3WY1A

Crystal structure of alpha-glucosidase
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
535
structure length
535
Chain Sequence
NMMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLDNMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSRPENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEVASDLPVAHFTATRDGSTLTLPAYQAAFMQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-glucosidase
publication title Structural analysis of the alpha-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism
pubmed doi rcsb
source organism Halomonas sp. h11
molecule tags Hydrolase
total genus 193
structure length 535
sequence length 535
chains with identical sequence B
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3wy1A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wy1A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3wy1A02
1ISZA 4EAMA 1Q4NX 1I1WA 3KL5A 3WUGA 4FNUA 4B9YA 2CHOA 5BXSA 1HKKA 2CKRA 4NZCA 2DT1A 3VDBA 4H2CA 3VGFA 1Z32X 4HZ8A 3H55A 2UY5A 1WZKA 1C8QA 4RE3A 3VTRA 1CXFA 1W3LA 4F66A 1ZJBA 1GVYA 1W9UA 1OCQA 3W6LA 5BYWA 3OLIA 1B3WA 4A3YA 3ZJ8A 1E6PA 2OW7A 2X2IA 1UZ1A 2WVUA 3EJTA 2CERA 1GHRA 1OGSA 2PBOA 1HJWA 1TQUA 3WY4A 5BXRA 2VCCA 3VIMA 9CGTA 1M03A 1ITCA 3CUJA 4FLRA 1QBAA 1K9EA 2ZXAA 2CETA 1BQCA 3DX4A 3FAXA 5D4YA 3SCVA 4QP0A 2ZX9A 4UQBA 2XWDA 1S46A 3KWXA 2WLYA 1VEMA 1H4PA 2X2HA 3D4ZA 3TV8A 3ARUA 1GPFA 3IK2A 1M7XA 1SYTA 3U57A 4J3XA 2G3IA 3NDZA 4CN4A 1QPKA 1US2A 3J7HA 4KGJA 5A2AA 1X6LA 3GH7A 1MW1A 3LXBA 1GOMA 2F2HA 1C8YA 4P8XA 2AMGA 1R34A 2EBNA 3BXWA 1GJWA 3PZUA 1MQRA 2WKGA 1R75A 1HX0A 3VD9A 1LQ0A 5A6BA 2VNCA 3CHDA 4HA3A 3O2LA 1V0LA 5D8ZA 2XWEA 5E6YA 1OGGA 2G4FA 5FL1A 2VURA 2X1IA 1EO7A 1UYQA 1J0IA 3UCQA 4FNTA 1H41A 4JKMA 1V6UA 5A6JA 2GJRA 4LX4A 1JF5A 1QNPA 4AMCA 1E0VA 3HG5A 4FNPA 4PMZA 4U5KA 1CTNA 1U30A 5C71A 1UR8A 3A3HA 4MAVA 1CGWA 4RE2A 2BXZA 2F1BA 2WCGA 4UOJA 2WC3A 2D23A 2V5DA 2W67A 1VENA 1UA7A 2CBUA 3WL1A 5I23A 1VEPA 1KCLA 3QOKA 4D6FA 4NZFA 1AQHA 3EYPA 3RDKA 2D0FA 1GCYA 4H41A 1R46A 4PMDA 3HG3A 1B0IA 3ARQA 2G41A 1GQKA 1MYRA 3PZVA 2VZUA 1VEOA 3MS8A 3DX0A 4JKLA 1BVNP 4OKDA 4GO8A 5A3HA 3RPMA 4H04A 1KR0A 4MADA 1C91A 1XCXA 3VDHA 4J7RA 2DSZA 3GXPA 1PBGA 2XG9A 4W87A 5I3DA 2NT0A 3BAKA 5HXMA 5BCAA 2F8QA 1R33A 3ZT6A 3OZPA 4Z2GA 1JZ5A 2FDMA 4C7FA 4OOUA 4DO4A 4WIWA 3ARRA 3SCQA 1Q6GA 1UZ4A 4AZ6A 1BYCA 3KE0A 4M81A 4U2ZA 4PMXA 2V3GA 3WQ4A 3AS3A 1LWHA 4MB1A 1NOFA 1MVYA 2FHBA 2ZUWA 4HA4A 5DT5A 1B3ZA 2WK2A 1BFNA 3OLDA 3DYPA 2WW5A 3EBVA 4WK9A 1EIBA 2QPSA 1UD6A 3HU7A 1US3A 4UFMA 3WDQA 3MMUA 1UD8A 5GNZA 4UZSA 2FH8A 2BXYA 2XVGA 2XM2A 2UY2A 3U5YA 3A4WA 1KGXA 1DWAM 4MDOA 2D1ZA 1RD6A 1M53A 4W84A 1FP9A 4W8AA 4PUEA 1GORA 4HU8A 3VINA 4D71A 2WB5A 1UUQA 3GH4A 3PZOA 4F9JA 2CIPA 2JF6A 2IXVA 3MMWA 1G94A 4BS0A 2VOTA 2NW0A 3ZR6A 1I75A 4X0NA 3A22A 1WDSA 1UWUA 2E9LA 2VCAA 1W1PA 1OIFA 3WEMA 5AC4A 4PBGA 1GUVA 1CGUA 4AEEA 4GPNA 1UR4A 1OBAA 2ESCA 2WLZA 1QWUA 1WO2A 1CYGA 2ZXBA 5GNXA 1E56A 3AHTA 4PMNA 5CPTA 2XN2A 3BAJA 1W3JA 3ZR5A 4CUCA 2G3JA 1EO5A 4IUGA 3BLKA 3AS2A 3CC1A 1E6QM 1CGVA 3ZQ9A 1H5VA 3WY1A 1PS3A 4W89A 3AIVA 3NJ3A 3F5KA 4CD4A 1KBBA 2XFFA 4AD2A 1DWJM 1QNQA 3WY3A 4PSRA 3KL3A 2IGTA 1RP9A 1VAHA 2CXGA 1EQCA 2NT1A 3GXNA 1JAKA 2DH3A 2E3ZA 4GQRA 1JG9A 3PHAA 4HZ6A 4IPLA 5KEZA 3CLWA 3EJSA 4W88A 3AMCA 2WAGA 4AIUA 3RCNA 3K8KA 1CBGA 3AYSA 3VIFA 3QGVA 2F1AA 4J3SA 3CUHA 1FH7A 3W82A 1Y7VA 4PMUA 1KGUA 3BVWA 4H8HA 3N17A 3B9EA 2BHUA 1V3JA 2IXUA 1A47A 3BAXA 1UHVA 1GZJA 3AICA 4AYSA 3LPPA 1JF6A 5CGTA 3OA5A 1BGAA 1DWHM 5IHRA 4NSBA 1VF8A 1JI1A 1NWTA 4PRWA 5AC5A 2EACA 1BF2A 3VIKA 2XGBA 3BUBA 4D1JA 3RJXA 3W0KA 2OW6A 1UR0A 4X0VA 2J78A 5DT7A 2WANA 5HNNA 1JYVA 4W85A 1QNSA 3N9KA 3WH8A 1E6NA 1XC6A 1JI2A 1HF6A 1E71M 1ZJAA 1CGYA 5E0CA 1G1YA 2EXOA 5JBFA 4WF7A 3FW6A 2WCAA 4LQ1A 4AZGA 3MSDA 3WEOA 2F7OA 3L2MA 3WL0A 2E9BA 2BS9A 2BY1A 2FGZA 5FIPA 3SCUA 1LLOA 3NSXA 5A94A 4LGXA 3A24A 2V5CA 1HL9A 1HXKA 1B3YA 1E73M 3EDEA 5CG0A 3ALGA 4CN1A 3NSMA 4LYRA 3AHYA 3BMWA 3WDIA 5FKYA 1C93A 3W29A 4IPNB 1H11A 1G5AA 3OLGA 1YQ2A 3BVUA 2E8YA 1JD9A 5A2CA 4LPCA 1KB3A 1E4LA 5HPCA 2WHJA 2C8NA 1B30A 1XH2A 1EDTA 2PC8A 1MFVA 1BLIA 1ZS2A 3WIJA 2DPEA 3VX1A 1FP8A 4PYSA 3SCRA 3A21A 3AJ7A 7CGTA 3QOMA 3W27A 1ISYA 3WQVA 2WXDM 3KLKA 3AHZA 1E0WA 1QBBA 4YHEA 2X8RA 1R85A 4F8XA 3ZIZA 2D22A 3SCNA 1DWGM 1K9DA 3ZJKA 3VGEA 2GFTA 3VIPA 1EOKA 1KR1A 1OGBA 4N42A 2VJXA 4JKKA 2CBJA 1UKSA 3PZ9A 1V3KA 4X9YA 2ZOXA 3RM9A 4JZ5A 2VCBA 3PZTA 5JIWA 2XHYA 1HKJA 2DGAA 4GI9A 1OD0A 1D3CA 1U33A 4HU0A 3WFLA 1J01A 3OGRA 1E1EA 4LYQA 3AMDA 3WY2A 1HP4A 4CD7A 3IJ9A 2WC7A 1QI0A 2WZHA 4NRRA 4DUWA 4CCCA 2JIWA 2BHYA 4M8UA 4AY1A 2VUYA 2BY3A 3IJ8A 2F7QA 5CQ1A 2FHFA 3WH5A 3L4YA 2E8ZA 3S2CA 2DT2A 1IZKA 3VD7A 4UFKA 3BSHA 2VL4A 2NSXA 1W9BM 3BAYA 1DWIM 5I0DA 4XZBA 1JAEA 1FHLA 4RL3A 2Y8VA 3S5YA 5AYIA 3SCOA 4GKLA 1WAWA 3MU7A 1WDRA 3K8MA 1HIZA 4ZFMA 1V0NA 2XVPA 4MDPA 1Q6DA 4TVDA 4HA1A 1J0ZA 1KTBA 4WJXA 3BUIA 4WKFA 1ITXA 1E3ZA 3AIRA 2UY4A 2VX7A 1JFHA 1W9DM 1NP2A 4CD5A 2ZWZA 6A3HA 4D6GA 1KFWA 3E1F1 3FNDA 2EPOA 1HN1A 3WQWA 2OSWA 2X0YA 1TVNA 1X6NA 4GO9A 1B9ZA 4W8BA 3WF1A 2GVYA 2VZSA 3WF4A 2TAAA 