3WY1A

Crystal structure of alpha-glucosidase
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
535
structure length
535
Chain Sequence
NMMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLDNMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSRPENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEVASDLPVAHFTATRDGSTLTLPAYQAAFMQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the alpha-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism
pubmed doi rcsb
source organism Halomonas sp. h11
molecule tags Hydrolase
molecule keywords Alpha-glucosidase
total genus 193
structure length 535
sequence length 535
chains with identical sequence B
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3wy1A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wy1A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3wy1A02
2WBGA 4LYRA 5CZKA 4Z2GA 1HVXA 1KGWA 4JZ5A 4DO6A 3F5KA 1GHSA 2JALA 3U57A 4PYSA 3EDFA 3EJTA 1E6NA 4CD5A 1HJSA 2E3ZA 2BVDA 2XGBA 4R27A 4AD1A 2GVYA 3VM5A 4PMYA 3WDHA 1O6IA 3THDA 1UUQA 4Z2HA 1QWUA 1JYXA 4W7VA 4H8UA 2PB1A 4JCMA 2WZHA 1EO5A 5I79A 1JNEA 5AYBA 3W6LA 3NSNA 4FF5A 1XHGA 2OYKA 3BAWA 2E9BA 3DYOA 1V6VA 4GQQA 1FP8A 1BYBA 3MUY1 1AVAA 2VMFA 5M03A 1UD5A 2VX6A 1KQYA 1HP4A 1UD2A 3WF1A 1GVIA 3MSGA 4LGXA 1WZAA 1LG2A 3GXFA 3AS2A 1JDAA 2WMKA 4DWSD 4NXKA 4IPNB 4S3JA 1UR4A 2FGLA 3N13A 1ISWA 1EDTA 5FCZA 5KZ6A 3DC0A 3U5YA 2DSZA 3CZSA 5C8BB 4UFLA 4CCCA 2X2YA 3EDDA 1CNVA 5A95A 3WNMA 2DT0A 4DWSC 4W8AA 4AD3A 1UWRA 1CXFA 4QLLA 1E6SM 4HOZA 4UQAA 1NARA 4W85A 1EGZA 2WZIA 1BSIA 1CXHA 3UCQA 4URIA 3AMLA 3ALGA 3PTMA 3OG2A 3SUUA 2PBGA 1UKOA 3WF2A 5FL1A 1BVNP 1JI1A 1V6WA 1G5AA 3T2QA 1FH8A 3GXTA 4OJYA 1B31A 4P8XA 5GNXA 1OM0A 2Z1KA 2CETA 3CV5A 2EJ1A 1BPLB 1W1PA 4E8DA 1CLVA 3KE0A 1JDCA 2EABA 4PMRA 4PN2A 1VB9A 1TCMA 3ZR6A 1C93A 1GPFA 5I0DA 5D4YA 3WELA 3TTOA 2YFOA 2XFRA 1E4IA 2CESA 1V0NA 4YHEA 4H8HA 4PCSA 1J0IA 4WJXA 1R33A 4H04A 1R87A 2VQUA 2GUYA 5KEZA 2Z1SA 1E6RA 4MNKA 1VBRA 4CD8A 1E5NA 4PMZA 4C7GA 3OZOA 1TQWA 5BCAA 5I77A 3MMUA 1EQPA 2W63A 1A47A 1TQUA 2J7EA 1GOOA 1BYDA 4P7NA 3UG4A 3LX9A 4U2YA 1BG9A 1XCXA 1BLIA 1OWQA 2VO5A 3E1F1 5GNYA 2VRKA 3WH6A 5CPQA 8CGTA 3J7HA 1H3GA 3W37A 1R46A 3VU2A 4DWSA 3AMKA 1WZLA 1XSJA 5BRQA 5CSYA 3OB8A 1UOKA 3W4RA 2WVVA 3U7VA 3WY3A 2BY1A 4QAWA 3RM8A 2Y2WA 3OZPA 5IHSA 2QF8A 4UOJA 5CLTA 1GUVA 3GNPA 1WDQA 3BLKA 3GH5A 1TMQA 1QNPA 2XN2A 1EOKA 3ARYA 3AZRA 3ZT5A 4F9DA 1MQPA 3TA9A 1WE5A 1US2A 3PTKA 2W91A 4H8VA 1V03A 4CCDA 2ZIDA 2J78A 2FGZA 4PTWA 2ZXQA 4AD5A 4D1IA 2ZICA 2PWHA 2QMKA 3VSVA 2ZX9A 3DYPA 2YLLA 1CGYA 2D3NA 2WWCA 1WO2A 4WSJA 1GCYA 1I75A 1AQHA 3WF3A 5DMYA 1UASA 3F5LA 1QBAA 1U2YA 1LF1A 2D22A 4JKMA 4UFJA 3IANA 3QOMA 4Z2KA 3VX1A 1PJ9A 4OOUA 2QMJA 4F9JA 2GDVA 5F7UA 2BV9A 1PBGA 1VBUA 5D9MA 3BUIA 2GJXB 1NP2A 4LYPA 4QP0A 4U3CA 1QNRA 3RILA 3WUFA 2J74A 1BYCA 4AZGA 2CEQA 3MV11 1LL6A 3I3EA 2QV4A 2GFTA 1KXVA 3L4TA 3PBGA 3FNDA 1W2PA 2ZUTA 2G3MA 2J8FA 2XVGA 1OT2A 1C8XA 3JUGA 2XWEA 3GXMA 1BYAA 1I1XA 4LPCA 4FNUA 2XVNA 4W7WA 2WVSA 2DGAA 1Q6EA 1UHVA 1NWTA 3VMNA 1C3FA 4HA3A 3VDCA 3CZKA 1PIGA 1G0CA 1LWHA 1J01A 1VJZA 2JEPA 3NJ3A 1QNQA 1DHKA 4MAZA 2BVTA 4GPNA 3WNNA 4UZSA 1NOFA 4DUXA 2FH8A 2WMIA 4P8WA 5A6JA 3T0BA 3AS1A 1QI5A 3WD2A 4YHGA 1PEZA 3EJPA 3GXPA 1CEOA 4OOZA 1GQJA 4MAVA 2XIIA 1J0YA 1GW1A 2YIHA 5IFTA 1QW9A 1E4LA 4AW7A 4EKJA 2V38A 1QHZA 4KRUA 3VIFA 1KFWA 5A8MA 1CGWA 4TOQA 3GBEA 4E2OA 4M81A 2AAAA 4TVCA 1ODUA 1GONA 1UD6A 3M7SA 5JUVA 2DPEA 5CGTA 1W3KA 3L4ZA 2EPLX 2O9OA 5FIPA 5FL0A 3FHQA 3U7BA 4JFSA 2G4FA 2OWCA 5HOSA 1VEMA 1V0LA 1M7XA 5BRPA 2CNCA 3WDIA 4MTVA 1KXTA 5TD4A 1H2JA 1W9PA 3RO8A 2WHJA 2WLYA 1MW2A 4FNTA 1MFVA 4F8XA 3A6OA 3BAXA 1RD6A 2VC9A 1FFRA 5BYWA 1GOKA 2WM0A 3SUSA 2MANA 1R86A 3PZVA 3II1A 3ARQA 3DX3A 3WBAA 3QHMA 2XFYA 5IXEA 1JZ5A 4CCEA 2PF0A 3CMJA 4W87A 4DM1A 4PMNA 1HP5A 3F4VA 3VIPA 1MYRA 2CHNA 4W8BA 3BUBA 1HKKA 5IDIA 1E1EA 3N04A 3VILA 4RE3A 3W27A 3UEQA 3AMGA 1ITXA 3SCNA 2WMHA 4HTYA 2FE0A 3IJ9A 3T09A 1TE1A 1E72M 3ZT6A 1R47A 1OSEA 5FKYA 3WL0A 4KGJA 3WF0A 2J8GA 1BGAA 4NI3A 2CBUA 3K4AA 2BHYA 2XJ7A 2G41A 1Y7VA 2PWDA 1BG4A 4JL2A 2QPUA 4J3TA 3ZJ6A 1W1YA 3AYSA 1M04A 4PBGA 4M80A 4W7UA 2D20A 2XGIA 4M24A 1J10A 1ZJAA 3T08A 3UR8A 5A6AA 1W3HA 3AIEA 4AIOA 1NOWA 2WCAA 1TUXA 1BAGA 3CZGA 4LQ1A 4WKAA 3RDKA 1EHNA 1F4HA 3SCUA 3I3BA 2Y5EA 1CECA 3AISA 1V3HA 1ODZA 1B1YA 3CO4A 1YHTA 3K8LA 4R5EA 4LYQA 4OZOA 1S46A 1GOIA 4AZ7A 3AHYA 3VSTA 2CBIA 3PZIA 1KR1A 4PMDA 4JKLA 1GOQA 1PZ3A 4AEFA 1W9DM 4NF7A 3BAJA 1JF5A 2DIEA 5GQBA 4Q7NA 2XVPA 3AOFA 4M1RA 1E9LA 4A4AA 3LPGA 4NRSA 1CLXA 2WHMA 1TVNA 2DT1A 5C71A 1IZJA 3HJEA 5A6LA 2D2OA 4XV0A 2EPKX 3L2MA 5LA2A 5AC4A 4A3HA 3FAWA 3WF4A 3S5ZA 2OWXA 2VRQA 4AZ6A 1HXKA 1W3JA 4HOXA 2VR4A 2NW0A 4CKQA 2FH6A 3B8SA 4TXEA 4FLRA 3PZTA 3PZGA 1HKIA 3SCWA 4UFMA 3SCTA 2V5DA 1V3LA 2GJRA 1K9TA 3GM8A 3UETA 3WUGA 2ZX7A 1UKPA 1JXJA 3HMCA 3WH7A 3WDQA 5CSUA 4NX0A 7CGTA 2WXDM 1ZBVA 3OLEA 2PBOA 1NH6A 2CKRA 2UY4A 3CHCA 1OB0A 2ZWYA 3BC9A 1V0KA 3VIHA 3EYPA 4D6IA 2XHYA 1K6AA 1UZ4A 3W53A 3FW6A 3OGSA 3H53A 5BXRA 5DO8A 4AD4A 7A3HA 5LYRA 4KH2A 4DM2A 2D0FA 2V5CA 3MU7A 3IJ8A 2CCRA 1Q6CA 