU3 A;  3LS8 A;  3FY4 A;  3CK7 A;  1N54 A;  5HI7 A;  3FUN A;  3LEW A;  2VGY A;  1GW6 A;  3EDT B;  2PQN A;  4RG6 A;  3OTN A;  4ACL A;  3FUL A;  3FUH A;  3TGO A;  1XGW A;  3O4Z A;  1UN8 A;  4U0S A;  3FU5 A;  3ZEF A;  2BF0 X;  4GYO A;  4I6G A;  5EDS A;  2L6J A;  3L17 A;  1L5J A;  2UY1 B;  4APF A;  1ZBP A;  3PNT B;  1UJK A;  2VSY A;  3GYZ A;  2VGX A;  3OAW A;  2ION A;  2L0I A;  2LAI A;  3RRN B;  3B13 A;  2I2O A;  4OYS A;  2WPV A;  4IUL A;  4JVS A;  3BG0 B;  3FTW A;  5JHB A;  2WXQ A;  3NZS A;  3MCX A;  3TG4 A;  4YVQ C;  4APO A;  4EPZ A;  5KCM A;  3RK6 A;  2VTB B;  4WNF A;  5ARF A;  1NZN A;  4I2Z A;  3ESK A;  4AJW A;  3U66 A;  5ENN A;  5JJ6 A;  3VTY A;  2WXO A;  4PS3 A;  2KCV A;  3D9M A;  4BFR A;  3RO3 A;  2LSU A;  4I6J A;  2AXV A;  4ANV A;  2QFC A;  3UT4 A;  5FTP A;  4WND A;  4Q69 A;  3LJ3 A;  4UI9 J;  4AXH A;  4JEH A;  3FTU A;  3APF A;  4BX9 A;  3JQ0 A;  3CHP A;  1E90 A;  3L16 A;  4MLP A;  3R9A B;  4WWP A;  4KMO A;  3PRE A;  4EBA G;  4YVO A;  1Y6I A;  2VSX E;  3CVX A;  3MV3 B;  4BSX A;  2CHX A;  4XZ4 A;  4EEC A;  2PM7 A;  1U3D A;  2AXU A;  3BEE A;  3I3N A;  1FVF A;  4UQX A;  1ELR A;  2GW1 A;  3URZ A;  2J4B A;  3CVN A;  2V8S E;  2WXR A;  3RKV A;  2XRY A;  3D9K A;  3QJZ A;  2I9C A;  4AY6 A;  2EQX A;  2WMN A;  5EKQ D;  4FC8 A;  4JW1 A;  4EZJ A;  3PRZ A;  3ZRH A;  1ZU2 A;  4ABN A;  4AP2 A;  4PS8 A;  3G2T A;  3LDZ A;  3FUD A;  4G23 A;  4CCA A;  3CVP A;  3IBE A;  3UQ3 A;  3PEV B;  2NSZ A;  3ZXS A;  3QK0 A;  3RRM B;  3FP3 A;  1LF8 A;  3FTY A;  4ME2 A;  4GPK A;  4G11 A;  4B8C B;  3KEZ A;  3FH7 A;  2DIW A;  3T5V A;  1IQR A;  2XPZ A;  4CGW A;  5J08 A;  4FUL A;  1ELW A;  3LY7 A;  2CHZ A;  3GZS A;  2PL2 A;  3QAR A;  3D9I A;  2DBA A;  3CEQ A;  2LAH A;  3B7T A;  3CV0 A;  5M72 A;  3L08 A;  2CFZ A;  2ZU6 B;  3JYS A;  4FJY A;  4HFG A;  3MYV A;  3FUI A;  3IHV A;  4K0R A;  4N3A A;  3B7S A;  3PEU B;  1H19 A;  2CFU A;  4KXK B;  2WM9 A;  3EHN A;  3MKR A;  3ZYQ A;  1OWP A;  2IFU A;  2PQR A;  2E2E A;  4IRU A;  4WNE A;  4ANW A;  4TV3 A;  3MX3 A;  3RO2 A;  3SBT B;  4CT0 A;  3JCK C;  4RVB A;  2R5S A;  2Q7F A;  4KZ0 A;  1DVP A;  3RIB A;  3CHO A;  