4FLQA 3BGAA 1Q6FA 2E40A 1TE1A 3MO4A 2VO5A 1QI5A 2DH2A 3MV01 1XRVA 4J3WA 3EJPA 5LA1A 5A8NA 2AAAA 8A3HA 1OT2A 3OGVA 3SURA 2W5FA 3W38A 3CZ8A 1TQWA 2J7EA 5EBAA 5FCZA 1UD4A 1ESWA 1L8NA 1WCGA 5D9OA 4KRTA 2D24A 5FOOA 1TCMA 3VDAA 3UERA 2D20A 2XYLA 4QLKA 3FAWA 1KXTA 3AI0A 3VM5A 4JCMA 3DHUA 3B9DA 1VRXA 3DYOA 4XZWA 3T0AA 2G3MA 3BUPA 4H8VA 3L4XA 3ARVA 3WMCA 3MUAA 4P7RA 1H2JA 4PN2A 1YHTA 3WNNA 3K4AA 4DO5A 1B3XA 2QHAA 4CVUA 1EA9C 4ZE4A 1E6RA 1W3KA 1JZ8A 2CESA 5LA2A 4MAZA 3M7SA 2VR4A 4GIAA 1RP8A 1GQIA 2UWFA 5A8QA 1H09A 3GM8A 1UR2A 1WZLA 4MTVA 5HDRA 4E2OA 3CHEA 3AMLA 1UQYA 4OUEA 3WNOA 1BYBA 4TTUA 1E6XM 2QMJA 3IANA 3WNLA 5A8MA 2WHKA 1ZL1A 5F7UA 1BAGA 1N82A 4LXFA 1MQPA 1PIFA 3VO0A 1J0KA 3OBAA 2W4XA 4AIEA 3CUGA 4TXEA 3K4DA 1KWKA 4HPHA 2O9OA 1EHNA 3ZO9A 1CGXA 2J75A 4DWSA 1GW1A 2O9PA 4PMVA 4QLJA 4FF5A 1UH3A 2BVDA 4DWSC 3OLEA 4QCEA 3D51A 1CPUA 1GNXA 4Q22A 3MI6A 2JFEX 1R8LA 1V3HA 4HMEA 4AIOA 1WB0A 1UASA 5FD0A 1WDPA 3F5LA 1H3GA 1NOWA 3AIBA 1W1YA 4UR9A 3WUFA 1TMQA 1CXHA 3SUWA 4PTVA 2YKKA 3BC9A 2W62A 4MNJA 3LRLA 5DEZA 4W8LA 2OSYA 1GOWA 4AZIA 1TQSA 3HJEA 1HTYA 3RIKA 1UD5A 3UG4A 3VSUA 1E5JA 1HJQA 4AD5A 3L4UA 3M07A 2ZX6A 3L4TA 3W24A 2E9MA 5ABGA 3KLLA 3DYMA 5D8WA 1PEZA 4EE9A 2Y4SA 3CHCA 1HVQA 3K46A 3A4AA 1M04A 3ARTA 1G0CA 4CCDA 1E40A 4KMQA 1LF1A 3L2LA 1ZBKA 4XUYA 4NX0A 3VD5A 5DF0A 1SMAA 3CZSA 3WEZA 3SUTA 1W91A 1DTUA 3SUSA 1V6YA 2JE8A 4QCFA 2ZUTA 2X2YA 2QPUA 3I3DA 3OZOA 2A3AA 3S5ZA 3WBEA 4PTWA 4PUDA 4JCLA 4W93A 1BTCA 3WMBA 4M1RA 2E4TA 1XGZA 4H8UA 3W26A 3CPUA 3BVXA 4OGZA 1UWTA 1XYFA 3WN6A 4Q7NA 1KXVA 1X1NA 4BCEA 4MJ2A 1Q6CA 1UA3A 3BMVA 4FLSA 4U31A 4MNMA 1HL8A 5CLTA 2MANA 1D2KA 3TTSA 4BF7A 2GDVA 4WLCA 3MV11 3RM8A 4UNIA 4AZ7A 3ZM8A 3VNZA 3EMCA 3I3BA 4FNSA 1O7AA 3BAIA 4CGTA 3LMYA 4P7OA 3WH6A 3CZJA 2OYMA 2J7FA 3ZJ6A 5I78A 1HJUA 3GBEA 3WQ6A 1WZAA 3WF3A 1UD2A 4AZBA 4UQEA 2YL9A 1VB9A 2DIJA 2D0GA 4B15A 3ARSA 4M24A 1B2YA 2WCSA 1LWJA 3HZ3A 1XH0A 3BUQA 4MJ4A 2XJ7A 3VD3A 2XN1A 3T2OA 3D5HA 3N11A 1K9TA 1QI2A 1E3XA 4PMQA 4YPJA 3RMEA 3AIEA 3RM4A 5C70A 2BY0A 4UFHA 3BH4A 1E5NA 2HVMA 4JFSA 4Z2KA 5IFTA 2DT3A 4H7VA 3WUEA 2YFNA 3SUUA 2F7PA 1GOQA 1KQYA 1DHKA 3VU2A 1UWSA 4JHOA 1DP0A 4BQ4A 2YL5A 5DO8A 4ATWA 2CPUA 1ECEA 3SEPA 3WMSA 2YDRA 2QV4A 1HKIA 1SFSA 3F4VA 3MUY1 2ZX5A 3ZT7A 2WSPA 2ZIDA 4J28A 3ZSTA 4BQ2A 3OB8A 5GNYA 1AQMA 1GVIA 1SZNA 1CXLA 4TX8A 1JXKA 3CV5A 1KTCA 4J3VA 2AOSA 3CMJA 1OT1A 1V3MA 1CXKA 1NARA 4WSKA 2DSKA 2CBVA 2YL6A 3N13A 2WNWA 4JAWA 2DQXA 3WUBA 4E8CA 4QAWA 5IXEA 2ZE0A 1BHGA 3M6DA 4PTXA 4UOQA 4Y7EA 2PI6A 1H0IA 3VSVA 1E6ZA 5M03A 4AISA 4OIFA 3VIGA 3NIYA 1E70M 3TTYA 3AYRA 3MUZ1 2JIEA 2D0HA 2DSWA 4DUXA 4TVUA 4JL1A 3W37A 3DHPA 4AMWA 3EJQA 2DSUA 3T08A 4GZJA 1E4IA 1WP6A 4HOXA 5C8BB 1D7FA 4D6EA 3FY1A 1JDCA 4CD6A 5LA0A 1QX1A 3A5VA 4CVWA 2V3EA 5ABEA 4NF7A 4YHGA 4AEFA 4JFWA 1WE5A 1V0MA 3I3EA 3MSGA 2EPKX 2CCRA 4J27A 4ZXLA 3W4RA 1R86A 2X05A 5DMYA 2BHZA 2VZVA 7TAAA 2Y24A 1O6IA 3H53A 1E0XA 1UKTA 1CEOA 3L4WA 2D73A 1VBUA 2JEQA 2WVVB 1HVXA 4ATLA 3AIWA 2X2JA 2FHCA 3ZT5A 1NQ6A 4V28A 1LL7A 2WZEA 4TVCA 4DUVA 3VGDA 4CCEA 2V3DA 2PWEA 2F7RA 2DT0A 1QI4A 5DFAA 3DX1A 1JYXA 2EADA 4FNQA 1TQVA 5CZKA 3MKKA 1SR0A 1ZB5A 3SUVA 2YLAA 1MXDA 4B3LA 5CLWA 2VVNA 3T2QA 4KRUA 4MB4A 1OINA 4ACZA 3GNOA 4HOZA 2VQTA 2WHMA 3IGUA 2J7CA 4OBSA 5CXPA 1NH6A 4DWSB 1HP5A 3WKZA 4DM1A 3D50A 5CPSA 5I24A 1HKMA 4WSJA 1MW0A 1UWQA 3RJYA 1ODZA 5ECUA 2G3NA 4N0RA 3PZNA 5JBDA 1H49A 3WENA 2WMKA 5I6SA 1VIWA 1UQZA 1JFXA 3SCTA 3AQUA 4UCFA 2XSAA 3WH9A 2CITA 4ML4A 2E0PA 3UR8A 1GJUA 3SCPA 2PWFA 3AHXA 3G6MA 2A3HA 3BLBA 1CNVA 4F79A 3RILA 4UTFA 1QHOA 2GK1B 3TA9A 3OGSA 1XD0A 1V02A 1CDGA 4ZXOA 4HOWA 2CKSA 5A6BD 4UQ9A 5E6ZA 3CUIA 2ZUNA 5GPRA 2OWCA 2J8GA 2O9TA 3PZMA 2GJXA 3VVGA 1ISWA 3NYDA 1JZ4A 1PZ2A 5A6LA 1V08A 3WFZA 3N15A 2EPLX 2XM1A 2CBIA 5BWFA 2VT0A 2YIHA 2WMFA 2W92A 4MNKA 2D2OA 1E4NA 1ZU8A 2VRQA 2YBTA 5LYRA 1EXPA 2XFRA 1JIBA 3WELA 3AMGA 1GOOA 3BVTA 3UG3A 1ZBCA 1C92A 4BZYA 4UFIA 1VFUA 1C8XA 1V0KA 4JFUA 1W1VA 1V03A 2VQUA 3ARZA 3GH5A 1ISVA 1EDQA 1UH4A 4GZIA 1W9VA 1CXEA 4QDMA 1W32A 1UWIA 4OOZA 3WDPP 3EDDA 4F9DA 5EFDA 2J25A 3GXFA 2XIIA 2HISA 1E43A 3WD1A 3AS1A 3AROA 2YLLA 1BSIA 1J12A 4S3JA 2OSXA 5BXTA 3ZJ7A 1HT6A 4RE4A 4E4PA 3BCDA 4JHZA 5M17A 1BG9A 2GSJA 2F61A 3AMKA 1AMYA 4U2YA 4XV0A 4WKHA 5M3WA 3PZGA 3WNPA 5I77A 2GDUA 3AOFA 3QHOA 5A6SA 3ZSSA 5EB8A 4AD0A 1OD8A 3RO8A 1QOXA 3SIMA 4CD8A 2YL8A 4EANA 2VC9A 4IM4A 2JALA 1UG6A 2J4GA 2DEPA 2CNCA 1RH9A 1BYAA 1HJVA 1CENA 1QW8A 3VSTA 2Z1SA 3GNPA 4D6JA 1LL4A 2QLYA 1XD1A 5BRPA 3L4VA 1MWOA 2WM0A 1K6AA 1R7AA 2EPMX 4GZEA 3B8SA 4AMXA 4OBRA 1UH2A 2WVSA 2QF8A 1MXGA 3CHFA 3U7VA 4P7LA 2VR5A 4D6HA 1TA3A 1E15A 1JDAA 4V27A 3VM7A 6CGTA 2BNJA 4LYPA 1UKOA 2V3FA 4C7GA 4K68A 4HMCA 2PBGA 1WNOA 2ZXQA 3LXCA 3N04A 4W7VA 3LXAA 2WVVA 1EDGA 1P6WA 4ZEPA 1E6SM 3GDBA 4HMDA 5ABFB 4BA0A 3TTOA 5KZ6A 4TOQA 3EMZA 2ZUSA 4NRSA 3EDJA 4DO6A 3VUPA 4CU8A 2BY2A 4UQAA 3PTMA 1TUXA 1R7OA 4R27A 2PWGA 3AXXA 3CGTA 3PZQA 1T0OA 1IZJA 5E09A 1AVAA 3D52A 1W1TA 1V6WA 3CZLA 4HP5A 2VVSA 1J10A 1NP0A 1V6XA 5A69A 4Z2JA 3WD3A 3DX2A 1JGIA 2YFOA 1EQPA 4GI6A 4ACYA 5E9AA 1J9YA 5AY7A 4CKQA 3KL0A 4CU6A 4A4AA 