3WY1A

Crystal structure of alpha-glucosidase
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
535
structure length
535
Chain Sequence
NMMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLDNMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSRPENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEVASDLPVAHFTATRDGSTLTLPAYQAAFMQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the alpha-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism
pubmed doi rcsb
source organism Halomonas sp. h11
molecule tags Hydrolase
molecule keywords Alpha-glucosidase
total genus 193
structure length 535
sequence length 535
chains with identical sequence B
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3wy1A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wy1A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3wy1A02
2AAAA 1SYTA 5F7UA 2A3HA 1KCKA 1LF1A 1UWUA 5I23A 4AY1A 2E9LA 2QMKA 3ARRA 3N15A 1PAMA 2W66A 3CLWA 3POCA 3THDA 1KXTA 4P8WA 3UR8A 1V6YA 4Z2GA 3II1A 1R7OA 3KLLA 1R86A 2EPKX 1OCQA 1MQQA 5C8BB 1V02A 1HIZA 4PTWA 1XCXA 3I3DA 2VX6A 3VD4A 4JKMA 4AD1A 5BXRA 4E2OA 1V3IA 3FY1A 2WAGA 1ZJBA 1ZBCA 3CZKA 1JDDA 5CSUA 2WKGA 3H55A 3MV01 2V38A 4OIFA 4KRTA 2DGAA 1EO5A 2VOTA 3EDDA 1G0CA 3LRKA 3ALFA 1G9HA 1BTCA 2DIJA 1US3A 2O9PA 4Z2JA 1J18A 1G1YA 3WY4A 3BVUA 2BV9A 4TTUA 3VDCA 4JIEA 1KXVA 1V02E 4MADA 3W0KA 2XGBA 2XVKA 3VTRA 3WFZA 1ZBWA 1UH3A 4HMCA 3CPUA 2EABA 1UKTA 4GQQA 4AXNA 2XSBA 4MNKA 3AS2A 1ISXA 3BLPX 3BVWA 3CHDA 1U33A 1CTNA 3GH5A 3L4ZA 1HKIA 3SCPA 3FAWA 1D3CA 2OSWA 1GOQA 1WDQA 4Z2LA 4QLLA 5IDIA 3SIMA 3AS1A 4TUFA 1QHPA 3EJPA 2YL5A 1E72M 3A4WA 2D23A 3G6LA 1O7DC 2CIPA 1VIWA 1PJ9A 3DX0A 1XC6A 3WL0A 3OA5A 4A3YA 1UZ1A 3WUEA 2Q8XA 1E6XM 3A4XA 4IM4A 3NYDA 2WANA 1C8QA 3APGA 3QOKA 2VQUA 1UR9A 1DWIM 3B9DA 4GZIA 3VD9A 3UG4A 1GQJA 4P7OA 2WSPA 3SURA 1EHNA 1IZKA 4MB4A 2EBNA 3AHXA 1VBRA 1UG6A 2NSXA 4BQ4A 2ZXAA 3WUFA 4GXPA 1LL7A 1KB3A 4ZENA 1UUQA 2DSUA 3AQUA 3VNZA 2OSYA 1HXKA 2E8YA 2XJ7A 4FNTA 2PWDA 1E73M 1NP2A 3EMQA 5AYIA 2VVNA 3QOMA 2YA1A 1EHAA 1MXGA 4B15A 1U2YA 2EPNA 1W91A 5A2AA 2FH8A 1E1EA 2WVSA 1C92A 3BAWA 1MQRA 4UQ9A 2D0HA 3THCA 2BHYA 4DM1A 4UFKA 2BS9A 2J7EA 3U7BA 1PIGA 2XHYA 3RM8A 1TCMA 5D9OA 4MJ4A 2JF7A 2J7DA 1IV8A 1E5JA 5A6BA 2WCSA 3AXXA 2QPUA 4C7DA 2D3LA 4TVCA 5FOOA 9CGTA 2V5CA 4M56A 1CXEA 6TAAA 3RJYA 4J3WA 3ZMRA 1UR8A 5FCZA 3WDPP 4PSRA 1UWRA 3T2OA 5E6YA 1GQKA 1LG1A 5A1AA 2XUCA 2C7FA 4CKQA 4E8DA 2QMJA 3SCSA 2XIBA 1CXIA 3VD7A 3WQWA 1ITCA 2J25A 1V3JA 3AI0A 5E70A 4CVUA 3AIWA 3DX2A 1B3XA 4M80A 4D6FA 4MTVA 4ZXOA 3AXHA 4IUGA 1BVZA 2JEQA 4WJXA 1QI4A 4LYPA 2YLAA 1JG9A 3WNNA 3WF2A 3A21A 1HJWA 5E6ZA 1CEOA 1C91A 1UR2A 4W7VA 3AIQA 4GZJA 1GONA 3PBGA 3CTTA 3BUDA 4J3SA 4HOWA 2E8ZA 3RM9A 1QX1A 2FGZA 4UFJA 2BHUA 1WDPA 4PMUA 3G6MA 3SUTA 1UZ4A 5A2CA 2GK1A 2XTKA 2F1AA 4MPKA 3N18A 4UOJA 1U30A 1E3ZA 2ZUVA 3BAJA 1B90A 4HMEA 2XPKA 1WO2A 3AS0A 1LJYA 4BQ2A 5HNNA 1VENA 4WSKA 2ZX5A 4CU7A 1DWAM 4UQCA 2F7OA 4Y7EA 4M81A 3SCRA 3VILA 3NSMA 2HVMA 1W9UA 2VCAA 1CGWA 3U5YA 3HU7A 4LQ1A 3WN6A 5HOSA 1BG4A 4JFVA 3AYRA 3B8SA 3WH8A 2WHJA 4ACYA 2UY2A 3FHQA 1C8XA 3ZIZA 1XSKA 1SZNA 1PS3A 4UTFA 1JZ8A 3MUAA 5IHSA 2D0GA 1X6LA 3POHA 2QLYA 5HPCA 5CQ1A 3EJSA 3U57A 2DT0A 1JD9A 1E4LA 1FFQA 1HP4A 3MS8A 3D50A 1R87A 3LPPA 3CUFA 4W84A 2BY2A 4FNUA 3WIJA 3UR7A 3WSUA 1ZB5A 1E43A 4UR9A 3VMNA 1JGIA 4Z2KA 1CXKA 2PI6A 1DWGM 3EDEA 4UQBA 3CZJA 2ZWZA 2E3ZA 3L4XA 1H0GA 1Y7VA 1ZJAA 2VTFA 4YN5A 2VX5A 1XV8A 5M3WA 1OIFA 4UFMA 3KL0A 1KGUA 3MV11 1GNXA 2G41A 2EPMX 1R47A 1I75A 4MB5A 3GBDA 3KE0A 3JUGA 3BMVA 1ISZA 4X0VA 5D4YA 1WE5A 5GNYA 1W3KA 4H8HA 4P7LA 1FH9A 4D1IA 