4D6HA 4JFUA 1WDRA 4KWUA 2DH2A 4UQEA 5A69A 4PMXA 2NT0A 3BSGA 3WUBA 4Z2LA 4DO4A 3VTRA 4UOQA 1G1YA 3D4ZA 2QLYA 1NWUA 4ATLA 3AYRA 4P8UA 1F4AA 1CXKA 1NP0A 3WL1A 5M3WA 1NM9A 2UY3A 1SFSA 3LPFA 2WMJA 3VD9A 3L2LA 1HX0A 2ZUNA 3AICA 1OGGA 4MDOA 4FLOA 1H0GA 4MJ4A 5E6YA 2VZVA 1WDSA 4HU0A 4CD7A 4AIUA 4FNRA 1FH7A 2ZX8A 3AIBA 1QI0A 4MDPA 4IPLA 1B3XA 1ISYA 2UWFA 1UH3A 2BHZA 2ZXBA 1KTCA 3NDYA 3B9AA 3OGVA 1JI2A 3EJRA 1CXLA 2YA2A 4AMCA 1W1TA 1VFMA 1IV8A 2E0PA 1K9FA 4CD6A 1J0KA 3VDAA 3MSDA 3SCQA 1LG1A 1E40A 2DH3A 1JYWA 5D8WA 5A8OA 3VGHA 2WAGA 1BTCA 1OIFA 2J4GA 4DUVA 4FNSA 1EQCA 1MFUA 4W89A 2G8ZA 3PZNA 2J7HA 1E55A 4FLSA 1W9BM 2VVNA 3GXDA 3G6MA 3IAPA 3NCOA 1TQVA 4UQ9A 3ARVA 5LA0A 3VIJA 3GH7A 1JYVA 3LPPA 3MUIA 2YFNA 3HU7A 1KWGA 5D9PA 4OUEA 3AHVA 1OCQA 2Y24A 3BVWA 2UY5A 2F7PA 1KWKA 4L4PA 4D6FA 2J25A 2D3LA 4ZEPA 2VVSA 2WW5A 4P7QA 1I1WA 4IM4A 4UZUA 1EO7A 4EAMA 1C90A 1SZNA 4UFKA 1SMDA 5JIPA 4CN6A 3AIVA 1GQLA 1TA3B 5ABEA 3MANA 2XYLA 4AZHA 2F7RA 2D1ZA 3IGUA 2A3BA 5I23A 3IJ7A 1E0XA 2XIBA 1WNOA 1CXEA 4JHOA 3WD3A 3CHFA 2WZEA 1QW8A 4QCEA 1ZJBA 2VQTA 1XRVA 1EA9C 3CZNA 4W5UA 4LXFA 3BVTA 3MI6A 2WC3A 4DWSB 1D3CA 3QOKA 4B3LA 1UKSA 4MNLA 1W1VA 4E4PA 1KGXA 3BSHA 4ATWA 2V3FA 3WDRA 1OD8A 2CPUA 2WSKA 3S5YA 4WKHA 2HISA 2YDQA 3VX0A 1E6ZA 3M07A 1ZB5A 1HTYA 1QVBA 4P7OA 1K9EA 5D9NA 4NXSA 3K8KA 4CUCA 3WEOA 3OLGA 2Y8KA 1HJXA 1SR0A 1W32A 4HMDA 3FN9A 3W25A 2ZUWA 1MW0A 5EMYA 1QHPA 1HF6A 3T2PA 1V3KA 2X05A 3WD1A 1WDPA 1IZKA 5HBFA 1PZ2A 3GNOA 1UD4A 3PZ9A 3WNOA 5A6SA 2DSKA 3BVXA 2WB5A 3CIVA 1PPIA 1JGIA 2V3DA 4B16A 4N42A 1DWIM 4B15A 1H49A 1VENA 5A2AA 5ABFB 3PHAA 1OT1A 5A2CA 3W0KA 1JXKA 4ZXLA 2ESCA 3ARSA 1GNXA 1ZBKA 3T0DA 2W4XA 2DEPA 3SEPA 2DSUA 2JIEA 3RM4A 1QI4A 4H41A 4D1JA 2QPSA 3FXYA 4HP5A 1A3HA 2JEQA 3WQ8A 2X8RA 4C7FA 1GVYA 1Q6FA 2W66A 3VD7A 3M6DA 1B30A 1CGVA 4AD0A 1UR8A 2JF7A 2WHLA 3DDFA 5ABFA 4J3VA 1R7AA 4ACZB 4NZFA 3AHZA 1W9UA 2W92A 4E8CA 3EMZA 4D71A 3KLKA 4KRTA 4MPKA 3BH4A 3EBVA 2JF6A 2X1IA 1TZ7A 4P8VA 4PUDA 2F1AA 4S3KA 5CLWA 5BROA 1CZ1A 2J47A 5CG0A 4U5IA 3WY2A 1QWNA 1JNDA 5DT7A 3RJYA 2YL8A 2CBJA 4ACZA 5A8QA 2NSXA 1K9DA 2AMGA 1JYNA 1E73M 4JFTA 9CGTA 3ECQA 1R7OA 4DO5A 2XN0A 3M46A 1KR0A 1J18A 2VURA 3SUTA 1QNOA 2YDRA 4QDMA 3TONA 1UH4A 2Y4SA 1AQMA 3BUQA 4U31A 3WEMA 2VT0A 1UWTA 1ECEA 3CZ8A 5BWFA 3DECA 4U33A 1VFUA 4WK9A 3RCNA 4D6GA 1E15A 5DEZA 1RPKA 3OIHA 5E0CA 2CERA 2F7QA 1X6LA 5BXSA 2YL9A 2DSWA 2YLAA 5A2BA 2FYVA 4M8UA 5GNZA 4J3WA 2D0HA 4BCEA 1SMAA 1CGXA 1KB3A 1FOBA 3LXBA 3A3HA 3K1DA 3ARZA 1UA7A 1UR2A 4NZCA 1KCKA 1GJUA 3CC1A 2EXOA 3ZR5A 4MNJA 3A5VA 2WVTA 4PSPA 3N15A 1V0MA 4PMQA 5DT5A 1H5VA 1GQIA 3AMCA 4MB3A 3WKZA 2F61A 1HXJA 1V6YA 2J77A 4QLKA 3CUHA 1DEDA 2WMFA 4MB4A 1OBAA 4HZ7A 1AQ0A 3VD5A 2EO7A 1HKMA 3AIQA 1BGGA 4CU7A 5E1QA 4BQ4A 1VEPA 4M82A 3ARRA 4GO9A 3VD4A 4PCTA 5FD0A 4GKLA 4WSKA 4UQCA 4UQDA 3SCSA 1V6UA 3SCOA 3D52A 4YN5A 1HIZA 2WVUA 1NQ6A 1UR1A 2WLZA 4RE2A 3PZOA 1JD9A 1UWQA 3BUDA 2OYMA 4B9ZA 3SCPA 5HXMA 4HOWA 1R8LA 2Y8VA 1VJSA 1CXIA 2WKGA 5E70A 4D6DA 2BY2A 1Q4NX 4QLJA 2PWEA 4OIFA 1L0PA 1BFNA 1UQYA 5JBFA 2PC8A 4U2ZA 3ALFA 3AZTA 1JZ6A 1GZJA 5A1AA 3TTYA 3DHUA 4ML4A 1HL8A 3VM7A 1RH9A 5I24A 1UKTA 1KCLA 1E6XM 3AXHA 1NOUA 2J62A 4J3UA 3ZJ8A 3AS0A 1LJYA 1V3MA 3W24A 2XM2A 3BMVA 3K8MA 2DDXA 1J0JA 5E09A 3RPMA 3AHXA 2BY3A 3BXWA 1D2KA 3CUIA 1QX1A 4WIWA 4GI9A 2D23A 1HJQA 1W9XA 1HVQA 4AXNA 3N11A 1WP6A 2XVLA 2EPMX 4ZFMA 4AWEA 4FMVA 3KWXA 2OSYA 3A21A 1ZBWA 2WCGA 4P7LA 5A6BD 1LQ0A 1JFHA 2WVVB 1EDGA 4X0NA 1B3ZA 1V08A 3GZAA 3BUPA 3PN8A 3MUAA 3WQVA 3TTQA 3CZEA 3VIGA 1B3WA 4X0VA 3FY1A 1PX8A 1MVYA 4BQ5A 3WD0A 1B3VA 2VL4A 4GIAA 3CZLA 3EDJA 3HG3A 2JE8A 3G6LA 3N12A 5M17A 3QHOA 2XFFA 2VNCA 2DT3A 2OSXA 3EJUA 4TTUA 3POCA 2BXYA 5A6MA 1QI2A 4UTFA 1LL4A 4BA0A 3VMOA 4ATDA 2G3NA 1PS3A 3HG4A 2XSAA 4K68A 1M03A 3L4YA 3VGBA 3WQ5A 1HWWA 4OBRA 3VKKA 1CIUA 3WDPP 1CENA 1PIFA 3A4AA 1UKQA 2C8NA 1HT6A 2WANA 3QHNA 1R75A 1J11A 6TAAA 1OINA 5GPRA 5IHRA 3ZSSA 3BLBA 1O7AA 1E0VA 2A3HA 3AFBA 1XH0A 3QR3A 3OLDA 4MB5A 4OGZA 4QFUA 1C8YA 1KGUA 1PAMA 3VGDA 4AEEA 4EK7A 1FP9A 2O9PA 4J3XA 1C8QA 2FHCA 1BF2A 1VIWA 3A24A 3W38A 4F66A 5I78A 1B0IA 1UWSA 4CVWA 1HJVA 1VEOA 2F7OA 1L8NA 4CN1A 4D6JA 2ZUMA 3CPUA 1US3A 3L4UA 2YL6A 2BXZA 5CXPA 2ZUVA 1JZ7A 1P6WA 2DT2A 3D50A 3FHAA 1GOMA 2ZE0A 4TVUA 5CPTA 1TA3A 3WSUA 3LXAA 2Q8XA 2J7BA 3NYDA 2EQDA 4HPHA 2IGTA 2YA0A 2IXUA 1UA3A 4GINA 3THCA 5JBDA 1ZU8A 1TQSA 3WNKA 3HG5A 3BMWA 4V27A 5HDRA 3WD4A 1HNYA 4B3KA 4FK9A 1JAKA 3ZSTA 1E0WA 2X0HA 5A6BA 1KBKA 3D51A 1XSIA 1HKJA 3HZ3A 5BXPA 2ZX6A 1QHOA 5EFDA 3AROA 3VDHA 2CBVA 1CDGA 1UWIA 1TQTA 2VX7A 1SYTA 1XH2A 3SURA 2GDUA 4KMQA 5HPOA 2XPKA 4TX8A 3T2OA 1T0OA 2E9MA 3W28A 1MWOA 4TUFA 2EBNA 1KBBA 1UD8A 3W29A 3SUVA 3L4WA 3BVUA 3MKKA 4BQ2A 5A3HA 4TTGA 1BQCA 1C7SA 3GYCA 3CBWA 4XZBA 4JAWA 2VCAA 1RP8A 4WLCA 3ZQ9A 3AHTA 3LMYA 3KL3A 3ARTA 3WNLA 3MS8A 5DF0A 5FOOA 1JZ2A 5E6ZA 4TVDA 4CU8A 2VUYA 3IK2A 3TTSA 3EMQA 4AISA 2FHFA 4AYSA 1AMYA 1E3ZA 3BAIA 3VIMA 5AYIA 4HMEA 1E71M 1ZBCA 2ZUUA 2EADA 1PX3A 5E0FA 1C91A 3TV8A 3ZM8A 1E43A 3APGA 3PZMA 2ZX5A 2XVKA 1Q6DA 4HMCA 3WBEA 2WC7A 3PTQA 2OLHA 2VI0A 3NSXA 4W5ZA 1HL9A 3O9NA 3BCDA 3WNPA 