4ATDA 1OSEA 4AZHA 1QHZA 3T0BA 4U3AA 3II1A 2BVTA 3VMNA 1M01A 3DC0A 5FL0A 3CBWA 2D3NA 3PZIA 1QHPA 1TR1A 3TP4A 5I5RA 3PTQA 5BXPA 3VGBA 3SCWA 2C0HA 2GK1A 3VMOA 5I79A 2F18A 1F4AA 1B31A 1KCKA 3WSUA 4CN6A 1KBKA 5HOSA 1VJSA 4CU7A 2EEXA 3UR7A 3VGHA 4W86A 2XVNA 1TZ7A 3WF2A 3NUKA 1WZMA 1ODUA 4FNRA 1NWRA 3EMQA 3GXTA 4B3KA 3WNMA 1FHDA 1CIUA 1QI3A 4URIA 3VIOA 1BVZA 3HN3A 5A1AA 3VILA 4IISA 1W3HA 3PN8A 1VFFA 1QW9A 4GXPA 4P7NA 4QLLA 5IFPA 4HZ7A 4JL2A 1HXJA 1J0YA 3A47A 4MB5A 3VNYA 2WWDA 1E55A 1FH9A 1MW2A 6TAAA 2VI0A 1XSKA 1BPLB 4AZCA 3BVVA 2YJQA 4E8DA 3VOCA 3AXIA 3W6MA 3WD0A 1C90A 2FYVA 1J0JA 2WMHA 3W25A 1BYDA 4ACZB 2CYGA 1UR1A 2J47A 1UD3A 5GQBA 3LRMA 5JIPA 2XPKA 1JZ6A 4B16A 1B3VA 2WYSA 3TOPA 5CSYA 1MQQA 4TUFA 4UQDA 1JD7A 2YA2A 4NXKA 1BG4A 2GJPA 4D1IA 3DDGA 3UG5A 3CH9A 1WPCA 4W5ZA 2OWXA 2Y8KA 1XYZA 4PMYA 4U5IA 1LG1A 3WH7A 1PAMA 2XUCA 1QVBA 4AC1X 4D6IA 2Y2WA 5D9NA 1PX8A 1HWWA 1RPKA 1PX3A 2YDSA 4UQCA 4W7WA 3POCA 2YBUA 3VIJA 2EO7A 1QNRA 2WPGA 1PPIA 3EJRA 2B31A 2OWWA 4UZUA 4TTGA 2EJ1A 3THCA 1OWQA 1E4MM 5JUVA 1E9LA 1GQJA 4L4OA 4P8UA 1NM9A 1AQ0A 3EDFA 1TVPA 4S3KA 3ECQA 3CO4A 5I2UA 2G8ZA 2FGLA 1OIMA 3M46A 4PMRA 1JNDA 3D4YA 4EKJA 4PCSA 1FOBA 4BQ3A 2GJXB 4W7UA 2YDQA 4PMOA 2PWDA 2XFYA 1J18A 3T0DA 2OYLA 3BAWA 1E72M 3HG4A 3THDA 1W9XA 3PTKA 3W53A 3IAPA 2J7DA 1L0PA 3WD4A 2EABA 3NDYA 5A6MA 2XTKA 2VRJA 5A8PA 4JFVA 1R87A 3BSGA 3O6AA 4PSPA 1JZ2A 4MB3A 2UY3A 4D6CA 3BLPX 3VX0A 1GOIA 2X0HA 1VFOA 4HTYA 1V02E 2YA0A 3QHNA 3CUFA 3QR3A 1SMDA 3MANA 1GQLA 4AW7A 3AIQA 5BROA 1K9FA 4J3UA 4OJYA 1JNEA 5ABFA 3ARYA 3K8LA 4P7QA 3U7BA 1FH8A 1BGGA 1VFMA 3AXHA 1W2VA 2J7HA 1EH9A 3VGGA 3FHAA 1V6VA 4FLOA 1UR9A 1NWSA 1DWFM 3UEQA 2W66A 1U2YA 3N1AA 1JZ3A 1A3HA 3ARXA 2IUZA 3EDKA 1CECA 1KGWA 4D72A 2A3CA 1ZBVA 2DDXA 3G6LA 4Z2LA 1CWYA 3UETA 1TFVA 3WQ5A 1C7TA 3N12A 5A2BA 4AYGA 1HJXA 3NCOA 8CGTA 2RGLA 2CEQA 4UFJA 2VMFA 3AZSA 3OIHA 1XHGA 1PIGA 2VZOA 1JYWA 1MFUA 3LX9A 1JYNA 1XSIA 1KXHA 1GOKA 1F4HA 3TONA 3AISA 1UKPA 1EHAA 2VX5A 1QWNA 3CZNA 5E0FA 3BUDA 3CZKA 3CZGA 4AZ5A 2J77A 3KEHA 3PBGA 1FA2A 3GXDA 2O92A 4XB3A 1ISXA 2WMIB 3EJUA 5A8OA 1KXQA 2BVYA 3GZAA 3K1DA 3S6TA 2ZUVA 1G01A 3GYCA 1R47A 4U33A 4MPKA 4DM2A 2ZICA 2V38A 2WMJA 5CPQA 1J0HA 4AXNA 2A3EA 2EPNA 1ZBWA 5AYBA 1TA3B 1J11A 1W2PA 3MUIA 4M56A 3W28A 2FH6A 2ZX7A 1Q6EA 3QHMA 4NXSA 3CIVA 1GONA 1UWRA 2X09A 5TD4A 3MMDA 1DEDA 4KGLA 1PX4A 3LRKA 4M82A 3CMGA 4UFLA 2VTFA 3AFBA 3N18A 3DECA 3VKKA 3POHA 4XX6A 3GNRA 3ALFA 5A6KA 2WC4A 1FFRA 3AIUA 2WVTA 2J8FA 4PEEA 3AHVA 4AWEA 3GTNA 1JZ7A 2W61A 1QNOA 3ZMRA 2WHLA 1GHSA 3H54A 4NI3A 1TQTA 4J3TA 4U3CA 1XH1A 3AZRA 4WKAA 2DSVA 1NOUA 4YN5A 3WNKA 3GXMA 4L4PA 2J74A 1C3FA 4QFUA 1LJYA 1E1FA 3WDRA 5CJ5A 2ZX8A 1HJSA 1TG7A 3FHQA 3ARPA 1CXIA 2YA1A 4M80A 3VDCA 3UESA 3JUGA 5BRQA 3LPGA 4PTMA 1H1NA 2WZIA 1WKYA 2WBKA 3CZEA 3DX3A 3D3AA 2PF0A 3VPLA 5A6AA 2C7FA 2VX4A 2WMGA 3CTTA 4BQ5A 1MW3A 1CLVA 2DIEA 2YOCA 1EGZA 2XVKA 2O9RA 5JBEA 2WBGA 1W9PA 3IAQA 4GI8A 1WDQA 1FFQA 4TX6A 1JXJA 1UOKA 5M5DA 2Z1KA 2VZTA 4OZOA 1UKQA 3U5UA 1IV8A 4D6DA 3AZTA 1VJZA 4B9ZA 2GUYA 3F5JA 3VD4A 2OLHA 2Q8XA 2XIBA 4A3HA 4AD4A 2ZXDA 4JFTA 4Z2IA 4M29A 2VRKA 1JDDA 2BFGA 4GINA 1XSJA 1O7DC 4DWSD 2BV9A 3LPOA 4P8VA 3OG2A 4KH2A 2D3LA 1I1XA 1OM0A 2OYKA 5E70A 4V2XA 1EOMA 4EK7A 2ZUUA 4NZJA 4FMVA 3VMPA 5A95A 3WDJA 3VIHA 3T09A 2RGMA 1LG2A 3O9NA 3VIIA 2XGIA 3HG2A 2ALWA 3WBAA 5IDIA 4P8WA 2EAEA 3ZOAA 3FN9A 1CGTA 1HNYA 2CHNA 2WKLA 2PB1A 4W5UA 4AZCB 5IHSA 5D9MA 3WF0A 5HBFA 5CGMA 3SCSA 2VX6A 4C7DA 1CZ1A 1B90A 5ABHA 2XSBA 3A6OA 3WQ8A 4HPGA 2EQDA 2XN0A 3NSNA 3GBDA 2ZWYA 5CSUA 2WSKA 3ARWA 2ZUMA 3BCFA 5EFFA 3AS0A 2J7GA 1PZ3A 1KWGA 2J79A 2A3BA 3HMCA 1IT0A 3A23A 3GXIA 5E1QA 2J62A 2PWHA 3APGA 3DDFA 1CLXA 3WD2A 1C7SA 1KQZA 4GQQA 5HPOA 3KZSA 2QMKA 4KWUA 5D9PA 3W81A 1V3IA 1H0GA 2W63A 1B1YA 2W91A 2JF7A 3A4XA 3IJ7A 4UOZA 1XV8A 4ZENA 4MNLA 4FK9A 1OB0A 7A3HA 3B9AA 1JL8A 1XCWA 4AD3A 1LL6A 3LPFA 4ZE5A 1G9HA 1PJ9A 2XVLA 3T2PA 5EMYA 1V3LA 1VBRA 4AD1A 3L4ZA 2WMIA 1NWUA 3FXYA 2J7BA 3WDHA 4PCTA 3TTQA 4R5EA 4JIEA 2Y5EA 2WWCA 4Z2HA 2FE0A 2JEPA
chains in the Genus database with same CATH superfamily
4PP2B 5DFVD 1HKKA 3EFDL 2X4QB 4CMHB 4PJ9A 4H2CA 5HYFA 1P7QA 3QRBA 3EWCA 3ZWTA 2EYTA 3VZZA 1AXTL 1T8QA 5ID0A 4L3CB 5C9KA 1CL7I 4NZ3A 1AQ8A 3E0LA 2WLNA 3D85A 4C1NA 3MR9A 1HOCA 3ASOB 3EB3A 4JN2A 3PV6B 2OW7A 4OTKA 3A4DA 3IGKA 1HJWA 5M2FX 2VCCA 3KM1A 4RIRB 4HIJB 3FUNA 3SCVA 1J1OH 2Z31B 5E6RB 3KWXA 2I57A 3L5WB 2MSPA 1U8PA 3EWXA 4LSPL 5DMJB 1NCNA 4CN4A 1UQSB 2KAUC 5D2WA 3K2MC 4L4JA 2Q76A 4MA3A 4OAWB 1R34A 2F54A 1OE3A 4AW4A 3S5SA 2VDML 3W1XA 4R7VA 3U36A 3UJRA 2NY3D 2IDUA 2HPTA 5C0EB 2NQZA 5LKNA 4PN6A 4JKMA 1HCYA 1DLFH 2H6UA 4URKA 3LKRB 5C71A 2DQMA 4HH9A 3S2MA 3HG1E 1DYZA 4HQQL 3H2MA 4JE4B 3GHBL 3KYKH 3LCIA 1F4XL 4Z3JA 1FLRH 2BGSA 3KX6A 1JHLL 2RH9A 1EA0A 4YHPB 3NL3A 3HG1D 2CM5A 4KJPC 2Y7QB 4PJAB 3VOHA 3VFWA 4GRLC 3AREA 1PD0A 4CVXB 4ZAKB 3U82B 4M7ZB 3HOJA 4PJGF 3D39D 4H04A 1R5VB 3US1A 4LOUD 1RQEA 3BN9D 3IRSA 2ZCGA 3UA3A 4CEUC 4OZIE 3RWFA 2PDXA 2VW7A 5LVEA 1F2QA 3OPSA 1EHXA 2VIRB 2DJSA 2Z8SA 4FEMA 3GC5A 2HVJB 4YHYC 1UUNA 1E2VA 4A2EA 4LY4A 3II2A 3N2CA 4DNMA 1EP3A 