4UQDA 5CG0A 3HG5A 4EK7A 3AFBA 2WHLA 3LMYA 1FFRA 3QR3A 1UR0A 2WC7A 3WEMA 1UR4A 3GTNA 3T0DA 4UOQA 1E71M 2CKRA 5KZ6A 1L0PA 2PB1A 1JI1A 4D6GA 3T08A 2VRQA 4PN2A 4TX6A 3L4YA 1TQVA 4EANA 3IK2A 3B9AA 4B16A 2CETA 5TD4A 5KEZA 1W9VA 3T0AA 3AMKA 5CLTA 1A3HA 3ARWA 1GOOA 4C7GA 1UWTA 2JFEX 1E1FA 1X1NA 3N12A 1HF6A 1UQZA 4Z2HA 1V08A 2YOCA 1GORA 5A6AA 1HJSA 4Z2IA 1V6VA 3KLKA 3WD4A 5ABGA 3ZJ8A 4KGLA 1UD6A 2WVVB 4JFTA 4WKAA 1PBGA 4W8BA 1EDGA 2J74A 3AMLA 3TTOA 1HKKA 3EDJA 5JUVA 4CN4A 1YQ2A 4MNJA 2VI0A 5A8PA 3UG3A 4W86A 4GO8A 2YBUA 5M03A 1AVAA 3ARYA 1H49A 1TA3B 2Y5EA 3BMWA 1IT0A 3VGHA 5ABFA 4MNLA 4AWEA 1BGGA 1J0YA 4FNSA 4BZYA 3DYOA 4N42A 5I6SA 3CV5A 3D52A 1PZ3A 1CXFA 2OWXA 2ZUWA 1L8NA 1R33A 4B3KA 4EKJA 2J7CA 2WHKA 2W5FA 2DT2A 4UFHA 4UQEA 4CN6A 3RMEA 1NOWA 4CUCA 2BY3A 5JIWA 1NOUA 3KEHA 4GPNA 3D3AA 1VAHA 4W93A 1JZ7A 4D71A 1TG7A 3LPFA 3HN3A 1PX8A 2D24A 4W85A 1JZ5A 2VZUA 4NRSA 1OT1A 2NT1A 3VO0A 4H2CA 1CZ1A 1UD3A 3EYPA 1JDCA 3MI6A 1D7FA 3VIOA 1TZ7A 3OZPA 2Y24A 4HU0A 4PYSA 3WF3A 2IXVA 1V0NA 2DSVA 4HPGA 3WMSA 3WH7A 2DT1A 3MSDA 2EADA 1QW9A 4J3TA 2JEPA 1GOMA 1J0JA 1O6IA 1UASA 4JCLA 2J7FA 1CECA 1JFXA 2ZX6A 4AZ7A 5E0CA 2X0HA 1KR0A 1HNYA 2W4XA 2YDSA 1VFMA 3WH5A 2EQDA 3EMZA 4NXSA 4AEFA 4CD4A 3WNOA 3IGUA 2F18A 2TAAA 2BVTA 1VFOA 3GXTA 1E40A 1V0KA 3HZ3A 3F5LA 5DMYA 2YDRA 1K6AA 2PBGA 1C90A 1R46A 1QHZA 1ODUA 4J3XA 1V6WA 2J7GA 2E4TA 3L4TA 1G01A 1MFVA 4UFIA 1JZ4A 2VQTA 4FNRA 4TXEA 4W5ZA 3GDBA 2CNCA 4MJ2A 3SEPA 4CN1A 2IXUA 3ARZA 4RE4A 3M07A 4P7NA 1BYBA 4HP5A 3WDQA 1LG2A 1UKQA 5LA1A 3OGRA 4XX6A 2ZUNA 3DYPA 2D2OA 2PWFA 2YLLA 2GSJA 5GNXA 5JBEA 2VZVA 1C3FA 5IFTA 1R7AA 3BGAA 4OKDA 2RGMA 4WF7A 1R85A 1KWGA 1HJXA 3W4RA 1OM0A 3MKKA 5BCAA 2V3FA 1FH7A 2WVTA 2ZE0A 4JFSA 2GJXA 3U7VA 1CBGA 2VX7A 3DC0A 3VIGA 3W38A 1B2YA 3RCNA 1EOKA 3AMCA 3LX9A 5BYWA 2BY1A 3AIVA 3OLGA 2WWCA 1H3GA 1UYQA 1VEPA 3PZ9A 1EDQA 1HJQA 3ZJKA 1JNEA 4KH2A 3PZQA 4XV0A 2X05A 1KGWA 1VBUA 1H5VA 1J10A 4HTYA 1BLIA 2WC4A 4TVUA 1TQTA 3VIHA 1D2KA 4HPHA 4CVWA 2VRJA 1K9DA 4M8UA 3FHAA 5I2UA 1AQMA 4YHEA 3WDHA 3WNKA 1WDSA 2WKLA 3GNOA 2J77A 5E0FA 3EDFA 1SMAA 1JZ3A 1W1YA 1GJWA 1X6NA 3E1F1 1BHGA 1UA7A 4D6HA 1XHGA 2DSZA 2AOSA 1H41A 1B3ZA 2XYLA 2F7PA 2XG9A 3IJ9A 3UG5A 2D20A 4XZWA 4AYGA 3NDZA 4F79A 3VSTA 1BQCA 1OGGA 4GQRA 1W3LA 3SUVA 2CXGA 4PMDA 4P8XA 3PZNA 3LXCA 5E9AA 3AIRA 3OG2A 1QI0A 4PTVA 3ZJ6A 5BRQA 4BF7A 1UH2A 1KQZA 3W25A 3VD5A 3AZRA 1K9EA 3VIJA 2DDXA 2J4GA 4JHOA 1BF2A 3M6DA 4TOQA 2F1BA 3VM5A 2W61A 1ISWA 1FA2A 2XM1A 3WF4A 3UETA 1OSEA 2VURA 3CC1A 4PMNA 5I5RA 3BAIA 1OD8A 4PMXA 1LWJA 1JF5A 2G8ZA 2WB5A 4EAMA 1MW1A 2ESCA 4F9JA 3L4WA 2WK2A 2X8RA 3WQ4A 1BYAA 4OOZA 5A94A 4CD5A 1E0XA 1I1XA 3F4VA 1CPUA 1UWIA 5EBAA 4AZ5A 2VRKA 5A69A 2XVPA 2YKKA 4LXFA 3TV8A 3OIHA 5FL0A 4CD6A 3WNLA 1GJUA 2VC9A 3TTQA 1MQPA 1NOFA 3W26A 3WQ6A 3W28A 3FXYA 5HDRA 3ARXA 3LXAA 1OWQA 3VGGA 4M1RA 1KBBA 2ZUSA 4QLJA 1QI3A 3GXPA 1HVXA 1LLOA 2XGIA 3WD3A 1B0IA 1KTCA 1XSIA 1HL8A 3VSVA 4W88A 5JBFA 1TVNA 4PMVA 1NP0A 4RL3A 2O9OA 3CGTA 4PTMA 3VSUA 1KXQA 1HP5A 5BROA 4HA1A 4GIAA 3BSGA 3TONA 1WKYA 3VGEA 1GVIA 3I3EA 5GPRA 1W3JA 2IUZA 3BUQA 1JYWA 4H8UA 1ZS2A 3MANA 2MANA 1XH0A 3BXWA 2BNJA 3VVGA 4OBRA 1QPKA 4NZFA 1DHKA 4A3HA 1E70M 3OGVA 1H4PA 1EXPA 3BAKA 1VFUA 1TQUA 2WM0A 1KWKA 1JZ2A 2NT0A 3ARSA 1TMQA 2E9MA 2UY3A 4S3JA 2EJ1A 2PWHA 3VD3A 3CZGA 5C71A 4X9YA 4HZ8A 2NW0A 3SUSA 2BFGA 1JAKA 2A3BA 2WW5A 2O9RA 3NJ3A 1CWYA 2QPSA 4PEEA 4EE9A 3BC9A 3WL1A 2F7QA 1WNOA 2W62A 2ZXDA 3N9KA 3CZEA 4WKFA 4L4PA 4B9YA 4QCFA 4WK9A 1M7XA 4CU6A 2WXDM 3PZVA 1PPIA 3DHPA 1B9ZA 1HTYA 2DT3A 1WB0A 2X2YA 3GXNA 1HKMA 3NSNA 5A3HA 1UKSA 4H8VA 4BQ3A 1QBAA 2J62A 3IANA 1VEMA 2Y8KA 