3GNRA 5C70A 4PMVA 2WMIB 1V6XA 3VNYA 2XTKA 3EDKA 2W62A 2VZOA 3L4XA 2EACA 1H1NA 5IFPA 3PZUA 3CZJA 1ITCA 4HU8A 4KGLA 3KL5A 3WENA 4MJ2A 4HZ6A 3A47A 3K4DA 4D6CA 2XSBA 4BS0A 4AYGA 1XYFA 3VVGA 3A23A 5CQ1A 2YOCA 3KLLA 4GI6A 2YJQA 4NRRA 2CHOA 3BLPX 2W61A 4MNMA 3WH9A 2VX4A 4PTXA 1QBBA 3VINA 2G3IA 2OSWA 3GTNA 2OW7A 4OKDA 1DWHM 3W81A 2JFEX 2J7GA 3UG5A 1IT0A 1E1FA 3BAKA 1Q6GA 4JKKA 5EFFA 5ABGA 1E56A 1EH9A 3KEHA 1LLOA 1TVPA 4PUEA 2W5FA 3RJXA 1VAHA 1E4MM 3DX2A 5JBEA 1H0IA 3VMPA 1KXQA 1XD1A 3BGAA 3SUWA 4V28A 4Z2JA 4JFVA 3AI0A 1R34A 4ACYA 3WQWA 2J75A 5AY7A 3VGGA 1WAWA 4WF7A 1MQQA 1W9VA 3W6MA 4ZE4A 3WEZA 1JL8A 3LXCA 3NIYA 1GJWA 1W3LA 2X09A 2B31A 2J79A 1JZ4A 2VX5A 3AXXA 3BCFA 5CPSA 1QNSA 2J7CA 1ISZA 4IISA 2BVYA 1CTNA 1QPKA 3DX1A 1V02A 1QI3A 1JZ8A 7TAAA 5I5RA 3TP4A 1DP0A 1UZ1A 3U5UA 1J0ZA 2QHAA 4PTVA 3VD3A 1UYQA 2V3GA 2WMGA 4EE9A 1E6PA 4OBSA 4W93A 2FDMA 5I2UA 4Q22A 2BNJA 4C7DA 3D3AA 3ZO9A 1YQ2A 4UNIA 2BFGA 3MUZ1 2ZUSA 1CBGA 1OGSA 3KL0A 3FAXA 4EANA 1XV8A 2ZOXA 3NDZA 4UFIA 3VPLA 4AZCA 3WMBA 3B9EA 1DWJM 2EPOA 4AY1A 3AIRA 4HPGA 4JCLA 3GBDA 3WMSA 4W8LA 4D6EA 4AC1X 3POHA 3BAYA 1ZS2A 1B9ZA 3VGEA 1MW3A 1V3IA 4J3SA 3SIMA 5M5DA 1RP9A 3CH9A 3DYMA 2IUZA 1H4PA 3WIJA 3ARPA 1UH2A 4LX4A 1G94A 2F8QA 3LRKA 3ARWA 2PWFA 2WCSA 2YKKA 2VZSA 2GSJA 3A4WA 1BHGA 2VZTA 5CGMA 4UFHA 4AZCB 3WN6A 2W67A 4JL1A 3DX0A 1XSKA 3TOPA 2J7FA 1B3YA 3CHEA 2ZXDA 3HG2A 3UR7A 1B2YA 4J7RA 2WC4A 3GXNA 1JF6A 1JG9A 3EJSA 4AMXA 2XM1A 2OW6A 1QOXA 1M53A 2WWDA 4RE4A 4V2XA 3PZQA 3VOCA 1XGZA 4F79A 4P7RA 2WPGA 4PEEA 4CGTA 3WH8A 1LL7A 4PTMA 2OYLA 3VDBA 5HNNA 1JDDA 4XB3A 3DX4A 1BVZA 2VCCA 4W88A 8A3HA 1JZ3A 3EDEA 2DQXA 2E9LA 4XUYA 1WKYA 3SCRA 2O9TA 3AXIA 2EAEA 3VIIA 3VIKA 4ZE5A 1CWYA 1DWFM 1DWGM 1WCGA 2JIWA 3WFZA 1X1NA 1TFVA 1EOMA 4J27A 2VZUA 4DUWA 5JIWA 1DTUA 1G01A 1XD0A 1G9HA 2ZXAA 2YDSA 3H55A 5CJ5A 2C7FA 3W82A 2F1BA 3BVVA 4CU6A 4NSBA 1FA2A 4N0RA 4Z2IA 1XYZA 4FLQA 1B90A 2WSPA 2G3JA 1TR1A 4U5KA 3ZT7A 1VF8A 3AZSA 3WUEA 5A8PA 4GZJA 4GO8A 1LWJA 2O92A 3ARXA 3RMEA 3OLIA 1W2VA 4FNQA 1Z32X 2WK2A 2E4TA 2NT1A 1OGBA 3O2LA 3WFLA 4UOZA 2OWWA 1HN1A 5D9OA 3QGVA 3RM9A 5I3DA 3K46A 3ZJKA 2E40A 1XCWA 1H11A 1WZMA 5LA1A 2TAAA 3CLWA 3VNZA 4AMWA 2VJXA 1XH1A 1E5JA 3CUGA 4PMUA 3SCVA 1E6QM 3ARUA 3WY4A 3CUFA 3LRLA 3WY1A 3RIKA 2EEXA 1N82A 1NWSA 3N17A 2C0HA 3WDJA 2X2IA 3CMGA 1CPUA 4H2CA 2J7DA 3F5JA 4ZENA 1UD3A 3AJ7A 1ISVA 3H54A 2WHKA 3B9DA 5A6KA 2YBUA 3GDBA 4M29A 3A22A 3UG3A 3WQ4A 4UR9A 4HA4A 1FHLA 2YBTA 4AZBA 1D7FA 4UQBA 4YPJA 5I6SA 2EPNA 3AQUA 3VO0A 3GXIA 3EMCA 6A3HA 2F2HA 5A94A 3D4YA 1EIBA 3CTTA 2VR5A 4GZIA 2BY0A 3VIOA 1JAEA 4AZ5A 4CN4A 2PI6A 1JFXA 3AIWA 4PSRA 2DSVA 1MXGA 1EDQA 1CGUA 4AIEA 4B9YA 2WYSA 4XX6A 2GK1B 4IUGA 5BXTA 2XWDA 1MQRA 3ZMRA 4A3YA 5ECUA 2ALWA 4CD4A 3O6AA 2XN1A 1E70M 2F18A 5DFAA 4W84A 1VFOA 2BHUA 2GJPA 2YA1A 3WQ6A 3CUJA 1KXHA 2FHBA 3D5HA 2XUCA 2CIPA 4JFWA 2RGLA 3T0AA 1J12A 4W86A 3VGFA 2V3EA 1U33A 2DIJA 1UQZA 4BF7A 5EB8A 4PRWA 3NSMA 2GK1A 2X2HA 3NUKA 1HJUA 1XC6A 3MMDA 4CVUA 2VCBA 4FNPA 2WNWA 5EBAA 3S2CA 4JHZA 1VFFA 1W91A 4HZ8A 2CXGA 1TG7A 4Y7EA 1ESWA 3HN3A 3AIUA 2VRJA 5E9AA 2ZWZA 1WB0A 2WBKA 3MV01 2A3AA 1V02E 3ZJ7A 2VOTA 1C7TA 2A3EA 3S6TA 4BQ3A 2PWGA 2X0YA 2X2JA 1V3JA 1GOWA 4QCFA 1M01A 1O7DC 1CYGA 3OGRA 3UESA 1ISXA 1VRXA 5HPCA 3DHPA 1CGTA 4WKFA 1MW1A 4U3AA 1GORA 1FHDA 1DWAM 1OD0A 2A3CA 5D8ZA 5ABHA 4GXPA 3CGTA 1J9YA 1E4NA 1GQKA 3AS3A 3N1AA 1C92A 4MB1A 6CGTA 4JIEA 4RL3A 1J0HA 4TX6A 1EXPA 1EHAA 2E8ZA 3LRMA 1U30A 1GHRA 1R85A 2O9RA 4AZIA 2CYGA 1E3XA 3W26A 4PMOA 1OIMA 1ZL1A 1NWRA 3ZIZA 2AOSA 4X9YA 4NZJA 3CHDA 3N18A 4XZWA 1UR0A 3I3DA 4GZEA 4ZXOA 2UY2A 3LPOA 3WMCA 2E8YA 2IXVA 1FH9A 4AD2A 2VTFA 3KZSA 3MMWA 2BS9A 2CKSA 1WPCA 1H09A 2XG9A 4MADA 4L4OA 5A8NA 4BZYA 3MO4A 3WH5A 3ZOAA 3OBAA 5AC5A 4GQRA 4GI8A 1PX4A 4M56A 3N9KA 1MXDA 4HA1A 1H41A 3DDGA 2WKLA 4J28A 2GJXA 1UG6A 3VUPA 1UR9A 3GH4A 2D24A 1HJWA 2D0GA 1UWUA 1KTBA 1X6NA 3OA5A 1JIBA 1WZKA 3EJQA 1JD7A 3L4VA 2YL5A 4D72A 2RGMA 2D73A 3AMDA 3A4XA 3UERA 2CITA 1KQZA 3VSUA 4H7VA 4UCFA 3IAQA 1FFQA 2HVMA
chains in the Genus database with same CATH superfamily
3DHJA 1GZQB 4XZ9A 3BOLA 4A8IA 3RA7H 4LYRA 5C5YA 2ISWA 1AFVH 2IPTH 1KGWA 3KGSA 4NQEA 4DO6A 1HI6A 3F5KA 1KIRB 1F3DH 3P3UA 2IG2L 4TRPL 4DVBB 1GHSA 1OP5K 4GG6B 4PJ8A 3OODA 3EJTA 3NVQA 1G7PB 4ABWA 3SPHA 2DLEA 2WLHA 3UZVB 4Y5YB 2E3ZA 3FEMA 1DO6A 4O10A 5JPMA 3C0LA 2L5HA 4CCZA 4G7QB 4ZAKB 4P9HL 3TYUA 1KSRA 4RFEB 4A2LA 1FN4B 3N4AA 5ABZA 2CUHA 2XGBA 3FOMA 5BV7H 1LP6A 1RIUL 4KV5F 3GHSA 4R27A 1RUAH 1A7QH 3YPIA 4E5TA 2GVYA 3VM5A 3WDHA 3NR0A 4R9OA 4L0PB 4PS4L 1YEKL 4F7KA 1J8KA 1G7IA 1UJPA 5KOVC 4JEJA 1CB4A 1MQ8A 5EU3A 4F8QA 5LBSL 5I1DB 4HK5A 2RFXB 4LT9A 5L4MA 3CVHL 3L5WB 3UJTH 4KBXA 4HN4A 3HCVA 5AYBA 4B9FA 1S2WA 2V7HB 2G2PA 1SGJA 4WIQA 3FNKA 3HO8A 3SDXB 2WAHA 3B5GA 1KB5H 3MYZA 4PI0A 3QPQC 4L1GA 3UA3A 5D2NB 1YEJL 5C0AD 3TT1H 1S6NA 3AY4C 3KJ6H 4NN7C 1THAA 3KVLA 1EYEA 5BZDB 4HCLA 4XIMA 3CXDL 2J55A 3BIBX 5M03A 2NTFA 3PSWA 2QQKH 3O4LB 3U7WH 2JKJA 2VX6A 5E08H 4KKLC 1WKFA 4NT0A 3MXWH 5HHVH 3UZVA 1NPUA 1D5ZA 4WTZA 4QTHA 1K70A 1GVIA 4MSSA 3MSGA 4A35A 4TL5A 5GSVB 1WZAA 3QZWB 1BVOA 3BDBA 2D7PA 