4KBQ A;  4E6H A;  1KT1 A;  5C2Y A;  2MRI A;  2VQ2 A;  4AVX A;  4BT9 A;  2PZI A;  4E85 A;  4HLE A;  1HXI A;  5FQ7 A;  4J6I A;  4I1M A;  5BUZ A;  2XCB A;  4W9R A;  2WQ7 A;  1H2U A;  3QWW A;  4U63 A;  4HOT A;  4J8S A;  5D0Q D;  4RG9 A;  2KM4 A;  3CGH A;  3QKY A;  4H7Y A;  3ZN3 A;  4DI3 A;  3MV2 B;  3D9L A;  2R17 C;  3PUK A;  1NA3 A;  1OWM A;  3TJP A;  4AV7 A;  3Q47 B;  4PUC A;  5CMW A;  1EYH A;  1UW4 B;  3CR3 A;  1E8W A;  4U0U A;  2GRL A;  3UT7 A;  3BG1 B;  2VSO E;  3FTV A;  3D9J A;  3FTS A;  3FEY A;  1QNF A;  2WVI A;  4U04 A;  5LOZ A;  4XI9 A;  1UJJ A;  4FP7 A;  2WXP A;  3ONL A;  4I2W A;  4HOQ A;  2X6J A;  2I6H A;  4G26 A;  4GZ5 A;  4UI9 C;  4GU5 A;  4A3V A;  2AW6 A;  3C98 A;  4MKT A;  1E7U A;  5G2N A;  4C0E A;  2KZT B;  1IQU A;  4GA2 A;  1FCH A;  2NC9 A;  3ML9 A;  3ZPJ A;  3DPD A;  3AS4 A;  4PH4 B;  4GCO A;  1NA0 A;  3PS6 A;  1Z3X A;  5A7D B;  3R7R A;  3LPZ A;  3CKB A;  3APD A;  5FQ8 A;  3QB2 A;  4D10 C;  1Z6T A;  4FLH A;  3B7R L;  3FTZ A;  5T4Y A;  1HX8 A;  3QC1 A;  4JHR A;  4Y6W A;  5FQ6 A;  4BWR A;  3ZYM A;  4NAC A;  4HVB A;  3ZGQ A;  1E8Y A;  3CHM A;  4IYP A;  4JPS A;  4G2V A;  5LFA A;  4Q96 A;  2X6I A;  4WUY A;  4A1G A;  1QQE A;  2QY7 A;  5KJN A;  3QWP A;  4TUU A;  3T5X A;  4UWF A;  4B89 A;  3Q49 B;  4HXI A;  5T8I A;  3EIJ A;  3S7D A;  4AM9 A;  3L6A A;  2YNQ A;  3VLF A;  3U64 A;  4A3T A;  1SQM A;  2CHW A;  2RD0 A;  3FUM A;  5CCM A;  5G04 C;  3I4R B;  4MS6 A;  5KJL A;  3LVR E;  1EPU A;  4DLQ A;  4J0U A;  4YND A;  1INZ A;  5BT1 A;  3MJW A;  2YHE A;  3FUE A;  3HVE A;  4U8H A;  5LCW C;  4BY6 A;  1KT0 A;  3P1U A;  4U0Z A;  3CVY A;  4XX5 A;  3UPV A;  3SD5 A;  5E75 A;  4UQY A;  2XRZ A;  1H0A A;  2VJ8 A;  4EZL A;  2VGX B;  4LER A;  4M3O A;  4CEM A;  1KLX A;  3ONK A;  3P2B A;  2IF4 A;  3PVL A;  4KT6 B;  4UQZ A;  2LSV A;  3E4B A;  2MHK A;  3OXG A;  4NRH B;  1DNP A;  1H2T C;  4NUR A;  5FZS A;  4B94 A;  4CT4 A;  2FO7 A;  3PUJ A;  5LP0 A;  3QDN A;  4A55 A;  1HFA A;  4QFV A;  4LRZ A;  1HO8 A;  3NZU A;  3KS2 A;  2YIN A;  3ASF A;  5AJL A;  3S7F A;  3ZYL A;  3CSF A;  4KYO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...