3GH7A 5ABHA 3OBAA 2GUYA 3VGBA 3NCOA 1H0IA 5GNZA 1LL6A 4MB1A 2OW6A 2VR5A 1Q6EA 3PZMA 2J7BA 5D8WA 2XFFA 1S46A 2YFNA 2ZUUA 4PMQA 1EH9A 2WHMA 2W63A 2VCCA 1XSJA 1A47A 3CBWA 4WLCA 3AJ7A 1E6RA 4M82A 3PZGA 1DEDA 1LQ0A 1FHLA 2WMIA 1V6XA 4FNPA 1CENA 5BWFA 1US2A 4QCEA 5A6LA 4AZBA 3KL3A 5CGMA 3RO8A 1EIBA 3ZO9A 3SCOA 1CNVA 5ECUA 4A4AA 5HXMA 1B3YA 4AIEA 5AC5A 1BAGA 2VT0A 3W27A 1QNSA 4P7QA 1RD6A 1C7TA 1V3LA 2WVUA 3N1AA 3MSGA 1GQLA 2YL8A 2GDVA 2CBVA 3QHNA 3QHOA 4ZEPA 3VIPA 2WLZA 1HL9A 2VR4A 4D6IA 1E6SM 2VVSA 4U31A 1VB9A 1NWTA 1UQYA 1QWNA 3MMUA 3PZUA 4OOUA 5A6SA 2EACA 2UWFA 4IPLA 3CUHA 1WP6A 1WZMA 5M5DA 1CDGA 1NWRA 2XFRA 1GOKA 2J8FA 1IZJA 3H54A 4W8LA 1HJUA 2G4FA 3A47A 1BPLB 1QI5A 2ZXQA 3TP4A 3TOPA 2DSWA 1XCWA 4ZE5A 1ESWA 3VOCA 1TFVA 1B31A 4UZUA 4DO4A 4F66A 3WMBA 1OB0A 2WMJA 1P6WA 3GXFA 3W6LA 4HOXA 3WF0A 1TR1A 5IHRA 4E8CA 4DO6A 5ABFB 2J75A 3BLBA 2WSKA 1Q6FA 4AZHA 3TA9A 3AZSA 5EFFA 1WAWA 4ATWA 5FD0A 1LL4A 4UQAA 4PMYA 1E6ZA 1ECEA 1SFSA 3VU2A 2E40A 1M01A 1J0HA 2J79A 1VJZA 2VJXA 3VPLA 4PCTA 4D1JA 1AQ0A 2BY0A 1H09A 1RP9A 4W8AA 3W37A 3W29A 2DIEA 1E55A 1RPKA 1MW2A 2CBUA 4W89A 3RM4A 2WC3A 2WZHA 2FE0A 4FLOA 3SCTA 5CXPA 1BYDA 3ARQA 4NZJA 3BAYA 1WDRA 2W67A 4MAZA 1HX0A 4H7VA 3VX1A 4ATLA 2YA0A 2D0FA 2CHNA 2FGLA 1J12A 2OW7A 1XRVA 1UH4A 1B1YA 1G5AA 2B31A 1M04A 3SCQA 3WEZA 2C8NA 2YL6A 3EJRA 2ZWYA 4URIA 1WZKA 3L2LA 4AISA 5HBFA 5GQBA 1JYXA 4D6EA 4ML4A 1JYVA 1XD0A 3ZOAA 3NDYA 2V3DA 4FNQA 3CHCA 3IAPA 1KQYA 1UOKA 2OWWA 4UOZA 2ZUMA 4P8VA 2XIIA 5DF0A 5A8QA 4AIUA 2ZXBA 3BVTA 3L4UA 4DUVA 4AZCA 3K1DA 3T0BA 4V2XA 5A8OA 1EDTA 2JF6A 5ABEA 4J27A 5I24A 3A5VA 1DWHM 1MW3A 2X0YA 4QLKA 5EMYA 3K46A 1NQ6A 1OIMA 4JFUA 1FH8A 5LA2A 5IFPA 3PTQA 3F5KA 1J01A 2CYGA 3AROA 4W7UA 2XN0A 2YBTA 1W9DM 4W7WA 3VX0A 3ZT7A 3AIUA 2WMIB 3LPGA 1E4NA 3ZSTA 4U33A 3WDRA 1VJSA 2FHBA 1CGXA 2C0HA 2Y2WA 5I0DA 1V6UA 3A23A 2YIHA 5CLWA 3A24A 1CGUA 3WD1A 2CBIA 3NIYA 1HN1A 2XWDA 3DX3A 3W24A 3FW6A 4KMQA 4P8UA 1FP8A 1MXDA 4V28A 4AZGA 2BXYA 5CJ5A 3WDJA 1EQCA 3SUUA 5JBDA 4JL1A 4JKLA 3BLKA 2JIEA 3O2LA 4IISA 2YA2A 4W87A 1V3KA 3K8LA 4KGJA 3VDBA 2AMGA 1W1TA 3LXBA 1N82A 1MFUA 1UA3A 1GW1A 5AYBA 4ACZB 3ZM8A 4AD2A 4DWSA 3AXIA 1UKOA 1KGXA 3SCNA 4QDMA 3MUZ1 2WCAA 4DUWA 5FL1A 3WY1A 3ZSSA 1GVYA 5EFDA 1CGVA 4D72A 3GNRA 4BA0A 1VEOA 3AS3A 1V03A 4JL2A 4AD0A 4AMCA 3A6OA 5D9NA 2ALWA 3DYMA 4JHZA 2WMFA 3N11A 5A6MA 4NXKA 4MB3A 3T2QA 3EDKA 2G3JA 3GYCA 2EAEA 3M7SA 3PTMA 3QGVA 2PC8A 4AMWA 1K9TA 1XYZA 4DUXA 4V27A 1VRXA 4DWSB 3EJQA 2YL9A 5IXEA 1E0VA 3WBEA 2CKSA 1H11A 2DEPA 4M24A 3N17A 2ZOXA 4KRUA 4H41A 3VDHA 1AMYA 1ISYA 3EJUA 1J0ZA 1DWFM 1WZLA 1CYGA 4W5UA 4OUEA 2JALA 2GK1B 5FKYA 1TQSA 2G3IA 1C7SA 5I77A 1K9FA 1QOXA 4HOZA 5CSYA 2VX4A 5A95A 2VZOA 1TE1A 3PN8A 3GXIA 1W2PA 3AHZA 1JIBA 3WD0A 3VIKA 2WMKA 3LRLA 1HKJA 2WZIA 2PWGA 1H1NA 5LYRA 3DDFA 1F4HA 4GI8A 3H53A 3ZJ7A 2Y8VA 4JAWA 4J28A 4HZ7A 3TTYA 3PZIA 1CGYA 1E6QM 2EPOA 3D4YA 1EGZA 2Z1KA 1JF6A 3O6AA 4E4PA 4NI3A 2OYKA 2CITA 3L4VA 3S5ZA 2G3MA 4R27A 1ISVA 4FK9A 3RDKA 3WKZA 1CLVA 1AQHA 1Q6GA 3O9NA 4YHGA 3DX1A 2EXOA 2YFOA 1W1PA 1OT2A 1GHRA 1QBBA 2WBKA 4HMDA 3PZTA 4MNMA 4OZOA 1JI2A 3M46A 2X2JA 5CPSA 3L2MA 2GDUA 4LYQA 1W9PA 2DH2A 1GOWA 5LA0A 2VZSA 7CGTA 3OLEA 2F8QA 1XD1A 1E5NA 3VGFA 1B3VA 3ALGA 4D6CA 1Z32X 4GI6A 1QNQA 3CUGA 3S2CA 3UCQA 3FAXA 3IAQA 1M53A 2DSKA 5E1QA 4N0RA 1UD4A 2X09A 5D8ZA 2O92A 3MMWA 1OGSA 3AYSA 2CERA 2OWCA 3RILA 3AZTA 3A4AA 2VMFA 3VIFA 3CIVA 4U2YA 5A8MA 2WYSA 1W3HA 3AISA 1ODZA 1NM9A 3DHUA 3HG4A 3HG2A 1KR1A 4GZEA 5CGTA 1GCYA 1E6NA 2CPUA 4J7RA 2XVLA 4HU8A 4PSPA 3WH6A 1JL8A 2V3GA 3AIBA 3ARTA 2WNWA 2HISA 3HJEA 1XH2A 2WLYA 3OGSA 4K68A 1TVPA 2PBOA 2OLHA 