5EU5A 2QPSA 1MNUL 5EU7C 1QT1A 4PCYA 5ANMA 1Y65A 1TPXC 1BEUA 1BEYH 3U5YA 2IKJA 2B5IB 3PJTA 2B7QA 2B4CH 1XDTT 2P45B 1EAJA 3K6NA 1SSGA 2CIPA 4BF9A 4LKXA 1CFTA 1U8KA 4Z1PA 3DXAB 4YHKL 1WDSA 3SM0A 3NL5A 3EEGA 4F58L 2VCAA 4NNYB 2XTJC 2DJMA 2Q71A 5BS0B 2K9UA 1R3WA 2ADYA 2XN2A 1JGLL 5I02A 4JFOA 3KPSB 1ZP4A 4Y4KD 3WY1A 1KPRB 4A2SA 4N2GA 2DL2A 3LN3A 4HFUH 2WNKA 4DN3L 5SWZE 1KBBA 2NY5L 1AD9A 4WKZA 1KFCA 4NPKA 3VFMA 2FL5B 4DH2A 2CPCA 3NP4A 4JK0D 2E3ZA 4HJGA 4IHOB 3UZEC 3ZX1A 3LHPH 2QADB 3TEXA 4DGIL 3DJSA 5D1QA 3RQ3A 1U4FA 2JKNA 4FI8A 1FTXA 4HALA 5IB5A 1CE6B 3P40A 3B9EA 3ARGC 4N2DA 1UWYA 2ZZ3A 1MHPL 3LQAL 3LPPA 2GSIB 5E2TH 4NSBA 4BEQA 2QUUA 5AOIA 2X28A 4AIZA 3U7WH 2OA9A 4D1JA 5DT7A 3T42A 3TA3C 4U3SB 1O5XA 5KBDA 1EBPA 1XX1A 4GT7A 3FN0H 4G7EB 3US9A 1O6SA 1YUKB 4P46D 4HD5A 1E6JL 4B97A 1AYRA 3VXPA 5L2KE 1U1JA 5A94A 3BURA 5AAMC 1HL9A 3Q8EA 2BC4B 5CG0A 1YDPB 5FO7B 3V6ZA 1Z89A 2B39A 3UTSE 4HT3A 3GIZH 3B0UX 3NJXA 4A6YL 2VLRD 3SDDA 4OCYL 1YPXA 2B7NA 4JPIA 4QOKB 2DQFB 4L3EA 4D94A 4PRTA 1Q38A 3QNZA 4OCSH 3OMZA 4CNSA 5F7LB 1Y6MR 4XC1H 1VFBA 3A21A 2DJ4A 4DJEA 5EC1B 4F15C 1PBYA 1AMKA 1DWGM 1AZUA 5FOBA 4L8CB 4LCSA 2OMYA 3CPGA 4JKKA 2AKMA 3A6BH 3GSUB 3VWKA 4XHJC 3L66A 4XCYA 2R9HD 1YEJH 1GY1A 4N9GB 3WY2A 1XR2A 1RSCA 5DLMH 2FWOB 4JHUA 1KGYE 1A8ZA 1Q0YL 5L7XH 4CSZA 3T0TA 4K1WA 2EDXA 4B4HA 1DZBA 3R0DA 1H3PH 4O10A 3VCCA 2F7QA 2DJXA 5CQ1A 2ENJA 3AQDA 3L4YA 3QIBD 2VLMD 4JQ1A 4O4WA 5ILTH 1JPGA 1QLFB 4GKSB 1DWIM 1JZJA 4Q14A 5AYIA 2APWA 2PEVA 4N6FA 2VMJA 1FXPA 3PJSB 4U3HA 4ZFMA 3OZ9H 4NHCH 3PCYA 2POZA 3WEXA 1F0LA 1XEUA 1L0XA 2YGQA 5F2GA 4MWAC 3UCCA 4JG1H 4L3AA 2YPKA 2AMUA 1EEXA 4Y9CA 1UIOA 5BZAA 1QI5A 3KPLA 5IVZA 2ESVA 3CWNA 1LQSR 1XGTA 1EEZB 4V11A 2K8MA 3W38A 5EBWA 4J3OH 1TXKA 3PJLA 5F1UA 1LP9E 1WFMA 3MHGA 4WUKL 3PQYD 3VDAA 1QDSA 5B1CA 1OAQL 3H4FA 4MAYB 1PS9A 3Q1EA 4ZNEE 3GB7B 2CKNA 2ZSVA 3IDMB 4UWQB 2OMZA 3FFCA 4AXWB 1SJEB 4MD0A 4F7MB 1D5BB 3I6LE 3HPJA 3PGFL 1E2WA 1I53A 4MQXC 5BMWA 4IXHA 4P04A 1GK8A 4E2OA 4A7GA 3W84A 4W6WB 2QGYA 4IIBA 1HDMB 2I17A 4R7LA 1BAGA 2H1PH 3NGFA 1TWZA 1W3NA 4AIEA 5IB4A 2AV7B 4EIUA 1UR3M 1K4DB 3HKZA 4XISA 2VLLA 3L9BA 5A3ID 4TR9A 4OIAA 1RZPA 1HHGA 4XCFH 2WOYA 1YVLA 5DJCA 3KCJA 3S5LG 3GDCA 1NJJA 1YECH 3T78A 4QEGA 5LGJB 1T0MB 3CFTA 1CG9B 1MJ8L 4NYLA 4PFHA 5AHLA 4W6YB 1RK1A 1AHWB 4BZ1A 5C07E 2DMBA 1RQHA 5ETUB 5FCUL 5DEZA 3MRLA 1KT2A 5F3FA 5D1XD 2KHAA 2MKLC 5JDSA 1XPYA 1KXQE 1XGEA 3FQYA 3M07A 8XIMA 3CHCA 3QUMB 3LSBA 1SMAA 4JYFA 4UYPA 2Y89A 3M8OL 2JE8A 4Y9BA 4R5VA 3CG8A 3I3DA 3TPUB 1E9IA 1UM5L 2IH1B 5IBXC 4IRSC 5DRZA 5F4WA 4KQ3H 3OHXB 5I5JA 3ZL2A 4CNUA 1XYFA 4LGRB 4MJ2A 5HHNA 1UA3A 5IFHH 3TTSA 3LB6C 2Y6TE 1XLAA 3EMCA 1GGBL 4P7OA 2IQAB 2IGLA 2CBTA 1XDMA 2R0WH 1XQKA 2PDIA 1CD0A 3HMXA 1B2YA 1XH0A 4MBRA 4PUBL 5IEHB 2ICWJ 2XN1A 2BVPB 4M8QA 1K9TA 5GRYA 1U8MB 3WS6A 2ZOLB 3AT9A 2HVMA 4Z2KA 3OAWA 4MHHG 3SI9A 1KYAA 4ZW6A 2QSQA 4PRNA 3PY2A 3K6DA 2Z4QB 1ECEA 5E1HB 1IWAA 4P2RB 3LZLA 2G9KA 2H3KA 2O4MA 2Q5BA 1E9QB 1Q8MA 3ZSTA 1RUMH 3O11B 4LBSA 4Y2OB 43C9A 1IKNA 2YQGA 4QTHA 5KYUB 5DURD 1NARA 3PG2A 3D34A 2RD0A 3ECBB 5DMKA 5LG6A 1D5IL 2YDAA 4GXUN 1WC7A 1GRWA 2JIXB 4WNQA 1Z5LA 2A74B 4GLEA 4UOQA 2VFIA 2QT3A 1N26A 1ACYL 5F1KC 3OAYH 4M7SA 3SZ6A 4YN3A 3MUZ1 2D0HA 4N2FA 4UF7C 1FWTA 4PJ6A 1E0OB 3U4BH 1QD0A 3HBGA 5D1ZD 4OJFH 3FB6A 1B6UA 4DVOA 4QO1B 4KZEH 4UDTA 5IMMB 5F6IB 1C16A 4RH4A 1SBSH 2ASHA 1WQVT 5HJ3B 4D6EA 4WTZA 3JT0A 2OQJA 3O6FC 2FJKA 3BSZL 3IDIB 1WE5A 1OAZL 2VQ1B 3UWUA 3I68A 3ZDXF 4LVBA 3DEQA 3DIPA 3MNVA 2A6KB 1REIA 2GVLA 1HL4A 4BE6A 4QGCA 3MJGX 4HKZB 1O94A 5FEBA 1IGJA 4YDIH 3QZOA 5KSUB 1I1YB 1MLBB 5EU3A 2XFWA 3M0XA 4NGHH 2TRHA 2F7RA 2DT0A 4X6CA 1ZB5A 1OSPH 4E3TA 3MRIA 2DYPB 4RFOL 3VG0H 2QCDA 5D2LA 4ELMF 4PRHB 3GNOA 4J4PC 1SXBA 4E41A 2GBUA 5IJKC 4L6OA 4OT1H 1P43A 2WO3B 1H49A 3BJ91 3WENA 1HZLA 4M19A 1KO0A 2AQNA 5DJ0B 4XP9L 4O0QA 2EYRB 4GAJL 4WFGE 5JORA 4F79A 3GR4A 4YSPA 2L4OA 3LN9A 3MA7A 1GKQA 2H3BA 1CDGA 1NCIA 5CWSB 4DCQA 3CUIA 2J8GA 2O9TA 3PXJA 1JZ4A 5A6LA 4G9FA 1CD8A 1DJQA 4ZL1A 1LT7A 3N43F 3NYKA 4NC2B 4V1XA 1NFDF 4DP8X 2VRQA 3F01A 3ECWA 2Y2YA 5F1OB 1C92A 5IR1A 1I45A 3MV7B 5CZXC 4H25B 4BHUA 1CXEA 2DFAA 3NIFB 1YLBB 4XVOA 4GRLD 4Y9GA 3WD1A 3T1FA 1E0UA 2ZA2A 1XLLA 3LV5A 2OSXA 3FDWA 1HT6A 4AMKL 1T22A 4EI6A 4PIRF 1BG9A 4UZGA 5BZWA 1Q7MA 1TJIH 1FYTB 2HT2C 3HFYA 2V68A 5J1AA 3F6IA 1PCSA 3NTCH 3V4LA 1MFAH 2F8VA 1QRQA 4DETA 5CJOL 3OKEB 4EANA 4LBEB 4C4UA 3JT2A 4DZ5A 3M0JA 5D6DC 4RFNC 1BVKB 2CR0A 2HV5A 2Z7WA 1NICA 4IDJL 4KXCA 4K36A 1Q66A 3LHWA 2NVAA 4YVVA 3LD5A 3KVMA 4FP8L 3MROA 1QZNA 4PRIE 5CEZH 3B7TA 4UNKA 3SOBL 1UZGA 4XC3L 1VFAA 1CWVA 5AHNA 3CFCH 2I60H 2AJSH 4B5XA 4XZMX 3DA0A 1EDGA 4WFED 2VENA 4BA0A 5KZ6A 2C1HA 2ZUSA 4PJHB 4ZUTA 3P1VA 4PW4A 2ATPB 4L4TD 2O5XL 1SF3A 2XTJD 3RPBA 2PWGA 4RW5A 2WWOA 1KB5A 3VZYA 1ZLWH 4WK2B 5AAWA 1M6JA 3QPYA 3TJHC 1MHEB 2GTQA 1HKVA 5EOTA 2GWGA 4X6BA 3S2JA 4Y7MA 3TLRA 3TN3A 3MB9A 1PIIA 3HE7A 4S3GA 4PS8A 1MHCB 3CLEH 3O4LE 1QLEH 1FHNA 1F8TH 3NZRA 2B2XH 4N68A 3ZDYF 2ZCKL 3RBGA 1SEBA 3BO8A 2YKLL 4C1KA 4GIRA 1PQZB 2EXSA 3QJZA 3ZYIA 3VMOA 3FYPA 1QTSA 3KPPB 4PB5A 4FTVA 1RMFH 3R8QA 4AJVA 3DVFA 