3MUHL 3A4EA 5AW3B 3V6OE 4NHCH 2OX1A 3G8RA 3REQB 3HAEB 5ID0B 1GVFA 1LVEA 4YAQA 5DMMA 2W38A 1D8CA 2Q5BA 3PPHA 1S9XA 4K6AA 1U8IA 4GKSB 5GISH 4TX9A 4C6NA 4N0UA 1KCUL 1RIVL 4CSPA 1OFEA 3BVNB 3K72A 5EUOA 3N13A 1AJ0A 5EMLA 1O75A 3QO0B 5M95B 3SRDA 3DC0A 1A7QL 1JRHI 2DBLH 5B1AB 5IOPA 5IROA 1E9OB 3CZSA 3P9LA 4HC1L 3EJJX 1J9CT 1HINL 1U91B 3NCXA 4N5UA 4PGJA 4RE0A 3VRLF 2E27L 2O6EA 4MMZA 5C8BB 1A4JB 1RZGA 1NU5A 5LNUA 1SNRA 1S7VA 3X11B 2X2YA 1MCCA 2XKNB 3L7FB 3PIQB 5IY5B 1CNVA 5CBIA 4OSUH 4W8AA 3MRGA 3WS6A 4RFOH 1RFDL 3A67H 5KJRL 3TZNA 2KT6A 1MJ7L 3ZN6A 2ODOA 2JIXA 1X97A 1UM4H 3U30C 5HP5A 5LN8A 3PL6C 2OR2A 3WIFB 2F8XC 4P04A 4CMHB 2OLAA 2EDRA 1NARA 4GSQA 4DP2X 4W85A 3IIVA 4P05A 4P2OA 4WK2B 3WCYA 1O5KA 3GJFK 2H0FA 2EIKB 4Y4HB 2ZXWB 4YHIB 1M2VB 3MRPB 1C1EL 2OR8A 4KTGA 3PTMA 2XXFA 3CSBA 4KWSA 3L7RA 5EUOB 4LSUH 4AITA 4RBPH 4Z7VA 1HFBA 1JI1A 2VGBA 3I7RA 3NP4A 2HT3C 2LAGB 3PWPD 5AKTA 5TF0A 4AJ0A 1G5AA 3T2QA 1A5SA 3HE7D 3GXTA 1DXFA 3F7QA 3OKLA 4F15C 3CLMA 1WWAX 2NNAB 1FYTA 1I6NA 3RI5F 3OXSB 2CETA 1RZGB 2P76A 4DN4H 3MVIA 2JCWA 1IQ8A 4KVCL 4DP0X 2AK4B 5B8CC 1JDCA 4PN2A 1VB9A 1TCMA 2IAMB 2HT2D 2IALB 3SGDH 3V18A 5I8EB 4OM1H 5KSBA 4GBXC 5I0DA 1GPFA 3D0AA 1KO0A 3NZPA 5TQLA 2YFOA 3QRBA 3G6AB 4N0FB 1J96A 2NX3A 1WIOA 4NDMB 3RDTC 1EHLL 2DICA 2BIIA 1B3JA 3EXTA 1YEGL 1YNTA 4H8HA 5K9XA 2DQDL 1KB9J 4L9LB 1YW1A 1MCOH 1B4TA 1MHEB 1NGQL 2DZEA 3HFML 2BP8B 3CU2A 3BWUC 4AQAA 5KEZA 4XIAA 2Z1SA 2FX9L 1DFBL 2ATKB 4PRPD 2QEZA 1E5NA 1JMZA 4BSWB 3S46A 1NGXA 3ZHDA 4QY8A 1FL3A 3CS2A 1V55B 2CJ3A 4GWEA 1Q0XH 1IJ9A 4NZRL 1MRAA 5JUEH 4KTYA 3SCMB 1TQWA 5LGYA 3MMUA 5CSRA 4LP5A 2FQFA 1DQTA 1L9WA 4QOKA 2P1YA 3NCYS 1A47A 3QQDA 4P2RD 1NBVH 5ESVA 4OZFB 2J7EA 1GOOA 4P7NA 2QIIA 1BG9A 1FXQA 2VO5A 5GNYA 3O6MH 3ZKND 4P5TB 1A6UL 3TWCL 3ZHKA 1A1NA 1PZDA 3EO0A 3WH6A 3VOJA 2X16A 3Q2DA 3KXFB 3NNTA 3T9PA 4LIQL 2FYYB 5IW3A 1CVRA 4YBQC 1DUYA 3OPSA 3GJEB 4JM4H 1AHMA 1LXMA 2CLRA 4K7VA 2LLLA 3GC2A 2BGNE 3AMKA 2IPUK 1WZLA 1GGYA 2RJGA 5IMOB 3LN4B 3PP3K 4FQHB 3TVMC 3EXLA 2BVUA 2H3BA 4PRIB 3PJNA 3O6FC 1MREL 1F6YA 4HYWA 4IPJA 3QI9A 3UBXB 2KBGA 3KPNB 1MCHA 2Y7SA 4IQJA 3NWRA 1JK9B 1NC2D 2VM3A 2WBJA 2VGIA 3QMRA 3RM8A 3HF3A 1FDLH 1MHCB 2XZZA 1NMBL 3X13B 3AZUA 2WPBA 5T1KB 3G77A 1EPXA 1Z3GL 2VLME 4YDNA 4DGWC 4H8NA 3RR1A 4B3VA 3KBJA 1N5AB 2GVJA 4A8NA 3JVAA 3S4SB 3TSDA 5DJ8B 4Q2ZA 2XFXA 1U21A 4X7SL 5MEOB 3KX6A 3HKFA 3ELFA 3QJVB 3VUSA 4XZUB 4UR7A 5H8PA 4I85A 2UXGA 3ARYA 4DQAA 3MR9B 1S2TA 3MBEA 1BKHA 1AQDB 5BNXD 2YX0A 1BQSA 3B03A 3GRIA 2DLGA 1ONRA 4JX5A 4Y9BA 3ZIYA 4NRXA 1KB5B 3BSZA 4KQ4L 2ZIDA 4Y5VA 5JW4N 3SJ3A 1EXGA 3F1QA 4JRYD 1D7KA 1DBJL 1AZ1A 2WOQA 2CLVB 4L4VE 3LCLA 4ZUWA 5DCBA 43C9B 2ZICA 1S3RA 5J5RA 4C6FA 2BWIA 1RJZB 4JM4L 4HKZB 4YNYB 3BW4A 3PWAA 1Z9SA 4YSDA 4ZD3L 1A3LL 3NO3A 4QXTA 2YLLA 4O50A 3THML 2J9XA 4UNLA 1ZPLA 3NK3A 2QFRA 3QJTB 4XAKE 4PY7B 1YBQA 4RZ5A 4WSJA 4DJMA 1RLWA 4YWGH 4GQGA 1LT7A 3G18A 1T1XB 1FI8C 5AAMA 1G0YR 2IPFA 5D32A 5F4SA 4NAJA 5DO2D 2YD3A 1JWMB 1LGVA 1T2QL 3T1FB 1LE9B 1G7QA 4NU7A 2JGQA 3AYVA 2D22A 4RW5A 1UUSA 1AKJB 1SOSA 4IQHA 2IOIA 4IU2B 5EIIA 5I66A 3IANA 4S3EA 2ZAHA 1DSFL 3GZOA 4JY5H 5CEZL 2CO6A 2GK2A 1BA9A 3TPUA 3ZDYE 1EEYB 2VDQL 4K2UL 3QQ4B 2QMJA 4RW3A 3H24A 2GDVA 1A5FH 4M7ZB 2X4TB 4NQDA 5I1JH 1VBUA 1EA0A 2KPNA 2R2BA 3HG1D 1Y1DA 5KSAC 4HEMA 4U3XA 1MCPH 2A83B 5D4IA 5HJGA 5KSBF 4MUPA 2AK4A 4P2RB 3VJ6A 3CIWA 4QP0A 5SWUA 3CPRA 2X4SA 4LLAA 3TKFA 5AAWC 1NZRA 3HPLA 3IJYA 4S2SB 2X6CA 5J6GA 4XAPA 5A2FA 3SQSA 1S78D 4AZGA 3BK0A 4S3DA 4MA7H 4KQ4H 5AZ1A 1EZVX 3BEWA 1NIAA 2J88L 3I3EA 3IARA 2WZTA 3W75A 2E67A 4AGPA 1KXVA 2FK9A 3CWOX 1YADA 3VXGA 4C60A 2PMQA 1ZK9A 5DJCA 2B9BA 2XVGA 3CN0A 5EFIB 4EN3C 3NCMA 4EUPA 4YHOH 3C2VA 4TULH 5LSMA 5F1VA 1A3LH 2JQXA 3GXMA 4IIBA 4JANB 4W7WA 2OMVB 4YU1A 3B83A 4MNGE 4ZXBC 5HYSB 5DT1H 3W7PA 5DFVC 4C47A 3MU3A 2J4WL 4WVRA 5JXAH 4HJEA 1JE6A 1LO2L 2D8KA 4X7EC 4Y4KB 3W11C 1M6OB 2Y5QA 4CRPA 2C9QA 1NWTA 4WQ6A 1NAKL 1YTKA 1TYJA 1F8TH 2OA9A 3C87A 4LCIL 4BIKA 3T6QC 1C3FA 2D69A 4MWFA 2QQNH 4HJGA 4GH1A 3CEUA 1CDIA 2EF9A 3CZKA 3FQ4A 3IETA 3G1FA 2GQ9A 5ABTA 1QNQA 5JO5B 1DHKA 2BVTA 2WXRA 4MAZA 3NO5A 5CGYD 2WTOA 4AKOA 4GLEA 2DVTA 3MROB 2WYZA 2FH8A 3EFDH 2OPJA 4JUTA 2FYMA 4Z1DA 4F7CA 3S88H 35C8L 1FNEB 1PZCA 4LB4A 2D31A 5AHFA 1QI5A 4KHXH 4ELMA 3W9DA 2WNKA 3O8XD 1NANI 4G9FD 4JNYA 1CEOA 2Y1YA 1V54B 4FI6A 1UM5L 2W9LA 1Q7ZA 4MD5A 2OYPA 2OI9C 4YO0B 3TO2B 4ABQA 4MA7L 3BPNC 3P0YL 4WHCA 3DI1A 2XIIA 1EBPA 3PJSA 3JTSA 1NGPL 2YIHA 3O3DA 5BMFL 3JBG7 5HDQH 1GW1A 3LYEA 4M0XA 2B8OT 1QW9A 4OJDH 4WJKB 3GQFA 3PHOB 4AW7A 5DEGB 1E4LA 4KRUA 3QUZC 3BP4A 5FO9A 5L8KB 1HJBC 3O8AA 5I1LB 3N44B 3QJOA 4HJGB 2AJVH 5EEXA 1CGWA 4LCWB 3W0WA 5C9KA 5F70A 1FNLA 4E2OA 4ABUA 3LLXA 1BLNA 2FATL 2J6EA 3O0RH 2VO8A 1I8IA 2Z31A 5F6IC 5GSVA 1C8PA 2AAAA 5ES4B 1ODUA 3HIZA 4TUKL 3RDTD 4UTLA 4GK8A 3ZDZB 3N14A 2PTVA 1E6JL 1CVSC 4EIZC 4E42A 2EP6A 4A21A 2EPLX 2O9OA 1XVSA 4PRBA 4ZSOE 3W9DB 3UYOD 4UTUA 3QXDB 4ICMA 1AHWA 5FA3B 5HOSA 5D7JA 4BE5A 7REQA 3LZ5A 2PD5A 4IP4A 3VI3B 3F62A 1HXMA 4P5MB 3VB8A 1F0LA 3D34A 4O02L 2B1AH 3VAEA 3VG0L 2BERA 2NY2B 2V5SA 4L6DA 1LL1A 5IVXE 3QCTH 4KHXL 