4JCMA 1T0OA 1FHDA 1CXHA 4AZIA 1V3MA 3VGDA 1GZJA 3GH4A 5CPTA 3WENA 3GBEA 3D4ZA 5BXSA 3PTKA 3MUIA 3BVVA 1PEZA 4D6DA 3VNYA 3CZNA 3BCDA 1J0KA 7A3HA 3SCUA 4XZBA 4B9ZA 2CESA 5DFAA 2A3CA 3AICA 1QI2A 4WIWA 4AZCB 4CCEA 5I79A 1C93A 4AD5A 1CLXA 4UNIA 3CZSA 5D9MA 2OYLA 2CCRA 3A3HA 5D9PA 3WQVA 3W81A 1WCGA 1W2VA 1PX4A 1QHOA 1UD8A 4LPCA 1EA9C 3CO4A 3KZSA 2XM2A 3W6MA 1BVNP 1Q4NX 3CMJA 3BUIA 3BAXA 1GOIA 2XFYA 3ECQA 4DWSD 1E3XA 3KL5A 1TUXA 1KFWA 2OYMA 1B3WA 4QAWA 1QNOA 1LWHA 3D51A 2E0PA 1J0IA 3ARVA 2WMHA 4UCFA 1QW8A 2XWEA 3VM7A 1SR0A 1I1WA 5BXPA 4F8XA 5A2BA 2J7HA 4AW7A 1VF8A 3OLDA 2DPEA 4R5EA 3WNMA 3WF1A 4UZSA 3IJ8A 4S3KA 3MMDA 1JXKA 1PIFA 1HJVA 1R34A 4GI9A 1E15A 1UD5A 3ZR6A 1RP8A 2WWDA 5AC4A 4J3UA 5BXTA 1W1VA 1BYCA 2YJQA 4FMVA 3HMCA 3NUKA 3K4DA 4AMXA 3AHYA 4OJYA 3VUPA 3WH9A 4CD8A 5C70A 4AYSA 4U2ZA 4FLSA 4HZ6A 3IJ7A 3W82A 4FLQA 1NWSA 4ATDA 1SMDA 2A3AA 2WZEA 4B3LA 4C7FA 3K8KA 3CHFA 4WKHA 1CIUA 2BXZA 1DWJM 2X2IA 3MU7A 1UKPA 3VKKA 3S6TA 3ZQ9A 1QNPA 1E4IA 3EBVA 1M03A 4GKLA 1DTUA 1NH6A 3WEOA 1OGBA 4CU8A 2X2HA 1UD2A 1JZ6A 1JYNA 3VMOA 4UFLA 3OLIA 3EJTA 4NF7A 1MW0A 3MO4A 1KCLA 3RPMA 4FLRA 5BRPA 3K4AA 5DT5A 2F61A 2UY5A 4JFWA 1XH1A 1BSIA 2J47A 3LRMA 3WUBA 5A6KA 3CZLA 4HA4A 2YDQA 1R8LA 3ARPA 4JZ5A 3CMGA 4PBGA 1NARA 4FF5A 2V5DA 3UERA 3CZ8A 2F7RA 2JE8A 2D1ZA 1O7AA 3BSHA 4LYRA 5DEZA 3VMPA 7TAAA 4F9DA 4PMOA 3DECA 1GQIA 2QHAA 1GHSA 2GJRA 2DH3A 4YPJA 3B9EA 2XN2A 1QNRA 1XYFA 2D3NA 1EO7A 3BUPA 3UEQA 2ZUTA 6A3HA 3BCFA 4XUYA 1W32A 1V0LA 1W9BM 1KTBA 3SCWA 3VIMA 4CCCA 4D6JA 6CGTA 1ITXA 2BVDA 3ZR5A 4Q22A 3BUBA 4LX4A 1E0WA 3T2PA 2BHZA 1W9XA 3TTSA 3S5YA 1KBKA 1WPCA 1TQWA 2A3EA 2RGLA 4XB3A 4QFUA 1F4AA 3J7HA 4QP0A 1TA3A 2VO5A 2D22A 2DQXA 5FIPA 5AY7A 4CD7A 1DP0A 8A3HA 3W53A 2E9BA 4PMRA 2ZIDA 1HWWA 4ZE4A 2VNCA 4MAVA 3U5UA 2XN1A 4P7RA 3AIEA 2WCGA 3CH9A 4MDOA 8CGTA 4X0NA 4M29A 3AHTA 3WMCA 2WMGA 3NSXA 3AHVA 2WVVA 1CXLA 3WQ5A 2FHCA 2QF8A 3WY2A 2EEXA 4AIOA 4H04A 1V0MA 2CBJA 2UY4A 2ZICA 1J9YA 2XVGA 3GZAA 4TX8A 2XSAA 2VL4A 2GVYA 3WUGA 2EO7A 3GM8A 3WD2A 2J78A 2ZX8A 1FP9A 3WQ8A 1E56A 2WBGA 1HT6A 4U3CA 2VZTA 4PCSA 1FOBA 4L4OA 1V3HA 4BQ5A 4JKKA 4BS0A 4NRRA 4NZCA 4J3VA 3AMGA 3N04A 3VIIA 3FN9A 1HXJA 4GO9A 1HVQA 4ZFMA 3VINA 4AZ6A 3SUWA 1WZAA 1EOMA 1E6PA 1MYRA 5DO8A 1Q6DA 4IPNB 1KXHA 4RE3A 4CGTA 4RE2A 2V3EA 2FHFA 2QV4A 3MUY1 4AD4A 3LPOA 2Z1SA 3ARUA 3WNPA 4U5KA 3PZOA 5DT7A 1MVYA 3F5JA 1G94A 3I3BA 3CHEA 4KWUA 2ZX7A 3D5HA 2WPGA 1RH9A 2IGTA 3SCVA 2GJXB 4U5IA 3DDGA 3VDAA 2D73A 3ZT5A 1BFNA 3BH4A 1XGZA 2EPLX 2J8GA 2VCBA 4OBSA 4PTXA 1Q6CA 1PZ2A 2VUYA 2OSXA 3BVXA 4PRWA 2PWEA 2CEQA 1OBAA 3WDIA 3AMDA 2O9TA 4HA3A 2BVYA 2W92A 1GUVA 1ZBKA 1ZL1A 1ZBVA 4DWSC 1PX3A 2Y4SA 3CUIA 3GXMA 4WSJA 1VFFA 1BG9A 5I3DA 1OD0A 1JAEA 5M17A 2JIWA 3UESA 5A6JA 2FYVA 1JXJA 1UWQA 3QHMA 3WY3A 3ZT6A 4PUEA 1JDAA 3KWXA 1BGAA 3GXDA 4AC1X 5A6BD 4NX0A 1UWSA 1E4MM 4AEEA 4Q7NA 1YHTA 4NSBA 3OB8A 1H2JA 3N13A 1UR1A 2XVNA 5E09A 1JD7A 2X1IA 5I78A 4GINA 1E9LA 4ACZA 1JFHA 3WELA 5EB8A 4TTGA 2F2HA 4U3AA 3PHAA 3AOFA 4DO5A 1UHVA 2ZX9A 3GNPA 2GJPA 5CZKA 2CHOA 2FDMA 5A8NA 1MWOA 1QWUA 1CGTA 5CPQA 4PMZA 3OZOA 2GFTA 2FH6A 1J11A 4MDPA 3RJXA 1JNDA 1OINA 3FNDA 4TVDA 3CUJA 4AD3A 4BCEA 5JIPA 1C8YA 4ZXLA 3RIKA 1GPFA 2PF0A 3K8MA 3EMCA 1R75A 4OGZA 3A22A 3DX4A 1QVBA 3T09A 1EQPA 3WBAA 4LGXA 2G3NA 3WFLA 2W91A 1NWUA 1B30A 4CCDA 4DM2A 4PUDA 1ZU8A 3HG3A 5HPOA
chains in the Genus database with same CATH superfamily