1NWRA 3EMQA 3EFOA 4G7SB 4LF2A 1NZRA 3ARGD 1Z8AA 4URIA 5E4IA 1T5XB 3D12B 1XF3A 4XWOD 4IISA 4JGDA 1DJWA 1KV7A 1H50A 1NCAL 1J0YA 1XLDA 2IXQA 2WWDA 1E55A 2D03H 4KCWA 1AGBB 3QUML 2EP6A 3W6MA 4ODTH 1CZ8L 3P81A 1J0JA 1Z9NA 1KNOA 4RGND 5GQBA 3FRUB 3H3PL 2BDNL 3ZMNA 4PZVA 1BFVL 1MI5B 2A6DA 5HGDA 5HHQA 3MJ9L 3TH3T 4A8NA 4OJDH 3VXRA 2YAEA 5LJYH 1MCIA 1FWSA 2DQCL 1W5NA 1SW7A 3UXIA 4IU3B 4HJTA 1J8RA 1FC2D 1RJLB 3TW6A 1TVPA 2ZG1A 4Z77B 2G8ZA 1GVQA 1X4YA 3ESNA 1EKOA 5HHOB 2B0SL 2CIIB 1SVBA 4O17A 5E8OB 1RZGB 5B3NA 1W56A 4NJHA 5TH2A 1RZMA 3VFGH 3BN3B 4XHJD 1VCGA 1J6OA 3Q6FA 3QDGD 3GHUA 2NTFA 4POZC 5KVDH 4HGKC 1AKJA 4QJ5B 5MHSE 3MRKB 4L23A 3LIZL 3HPXA 4TRPH 2W66A 1YMMD 3CDGB 1WWCA 2A3CA 5GZNA 3KRSA 3UWVA 3SO3B 1ZGLA 4ZD3H 3UJSA 5CGBA 3ISYA 4HWEH 3FGCA 3B2UC 2BP8A 4MWAE 3HFMH 5FX3A 1F6FB 4I87A 1JPDX 2VRAA 1YNPA 1J9CT 3FH8A 4MWAD 1MDAA 3K71B 3RAJL 2ZUVA 3SYOA 3W75A 1RA5A 3W88A 1Z3GH 4WHBA 3BCJA 4O12A 2FIKA 2QR0B 2F5BH 1W2PA 1Q6EA 2OODA 1HHHB 2OKOA 3ZTCC 4GISA 1P1VA 3QUGA 3DECA 5EMMA 2BMBA 3POHA 3H9SE 3RWCB 1NL0H 4P99A 1JZ7A 4X22A 5HA7A 5CEYB 2C9QA 2NYZA 3H9SD 3PBYA 4X5PA 2DSVA 3TFCA 4FAMA 1YDNA 4HYTB 4YN5A 5KWYC 5I6OA 1F11B 4M61A 2ZZ1A 2IMNA 4PV8B 4JO2L 1AJ7L 2NXYD 3UESA 2EAWA 3C3NA 1Z0MA 3TZNA 5JOPD 1RK0B 5T5NG 4G11A 4I9TA 1KV3A 1T5KA 4MQXD 4B7LA 1OANA 2JXMA 2XPYA 4J1UB 2ENSA 4BELD 2AJXL 5AYQA 3T0EB 1UKQA 3IS0X 3CHRA 1O7DC 1JZIA 4P8VA 4KH2A 4AK2A 1I1XA 2OYKA 4YHIA 2UYLA 2IPFA 2VABA 4L6HA 1UPMB 4P3CL 5IHUL 1WIOA 2J6EH 3SHSA 1PL9A 4LVAA 2P44B 1T21B 3ONCA 1T89C 4WI3A 3MBEA 2JI3A 2EAEA 4KY1H 1HZHL 1T7LA 1R3KA 4JMNA 1PTAA 2K7QA 1ZA6B 4P9ML 1V79A 2EQDA 2HJFA 1G43A 5EFFA 3AS0A 2G0KA 1OYBA 4DEFA 2BOCB 4IRJA 3BOVA 1ENUA 2QSCL 1KLZA 3ZTDC 4TU1A 3EO9L 3OZYA 2NY7L 3V6BR 2D7MA 4IXXA 4L61A 3GJFA 1V3IA 4YVUA 2A3TA 2AJZB 3H42H 3M0VA 3A4XA 5CHNA 2ZYIA 4UOZA 5KN5A 2C15A 4NZDA 3C6LB 3M0HA 3HPFA 4HEMA 3UTOA 4RR4A 2XVLA 3GEWB 3D9AH 3GTHA 3O9WA 1NAKL 3UO1H 3FXYA 1LO3L 3LB6D 2Y5EA 3VXMB 4O13A 3OHMB 3FHEA 1BZDA 4RNHA 3GSRB 1NFAA 1UACH 2X40A 4TXVB 1TSRA 1KIPB 1BZ7B 4OLUH 5SV4A 4FOMA 4LCYA 1X9LA 2I27N 5DGQA 4A3YA 3EH3B 3D06A 1OTUC 3VTTA 4QXVA 2DQIH 3TT1L 3K1GA 1R6WA 1VBGA 5D71H 3CUJA 4L8SB 4HZLB 4GUGA 4GUPA 3PFRA 3D4ZA 3TV8A 3TCSA 4PJFF 5IVXE 1V8EA 3A5FA 1KLFA 7FABH 2G3IA 4ZX6A 2Y8UA 3E2QA 5I2IB 3FYEB 2NNCA 2PYFA 1BA9A 4JPSA 2AMGA 1VERA 1HX0A 1XCFA 4MX7A 3S37X 2ZOKA 3PG8A 5I1CH 4NKDB 4AGOA 5HMDA 4MF4A 1E9OB 3PDOA 1J0IA 4TUJB 3A64A 2QEJA 3HG5A 3EOTH 4WW2A 4U4IA 4GCXA 3GTTA 4YHNA 1XIMA 1FHUA 4EN3B 4LSBA 2DQ6A 2M83A 5I23A 4CQBA 1O7VA 1QYGH 5C7ZA 5E2VH 3N3MA 5T1LD 1UB5A 2ADJB 1IYXA 4EPKA 2RFXA 3R0KA 1KC7A 5LIWX 3O6FD 5IB3A 1PO9A 5EC2B 5CF3A 3W6YA 3QDMA 5C0AE 3WQDA 5KS9A 5HXMA 1JZHA 2OP4L 1L6SA 3NN8A 5K93A 2ZKHH 1TWDA 4LSUL 5INCA 3L5JA 2VFHA 4JW3A 1DBBL 1BP3B 5J13B 1M3UA 4HMNA 2WW5A 2V5SA 3HU7A 1FL5A 3P5ZA 3OKNA 1KJ2H 5IJVB 2VN7A 3S5OA 2FH8A 4BE5A 3AJXA 4F0KA 1CYXA 4LHQB 3A4WA 4RDQG 1WDAA 1SZRA 4ILSA 5GJPA 4Z0XB 2E47A 1QPPA 5DJ6B 5I66B 2FT6A 4ZODA 2GDQA 4NILA 4MCMA 2VOTA 1ZS8A 2W88A 4Y2DA 3BDYH 3ZHKA 2TPSA 3HC3L 1P4CA 5I09A 5LHEA 2ZXBA 4WWNA 1B4JL 4PTTA 2ITDB 2MQ3A 3RPKA 1UBPC 1VFHA 3VXUA 3SPJA 1R3LA 1W1B1 1CL7H 3BEWA 4KIRA 5DD1H 3B9KA 5E99L 1SOXA 4PREB 2L7EA 2H0FA 1E8YA 1TUPA 3WO8A 2G97A 1RIVL 2BWDA 3SE8L 3C60A 3E38A 5EMJA 5F7DB 1E9PB 2YGVA 5CZXD 1A0DA 3ITGA 1IGCL 3RCNA 3B4NA 2MCMA 2NX5E 4PJDE 3TMLA 1BD2E 4TN9A 3QZWA 4ZQMA 1KJVB 4X7FC 3NK3A 5C0IB 5J5RA 3V7AE 2NX5D 2HT2D 2PDBA 4XOEA 4BQ9A 1MY5A 4Q8QA 2QJNA 2EO9A 3GU1A 2WIIA 1W0VB 4AQ1A 3B43A 1R5YA 2JKAA 4HPOH 3RJXA 3DN5A 4WGXA 2OW6A 4W85A 3NL6A 4XGZA 4Q9RL 2JELL 2RQEA 3WJYA 4RDWA 5EA9A 5E0CA 3VK5A 3HZYB 4A3RA 2WNGA 3Q44A 1FI8C 1KELL 4ODHH 5FDYA 1RUSA 3WEOA 3L2MA 3TOYA 4TO8A 3SCUA 3FO2B 5DRWB 5LBGA 1XGPB 4UTUA 1XLMA 1EZSA 3NIDF 4CN1A 4HG4J 3CFBA 1G5AA 3E8VA 4AVNA 4KKCC 2E8YA 1R9YA 1KB3A 2R24A 3ARDB 2XXFA 4KOCA 2AQTA 3GVGA 1GEQA 2V5RA 4GK8A 4L1XA 4YO0B 4UTJA 3FTSA 1GOHA 1HKWA 3CQFA 4PG2C 4PHXA 1BXUA 3KLKA 3ZGIA 2DLIA 5GIRB 3W7RA 3BQUC 1U5HA 3TJHD 3IJEA 3T4AA 1L7IL 2GFTA 3UVIA 3SGDH 5LDUA 3FTWA 1EOKA 1MAML 3I6KB 1FCUA 3HR6A 2J8UB 4NZTH 1ORQB 3KRZA 2DY2A 1Q94A 5JYLA 5ERWA 3VI4F 1FJ1B 2VCBA 2MCG1 2ZC8A 4WV1A 1NDGB 5CUSL 1GJPA 4OZGB 2DGAA 3DTUB 4PJXE 3RFZC 1U33A 3V0UA 4CQCA 4EUPG 1RZ8A 1V55B 3L3KA 3UBXI 2QPDB 4H1LB 4C6CA 3NPZB 4CCCA 3WN5C 3W1AA 1XCQA 3RDJA 3NOIA 3PWVA 5C0QA 4KERA 3WH5A 3KVJA 3TBWB 2FZMA 4XODA 4UV7L 5IGXH 1URZA 5D9SA 3Q7JA 4F9LA 4ZTPH 1YEIH 3GIVB 3QV8A 3V9FA 4RWYH 5D2NA 2Z00A 1QQDB 3MV9A 1WAWA 1U42A 1PDKB 2XVPA 3QNXB 3X1FA 4I3SH 1NIDA 1QOPA 1F2XK 1W9DM 1ZFJA 4P0DA 1QLRB 5B3SB 1YNYA 3SYCA 5F89B 4LDCA 2K78A 2QIIA 3P9LB 1MLCA 1NF0A 4R53A 3MV01 5IOBA 1NDYA 1OQXA 3PWPA 1KFAH 3G04A 2OEKA 4Q6XA 1RK5A 4Q6JA 4KH9A 3SE9L 1SNRA 2ZWLT 3IN2A 1BECA 1EDYA 4UWMA 1ZVNA 2H41A 4LANA 3LEXA 3QV7A 4R7DB 4TNWK 5EU9A 1GVOA 1AIFB 1H2JA 2ZOWA 1DORA 1SPDA 5KVFE 3U0TB 5SX4I 2OMXB 3S9YA 3GMRA 1S78C 4S3CA 4NZ5A 1UQYA 3P74A 3G5WA 2QMJA 4JFYA 2W65A 5GRVL 1BLNB 4LXFA 2A3LA 3MV8E 1DFXA 3ML9A 4CVZB 2VDMB 4POZD 3B9VA 5G4OA 3WJMA 1P2CB 4G8EB 1I8AA 4CC1A 5CINH 3L12A 3MV8D 1VPYA 4QIRA 1YAZA 