4LCUB 1W9PA 1BQLL 3OVRA 1TIWA 3PIQA 4S11A 4FNTA 2VXQA 4H4IA 3QR1A 5E4AA 4X4XA 2YD2A 3CCHB 4ODWA 3QSRA 4NQVA 2XH7A 4LY4A 5T1LA 3S6CA 3WFHB 1GOKA 4A7QA 2FMOA 3PPCA 3R5EA 2YSSA 1P5UB 3TZVD 2Z1BA 3SUSA 2JJSA 2Z8SA 3TNMA 2P43B 4E2BA 2FRGP 4L1TA 4PV8A 1YKWA 4P57A 4A7VA 5H94B 5BMFH 2MANA 3II1A 3ARQA 2GEQA 4Y9GA 4UIKL 4XMPL 1OF8A 2GSEA 3LZRA 3QHMA 1AL8A 4YN3A 4E4UA 2ZZUT 5I1EL 1G84A 3GLEA 4Z7NE 1F4XH 1KFLA 3A13A 1BBDL 3CHSA 1Q7MA 4NUJA 1AC6A 2WB7A 4ZUUA 4B91A 3HG1A 4O15A 3VIPA 3NACL 2J9ZA 3LS5H 3DXAE 5E8EA 2JV6A 5IB3B 3MRJA 2ANUA 3MRKA 4KQ3L 1IAIL 5EO1A 4BZ1L 4ELDA 1X9UA 3G5XA 1LLZA 1W1B1 4HMNA 2HP4A 4K3DL 3N04A 4Q8WA 2IWEA 3FU6A 4G43B 4N26A 3VILA 3QS2A 3Q13A 4HIHA 4JPKH 3PWGA 3CX5K 1W5PA 5D5ME 3SCNA 4IOFC 3D39D 1NAML 3TURA 3ABQA 2WMHA 2WJFA 5KZDA 3AG2B 1KRMA 4ECLA 1LK2A 1BQHA 2HS8A 4OHQA 1SJXA 4JFPA 1IFGA 5CZVL 1E72M 2VIRB 1ENUA 3MRNB 2H3XC 3HFTA 3KLSA 4X0KA 3FYIB 3H9SA 4G1EA 3WL0A 2FR4B 4JDVB 3MV8E 4NM4H 2MQCA 4AEIH 2J8GA 6XIAA 4S1DC 4NI3A 4EBQL 1YMMD 4L4TB 4QNPE 3TW6A 3U1QA 4PD4K 1Z89A 1LYQA 2G41A 4A22A 1Y7VA 1ZALA 1UT2A 4YE0A 1XIWC 2N0KA 4JL2A 2QPUA 1V7MH 4J3TA 4OF5A 4PB0L 3SPVA 3X14B 4CC4A 5JDJA 4M1GH 2RUSA 1E65A 1ELSA 2F53A 1II4E 1X5GA 5ITFB 2HDJA 4QRQA 2FB2A 1VPXA 2C4XA 3VKAA 4W9CC 1ZVSA 4M80A 1KJ2A 3DA0A 4L3EA 3ZE0E 3VD0A 2CDGB 2FB3A 12E8L 3NM1A 5CJXC 2HH0L 4M24A 3QUMA 5IMLB 4G11A 1K2DA 3T08A 1ZJAA 4X5WB 4LCCC 2IH3B 4MTMA 4Q0XL 1HILB 2XFGB 2CA4A 2DYSB 4JZJB 2WCAA 5T9BG 3G6JA 4PRAB 4WKAA 4Y2DD 1EHNA 5AWNL 4HCDA 3WN5A 1QBML 2PU1A 5E94B 4HCFA 4LL4A 5JLZA 4FHAA 5GSRA 1CECA 3O3BA 4XKYB 3AISA 4JMXA 5I8OL 4FR6A 2YARA 3HZVA 5KW9L 2GJ6D 1EZUA 4L3FA 2G5BB 2NR6D 4I7UA 1QKZH 5KVDH 5IVXF 1JPIA 3KM2A 5DUML 2BNRE 1ICQA 3F64A 3LK6A 4PJGA 4G80A 3ZYZA 1QFUL 3DSFH 4DQOH 3NIGF 2CBIA 3HHRB 2AQVA 4DBSA 1KR1A 1WWBX 4Y4KD 3R11A 3GR7A 1T4WA 4JKLA 4GIRA 4PMDA 1A1OB 5FO8B 2NUWA 3SI9A 2YQBA 3KW8A 4J1OA 4HJWA 4OZGB 3RWIA 1KA9F 2P5ED 4LLYB 5J1TC 1RAMA 2Q7YB 1SDDB 4HZLB 2XVPA 1JWUB 2PYEE 4MQSB 4FADA 3B0YA 3KWSA 1IE5A 1L6ZA 2PU0A 2VDLL 2VEKA 4HK6A 3MBXL 4HWBA 2R0LH 1T4KB 1RZKL 4NO3B 1RQHA 2J27A 5C71A 4J4PD 1TO4A 4PP2B 5G4EA 2DRUA 1WSST 4WUKH 2I9LB 4M1CC 5A6LA 4GUOA 4XV0A 4NRXB 3L1EA 4Y5VB 3NFUA 2EICA 2EPKX 3NN8B 4PRNB 1BQ5A 5DEJA 5E4EC 5ITBL 4P3CH 3S5ZA 5JHMA 2VRQA 4WKXA 3S5OA 1KPRB 3S36L 3UTPE 4MNQB 4R5VA 4HOXA 1W3JA 3MB9A 3W7IA 4CKQA 1I8MA 3BZEB 2FH6A 4I7ZC 2IXQB 3AT0A 2VDLB 5EIQA 5J56B 3KNBA 5HHOE 1A0CA 1EWEA 2Z93B 1DQDH 1AY1H 1HKIA 4KFNA 4NKMA 4I87A 4BDVB 4UFMA 1BMZA 3Q7JA 2V5DA 4N8VB 3ILQC 1K9TA 4YFDB 3UETA 5IMMA 5F7HA 4W5ZA 4JTGA 4B4HA 4EF8A 1A5CA 4MMXC 4WNQB 3T6XA 4F7EA 3D9AH 3WDQA 4IGBA 5CSUA 4OE7A 1M3JA 1TTUA 4YTRA 2ZTKA 1QO3B 1V7NL 3FQNB 3FSTA 2YLHA 1SF3A 4JPVL 2PGFA 3FL7A 2B2XL 1ZLSL 4FXLA 3N15A 3LNFA 4XPFH 4K94H 4Z23A 1GGTA 2J43A 1MZZA 4RWYL 1XIJA 3BKJH 1XLGA 4PP1D 3T3PE 4DKDC 3P02A 1X8FA 2G97A 3K74B 3FONA 3FK4A 3GGWA 4B95C 1K6AA 1UZ4A 3PF3A 2HV5A 2ZSWA 2L7UA 3G2GA 1N12A 2R29H 2WGXA 5IFAL 1WFOA 1IM9D 3E80A 5DO8A 3GVRA 2VITA 4LBAA 5FUOH 4AD4A 1J7VR 2QHLA 1IB5A 3B0UX 4XO4A 1KB5L 4D9LH 2R83A 4J35A 5EC2B 3B6SB 2GBTA 2D4FA 5ESAB 4XWGH 1IM9A 1XIWD 1LDPL 1Q38A 1V8EA 2V5CA 3MU7A 4YTTA 2H26A 4NKDB 4JK0D 5KSAB 4FX6M 3CXDH 5EOCH 3I75B 2ZNXA 1Q6CA 4D6HA 4PCKA 5I0YA 4O2CA 1FHVA 4NGHL 1E2WA 3ROLA 4HK7A 3PNWB 1XCFA 2FT6A 3BSGA 2PDJA 5D1QB 1SN5A 3ISWA 4PEKA 2XRAH 4TUOA 4Z2LA 4DO4A 1UC6A 2IO5A 2CK0H 3D06A 4LLMA 2APBA 4A8RA 1U93B 4XP4L 1RHHB 3PP4H 3OJ2C 4AF0A 5TQ0H 5IB5B 3FOMB 3WLOA 3RTQA 1VCAA 3VACA 4HEPG 2DQUH 2IBBA 3D4ZA 3Q6GH 4UBDC 1NWUA 4ATLA 4I9WD 1S9VB 2NXGA 3AYRA 4MWAA 2WTRB 5JO5A 5I8EA 2O5ZH 5K9DA 3L3OC 1ASOA 4OM0L 2QHRH 4HK0A 4LPTA 2UY3A 2W27A 1UG9A 2XBDA 3QULB 1AZBA 5CJOL 4X8JB 3SO3C 4DVRH 3HPSA 4GRWF 3T3MF 4ONOA 2JKXA 4Y89A 3SDXA 4MQ7A 8RUCA 1M7UA 3P4OA 2YJLA 5H35A 3OGCB 3BDXA 3P80A 4HGMA 2QJDA 1KV8A 4YGVA 4FLOA 1LDSA 1H8SA 1K6QH 5AVVB 5GIRA 4D9LL 4F8OA 2YXFA 1H0GA 2PLCA 2IQ9L 3DV6B 4CVZA 3QHZL 4KDTC 3DVIA 3TMLA 1BMGA 3WHE0 2NY1D 4M7KL 3VNMA 2VZVA 4DPRA 3ZVHB 5D2NE 2NNRA 4BFRA 3TH2T 1T22B 1AG1O 4UOW0 1QPNA 3GO2A 5DJAB 1FH7A 4AIUA 3S96A 4C91A 4DJDD 4JG9A 3UBGA 3HKZA 1YPFA 5D71H 4D9RD 4DN3L 1JPDX 1VBJA 4MDPA 3BG3A 1ZA3A 3CHRA 3GTFA 4AM0Q 1SLXA 4GYPA 2Y6SD 1PY4A 4IPLA 4QYOB 4Z3JA 3GS4A 2W9DL 3CH1B 2UWFA 1E9QA 2EO9A 3H56A 3MLTB 2XQBH 2V4LA 3EBHA 3H9ZA 4PJ6A 4XN8A 5CZRA 4G7YL 4ZS7H 2XBZA 1TENA 4E41E 5IR1B 1WTGT 2ONEA 3DCPA 4MLJA 2PXYD 1T0PB 4K0OA 4CDHA 4I3RL 3L66A 1CXLA 1V93A 2E6AA 2YN5A 4K8RD 3C0QA 3P5ZA 1H6EA 2EC9T 5GGVY 3LB6C 5DURB 1F3RB 1O6TA 1H62A 4PG9A 3WKMH 1UUNA 4ELMF 1A1MB 2O5YL 3M17A 4ZTOL 5IREA 4GQ9L 5LAXA 3VDAA 3LRSA 2J5WA 1A66A 2PTDA 3KTXA 3MSDA 3JWNE 4E38A 2V33A 4X7TB 1M42A 4FXRA 3O0KA 5C0EA 3IMTA 2CO4A 2XH0A 1LZOA 3UWQA 3II2A 1RCOB 1ZTXE 2GAZA 4M6OL 5CD5D 2ESVA 4X9IA 2PLMA 4QHNA 4LHUG 1KFAL 2X6VA 2F68X 4G6ML 1E27B 1T2XA 3BUYA 4FLSA 1CR9H 2PCPA 4XN1A 3N85L 1W9BM 5GGSB 4KK8D 4PZVA 4YPGB 3NCOA 3CN1A 1IC7L 2YD4A 4HFUL 1J4EA 1IEWA 3C0SA 3DURB 2DLIA 1E8WA 1HU8A 2FECL 3D2UB 3VNLA 1KBLA 1OAZH 3LRHA 2OV0A 3FTWA 3MUIA 1U8CB 3U57A 2ZKHH 2FT7A 2YFNA 4HWNA 1DBAL 5TE7H 3SZKC 3F3HA 4K3JH 3UTPD 