3KG5A 4Y9BA 1TMHA 1LO3L 3D25A 4QRBA 1MHHA 5FF6B 1Q7QA 4OI7A 1SYTA 2A3HA 3R1GL 3SJ3A 2DQGL 2WXKA 3GHSA 1C9WA 1LF1A 3DOHA 1KTDA 4K3EH 2ZAIA 1UWUA 4MFEA 4AVFA 2PPEA 3ES6B 4LDOB 4J1UB 3KNBB 2BPBA 2EKSA 1XGUB 3K6SA 1OGAB 3QUZD 4O8RA 5LDUA 4O9HL 3LCWA 4Z7UF 4TNGA 3BLFA 4JLRB 3IVUA 2UXTA 5ABZA 1PAMA 3VNDA 1KBWA 3CLWA 4PJCF 5D4JA 3S6DA 1OM3H 5DWPA 3KS5A 3RPDA 2P5EE 5D32A 2JGQA 4KI5C 5D1ZA 3PPSA 5TFSL 5ETUA 3D05A 2VISA 4E41B 3II1A 1R7OA 4MQTB 3SPHA 3TBWA 3T3MF 1ETJA 1HKFA 1S78C 2UV3A 2VWEE 3BZ5A 4FXGB 5D72L 4IGBD 5DHMC 1DPMA 1V02A 2A6KB 4BE6A 1HIZA 3QWRA 2ZE3A 2GT9A 3GSWA 4XT1C 4FPSA 3ENLA 1MLCA 4YTQA 1PZDA 2Y5QA 1AC6A 1ZV2A 2P4AB 4JKMA 4YBLC 4XPFH 3WNJA 4JBSA 2CBOA 3PK7A 4GG9A 4AD1A 5C3LD 4E2OA 4Z5RA 5F1VA 5HUPA 4E2BA 5L88L 2WAGA 3IDXL 4MFHA 5ACZA 3SBFA 1ZBCA 3UTTB 3EBIA 1R5VB 1Z0NA 4PRDA 3BSMA 5EZLA 1G6RB 4UT9A 2IBZX 4PJAB 3CIWA 2YDAA 3H55A 1EUNA 4FS9A 3B7UX 3EX2A 1JQXA 4O4VA 4U10A 4OIFA 4V2CB 4XE0A 4FNLL 5D1XC 4AYBA 3DBNA 4KRTA 5D7LE 4Q33A 5HHNA 1ZPUA 5FOBA 3DGGA 3RGVA 4JZNA 1E6OH 5DQDL 1KV8A 1OZMA 4PRID 4EIZC 3WTWA 3V95A 5I15H 1G0CA 4U3SB 5FXCH 2YOAA 3L95A 3SDAD 2NTFA 1PCWA 3P3SA 3UU0A 1OX4A 1A7NH 4V2BA 2IKGA 1XSOA 3W1RA 2C9SA 2VXVH 1NFKA 4Z2JA 4TTUA 1G1YA 3WY4A 1ZTXH 4TTDC 2DQIL 5IBXA 1KYFA 1LDPH 4EI5A 3IS1X 4YHZL 1EZLA 1F97A 3I6KA 4JIEA 1EGJL 4GXVH 4U6VL 3BV4A 3BWZA 1E5UI 3T3PF 1V02E 2JQMA 2ZYHA 5DEJA 5DXWA 2FTAA 4ZW8A 3U4FA 3V0WH 2PP0A 2YLHA 1XGYH 2EABA 3DCPA 3QZWB 5E9DD 4GQQA 3KP1A 4CNOA 2FX8L 1M71A 3AUJA 2XSBA 3F03K 3CH8A 2B1AH 4LPVA 4NO0D 3LPWA 2W9MA 4MNKA 5HR7A 3WBXA 1BKHA 2FYYA 4QY8A 5KVEL 2Z93B 4FF9A 2V6AA 4DAGL 4PJ8D 3GNML 1NBYA 1EUUA 4YHIB 4P5RA 1N8ZA 2BNQD 4PW4A 3PREA 2A2IA 4XX1E 4GAYA 2VXNA 1XGDA 1M42A 4IXXA 1N59A 4XISA 5J12B 1HKIA 3SCPA 1BBDL 4JO8A 4EWND 1D3CA 4K5LA 2OSWA 5BWAA 4PUBH 1R5YA 4OT7A 1WDQA 4Z2LA 3SIMA 1D6VH 5IDIA 1ZSDB 4I3SL 4JY5H 1TQXA 4TUFA 1QHPA 4KUCF 3TO4D 1TMCB 5F4WA 3PFUA 2HPOA 2DD8H 2WXRA 3A4WA 1N5AA 3MUJA 4AH2B 1FPTH 3SKNA 2D23A 3M4HA 4S3FA 3T77A 4NN6C 1X4ZA 4A66A 1UC6A 3K1KC 3LEVH 4C6LA 4MQXC 3SIZA 5E8DH 1VIWA 1WIOA 1PJ9A 2RD0A 2YAOA 2INFA 2EILB 1IT9L 4MZYA 3P3UA 3C6LB 3W0WA 1SFJA 5U4NA 5IMLB 4O17A 1QSEE 4NKQB 2CXEA 1UZ1A 1AH3A 1RA5A 3ZL4H 1F3TA 1E6XM 2GI7A 3UZVA 3SE3C 4JRYD 4R4BB 1ZGLP 3RX9A 2JF1A 3HV8A 5C08D 2QJNA 3O2DL 1TZ8A 1PDKA 2QV2A 4XX5A 1HUVA 2VQUA 3RNDA 3UP1A 5GS0D 1BGXL 3RI5F 1UR9A 2H0PA 2B3RA 5BS0B 1DWIM 1K4DA 4OV5A 5L2JB 5ABDE 3VD1A 1N3NB 3QC5X 2F74A 4MGXA 4YSRA 3LHAA 3PP4L 2FX9H 2VEFA 1BQLL 3DPBA 5FA4A 4AK1A 2FZ8A 3PWLA 3SURA 1IZKA 4MB4A 4H2HA 1ZVYA 3UROR 1UP2A 1G7IB 2XTJC 4ODTH 3NTCL 4WKZA 2Z26A 4QQ3A 3LKSB 1ID2A 3BXNA 3W6YA 3WLLA 1FGVH 1UG6A 4BQ4A 4Y5VC 2ZXAA 3PP3K 4DBUA 3EAKA 4D9RD 3FONA 4XBKA 1KB3A 2DSUA 4LF1A 5C0RL 3KPSE 3ZTJG 4IIBA 4EUPH 3H2PA 5KYYA 3M16A 3PG9A 1D9KD 2N3JA 2XSXA 3V1PA 2E8YA 2NY7L 2HCZX 2O6FA 2GFBB 1EJVC 3EMQA 4D0CA 5HDOA 3C2RA 2VLRD 3BPCA 2VVNA 1LRTA 3QOMA 2YPKB 4LC6A 1ZNNA 2VC6A 1U92B 1DORA 3LU2A 1W91A 1ZLUK 2FH8A 3ZE1E 2X9ZA 2WVSA 2EDKA 4MLSA 1ZP3A 4M02A 3GK0A 1J5TA 1MQRA 1RU9H 5HMSA 3THCA 3IF1A 3AACA 3ARFD 4MJID 4ODXA 4OF7A 1F6FB 2G3FA 3FIGA 3REVB 1EEZB 2YRBA 4ETQA 2WLIB 1IGWA 1PIGA 4MX7B 3FO9A 4DT2A 2IAAC 2ZKYA 3PR2A 2OTUB 2VHLA 1LTDA 3OIXA 4E3TA 5ECVA 3PJLA 2PTDA 3NYZA 1FYHB 1OPGL 4MJ4A 3GI9L 3QR1A 5DA4A 1AK5A 1FAIH 4U49A 1IV8A 2J7DA 5KVDL 1K7FA 4W9FC 3SZ8A 5A6BA 3P2TA 3AXXA 5EBLA 3N42F 4GOAA 2YD7A 1HJBC 5FOOA 3FUDA 4YVPA 2IBBA 4IPPA 5EU6D 3B9NA 2KUTA 4OCYL 2GYIA 2YD2A 3CAQA 5F93C 3ZIYA 1CXEA 3SYPA 5KBMA 1R5VA 4PRDB 3KLDA 3CU7A 4MS6A 2BW5A 4TLUA 3WLHA 3QJQB 3DI1A 1VACA 3GB7A 3ZE1B 2MQ3A 2X16A 4DPBX 1QRNA 1RHHA 1GXEA 2A6KA 4WDXA 4PSRA 4QWWC 4GP4B 1W1A1 1UWRA 1MLCB 3T2OA 5E8NA 1ED3A 3ELFA 4K7PX 4OR1A 1JHTB 1VPQA 2XUCA 1IE5A 4JX6A 2CMRH 1DVFA 3PUUA 2C7FA 4K3DL 3L5WB 5F3HA 4ZQKB 3VFTB 3SCSA 4AGLA 4Q74A 1AG6A 3EBHA 3VD7A 1N8FA 2ITCA 