1I2NA 3RI5F 1EXHA 1V3HA 3N40F 3EHBC 4NO2B 4UR9A 3H2PA 2DB8A 1RZIB 3WJLA 5DK2A 2QJJA 4XNQA 3V55A 3LRLA 3FB8A 3PG9A 2WJEA 3MNZA 1E5JA 4O15A 2VGBA 3KOXA 4QIUA 4XVTH 2YZRA 1ICPA 4RMVA 3KLLA 4LP5A 4OCWL 2AS5M 1A6PA 1QSVA 3C8FA 3WKML 3CH8A 1V6YA 2CRZA 1YQVL 3RBSA 4PTUA 4IM8A 4GMSL 5CFAA 2IBZX 4KOBA 1RZJL 5EUOB 4MNHA 4Q7NA 2BDQA 3BZEB 4JZNB 4S2SA 3G9VA 3B6SA 3QXBA 3VNZA 3O8XA 5G4MA 5HYSA 4K9JA 4M1GL 4Z08A 1S7QA 4H9TA 2ZSWB 2K9FB 4DZBA 2WZPA 5T1MB 5DCDA 5I8EB 1DN0B 2XC8A 3AGWA 4V1DB 4GG6F 3G6JA 4TNVK 3QW3A 2VLKD 3BG9A 1E3XA 3AIEA 4HSCX 4IBUA 5A7EA 2INZA 3UNDA 2GITA 3V3WA 3MRFB 5HHVL 3DX9B 2F7PA 1TJHL 1D6EB 3KXFD 1O7DE 2P5NA 4KKPA 5C2GA 2GSHA 3BRFA 3SBPA 2ERJB 5G4EA 3KCPA 2BRRL 3NQKA 3MUY1 4MXVE 3IDNB 4QHLA 5AHIA 5AW9B 2Z8WC 4GSXA 2F8XC 3W2MA 2PDFA 5K59E 4U6VL 4I5BA 3KFTA 1QBMH 1X9QA 2BSEA 3LY0A 4H9ZA 3ROLA 3QDJD 1QKZH 2G60H 5DJZB 2I9LB 5JXQA 4R88A 3EX1A 4KAQH 1TQXA 3CIXA 5HYEA 3QFDA 1LO0L 4IL2A 4Z7OF 2I5QA 5HANA 3NCXA 4DZAA 3ELFA 4OV5A 1GY2A 1NAML 4QGYA 2FPVA 3QHFL 1NKGA 1PDZA 2YZ5A 4RZCA 1D7FA 7ENLA 1J8HA 1DANU 4CA4A 5D7JB 5G1TA 2V3EA 1CE1L 4ZTOH 4R0LA 4KFOA 3W1UA 5AVSB 2IIJA 5J6SA 4GBXC 2Y24A 4H4NA 3EYOA 1E0XA 5REQA 3L23A 2PDUA 4XXWA 3E5PA 2OXGB 3WKPA 2X38A 1S5IL 5EB9A 1KYOJ 1MZZA 2A1WH 1LL7A 1SDDB 1UWFA 1X7TA 2X1QA 1JPKA 4Q89A 2BBFA 4A6YB 5GJTL 1TQVA 1GGCH 4ANUA 3TA4D 1MIMH 2AGKA 4BFIB 1XGDA 1MXDA 1IBYA 2OVLA 4B3LA 4PGBB 2YPIA 1NH6A 2Z9TA 1UZ6E 1CICB 1OTUD 5GGSA 4WSJA 4TL4A 4U7SA 2PR9A 2QVTA 3TEUA 4IMDA 2OJ1A 4HNNA 1KRBC 3QA3B 2COVD 3AQUA 2YZ8A 3Q37A 2YPVH 4LEQA 1TEYA 4YAQA 3NCWA 4TM9A 1QHOA 5AB0A 3TA9A 4KDVA 4YDZA 4U1KB 1UC6A 4F9PA 2VDRH 3CWHA 2XYCA 4AQEA 4H4IA 4ZXOA 4FPSA 2R2HB 3FUFA 3MHZA 2GT9A 3PZMA 5F3BB 1BQ5A 2VDOH 5I6MA 3EGSB 3MWCA 3F5WA 3CU7A 1OFBA 1AXSA 2VLJA 1VD6A 5I73B 3V0GA 3RWJA 3NH7L 3T77B 2VEFA 3DX6A 3ROOB 1M7IA 2H8PA 2HS8A 3L3OC 1V8HA 1W9VA 4LSDA 5DD5L 3V0WL 3GFUA 5HUOA 2EXWC 3P4NA 2Z93A 1O60A 4RAHA 2EIJB 4XWGL 1DBKH 2M2DA 4X7EC 1M7JA 3W7HA 2O7QA 2P8BA 3VC6A 2Y5JA 3MI2A 4LFHG 5IEKA 5EB8A 4QR6A 1MQKL 4IBLT 4JAMB 1AL7A 4E4FA 2CNCA 1RAKA 2CUMA 2MTPA 4GS7C 1XC4A 4J3OC 2DWDB 3L4VA 4MY1A 1MWOA 4PJIE 4BDVB 2V5LA 3VXTA 4KV5E 5XINA 3QO1A 4K2UH 5JHMA 2X42A 1C9SA 1WHPA 4FO4A 5MF5A 4YBQC 5KVFL 5D55A 5TIMA 1QR1A 1YIXA 2HPIA 4DKFL 5DD6B 4H9XA 4C7GA 5BRZD 4K68A 4F80A 2HMIC 2Z7ZA 4NKIL 1P0KA 1JP5A 4HWBA 4KVNL 1MCWM 1SW3A 4K73A 1PYWB 4NRSA 3LA4A 1WUZA 4G9DA 4UQAA 3L0NA 3MODL 3T1GA 4HIXH 4Y5YB 3AXXA 1IR2A 3WLWC 4QG6A 4LB3A 1QAWA 5E09A 3TIEB 3F58H 2Y5QA 1SRDA 1ZV5A 3RX8A 1SO4A 2Y5TA 3R8RA 1X4XA 3N42F 4A4AA 3VCLB 1DXEA 3DRQB 1QHZA 5DZNA 5I76A 4BK9A 3NP3A 3D1MC 5F2FA 5FO2A 3UGUA 4LCCC 1SN5A 3NPWA 4WCYH 1AW1A 4LUYA 3TN6A 2Y3AA 2R39A 3RUGA 1QRNA 3VB9A 3M0YA 4DNLA 3UR7A 5I1LA 3HO8A 2GIXA 2H6PA 3VFVB 3ZE1F 1A4CA 4OZIB 1I8KA 1M1XB 2BX7A 4RX4D 2F74B 3KVPA 5BMFH 4WWKD 3D39E 1RUKH 4Z7NF 1BF6A 2K45A 4MB5A 1WIPA 4H40A 1RZFL 2DTML 1I1FA 4APQD 5C08A 2VDQL 3WK3A 4I3GA 1EWEA 1N0XH 1UR1A 4OZFH 3CL8A 2MFNA 1JPFA 2C3XA 5MERA 2MOVA 1TNNA 3PNZA 1JVLA 2WYSA 3HNSH 5D5MA 3CPLB 3STZA 4UQDA 1MQQA 3UPWA 1KBLA 2OWXA 2KC0A 3SGDI 1J88A 1D7KA 3QZNA 5SWSB 2VDKH 4KJYB 4M6NH 4GUFA 5I28A 1N0LB 2YDSA 1UOZA 3WMQA 4KKCD 3WLTA 3U0PB 2P5EA 2AC0A 4YDVA 3FULA 4IBQA 1NM9A 3LKSB 3LI1A 3RWGB 4IIQB 5I2UA 1K7XA 3V2AR 1E28A 1FFOB 2AEQH 4PCSA 3B4YA 5TE6H 5CGYC 2PWDA 3BQUD 3MLWL 4WW1B 5LCVA 3B2DC 3K2UH 2BOBB 4QTIH 5I16B 5A8PA 3PGCB 4R90H 3JRKA 4MKVA 5SWZB 2X0HA 4TMPA 4WWID 1NMCC 2B08A 2YR3A 1S2CA 2YA0A 3FJTA 3CUFA 4ETYA 4AW7A 5BROA 3OX8A 1CN4A 4Z76B 5A16A 2YGYA 1E5ZA 2R82A 4Y4HB 1KCUL 4M5ZL 1TZIA 4H0GA 3U46A 5HJLA 2WWKO 1N9PA 4BSWA 1IAOB 3N25A 1HW6A 3MA8A 3AT8A 3WFEL 2W0UA 1JNLH 4D72A 2CMRL 2DDXA 4Z2LA 1CWYA 3UETA 1IC5L 3RL1A 4LOEA 4KO6A 4R2GB 4WHCA 3S34L 2CEQA 3B8YA 4QEEA 3MLPA 1TSHA 2OZ4H 3EBAA 1OQFA 4LSSL 1AI1H 2AI0L 4XB3A 3A3WA 5IUCA 3K1DA 1Z48A 4P48A 4MPKA 1UZDA 4XWOC 2BLFA 1V10A 5L2KB 3L7EB 2OZTA 1OFPA 3MMEB 4M56A 2ZX7A 4NXSA 4ZZKA 3CIVA 5TD4A 4LLQA 5DRXB 4WK0B 3UTSB 3DX8B 3NO3A 3DUUB 4PWEA 3WIIL 3D4GA 3EBHA 5A6KA 4RGNC 1J8KA 4KTDL 1XI3A 1N59A 5C54A 3ZMRA 3UAFA 3BWZA 1P5UA 1XH1A 3AZRA 1EEYB 4XAZA 2DQGL 2FPYA 3ZHFA 3GXMA 2VLRE 3NEVA 5EIQA 1FORL 4JFQA 5F0LB 2YHGA 1MHHB 2JQZA 2MCAA 3WJWA 1WKYA 1IVTA 4K5PA 5AUMA 4F7TB 1W54A 4G8FB 2VX4A 1VR6A 2V8ZA 1DXFA 1S78D 4QQ3A 3MLUH 1VZHA 3O15A 2VM3A 1W0WA 4P8QA 3DO7A 4OH2A 3VD4A 1JHTA 3CVHL 2P3EA 5FEZA 2VRKA 5I7GA 4GINA 1KRAC 3O2DH 1EJTC 4NZJA 3EHBD 1LG2A 2JQXA 3HG2A 1U5JA 3F4DA 2VLME 5AZEL 3QWQB 4X5XA 4Q2ZB 1LP6A 1AK5A 4OUIA 2XSBA 3QC5X 2VEKA 4JFZL 2ZWYA 4XVEA 3QORA 1GTNA 5D7LA 2DZAA 3D8MA 4JKNA 4M5SA 3MLSL 3G0UA 1RZKC 2CRMA 4V15A 4P57B 3W87A 2FIRT 3A23A 2XQBH 4BFNA 4UAOC 4PU2A 4ZX3A 2WXGA 1CF8H 4KZDH 3CDYA 1SFTA 3QEZA 2C7UB 2JF7A 3H2WA 4MYWB 1LP9B 4ZENA 3VD1A 3LCHA 5HDQH 1DQVA 2NY2C 2FLBT 5KSWA 4QS6A 3T2PA 1KUMA 2WMIA 5K9QG 5G2HA 3KPRD 3C5JA 1K2DA 3PQYE 3KBWA 4FFYA 2O5YL 4BINA 1MQ8A 2G5WA 3VDBA 3I2CL 1AD4A 3VNLA 1AW5A 4WO4D 5C9JA 1Y0EA 4LHUD 4MZYA 4IPPA 3GRBA 4RFEB 1W6TA 1A4KB 3A9BA 2DQHH 3T0WA 4TV6A 2NXYC 3PPHA 5DJAA 2X6MA 3EO0A 3GDTA 5JPMC 3WY4A 4NNPH 3OZLA 5L4IA 1ITCA 3BKYH 3DX4A 