1NOAA 1JPGA 1KWGA 4OUUB 2Z1XA 3AHVA 2A74C 3QV9A 3MHUA 3BVWA 1GVRA 1H5BA 1XFPA 2XBTA 5GGUA 2F0CA 3QAZC 4DXVA 1KWKA 3GKAA 2R9RA 5LXXA 3REWB 3LHUA 5F7YC 4E5XB 1QPPA 1MFCH 4OF3A 3FJNA 3CMOL 3U0PA 4S3FA 2GFBA 4QXTB 4S1QL 1GZPA 2E6PA 4ODBD 1I2RA 3C09B 5FEZA 4I8YA 2R4SL 2GBVA 5B1CA 2VDHA 3EX3A 3ARDC 2XU2A 3MUXA 1DXIA 1NANH 2NW2B 4DO7A 5B7YA 3S3JA 3GJFB 5CNHA 1PSCA 2F54D 4WO4C 4YSSA 2D3JA 3ZRFC 3UBXG 2XZCH 4NAFA 3W7JA 3WLHA 2XISA 4UZUA 4B9PA 3OPZH 2C1PB 4FKKA 1SZNA 2UX7A 4UFKA 2OXHB 2BCKA 2XH4A 4NQEB 4ODTL 5CHNA 3V10A 1V4YA 1ZIBA 4FCHA 1GQLA 1GTNA 3ANUA 8PAZA 4GOAA 3EYUL 2XZ7A 2F7RA 2D1ZA 4EX4A 1XLAA 3X1EA 3IGUA 1S4IA 2A3BA 1H15A 2WLJA 3BPCA 2IDUA 1ZHBA 5I23A 3BKML 3JVGC 4NI6A 5J11B 4LCSA 4JTSA 4N9GA 3DVFA 3GG7A 3KEDA 3RLUA 1CXEA 2DQJL 4H0LC 1L8PA 2H9AA 3WD3A 1JPEA 1X5LA 3CHFA 2WZEA 1HKFA 4NFDA 5G2IA 3T2NL 3NABH 1RH8A 4A2EA 3T0TA 3QULA 2YW4A 2P8PA 1OSPL 4OF8A 3FB7B 4IDJH 4Y8AA 1FFOA 2COQA 5F2MA 3AGVA 1A50A 3UZYA 4HUVB 5HHXL 3QSTA 3NAAH 1GC1C 5DDHB 1IEAA 1N2RA 3WHXB 1KCSL 2WC3A 4DWSB 2FJFA 4UINH 1OYBA 3MNZB 1JZGA 4PJGE 1W17A 4KUZH 4I4WB 2NYKA 3QP3A 1LE5B 1UKSA 4MNLA 1OIOA 4HYTB 2G60L 4IGBD 1KGXA 4DOHE 3KOWA 4E4PA 1F13A 3K5SA 2OMXB 4LVHC 4IW4C 2OBGA 2QNEA 4U1HA 3BKYL 1SN0A 1OD8A 3WDRA 4LCCB 4B5ZA 3TJHC 1F3TA 1LEKB 4PBXA 1HEJC 5IB2A 2YDQA 5KJ4A 5MEPB 3K5XA 1FVDB 3HBQA 1E6ZA 1C9WA 1LLWA 4BKLB 3ILPB 3TW7A 1QVBA 5D9NA 1A1OA 5FO8A 2BWGA 1LP9E 3K8KA 4I2XE 4PJBE 3BN9C 1I0DA 1X98A 3WEOA 1TKKA 2OEJA 5CPLA 3FCUB 4C1LA 1NCBH 5TFSH 4L3EE 2MNUA 1HJXA 4UDUB 4IBUA 1WITA 3N5AA 2VE6A 4FZEH 1HE7A 5BOOA 2F53E 5FR3A 1PB0A 4NQDD 1Z48A 2ZKXA 3DVNB 5D09A 2H8PA 3QNXB 4OD2B 3IM1A 1B57A 1WBJA 1CWYA 2PR4H 3Q3GB 5SV3A 3C8NA 3AU1B 3ITGA 4NKIH 4E9LA 1KPUA 4RAHA 3KPMB 3A4FA 4MSWA 4OV9A 3X12A 4TOYH 4Z6AT 1IMHC 5C07E 4MASA 2QUUA 3PWLB 2DSKA 3PWIA 1G7JA 2KERA 1EB3A 2WB5A 3SKUD 5EZJA 3FFCD 2HFEA 3HGRA 4HGXA 1I9JH 4L1HA 4K4KA 4ZQRA 5BJTA 1ZTXL 1JCLA 1DWIM 2OZNA 1KCZA 4AZUA 3G1VA 1U22A 4H3DA 1I8IB 1SMOA 4WEBH 1FQ9C 2VERA 4NKMB 3RUBL 5A2AA 5ABFB 1NGZA 3PHAA 2YMOA 1P1XA 1Z6KA 2WSYA 3W76A 4GBXA 2GJXA 4BFFA 3Q44A 2HKHL 4FRWA 3AWEA 2BNRA 1OGAB 1F6PA 1IC4H 2ZYIA 3QEHB 2OZ3A 1GYAA 2W4XA 1TVBA 4LU5L 1NEZB 2CSPA 1U91A 3ZQWA 1DIKA 1QI4A 1CU4L 5FA3A 4H41A 3FXYA 1T1WB 2FWOA 4BI5A 3CYJA 5C97A 4F5CA 4KKBC 5HQMA 2XIJA 3W7OA 4HLJA 4I1NB 1XLJA 3HMWH 4EAEA 2DQCH 4EPSA 1GVYA 1Q6FA 4YBQD 2FD6L 1PLBA 4HUMB 3S2AA 3EGXB 3UAAA 1W6LA 5KYUA 1LTDA 4DUOA 1UR8A 1WG3A 1DJNA 3Q45A 1XGYL 2JF7A 3VCLA 4ODWB 2PUQT 1I9CB 3AQYA 3W57A 3H8AA 2YN3A 3P77B 1Q45A 1BW8A 2HPOA 5ABFA 3CLFL 1OZUA 5GISL 3P0YH 1EFXD 3F7YB 3ISRA 2AJSH 3NJHA 4NZFA 4RRPM 4WWPA 3QC3A 2YQGA 1PWLA 4P49A 2R8SH 3EMZA 4EWJA 2NZLA 1UFGA 1LDCA 2C15A 3KBWA 1S5IH 3DO4A 4C56E 4F9PC 2DAVA 2ADJB 3DHDA 4P61A 4UTIA 1Z3RA 4H8WH 3BH4A 1AD9B 4MPKA 4Z08A 2JF6A 1TZ7A 3KD4A 2HYMA 3DGRA 1TLMA 4F7MA 5HULA 1KKOA 2DZSA 2F1AA 4GBUA 4I13B 3WGUB 1YCSA 4JQAA 2GSGA 3JZEA 3W23A 4L2LA 5CLWA 1BREA 1DIDA 4Z7WE 4YWGL 2J47A 2IALA 2JKEA 3C3NA 4RDYA 4U5IA 3LKSB 3WJJC 3JS3A 4KDWA 3OV6A 1T2QH 3WY2A 4HU3A 4PVNA 5E56A 3VU1A 4KEZA 3GU9A 1NLDL 1JNDA 4LPYA 4XC3H 3W39A 4QIUA 4JTUA 5DT7A 4MKVA 3RCYA 5CC7A 1J1XL 1HHHA 4LLWB 5C0NC 1EERB 3W0WE 1Z5YD 1K9DA 2AL1A 3TE9A 1OX5A 1P7BA 2YPKB 3SDAB 1SJCA 4BY3A 2YEZA 1FPTL 5I6PA 4DF2A 3PBUA 3WFCL 5I30H 5IVZA 3RU6A 3MRLA 4YSEA 9CGTA 3BP5B 2OMXA 1W6TA 4DO5A 1J05B 4Y4HC 3R0UA 1J18A 3C8KB 4JO1H 5DLLA 5FB8A 1VH7A 3B3DA 2E9GA 1OAJA 2Q9OA 3V4VL 3IGLA 4XKMA 2BSDA 5CILH 3FCTB 5T3ZD 4M6VA 3KCJA 1OO2A 4AHPA 1TZZA 1ZT4B 2VT0A 4NKOB 3VQ2C 1UWTA 4J5NA 3DAQA 3W02A 3H9YA 3ANYA 3W7CA 1YEHL 3CZ8A 5BWFA 2R29A 1CICA 2R2HA 3S36X 5H4ZA 4TULL 2X2GA 4QQUA 3QYQA 4BEIA 1EHLH 1TMHA 4TIMA 3UXKA 3FRUA 4KXBA 1OAYL 4KROD 4H1LG 4UDUA 4FQJL 4QXWA 4YDKL 5DQDL 3AW5A 4PAZA 1VYRA 5DEZA 1E5YA 2EKGA 3AUJA 4HNLA 4L9DA 1CGSH 3NA4A 2UVEA 1KYUA 2MIZA 1AZCA 1SJEA 1XZ0A 5G4OA 1WYJA 3LN4A 5TH2A 1AQKL 1N8ZA 4S10A 3FS9A 5JW5A 3QN3A 2UWEA 4WDXA 5E0CA 4AB4A 1HH9B 4GAAA 2PDXA 2F7QA 1JP5A 3NCEB 4I5XA 3SJVE 3SSZA 4YQXH 2X0WA 2N3JA 5BXSA 2AKRA 4K9EH 5CEWA 4BQ9A 4Z7UB 5D93C 1GH7A 1OB1A 4KDVA 5J9PB 1UM6H 2KPWA 5A2BA 4GI4A 4LCWD 2IGFH 3FCTA 3VXMA 3N41F 1XLDA 3MFFB 3M9YA 3KBPA 4QRUB 5IJDC 1A4LA 4JD4A 1U5HA 5CZTA 2YSSB 4AU0A 3GTXA 4NPYB 3A3HA 4JTAA 4RMRA 3KYNB 1UA7A 1KCKA 1JV5A 5C09D 2QCDB 2QVKA 3NZ8B 3IFOB 4FFZA 4LSPL 1JEZA 2JLPA 2ZPKH 3HQOA 4KJYA 1F6AB 5HD8C 4GHRA 4LNYA 1OEPA 5CILL 4ZPTA 3IVKA 4ZQOA 5C9XA 2MPAL 1KB5A 1UCBH 3ULUD 1XF4A 3TASA 1LQSR 1NJ9B 4U1LA 4YDLC 1YEIH 1E4XH 3IU4L 4HEME 4XMWA 3RAJH 2F9BT 3GPEA 4HVBA 1H5VA 2PDQA 3AMCA 3NZ1A 1AG6A 3SCMD 4PJ9B 5DT5A 2ICWB 4F7PA 1V6YA 1TQCB 1EEYA 2DY3A 4JE4B 5J0BA 4X6CF 3SFKA 2HJKB 3BJFA 4M02A 1LJMA 1DHPA 4X22A 2WWMC 2WMFA 2OZ4L 3FT3B 3ZE0F 3II3A 3VD5A 1FDLL 4JFQB 4JKPL 3H7LA 4PY7A 3SCMC 3V5DB 3AIQA 3PWVB 4P06A 3CVHB 3UAFA 3QFWA 1NBYA 2O1AA 2JELL 5ERWA 4CU7A 3C5QA 1BFTA 3IGAB 5IJBC 1NFDB 3PDGA 4MBRA 3UEZA 2Z0UA 3HBLA 4F80A 2PDNA 5I8KL 4PJ8C 4OLUL 2EVGA 1VEPA 2UV3A 3ALPA 4EDXB 4Y4FB 2XWZA 1G9EA 2VXQL 1GOGA 3HZMB 3QA3A 4R2GB 2K6YA 3WS6C 4PCTA 1JPKA 3GVVA 4FFTA 4XVTL 2HMCA 4MMYB 2OL3L 1ONQA 3LEVH 