3FB8B 4P2OD 3TX4A 3WQWA 2ZG2A 4YHPB 2A74B 2J25A 4HIJB 4KZDH 1EEXA 1V3JA 4HF5H 3AI0A 4JNMA 3DUSB 1W6LA 3N40P 3VXNA 2BASA 5CNHA 2BS71 4UMGA 1YNKL 4JO2H 5DRXB 4ZMWA 2Z1BA 4M80A 3TYCA 4WCYH 3IU4H 2I07B 4RMWA 1SOQA 1NKOA 3AXHA 4ZXOA 1BVZA 5SX4I 3HO8A 4XPTL 1QI4A 1Z44A 2VDML 3RU8X 3W88A 4RXFA 2BZ7A 1JG9A 3UCRA 1HCVA 1R3IH 4U3HA 4HLEA 4JGDA 5CEZH 3S9YA 4W7VA 2EECA 2UX7A 4OLWL 1GONA 4XMZA 2HJKB 4AWUA 4HOWA 4YSQA 5E03A 3OJ2C 3UNTA 2E8ZA 3WN5B 3Q1SL 1VZIA 3WTTA 1G7HA 3LHPH 3MXWH 4F2FA 1PUDA 3MYJB 3GSUB 4JTRA 2HKHL 3QEGL 4F20A 4R5XA 1Y0LA 5TGBB 3SUTA 4CCZA 5A2CA 2XTKA 2XH4A 2F1AA 5EC2A 1MFBH 1T22A 1TZHB 1ZT4B 2A6JB 1X7QB 4IYKA 4P2QE 3TM6A 5I1GH 1U30A 4UIMA 1ECQA 4LESA 1EK3A 3EA1A 1E3ZA 4BH8A 3AC0A 3MKCA 3KPSD 1X5GA 1E8YA 1XLHA 4Q7IA 4GS7B 4YHOH 5B8CB 4ONFL 1FWFC 2DN7A 1VLIA 1XM3A 1XPGA 1P84K 5JO5B 4WQ6A 4NAMA 4TYUA 4BQ2A 4PLOB 4M62L 2R0ZH 5HNNA 4KC3B 4WSKA 4KVPA 4ZS6C 4CU7A 1GC1C 1DWAM 2F7OA 2QADC 4Y16A 3DFYA 5E6ID 4PWJA 4M81A 2GSGA 3FQTA 3KM8A 3VILA 2HVMA 1UXSB 4OD1L 3C6LC 1S2VA 3VNKA 5KINA 2BIHA 5HNTA 5I00A 3C0LA 4R84A 1JZJA 1QP1A 4HCRH 2G3XA 1XLBA 4JPKH 1RAMA 4LQ1A 4OCYH 4FSAA 1IX2A 1XGRB 3C56A 4AG4L 4QTIL 1AR1B 3B8SA 3WH8A 4ACYA 4YR6B 2HMIC 2ROYA 4G80B 4PB9L 4EPSA 2HPTA 4FLHA 2R39A 4JZNB 4LL1A 7A3HA 2D69A 2GJJA 4ZFFA 3OXRB 1PS3A 1A9VA 4UTFA 1HSBB 1SY6A 1TZGL 3IV3A 2A77H 4JX4A 4HXBH 3DO3A 4XD4A 2E59A 2VDQB 3TCSA 2QLYA 3L9EA 2R2HA 2QQKL 2X4OA 4K8RC 4HT1H 2EAWA 3HC0A 2DT0A 5CKAA 4LCWE 1P9MC 4NO0A 4EX4A 3UY7A 1ORSA 1E4LA 3MDJA 4IRSD 3HBLA 1AS7A 1YPZF 4I9WE 3CUFA 2DAVA 4KUZH 3C52A 2FZ9A 3EWCA 4HEPA 3TZVA 2NY1C 4HW6A 1E43A 1WCQA 2BGQA 5D6CB 3S1WA 1JWSB 1XLGA 3O6YX 4EI5D 3GNNA 2NZLA 1IBFA 1JGEA 1JGIA 3VMNA 3TJHC 1S5VA 2X1OA 3ILQC 3VRLF 2V17L 1DWGM 3G22A 3F7VA 4FR6A 4LWWA 5C2GA 1UB5A 3MNWA 4JGNA 4LE8A 4UQBA 3N06B 2VDOB 2ZWZA 3JV0A 4JM2A 3L4XA 2FX8H 3ZTCC 4DGVL 3KAAA 1Y7VA 4UDTB 2X89D 1VRDA 1EEZA 1EERB 5CHNA 4S23A 2VX5A 5KYWB 5JHBA 3P30H 2GQ3A 1X38A 4JAMA 3KPRD 1L3WA 4UWQB 1QLEL 1YJDL 4MB5A 2DZAA 3CJJA 5I2IA 2APXA 5C0BD 1OGAE 1ISZA 4WCYL 3QZEA 2ZC1A 4LP8A 3UZQA 5D4YA 1WE5A 3OKDB 2RH9A 4OZIA 4AWTA 3SADA 3FUEA 2UWEB 3DX7A 2D03L 2EDWA 4QRPE 1W3KA 4DIAA 4KJWD 2YQBA 1EZSA 2X53A 4LSDA 4Z1DA 1ODAA 2F5AH 2B0SH 1SLVA 4XP9H 1A21A 4YBLB 4H9VA 1MFCL 1E9PA 4JW3A 3C8NA 4QM1A 1PSCA 2NX9A 1G4EA 4MA7H 5K5YA 4M43H 3QR3A 3SECA 1H3PH 5D1ZI 1UR0A 2CIIB 5D7LA 4HJFA 3FVMA 4WZ9A 1GVFA 3QDHA 2V2WA 3PUOA 2F53A 2YMXH 4FQXA 3T44A 2JV6A 1ACZA 4N6RA 4XB8A 1BD2A 3X3FH 5C0AA 1KBGH 1QEXA 1HZHL 4ISVA 2QCEA 5E0KA 3T08A 1U5VA 3H2FA 4CILA 4O19A 3VYOA 1TQVA 4N2IA 4LCQA 3MCLL 1QBML 3IK2A 3IXTA 4HCFA 4KAQL 2MKLC 3GSRA 1J4EA 3DZ1A 1TETH 2I07A 3I6RA 3IACA 2CETA 3VKJA 1QATA 3H2AA 4HPOH 4B5TA 3UCDA 5DZAA 3KX6A 1W9VA 3QJUB 5EEVA 3RLHA 4GRMB 1BSLA 3TH4T 1N4XH 2X6VA 3ARWA 2VLRB 1W1IE 4P4KD 4PRAB 2AJSH 4UNLA 3QXUA 4ZFOA 3RFZA 1MVUB 3MO1B 1A4AA 5C3IA 4OHQA 4X9IA 1OEPA 3URAA 3IAGC 1EWHA 2JFEX 1NCBL 3OZ9H 5I3KA 7REQA 3IRDA 1S5IH 2P47B 1UUMA 4GWEA 1RIVH 1P4LB 1XLFA 3MYOA 3CXHJ 4AHOA 5J6HA 3BLDA 5D7IF 1HJSA 5JW5A 2FMOA 4FTDA 1U8LB 4NM8H 4EWJA 3KLKA 5GISH 1KFGA 4UF7C 3V18A 4KGLA 3CPLB 4QYOB 1OSZA 4D9QD 4Z7UB 4FQ2L 4BUQA 3ARBB 1A80A 4JFTA 5CLZA 3L48A 3THML 4ZS6D 5FKAA 4BF5A 2CJUH 5B1KA 1BEYH 2HA1A 4Y8DC 2PRLA 1SVBA 3PAUA 5FUOL 2BRQA 2ZCLH 5SWQB 3KFTA 5D2WA 2V2HA 4RZBA 2BSSB 4ODTL 2WNQA 5JUVA 3ZWSA 3EKCA 2ZWKA 3L9RA 5CJOH 5I76B 2Y7QA 4I2XA 3H1ZA 3PBVA 4Q6IC 1CICC 5M03A 1YPZA 2NY3B 4FG0A 4LSQH 4M61B 1OD7A 2DPKA 1CVRA 2VKWA 4G11A 3KDMA 1O5DT 1HHJB 3KYMA 4LV9A 4F0LA 2PN5A 1NEUA 4RNHA 1TA3B 2CW6A 5LNSA 4MD4A 4GLRI 4Z7WE 1MHEB 4G8FB 5C92A 1BXXA 4WEBH 1TR7A 4GQPH 