5L0QB 3IN0A 4UQBA 2XWDA 1TPB1 1UXSA 4YJZL 3U57A 2EO1A 4QGTA 5CM1A 1G4PA 1P0SE 2DZTA 2PTWA 5A2AA 1DVJA 4D9LH 5C07B 3GNMH 1THAA 4G82A 3C6CA 2D7QA 2QVMA 3N50A 5DQ9A 1R38A 4KEZA 4ELKB 2PCFB 5HMFA 1KF9B 1EFXA 5D1XE 3MNWB 1UJ3A 4JZJB 1IBGH 3KPOB 2A4CA 3QS3A 4IU2A 2CBUA 4XPBL 4QHKJ 4GHRA 1YMHB 1CBVL 4OB5L 4GUIA 4F8PA 1YE4A 1B4RA 4A8LA 3T5WA 4C6EA 3WI9A 2J2ZB 5GRVK 4XCEA 2L7QA 1OY0A 5CBEA 4B4FA 5AOMA 5IREA 3BVNA 2QQLH 1XCXA 3EA2A 3GXPA 3I6GA 4GBXD 3OJ2C 5BCAA 3VRJB 1NGXB 4BZ2A 1MJJA 4K71B 1Q6GA 1UZ4A 1LOQA 3WFHA 3W7GA 4Q9QL 5EBMB 1A7NH 1KFGA 2X4UB 1JRCA 1ETZA 1F76A 1UD6A 2NX1A 3VE0B 3EXSA 2EE3A 1QUNB 2ZVIA 2OKTA 4Z7UE 3ITXA 4NUWA 3WIHA 1F86A 2V63A 2P5WE 1IC1A 3MUJA 4GRWF 4N2LA 2W0KA 4PP2A 2P5WD 4PB9H 4NHVA 2X4QA 3IJIA 3RPDA 1WHOA 3IIPA 3CVBA 4HIPA 4L3CA 5FW7A 3S3GA 2QTVA 2ESCA 1SQMA 4Y1TA 1XISA 1QWUA 4HXBL 1EZVX 1I4FB 5F9WB 3PV6A 2LLNA 2ZZ4A 4QKXB 3RWHB 4IMLB 4G8GD 5D1ZB 1H5VA 4RIRA 2BW5A 4HIJA 2LQRA 4X9BA 2IOMA 4WVRA 3L2IA 2VXUL 3BKJL 5C7HA 1DWJM 1QNQA 5DC4B 3L5WA 3MO7A 1EWHA 1AZNA 1UQSA 3W86A 5BNXD 1DQLL 4HZ6A 2BJMH 4XZHA 4RISL 1EJOL 3V95A 3MLYL 2I9UA 3K8KA 1CBGA 4C6IA 3Q8FA 1TU2B 2EXWD 4HCRL 4KKXA 4FXKB 5C0EA 4H8HA 3TA6A 5GGRA 3GB6A 2KH2B 5DXWA 1NCTA 4N8VB 5FESA 4JX0A 3M17A 1DE4B 5EMKA 4NQDE 3IJHB 3E6FB 4M93B 2NR6C 2Z1BA 4M4PA 4YHPA 3LHYA 4GQGA 1JI2A 4PJAA 3VUAA 2DZEA 4NQDD 5AKRA 1G1YA 4J3OD 2WCAA 4CVXA 4DAFA 5LKYA 2BS9A 4ZAKA 5ABAA 4A38A 3V4VL 3A24A 2X6VA 2EE9A 3ARBA 4YBQD 2F0CA 3PJXA 3WBYA 3OKDB 2HMID 1WOBA 2VIRA 2CWXA 4AGNA 3HUJF 2HVJA 4Y5XC 1GGTA 5GGVL 3LMJH 3WLWD 3FU9A 1N68A 4E42B 3BPLB 3R0UA 3VG9C 3O3RA 1BYPA 5JXEA 2INFA 1DSFH 1A14L 1Y5WA 3THML 1OHZA 3FOMB 5E0KA 4EOWL 2CLOA 3PZTA 1A3RL 5AFAA 3FTYA 4HHWA 1FWDC 1J01A 3FCBA 3KD4A 4JNYA 1TKKA 2AL2B 3ASNB 3HB3B 4GE8A 1PZCA 3DXAA 2QQNL 5G5IA 5BS0A 2WBJC 3VABA 2RDTA 1IQWH 3AUVA 5ECVA 2R4RH 4LS1A 3KPSA 4LCUB 2Z7UA 5C2BH 2EKJA 4F57H 3HC0B 3NSDA 3TEVA 1PG7X 5D05A 4YHYB 5KSAC 3HRZC 3K8MA 5KUKA 3LEVH 5KZEA 2FL5A 3ABSA 5AD0B 4YWSA 1JUEA 4FQXC 2VC2H 1NP2A 4PY7B 3Q8CA 4FZIA 2VXVL 1TPXB 1Z3RA 4PRIB 3VWJD 3D47A 2WTRB 3RU8X 4NWTL 3WF4A 3PUDA 4FLQA 2UBPC 1CE6A 1TE1A 2DMCA 3HJ0A 4KKNA 3PSWA 2R2BB 4TPRL 5D2YA 1MREH 2GSIA 5EU7E 1ID5I 4BV1A 1YTKA 1D9KB 4N8CH 3NXLA 1OAKL 2ZUYA 2WYZA 2D20A 3FJ4A 2GC7C 5KZDA 4G7EA 3VM5A 2PRHA 5C0RL 4L8BA 4WFEE 2ZTJA 4O2CB 1SJCA 4ZE4A 4L4TE 2HTKC 4WR3A 5CGYD 2XTJE 3K6FA 3R0NA 2UWFA 2BC4A 4RESB 2WJ7A 4MJMA 2ATAA 3ENLA 5FO7A 4ENED 1EC9A 3FB7B 3BP6B 1B4KA 1N7ML 5LLIC 2OR9L 3O4LB 5I0ZA 4LCIH 4H0LC 4QOKA 2DQFA 2VD9A 5F7UA 1MQPA 3BW4A 2N01B 3W7NA 3QFEA 1XDLA 4U6YB 2O9OA 5HY9B 1QFUL 4PMVA 4XT1C 5EC1A 4NC0B 1PKQB 2PZ0A 2QEZA 2BNQB 5JHLL 2BS71 5JOFA 4LOCA 2Y1YA 3D7PA 4FYRA 5CSRA 4MA1C 4L8CA 5JXAH 3FU6A 3QYMA 4MYXA 4GVHA 2VOMA 1CXHA 3TA3B 2CU9A 1NIBA 1M57B 1KEMH 3L81A 1WTGT 5B7EA 1JRHI 4YVNA 4JQVA 1AS8A 1RHCA 5EDXA 3Q05A 4KK8C 5T5NF 1U3YA 4ZFCA 2AJ3B 2FD6H 1WA0X 3GSWB 3N4EA 4AG4H 5KYXB 1AXIB 5DF0A 1V7MH 5CP7A 1IHIA 1DJXA 4OD1L 3BUYB 3DBSA 4GKSA 4RGNE 4DTGL 2YUXA 3S5ZA 1QASA 3DCPA 4K94C 1OE2A 4Y5VB 3SE4C 2A85A 3X14A 1ZAGA 1UC4A 3PJSA 4BKTC 1X1NA 5CLTA 1KM0A 2BSRB 4I48B 1JCVA 2CJ3A 3KOWA 3GBEA 3FCPA 3EKLA 3CV6A 2MRYA 4X9FA 1KEGH 1AYOA 3KPQB 3QUYB 5DXXA 3PUGA 3O3DA 2HKHL 4WTZG 3U6RB 1EEZA 3EWDA 2A1YA 3LZ5A 4FFZL 4MUZA 4PWIA 2NLJA 1GZHA 3VXOB 3H7UA 1FWNA 2GCYB 1G6VK 3TU6A 3RNQB 2YFNA 32C2B 2XZCL 3PBUA 5FJOA 2ZCHL 5EOCL 4MAYA 1KB9K 5HYJD 1OAYL 2J43A 2X1RA 3OIXA 1YEWA 3GB7A 4J12A 3QDGE 3N2OA 3WUWB 1L5GB 3UAJD 4AXWA 1SJEA 4F7MA 1D5BA 2J5WA 4PJ8D 3G5YB 5GRWA 3JU2A 1YMME 4KNSA 3UT0A 1AR1C 3SAZA 1T7YA 2DSKA 3GK8H 3CHXA 1HDMA 2YL6A 5I1IL 2VXQA 5SX4H 1TREA 2B8OT 2AV7A 1K4DA 3OXRA 2W1NA 1ETA1 2BSBA 2J1XA 1KCVL 3DIFB 2VXTL 2HPMA 1T7ZA 2CLIA 1T0MA 1CG9A 3TM6A 2QSVA 1OAXL 4DJDD 3P0WA 3SB3A 1KGJA 4S2CA 5ETUA 3BKCH 3ML8A 2EPKX 3EZ4A 4WEMB 4U1JB 2NY2D 4HS3B 5K1JA 4JNXA 2VGGA 4ATLA 4CBPA 5CEZD 1LD9B 2WWMC 2Y36H 4AF0B 3TWAA 4CCEA 5IIEB 4ZQNA 1QI4A 3ARFC 1ZSXA 4DYKA 3TPUA 2IH1A 3MLXH 1SQ2N 2RGSA 3M6YA 3OHXA 3IFOB 2CO1A 4HD9A 4S1RL 3VKBA 5JOPE 1FO0H 4O1EA 2Q3XA 4F7PB 2RA1A 4MCYB 4XPHL 2ZQKA 1L6GA 4OLWL 4FQCL 1MW0A 3D0LB 5EU4B 2RJGA 1UB3A 2J72A 2XWTB 1KRCC 2IQAA 4IKKA 4UCFA 2CITA 5T1DH 4YCPA 2NQ3A 4TQ8A 2AEPL 3W2JA 2DQUL 3NA9H 1UA6H 5IEHA 4L9LC 1XSOA 2BVPA 3CN3A 2V9RA 2X1XR 1U8MA 3TVMC 3UF9A 1KULA 3VGAC 2PGWA 1VDGA 1I8MB 1CD1B 3G3MA 2A7RA 5AW7B 4YBHA 4F40A 1WF5A 2EKSA 5EORH 3SDYL 3MACL 4WJ5B 5HPMB 4F8TA 3WE1A 2Z4QA 5LYRA 1FDLH 3E6HA 4IBZA 2AQ3A 4P2RA 4IRSB 2J88L 3N4AA 1MN4A 4L0PB 4PVMA 3O11A 5JYMA 4RDQF 3AB0B 4Y2OA 4J23A 5I74C 5KYUA 4GVFA 1K5WA 2HUHA 4HPYH 1CVRA 3ZJ7A 3GMNB 2ZNXA 1RR2A 4JHZA 5AW8B 2JIXA 4ENZA 4U2YA 2KPNA 3AOFA 3HGRA 1OD8A 3S5NA 3QQ1A 4F7CB 1CD9B 3DGGB 5TQ2L 1BYAA 2D4DA 3VSTA 2GGJA 3NQVA 5IMMA 2QLYA 2BNRA 5HJ3A 4L80A 1A3LL 1GOFA 4MYPA 3IDIA 3V4PL 1EVTC 4KBXA 4DY1A 4XP6L 1BZ9A 1SXSA 2A6KA 3S8GB 1NJ9B 3VFUB 1FGNH 4W7VA 5DCBA 5IVXB 5KSUA 1I1YA 3MLZL 4PE8A 4YSQA 1OP4A 4POYA 1O68A 3PTMA 2J3SA 2EDWA 4R27A 1TJGL 3EYSL 1NUGA 5JMOC 2DYPA 4ZRGA 1V6WA 4PRHA 1F6LL 4HP5A 3WK2A 3BZDA 2Z1PA 5LGZA 4Z2JA 4HIHB 4AU0A 1EQPA 3WFCL 2G0LA 3BUVA 