4LAJH 4Z78B 1Z3NA 5BW7A 2P4AB 4FYTA 3VFGH 3WLJA 5T3XL 4UQDA 4IZGA 3MHGA 3V4UL 5I28A 5IDIA 3AG3B 3MP5A 3LZFL 1V6UA 4CJ0A 5FYJL 1RZKC 2DOCA 2WLZA 2Z9TA 4FKHA 1AG0A 1OP3K 3TBBA 3JT2A 6FABH 1UR1A 2V8ZA 1K8DB 1KLUA 3MV7E 3P30L 3FT3A 1AGEA 2KS0A 4N1EA 3UO1L 3BUDA 4Y2OA 1NPJA 3SBWA 5TDOA 2C26A 3NZRA 1P4LB 4JPWH 4B9ZA 5FEBA 2BOEX 3OYXA 5JIKA 2BSSA 3ULVH 1F11A 3BFWA 2IBZX 4B53A 4HOWA 1GQNA 3K4WA 3E0WA 5AHNA 4L8BB 2F7IA 5I6XB 1DQLH 4HLEA 1X9QA 3QIWD 1NDTA 5D7SL 4ICXA 2E9IA 3GSQB 4OIFA 2BDNL 4KKZA 3GE7A 3VYNA 4Z7NF 3HC2A 1RUSA 3M7WA 3U79A 4US5D 1Q6OA 5SWSE 4ZMGA 1CF1A 1XI3A 3CDZA 2KLTA 1AZZC 2KLRA 4N87A 5L4FA 1SQ7A 4AV0A 5AKSA 1X8CA 1BFSA 3TTYA 5A1AA 3SPJA 3DHUA 3ZDWA 3VFSA 3OVGA 4P8QA 4E3TA 4F0HA 3PNWA 5F7WC 1E6XM 3AXHA 4RISL 4DEUA 1NOUA 2E6YA 1LJYA 1V3MA 3FUHA 1Q7QA 5HI4D 3GIVB 3DTXA 4NWTL 1D9KB 2PO6C 3DX8A 3K8MA 3QIBB 4TQIA 1KCWA 5JYMA 1I7TB 5BRZD 4JJ5B 3QV7A 1I3VA 5CAHA 1T3FA 3QIUA 3A5FA 2FWLB 3MN8A 3UJIH 4OZGA 3RWIB 4HXBH 1BYPA 3VI3F 1TTBA 4GI9A 1HJQA 4LOVA 1WK0A 4GY0A 4W6XB 4XCYB 2I5YL 4NCC2 3W83A 4WFFD 1W9XA 5IMKA 1HVQA 5JQ9A 1SY6L 1SVBA 4I77H 4HXAH 4HDIA 4Z0XB 4BHUI 4M3JA 1KGJA 4P46A 3QH3A 4BSVA 3GIPA 4IL0A 4ZNEA 3LQZB 4FMVA 2Q86A 2ZF9A 3QW9A 5CCHE 4IIFA 3KWXA 1DZBA 1RSFA 1UA6L 2OSYA 1HKLH 4R4NC 2ZDSA 1EYWA 2C3VA 3MA7B 3TA3A 3TH3T 1I3RB 1W8OA 4P7LA 1A4JA 3L45A 1EEXA 5E4IA 3WK2A 5HVGB 1SLUA 3WQCA 2I7OA 3TA3C 1MUWA 2AQPA 2OMYB 1T83C 5AVUB 1JUEA 2ZUQB 5FUOL 2HH0H 3X12B 3WQVA 1OP4A 4XCCL 5HNRA 2ADGA 3C60C 3F6IA 4RGOH 1FC2D 1H9VA 3SHSA 5GZOA 3VH8A 3DESA 1HQRB 1J9QA 3K6NA 1MNNA 4XWOD 3FY1A 3RR4A 4BQ5A 1WXJA 3L5IA 4QTFA 4A05A 2WYHA 3EF4A 3O07A 1P5UA 4KW2A 2G0LA 1J1PH 3U4EA 4OI9A 2DZPA 2CW6A 1S7TB 5M17A 3IJDA 1PD0A 3PP7A 3QHOA 5IHBA 2XFFA 3KLDA 3MCLH 1XL9A 4Z3GA 5LIKX 4FQLL 1P4BL 1QKZL 2CG9X 1CFSA 4FXKA 5KVDL 4IFKB 2IPTL 3DOHA 1IGTA 2IPKA 2VN5A 3BESR 2VXNA 4Y90A 4GYBA 2AHIA 3BANA 1QI2A 1YYMH 1DQMH 2J1XA 1MFAH 2BP0A 2C7UA 2DQUL 3DOSB 4BA0A 1WA3A 4ML9A 5F1UA 5T9CE 5EU4B 1ND0B 1A1MA 3HNVL 3M17B 2G3NA 1NCNA 4JFQA 1C9DA 3LTPA 1JHTB 2OX5B 3BQUA 4BH7A 4K68A 4PJHA 2ZVRA 1E7UA 2QHRL 5FGBC 5ISZB 4D2JA 4AWSA 4QE5A 3PDOA 4PJ7B 5FM4A 4H4NA 1U92B 4XOAA 3UTSA 4CQBA 4MYAA 2HA1A 1CIUA 3AWNA 4GQBA 3S37L 3GLAA 3RCMA 4O51B 2DLTA 1Z0MA 5LBSH 1AMKA 1PIFA 1RZKH 3A4AA 5C0BE 3LY6A 4E9SA 4G9FB 5B39B 3KPRB 1I3GL 1MJJB 1FRGL 4CL7A 1BRLB 4NYLB 4XVSL 2DTML 1P0NA 2HK0A 5GGSA 5BQDA 4X42A 1K8IA 3PV7A 4JFOB 1A6WH 2UXTA 4PVLA 3W7QA 1SUJA 4PCFA 1FSKB 4AUYA 3L48A 1A5UA 3AFBA 1NPNA 3APDA 3S36H 5KS9B 4NUJB 4MB5A 5DHYB 3EOLA 1C8YA 3LCIA 2O72A 2NX5E 4EK7A 1IR2A 5EU4A 1FWDC 1DVJA 2FCBA 3P81A 5A16B 3LH8A 2CLZB 2E7MA 3J2PA 3REWA 3ZKXB 2QVTA 3TK7A 3WO8A 1OANA 1R5VA 1BQKA 4FQLH 4J3XA 4XD3A 4J4PC 5I78A 5KSBE 3KHDA 3ATFA 1HJVA 1ZWIA 2X70A 1FWFC 5HGDA 3E3HA 1XDLA 1DQML 3WX7A 2F7OA 2Z7UA 4TUJB 2YPLA 4I5BB 1O66A 4WEEA 3E02A 1N59B 1S5VA 2VLRA 3QNYA 3C3UA 3S5NA 4CN1A 1H50A 4XTDA 1GZ1A 3KPPA 4CVXB 4LHJB 3GKFA 3IJ6A 3L4UA 4RWYH 1LO0L 5CXPA 2YL6A 2Y7FA 1KN4H 4RIRB 1P5UC 1MHPL 1MCIA 4KMLB 3LA4A 2GUOA 1GCFA 2Q71A 2R2EA 4CMMA 4ZCWA 4X7CC 2R24A 3FHAA 5H8DA 2ZE0A 3HI1A 1GPOL 4TVUA 4Z7VE 2WXJA 1XGUA 2Q10A 1GOMA 3NGBC 5CPTA 5I07A 4CQCA 3FH8A 4R8WL 1YC7A 4RGMB 4WW1A 4KFZC 2H1PL 3NYDA 1GKPA 4JNZA 1U3YA 2IGTA 3LCHA 2ZRXA 2B7OA 2HRHA 2IH1B 4POZD 1N5AA 4W6WB 2YCLB 1Q2SA 3BO8B 3TN0A 1XGRB 3ROOB 1KC5L 3FO0H 2R15A 2DD8L 3QUHA 4PWKA 1SLWA 3VFUA 5I1DA 4GP8B 2D7TL 3E6FA 4Z7QB 4IJBA 3HG5A 3IJHB 3KBNA 1ME8A 5F4XA 2P8PB 1NAMH 5JHDB 3V75A 3BLLA 4NGHH 3ZL1A 3CHVA 1HOEA 3LIZH 3G1XA 3UPMA 2OTWB 3MNWA 5HDRA 3HTLX 2X4UB 3TZVA 3MA8A 1E42A 1I4FA 2DWDB 2VLKD 4MLIA 3B40A 3EH4B 1AW1A 3GNDA 3HHMA 4UIMB 2P7TB 4KJPD 3INOA 4LQFH 4DK6A 4BRJA 2VL5B 4WFEE 5HNUA 4B5XA 1E0WA 2X0HA 1ZLWH 3NQ8A 2XTJB 3PJSB 4FFYH 1KBKA 1BD2B 2J20A 3KS0J 4WW2F 5DYOA 1XSIA 5HGGS 3B2DC 1HKJA 2VGLM 2CDFB 1XLMA 1X5YA 2QSCH 3HZ3A 5EZOL 2BVQA 3ZMNA 4FMFA 2ZX6A 4Q56A 3LMJH 3AROA 1N7MH 5AZ0A 4S1RL 4PJDE 3TCLB 1A0QL 5ISZD 1DQIA 2PO6A 4M1BA 3VDHA 5C9ZA 1TZAA 1PKMA 2VX7A 1BEYL 1CFNB 4P2VA 1T96A 1WHPA 3KBHE 4XCEA 1W31A 4P48A 1BX2B 4ATTA 2I56A 4LLYA 2A9AA 3I4KA 5HNTA 2JIXB 3HNTH 1T0OA 2E9MA 2CAKA 4TXVB 1R1CA 1ZEAH 3KCLA 3UTTB 4TUFA 4YNGA 1GKQA 2KX9A 3T1FA 1X5ZA 2D3VA 2EXSA 4P2RE 2CCVA 3IFOA 1WFIA 2GJZA 5DQJB 3W29A 2O6FA 3L4WA 2VE6B 2B81A 3MKKA 1YPXA 3VDGA 4DI8A 3QHZH 2XWTB 4UIMA 5A3HA 1SVCP 1BQCA 3PANA 1XBZA 1VPQA 3VTAA 5FAAA 4FXJA 1OGPA 4HIEA 1TV3A 5D2TA 5IHZB 5F9WB 4WKZB 5AVZB 2P1FA 3NCFB 1F6KA 4N6RA 2JKRM 2V9RA 2VLLA 2AAMA 2VCAA 4LUTB 5F2FA 2VXUH 4IMCA 3LMYA 1NDGB 3E5BA 3U0WH 1AGDB 4EXAA 2NY2D 3MS8A 4NQSA 1BCIA 2XV2A 4JFXB 4NNYA 3BW2A 4ZOAA 1WZ1L 1W3TA 5FOOA 4HJJL 1JZ2A 3BZ4A 5E6ZA 4F2UA 2FWSA 4HSHA 3QUGA 3MJ6A 5BV7L 5IQ9B 1AUSL 1XB6A 3EH1A 3UJJH 4CU8A 4ZQKB 4LRTA 5SX4H 3QZOA 4PR4A 2BWQA 4AISA 2PF8A 4JTCA 3WQGA 4K1GA 2X4NA 3BAIA 1OGAA 3VIMA 1O6SA 1XL4A 3OQ3B 3IACA 5AYIA 2GVEA 3HFFA 5I3JA 1D9EA 2PCFB 3GIZH 2HPMA 2DN7A 2ZUUA 4Y2DC 3VA2C 2YD7A 4H25A 4LGSB 3VRIA 4AGLA 5HYQB 2G5RA 1XTMA 4XRCB 1C91A 4LS0A 3TYEA 3TQ0A 5E1HB 3TV8A 4UMGA 3FGCB 1IGML 3QEQE 2PYFB 1RZ8A 3RGBA 1KEML 3STBA 4LL1A 5IB3A 4LLMB 1TPXC 3HBGA 