3EIFA 1QFPA 5D5MB 1RLBA 4ZOEA 4ABQA 1KC5H 2VDPB 1DBAL 2NY2D 5D7KE 1JF1A 4F2MA 4P06A 1GS6X 4FNSA 3ILQD 1EBAA 3ARGD 3BPCB 1TPWA 2O26U 1J9SA 1KM0A 3FPXA 1VBGA 3IUHA 4G7YH 3LUTA 3DGCR 1Q7MA 5JYLA 1WAAE 4X5WB 1IWBA 3TH6A 4BEUA 4A29A 2OWXA 4DJDA 1NC4D 1HEJC 1NBYB 4G72B 3DUUB 4L8CB 5DCCA 1R33A 1UUSA 3FONB 3FB6B 3OXSA 2J7CA 4KXDA 2JB5L 2XTJB 4M8RA 3SKMB 2GITB 2NXIA 4C90A 2B59A 4Z3EA 5DHVH 4X0KB 4NVTA 2ZSVA 2PU1A 4JR9H 2H6UA 3MZ2A 3FRPB 3RX2A 2AJUH 5BOZG 4LT7A 4YHNB 3RCYA 3RMEA 1TZIB 1HDMB 3QDGD 1OOAA 4NY2A 4CUCA 1G6VK 2BY3A 4L7ZA 4E3VA 5J3HD 4TQEH 4P04A 4BJLA 3ORWA 3KEHA 5DMNA 3D3AA 2DIAA 2G3ZA 1THCA 1QTYT 2JCCF 1INQA 3NDYE 5F2IA 3H2OA 5I3HA 3CASA 3ZS4A 4QKTA 3PWUA 1TQCC 3ZDXF 1I9RH 3QYQA 3RPTA 5CBJA 3W7OA 2D24A 1JZ5A 1UZHA 2VZUA 2OZ0A 4P59L 3FQ1A 1QMUA 4XVUD 4GC4A 1EGVA 2NT1A 5HHPA 1P5BA 4YDJB 1UZ6F 4D9LL 2OT0A 1UA6H 2Q8AH 3EYPA 4INFA 2L04A 5JIHA 2F8VA 2YD3A 1QYGL 4Z77A 4ZA0A 2VRAA 1ONRA 1D7FA 2HVBA 1F1GA 1GR7A 3MMEA 4NPJA 4FFWD 4XH2B 1Q90A 5CIPH 1TZ7A 3VIOA 2Y24A 3NIDB 5D2NA 5GGVY 1DJZA 3WF3A 4KKCD 2X0SA 2PWVA 2M26A 5CN3A 4UUJB 1P7BA 4LSVH 4HPGA 5IW1B 3IRSA 3V6OC 2NCMA 3KWSA 2O4MA 1SUXA 1KRAC 1O6IA 1QFHA 1UASA 2PYEA 4R3SB 4I87A 3TBSB 1P6BA 1DJGA 1SDYA 1JFXA 4OT1H 3PF3A 1U91A 3WUZA 4JTTA 1Y6MR 2MCPH 4TVPD 1NSNH 2DZEA 2WNXA 1I1FA 3UTZB 4F91B 2X0HA 1KR0A 2BWIA 4NO5A 4H9YA 4U4MA 2YDSA 4ELDA 2YKLL 3C6EA 5ITBH 4FXTA 3ZN6A 2QCHA 1WHOA 2DYRB 3GNXA 3GR4A 4GUQA 1ZSDA 3N91A 2QVIA 3MRMA 3WNOA 5D2XA 3DJZA 4HGWA 4NHVA 3RWJB 2WWKT 2NLIA 2AVFA 4IG2A 3N2BA 4AGOA 1E40A 5E7FA 3MRPB 4MVAA 3F5LA 1IEAB 2VMEA 2HFFA 3SQBB 5AHIA 1IC1A 5IK3B 5I06A 1EKOA 1KTRL 1F56A 2QDWA 3BP4A 4KJPD 4J3XA 5DJ8B 4Y0GA 4LVDA 1DQJB 4P3DB 3REWA 5GGTH 1MI5B 3MODH 4AX3A 1SVZA 2RTTA 4U1NB 1VKXB 1EXBA 3KPSB 1H50A 4P5TA 4YXLL 3GD6A 3S4TA 1YQVL 2E7MA 4Y2DC 2IH9A 4YFDB 5FGCB 2PDNA 2ATPA 4E8GA 1EB3A 3T0EE 4UFIA 1FWAC 3VWKB 3E6HA 4B41A 1NWPA 4CJ1A 3R8QA 4LBSA 2JI3A 3IXAA 5L2KE 3A4EA 4NQED 2GQAA 1R3LA 1UYWH 2C18A 5E1HB 2CNCA 3M8OH 4I0CC 1OWWA 1LNUA 2F53E 4O58H 4RDBA 1G7QA 2JJWA 4CMHB 4EI5B 2ZWNA 4CN1A 3LIZL 1QRQA 1TREA 2A7RA 2BMBA 5DMMA 4P7NA 4AQOA 1URLA 3VXPB 4HHGA 4AUYA 6REQB 3LV3B 3F5WB 2Z1XA 4HNLA 4HWBH 2BFVH 4MDIA 4X7TA 1RZ7L 3CVIL 4BFJA 2PC4A 4WGVB 4KKXA 1JNLH 1P5UB 3D07A 1LG2A 1UKQA 1RUSA 3DGGB 1DFBH 5LA1A 4O9HH 1QWGA 3UYCA 4JFFE 4XX6A 2IG2H 3W7RA 4ZTXA 3MRKB 3L1OL 4XNUL 5F7HA 5D1XB 1H7PA 3ABSA 4Y4HB 3HFTA 1EBGA 4FKKA 4L48A 5IW6A 4M93C 2ALRA 2BOEX 5JBEA 1Z2KA 4KNUA 3JWDH 5DMKB 1C3FA 4KBXA 5IFTA 2ZZ3A 4OGYL 1F45A 4JFHE 1R7AA 2HT4C 3BGAA 4A7VA 4BKLA 4I4WA 3VFNB 4OKDA 2E74C 2P3YA 2QQNL 1JPMA 4HYTB 2DW5A 4WF7A 2NQHA 3C5QA 3OX8A 1E5BA 1OSPL 4ENED 3NQFA 3EOAB 4OU3A 1WQ5A 1HJXA 3DMMC 2NX5E 2O5ZL 3RQ3A 1FWRA 2QNEA 2P3ZA 2Y5JA 4IPIA 4HU4A 4N2AA 3C3UA 4PJHB 1FL3A 5CKSA 2IPTL 3L9RB 3PXHA 4HIPA 4JM2D 1WFNA 5EN3A 4PJ5A 3VCLB 1PV8A 3GZKA 1GW6A 5F1UA 2DLTA 3W83A 2OMVA 3AO0A 1W0WB 4MHBA 3DC0A 3VIGA 5D2YA 1U8KA 1L0QA 3KPNA 2PP1A 5FKAB 5F6HI 1S7RA 4LCYA 5KOVC 3VXRB 1Z3GL 1F4WH 2PSNA 3NA9H 5H91A 4RWYL 1U8PA 3LX9A 1O6SA 2OJEB 3AIVA 1HZKA 3WUWB 3UJRA 2XWZA 4UQ2A 4IEFA 3S2LA 5L8LB 3CPRA 3LOWA 1UYQA 3QUXC 2R4SH 4IKNA 1VEPA 4L1SA 2TPSA 3PZ9A 4XWGL 4HIBA 5KG9A 4BD4A 3FN0L 2AEWA 3W74A 5T3XD 5HGHA 2QAPA 4HJJH 1NJJA 1VBUA 4KRNA 1A14H 5CBAB 3E5BA 3ZU8A 4ADUA 1NWOA 1BLIA 1MIMH 3TURA 1AFSA 3AT8A 1TQTA 2V67A 1QD0A 1F8MA 3SGUA 3KTXA 3VIHA 2W65B 1FHNA 2EICA 2PW2A 1M3IA 2N01B 3QFJA 4XMPH 1D2KA 2ZONA 1LK3H 3O3DA 2R7EB 3NCYS 3V4VH 3B40A 2G30A 2RKXA 3TDFA 1GVQA 1NBZB 3G1VA 2DB8A 2YPVH 3L5XL 4GMTH 2TMDA 2V9TA 5A7BA 4YHEA 1ZA3A 1KCUL 4JDYA 3VNLA 3H9HB 4ZFGH 4UTIA 4Z1PA 3MNVA 4G1MA 