5CILH 4ERSH 4AV5A 3IKKA 5C9XA 4RCAA 4LEEA 1ECZA 4LSVL 3ZLQC 5DJ0A 2VGIA 2OU4A 3WJJA 2EYRA 4IQEA 2JK5A 1V7NL 1WWAX 4KI5C 1ZHNB 5ESQA 5GISH 3W3BA 4E9LA 4QISA 8FABB 3FPXA 4WXYA 1TZ7A 4CQAA 3OW1A 3SYAA 5C0AB 1MRDH 5KJ4A 4O54A 2FWUA 1S5TA 4QT5B 3ZYJA 3JR2A 3RG6A 4M7JH 3M1BB 2NUPB 1JGUH 3VNYA 1PSCA 4Z7QF 2NR6D 4FGMA 2YJQA 2CKBL 3VOCA 3NQEA 5HMSA 3WD0A 2DWTA 4H25A 1XLKA 1R3IH 2WMHA 2CYGA 5EPMB 4ICCX 1TPDA 4PTNA 4NJAL 1QK2A 2GFBB 4TUFA 3QJQB 3F7KA 2NUWA 4JPQA 4UTAA 1XYZA 4FAAB 3PANA 3U4EB 2HLFC 2YMXL 4JKPL 3MOQA 1OAJA 5T9BG 3OKEA 4ZO9A 3H4XA 1JGVL 3TJPA 2OWWA 3US0A 1SUXA 43CAB 3W02A 1T66C 3U6XA 1OWQA 3NGJA 1BVKA 1KKRA 3O6YX 3UTPD 2G2RB 4NJGA 3NQAA 3VA2C 4PJ5A 4Z8FL 2DZWA 2GJXB 2YDQA 2F58H 3JVGA 3TZVC 1J18A 5D37A 5I5IA 3THDA 1L0PA 1YEHH 2LU4A 4ERGA 4I5UA 4BXVA 4X9SA 3WHE0 5FF4A 2HPOA 1GOIA 3HE6B 3FONB 4WU5B 3QHNA 3O3AB 5T3XH 1GG0A 3ELQA 3IDXL 1SZGA 1QOKA 3VQ2C 3QQ3B 3QJOA 1IM9D 3K8LA 1YLVA 1Z9AA 1BKSA 1A5MC 5I1KL 2ATPA 2TRSA 4AGLA 1QABA 1V6VA 4X5QA 5CJXC 4M48H 1DBML 3VI3F 1RZKL 3UZQB 3B06A 4X7DC 2WBJD 4PJDB 4JQAA 5IESH 1QWHA 1BD2B 2IUZA 1MHEA 1FZKB 4U1MA 1SYVB 4I18C 4DP1X 2H9GB 4YC2B 1JJUA 2E74C 5EEYA 4AYGA 3NCOA 3MSPA 4FQ1L 2VMFA 1NAMB 4ESKA 1MHCA 1MFUA 5FYLH 2RQ8A 5KSAD 1ICSA 2CDFA 4XPTH 4AZ5A 1FA2A 4HUVB 3EJUA 4YTTA 4FQXD 1KGCD 5DS2A 2ZYSA 1PQZA 5AW0B 4IJ3B 4Z6AT 2UWEA 3BDBA 4WWKC 4Y1AA 3KPPA 2HBVA 4HXAH 1POKA 1ITQA 4APQC 4UT7H 1T3FB 1A22B 1T5XA 3DU0A 3NM3A 2BW4A 3EFFA 1KTLB 1Z9PA 1DUZB 2OOGA 1G4SA 2K6ZA 3HB9A 1AGBA 3T4WA 5E8DL 3JTSB 4C59B 1TYJA 3QZAA 2PDCA 4JREC 2YA1A 3FRUA 1U1HA 2RCSL 3QULB 1KCZA 4ELDA 4L6DA 2HTKD 1MI5A 1S6NA 5F8QC 3CZEA 3D3AA 4J2QA 4OF5A 4CSPA 2UV8G 1XBZA 3T40A 4PJXB 1QPOA 1KD0A 4UUJB 5JIIA 3LZNA 1IV8A 4JN6A 1XF2B 3LSOB 2GUYA 4IU3A 1I0BA 4HC1L 1RJLA 4JFTA 4M29A 4C6NA 1FAIL 1XSJA 2BV9A 5HHOA 4XNUL 4KQ4H 5E4EC 4ORMA 3GBNH 3RLGA 3NPUA 4M7LH 2GJZA 4FCHA 4P2OB 3VIIA 1ZLEA 3CAKA 1RZGA 4G83A 3UPAA 1FNSH 2XT1B 4X8XA 3FN9A 1D5MB 4JMXA 2PB1A 3B4UA 3CWGA 1HHJA 1CZ1A 4HTBA 3IPWA 2IPTH 2WZ5A 2NY6B 4GKOA 4B6ZA 4L5FH 2XN0A 3I6EA 3MRKA 4I0PD 4KK8D 4AEIL 3QYSA 2H32A 1WXZA 2OELA 1WAEA 1F3TA 4NPYA 1BAFL 4M6UA 1B0RA 4Z3GA 2CLVB 1VJIA 3CDGA 2P53A 1DQMH 2WLLA 4K7FB 4KKBC 4ORGB 3BLIA 2A77L 5D9PA 4EDWL 1B1YA 1ZCOA 3GBLA 5BOZG 5L9FA 3T8LA 3ZW3A 1JL8A 1MEXL 5H4ZA 4GC3A 4DESA 4DOHE 4P61A 5FGBA 1S38A 3OF6D 3K71A 1EHKB 1OK6A 4Z2HA 2PCEA 1ML0A 1N6UA 4QRBA 1Q4NX 2C3WA 1V4YA 2H8XA 2CHOA 2QR0A 2CKRA 5HDLA 4RNRB 2E7FA 3VGFA 1HHHA 4XPAH 1FBIL 1XGYL 4N8UA 2E56A 1W9UA 4U28A 4B3ZA 2GJLA 4QJ3B 4NRZB 3BGGA 1E6PA 5BOPA 3CV2A 2CERA 5CEYA 2KLTA 4HLZG 2XWZA 3T2NL 1CLYL 3MV8B 2PBOA 2DJUA 3FO0L 2Q01A 4Q0XH 1KBGL 1NCDH 1TRDA 4FLRA 2ZXAA 3NAAH 4HCDA 3R4IA 1F73A 4Q4MA 3QIWB 2EUZA 4PV8A 1MCDA 5HI3C 4EX4A 4XBMA 1J9SA 4KGJA 3RVVC 1LOLA 3BZJA 1U8LA 3NCEB 3TN0B 1RK0A 1DL7H 1YN6B 4OJAA 1OFRA 2W80C 3GQFA 4EDXB 4N2MA 1DLHB 4M1DL 4HA3A 1E9YB 1MJ7H 1AR1D 2OT1A 2V33A 3IGFA 4GFIA 3T0EA 3ANUA 3V6FB 4AMCA 3W2NA 2X89D 1XYCA 1MKFA 3F7VB 4GW1B 5JDJA 1DV7A 2IW0A 1Y18B 3JZYA 2DLTA 3V0VA 5IBTH 1TV7A 1OG0A 3T55A 5DVPA 1EAPB 4DXXA 3U9UB 3DWTA 3BLOA 1FV1B 2G41A 1N5YH 1T21A 3DVGB 1QSFD 4PRBA 2CZDA 2ISSA 4OKDA 4GO8A 2EVHA 4YBLC 2X1WL 3RPMA 3HI5L 4FQ2L 2VDQB 2P8PB 4K3ZA 1DL3A 1ZA6A 4M5YL 3EWUA 4Y9OA 1OCZB 2MH4A 3PUEA 4XO4A 3UO8B 3C8KA 3JVAA 5TQLA 3LGDA 4U6XA 4LSRL 3ETTA 2CDGA 1WAAE 1J86A 4PJBF 4XB7A 4XTRC 1QHQA 2BOCA 4B9GA 2WWMD 2J4WH 2FHBA 4N4YB 3ARFD 5I06A 4FD0A 5TF1H 2Q3AA 2AJZA 4PV1C 2UX6A 3NZHL 1EEQA 4PS4H 2NLIA 3C6LA 2B1OA 1TLMA 2VLKE 3QZWG 2N1KA 4F8OA 1LLZA 4WO4C 3OVUB 1FP9A 3LNEA 2B4CC 3LZQA 4X7CC 3PZOA 1OGAA 2VUNA 4JFHD 3KXFE 3UYCA 4JO1L 4PUNA 2PCXA 3QMTA 3BD3A 1KIPA 1BZ7A 1UCBH 2GPZA 3UJ2A 1AH4A 4P3WA 5GNXA 3TVMD 3NABH 5MEOB 2E5CA 4Q4PA 3O45B 5ITFA 4U0RB 2G3JA 3BLKA 2R29H 4L8SA 4ZUWB 3IFNL 1MF2L 4IOSD 3UNTA 1M6OB 3AIVA 4HZLA 3S35H 3QDJE 1A64A 3IF1B 2IPUG 2K8QA 5I2IA 1F6AB 3GSNL 2HFFA 2E76C 5HDWA 4JQXA 4AIUA 3VIFA 2CFFA 2F1AA 2J8HA 4NKDA 4ZYKB 3FUMA 4PMUA 5JHDE 4YHOH 4TUJA 2GLKA 4R96B 5HQEA 3O6LH 1R2TA 4M6MH 5JHDD 3QIUA 1XEDA 2R1MA 4MHBA 1EGJH 1DBJL 1MFCH 2PXYB 4EN3A 3BWUF 1CURA 1YNTF 3I7RA 2ADJA 3KM8A 1CGYA 5BWAA 1X9UA 4FZ8L 5KYWB 4AZGA 1E1CB 1T40A 2BY1A 4UIKH 5DJDB 1VYSX 5EC2A 1H6UA 3LM3A 4N2EA 1J1PL 2QT6A 2KQNA 2KZBA 1GGIH 1YQ2A 5ADOL 2J5LC 2QYGA 1GPOL 3TEYA 5GGVY 3GWQA 2WB7A 2BZDA 5D8JH 1SSDA 6FABL 3GTFA 4ATTA 1NMBL 5I18L 3NQGA 3QOMA 4KCTA 1ISYA 1CB7B 5DZVA 1NELA 4IX2A 2NWRA 1JUFB 4Z7IA 2CD0A 1URLA 4JEJA 1H5BB 4PEKA 3GO1H 3QXTA 5IJVA 3CVHB 3TJEH 1FWCC 2AZAA 2C1IA 5E24E 1UKSA 5I17A 4FXGC 1TZHB 3ES6B 3QY7A 4Z0XA 5DJ6A 1C1EL 1JVOA 5I66A 2E5EA 5I30L 4NZRL 4GMTL 1A7BA 4KI5E 4HOMA 4IBWA 3OGRA 2A79A 4OD3H 4FKEA 3SPGA 2LT9A 3DK0A 2Q7AA 3NOEA 9XIMA 5DO2C 2K4AA 4O51B 3ABKB 4KI5D 4YXHH 4HF5L 4GA8A 2QVHA 2VKZG 3P4LA 1EJUC 5TF0A 2YMTA 2CE6A 1JAEA 4PBWD 4ZJ9A 2PTVA 4AJYV 2Y25A 3Q8AA 4NKQB 2ZJSH 4NB7A 2A6JB 1V0NA 5TE4L 1E8ZA 2Z7KA 4TQTA 4JN7A 4PMFA 2GUOA 3A4JA 2XZ7A 1E9PA 1NUNB 4PJIB 5LQBH 4RA0C 1HN1A 3B2VL 4RW3A 1HK6A 3GI9L 3WF1A 4WDTA 1A5SA 2A0LC 2DH2A 2Q1EA 3CE1A 4J3WA 3L3GB 8A3HA 4K23L 5C0IA 2C5DC 3D46A 4NBXB 2HLFD 4WSHA 1KJMA