2AABL 1FV1B 2WC7A 4YSPA 3RWJA 3T65B 2LVEA 1PXGA 5C2XA 5LHFA 1AGDA 3C2SA 4Y2OB 5C7XL 5CGBA 4YX2H 1E8ZA 1AY1L 3BCDA 3RPKA 4OLYH 1FWCC 2FO4A 1T21A 3C61A 4WO4A 5C3TA 2WMIB 2QKIB 4WEMB 4I9XA 5ESAA 3VNYA 3FTXA 3KYMB 1IFHL 2VZOA 4AK1A 2QJIA 4IXXA 3W3OA 1OD7A 3L4XA 5HI3C 2ACQA 2E59A 2OT1A 2XA3A 2HT3D 2XTSA 2XLLA 5FCUH 1IIKA 1Y07A 4WGKA 2ZWSA 5FDYA 1VHCA 1FG9C 3H3KA 4NC1E 5AVYB 4PJIA 1ZZMA 3UVIA 4L9YA 3KL5A 2N7SA 5LGKA 3L9EA 5D7KE 5IDZA 1G67A 1DQQA 4DB7A 3US1A 4ZQNA 4CBZA 4UXDA 3KLHC 5GIRB 5I74C 4LEQA 3K4DA 1EJUC 1TSIA 4UTBA 3FQWB 1J8HE 4WHDA 4EOWH 4WEBL 1RJLA 4HWZB 4FQ1H 4N8UA 3L3HB 4JZOB 3SODB 5FWQA 2PS2A 3F03K 5D70L 1S3KH 5J6SA 4XAYA 1H61A 1VQTA 5F9AC 1FX6A 1FWAC 1MDLA 5CIPB 4M6PA 2DLFH 4K7PH 4RFOL 2P53A 3CMFA 3N6HA 2W61A 2NNXA 2V8LA 3G22A 3PNUA 4RNHA 3KPSA 2IH3A 4KITB 5GRZA 3JSSA 1XQLA 3KHOA 5C0QA 1HEHC 1QYGH 1DE4B 2D2GA 5A2IH 5T1KD 4IGHA 1E4XI 1FZOB 2OSWA 3HPAA 4PJIB 3LQZA 3N2JA 5DN1A 5KN5A 3SYPA 3PPSA 3VKBA 1BJ1J 5B22A 1JZJA 1K03A 3CV1A 4G6JH 5EEYA 3KPNA 1TQBC 1AAJA 1JZEA 1H63A 2J7GA 2B9AA 4AQOA 1PAZA 2D7QA 4H88H 5FB8B 3QG7L 4QGYA 4D3CL 1U8PA 4N90D 3RFZB 1R3WA 4OUOA 4PPTA 2YUZA 4EZJA 1KELH 3P0VL 4G80B 2PGRA 3IYLW 1P1VA 5GJTL 1IGWA 1OJXA 4OLVL 3NPWA 2V5MA 3QUKB 4X98A 3JWDH 1O5RA 3MBED 1W8SA 5EPDA 5ABGA 5AC7A 2CBOA 3KEHA 5D1XA 2OG9A 4PUEA 1I8KB 2MEJB 3HAEA 3L9YA 5KBLA 3DX9A 1QFWM 4PQXA 3ZKMD 5JBEA 3NGJA 2EECA 3QUXB 4K7FB 1H0IA 3W7RA 2OEMA 5IR1A 3VMPA 4AEOA 1SF5A 4XTIA 5TJWK 2AZUA 4Z2JA 3W5NA 4QHLA 2WGNB 3ZDXF 3AREA 1X5HA 2BM3A 1NJJA 3KXFD 1DQJA 1I1YB 3ZU8A 1CF8L 3OKDB 4AXWB 1UWGL 4CAGA 2Z31D 7ODCA 5BRZA 1PCWA 4MKNA 1RZJH 2QSQA 1Y6NR 1P4IL 1A7OL 3LXCA 3NIYA 3W71A 1GJWA 1W3LA 4X4YB 3OEXA 1KNOB 3PK7A 4KF1A 1EWHA 2X09A 4XAKD 4E9QA 4MNQD 4P9ML 2VX5A 2QCFA 1I7RA 3HR6A 3BCFA 4FX5A 3AXXA 5AYXA 3QUKA 4X98B 1QNSA 2OKTA 2J7CA 3LBOA 1L0QA 3WFEH 3TEYA 3SSJA 1QACA 1KLGB 3QFJB 2BVYA 4N8VA 1KCVH 2AV7A 2OSLB 5EO0A 1V02A 2D7MA 4AYMC 4X0KB 1JZ8A 3NQKA 4E6MA 1CK0L 4Q4RA 3MRRA 1UZ1A 5I17B 5HGHA 1IGJA 3SKJL 1FL5B 3H2WA 5D7LA 4RPPA 5IIEB 1J0ZA 3TBWB 2RIKA 2Z27A 3O8XC 3QR2A 3JWDL 2VSDA 4ZTPL 1OOAA 2WAQA 2IANA 5DS8B 2R2BB 1G7PA 5H37G 4BZ2A 4NBYB 5HYSA 1HOCB 2Y1VA 2AL2A 4OFCA 2V3GA 1NIFA 4EE9A 1E6PA 3X3FL 3GBML 3SJVB 1ZQ5A 3C8HA 3H26A 1WA2X 2HG5B 2FDMA 4N6EA 1P7TA 5D6CA 2BNJA 1HSBB 4PB9H 4AL8H 3ZVHA 1EJWC 4DRSA 1OAYH 5D1XE 3ZO9A 3PWPE 5E2UL 1Y65A 2HKHH 3R6IA 1KV5A 3LGGA 3A9IA 1U8KB 1YPZB 1E4HA 1W0YT 2BGQA 5GZNA 3HI6L 1UWAA 4Q7BA 3WJMA 3V55A 4KFOA 1QG3A 5KYNA 2J21A 4X63A 2CFFA 4EANA 3NQ6A 2Q01A 1AA1B 1XIIA 2ZOXA 4JQ4A 1T5KA 1P4IH 1A7NH 3Q5TA 4LSVL 4Q8UA 1KJMB 3KPPB 1XQ4A 4ANVA 3T78A 4PRRA 3UA4A 2C1IA 1OQXA 1OAZL 4K94C 3EJZC 1HEZA 1ZVHA 2DQCL 3MJ9H 4IBWA 4AZCA 1PKQA 1PYWB 3OKMB 3P2TA 3PL6B 4KJQC 2UV8G 5B8CB 3PBYA 2ESVD 1DWJM 3OMIB 2EPOA 3WFEL 4AY1A 4EJ1C 3G1RA 4AX3A 3AIRA 5BU9A 1QPXA 3WJZA 4QHKJ 4D6EA 1Q9WB 4HCIA 4NIKB 1TPVA 3POHA 3MRIB 4W9DC 3SE8H 5KBNC 4B3EA 3VGEA 5FO9B 2E1WA 1FWHC 2AQTA 2BSTA 1MW3A 3CMOH 4PWGA 3F8UB 1KG0A 4LASH 3CK0L 1M9HA 2BHFA 3FTVA 2QV2A 2Y36L 1ZT1A 2G9HA 1TO3A 1RP9A 4XHJC 5D7JC 3DYMA 4FHKA 2VDQB 1TTFA 2IAND 1H4PA 2R8SL 4CJ1A 2PDHA 4NQCD 1UPPA 1QFWL 3TXZA 5ELIA 5C6TL 2F8QA 3FRPA 5FO7A 3D30A 2NUTA 3WHXA 4K38A 1L6GA 2YKKA 2GSJA 3QIBD 2QW5A 3MNZA 4AIXA 3L65A 1Q90A 4AKQA 1IARB 2BFVL 3VYLA 4FQXD 3CDZB 4XHJD 5E1IA 1YUHA 4K5MA 1WV7T 5CMAB 5C0DA 5IJKA 1CFTB 2EDQA 3A12A 4GKZB 1PTGA 2WZMA 3WN6A 1MCOL 4QSHA 5FYLH 5F0MB 3H2EA 3N25A 2W67A 5BO0D 5BQ7B 3AGWA 1BZEA 4PGCA 3E0GA 3PGDB 3VFWA 3QQ0A 3MZNA 5D33A 4MNQA 4F2BA 2J6XA 1NUFA 1TZHB 4HULB 3UR7A 2WKOA 4LCWA 3O6FB 2WZAA 2YKLL 1G1CA 4GRLC 3BKCH 3RHGA 1FYHB 3AITA 3GXNA 4U6XB 3DHMA 2J73A 3EJSA 3EXJA 2OW6A 1MCPL 3Q8EA 5GGRB 3NGFA 3EJZD 4H6RA 2LR4A 3TCSA 4JM0A 2CIKA 4AUJA 3VOCA 3V6ZB 4JW3A 2DQMA 2XU9A 4NUMA 4WUUA 3SDDB 3KM1A 4W81A 2Q0ZX 4CGTA 3LY0A 1LL7A 3P60A 1LTXA 3DLQR 5TAOA 3D25B 5CSBA 4LT7A 3VDBA 3PR2A 5EMJA 4IOFD 1HCYA 2Q7NA 2BNRB 4XB3A 1RK6A 2EKSA 3DX4A 5CCKL 3SKOA 1E9YB 1QXLA 2HBVA 4QS5A 4PMJA 3FB6B 3MNMA 4HIJA 4RVBA 3C5ZA 1TVBB 4MJ5A 1LWRA 4X5QA 4ZAKD 3P30H 2NZ9C 3UO1H 1SRDA 1OCWH 1YEFH 4ZUSA 2QJMA 4OWGA 4AHQA 1C12B 1MF2L 1BGXH 3C6SA 4HHAA 3RX9A 2VHLA 4W9JC 4M61B 4N02A 5LWYH 5C6TH 2O9TA 4XUYA 3SCRA 3DARA 4HSNA 3T8VA 3WG7B 2ERJC 1GGBH 3VIIA 4LLVA 3ZHLA 4DELA 5E9DA 1JGLH 2G9KA 4B2DA 1OG6A 1L9QA 1NDGA 2IC2A 4L29A 1T1ZB 4HZAA 2PDUA 4ZE5A 2FBJH 3UJRA 5JPMC 1DWFM 1WCGA 5CF3A 5F97E 3CDGA 4KNSA 3L9BA 2JIWA 2R0KH 4F91B 1G6RB 2KZBA 3OB0K 1J6OA 4X6FB 4NI8A 4V1XA 4M8QA 3UJEA 5JIWA 5TFSL 5TF1H 4ZRGA 1DTUA 2WV3A 4GSXA 5IW6A 1I2NA 1XGEA 2KAUC 5T5NG 4XD5A 1A7PL 3MACH 3ECVA 1G9HA 2YDSA 4QG6A 1U8HA 3H55A 3R18A 3NRQA 5HMDA 4JY9A 1T1WA 1E5UI 2C7FA 2FWOB 3BVVA 4ETYA 1O1HA 4J12A 2HK1A 2J8UF 4BINA 1FA2A 4KWOA 3OZMA 3DNKA 4NSBA 4N0RA 2KQMA 3TUUA 1Q65A 1NGXB 3NA9L 3EYVA 5C9JB 3HQNA 1RL1A 2DEWX 2HLFD 3FO2B 4HHAB 4W4NA 4F9LC 5JDSB 3TDFA 2RAGA 5C2GA 4N1CA 3IN2A 3SE3A 2GGJA 5K7JA 2CGZA 3WLWC 2G3JA 5AQ0A 4P2RA 3V95A 4UC5A 2GSIA 2EYTA 3JV6A 3L21A 3WUEA 5A8PA 1A21A 2J72A 4GO8A 4URKA 1LWJA 1XIBA 3TCXA 4DPAX 5CCJA 5L0QB 4KIEA 4LGPB 3GLDA 4FMKA 1GS7A 2IBZY 2OL3B 3DX5A