3UTTA 4JG0H 1EFXA 2WKLA 3I75A 4JZOA 4GSUA 3EDFA 4PM1A 3H0TA 4NC1C 5DHEA 2P42B 1JZ3A 1A6AB 4O2FA 4XVTL 3GBMH 1J6OA 3VKBA 3VZZA 1L7IL 4FCAA 4ONVA 5IR1B 2VXUL 1JV2A 4FQ1L 4MJHA 1LBLA 1XBYA 2WY3B 2CKBA 3LEYH 1GYAA 4W4NA 3ZTNH 3M64A 5H6HA 3P1VA 3KOZA 1XHGA 5HJXA 4W1TA 1V7YA 3KBHE 3B04A 1G9NL 1HHHA 3R7MA 1NLBH 3MVIA 4BKNA 3OHXA 1BM3L 4HJGB 3EHBB 3UG5A 4OZ4A 4MSWB 1KCVL 2YB4A 2PO6A 3IU3B 3G5XA 1A64A 2ICWJ 4FB7A 3VSTA 4I5BB 1V7MH 3DHJA 1TJIL 2OI9B 5DU7A 3P81A 4DGIL 1OGGA 5TTRA 1IAKB 1QSED 5ECGA 1DUZB 1G9MH 3QKEA 2CXGA 3Q8FA 3NG3A 2QT6A 4OJDH 1O66A 4U4IA 5E9AA 4P4KB 3OG2A 3W2DL 1X96A 1F6LL 5BRQA 3SQOH 4O2EB 3DTXA 3WLIA 1IKFL 4D7PA 1GKRA 3HIZA 5HYJD 5JQ6H 1KQZA 1WUNT 2GBUA 1MSPA 3AQZA 3V0HA 4KNQA 1V5XA 3CC5B 3NFUA 3ARGB 1M7OA 1Y6KR 2CJTA 3W25A 1YYML 2Y5TA 5C07A 2F53B 1FNHA 3WLNA 1V27A 2HKFH 3UTSA 1R9ZA 4TLTA 2ACRA 3VFOA 4PP1C 4ELMB 3MY9A 4MG4A 4DJDC 4TOQA 3M6DA 2A0LD 3C8KA 4UAHA 3BDYL 2W61A 3NQCA 2W27A 1X1OA 1MEXH 4BWWA 2DIKA 1FXPA 4PG2C 4XN5A 3WF4A 5FCUL 3EO1B 3UETA 5IW3A 1KPVA 4WK4B 5EN2A 1V6TA 2VURA 5TAOA 4KKLD 3LTPA 3DK2A 3ARBC 3DBXA 3OGOE 3CC1A 4QNPE 3QVQA 4JY6B 1WD8A 5EBLB 3ZDWA 3TNNA 3FJ4A 5IHLB 2QBWA 1JF5A 4ODBD 5AYTA 2P8PB 4CBPA 5E4EB 3EFFA 3TPKA 2VGLM 4AE1A 2DWEA 2XXMB 1G4RA 3KPOB 4HBCH 7PAZA 2Z34A 1EJWC 4KROB 4R5VA 1VFHA 3W86A 5BPPA 2ESCA 3KXQA 4P5KB 3BI9X 2WGXA 3QG7L 4AKOA 2X8RA 3IMTA 5HJYA 1AZVA 5IQ7L 3MBEC 1FF5A 2E4FA 3GDRA 4LKXA 1OTTD 2VM3A 4BXSV 1AS8A 4JQIH 5JPNA 1O5KA 3LNPA 3ULVD 3CFJB 5DVMA 5GGRY 1XX1A 5A94A 3F4VA 4W9KC 2IPKB 1TTCA 4ZMXA 4UT9L 2VKXA 4B91A 4KRMB 2VRKA 3OAYH 2J6EL 1Y65A 4M5SA 2XVPA 3CLMA 4AZ8B 1ZDQA 1KENL 3B5TA 4YEFA 2DLIA 1SO5A 5FF0A 3NH7H 2JCCB 1GJUA 1S9WA 2V5SA 2PTXA 1MNSA 2QHRH 4OZFA 1MQPA 5IBLD 4JTHA 2DWSA 3W26A 1PHWA 4BUHA 5E56A 3QPKA 3LSOA 4IUOA 4RA3A 3W28A 3WIHA 4EOWH 2PMQA 1SNRA 4J2XA 2W07A 2WZTA 3APYA 4FFWC 3T3MB 4ZMAT 4HQVA 3WJLA 2FZ3B 3WSQH 1DANU 5D96C 5IB2B 4GD0A 4EVNA 4C4BA 2BSBA 4O02H 3PVFA 5JHAA 2CM6A 3T05A 3GXPA 3NIGB 4J6RH 4QXVA 1E51A 3L21A 3OPSA 4L9XA 1RV6X 1B0IA 4C83B 1AGEB 2IQAB 5DHVA 4ABWA 4W88A 3IS4A 5JBFA 3H56A 5BXPA 4BINA 1GGOA 4PMVA 2X4UA 1X7QA 5FWRA 2O9OA 2FATH 2EUZA 4GUIA 3B7SA 4A3RA 3CGTA 4KRLB 4HD9A 1FL6B 3FQXB 3KS0H 2RJGA 2W9EH 2VGBA 3R11A 3FSWA 2MTPA 3LS5H 3VSUA 1HP5A 1YBQB 1NCJA 2VE6B 3FFCE 4LAQH 4I88A 3LV5A 1HE8A 4WKXA 3RBSA 2AEPL 2OR9H 3S0CA 2IQ9L 4FFZH 3AWGA 4GQ9L 2IWKA 1GVIA 1NDGA 2H4EA 3U4BH 1WKYA 3UO1H 2YZ5A 4REQA 1W3JA 4HK0A 3GJEA 4S11A 3H26A 3TLRA 2IUZA 3TT3H 3S9DB 1TTRA 1JYWA 4H8UA 4QRAA 3BXWA 2Z1WA 4JIRA 5DQJB 4N6FA 4QQUA 2HZGA 5EOTB 4AQAA 4NQDE 1IKNA 4ZB5A 1QPKA 1AA1B 3VVGA 4NZFA 1DHKA 1M1XA 3IXAB 3K0WA 5DBUA 2DIBA 3P2DA 5C07D 4KI5F 3O3AA 3G1AA 3HB3B 1SOKA 3HUJE 1PLCA 1TCRA 4AQ8C 5T3ZD 1Q13A 4Y16C 2IGLA 4YHOL 2O1AA 3VXSB 3P9WB 5E23A 3TBVA 1DE5A 4GY0A 1ND0B 3EPMA 4OBTA 3SDOA 1MCIA 1Q9KA 4WHTB 2JWYA 2FSEB 1FQ9C 1VFUA 2ICWB 1N59B 1TEFA 2WM0A 4MZ2A 2NY1B 4JR5A 1S9YB 4WI5A 3MCMA 1FNAA 2NT0A 3AB0C 3GSXA 1K3ZA 5D7HA 1TMQA 1C5CL 4ZSOE 2HKHH 2YUVA 2XWCA 4UBPC 3WKPA 4WHBA 1ZLWH 3U0PA 1S7QA 1WDWA 3TWBA 3VD3A 1Z9MA 2PWHA 2K7QA 2OA9A 3FB5A 3MLVH 1BF6A 3AU0A 1W5NA 32C2A 1KXQE 4AC7C 4HZ8A 2CDFA 2NW0A 2DWXA 5I1GL 4L37B 1G7VA 1TJHH 1PTDA 4PUUA 4GP8B 4F92B 5J1TC 3IMSA 3OKOB 4K94H 3N9GH 4IOFD 2A3BA 1BA9A 2B7NA 2WW5A 4IT1A 4IQJA 4G9PA 3PBMA 4FG4A 4C8XA 2ZXEB 3BVNA 2P5PA 5DUPH 2FEJA 2H9GA 2ZCHH 4I3GA 2XZCH 4X5LA 4F80A 2Q5BA 1AW1A 1N55A 2JKIS 2VGFA 3GKFA 4HNVA 4XO5A 3U2OA 3AT9A 3CZEA 4QRUB 3GHUA 1ADDA 1SBBA 3B3IA 2HRPL 5I1CH 3LS9A 4WK9A 3G6DL 4G9FD 3WLWD 5H35A 3ESPA 3HA0A 2WXDM 1PPIA 4L3AA 4HS6A 2PPAA 2UY6B 3IDGB 5D1QA 5I7GA 3WEXB 4NQUA 4UBDD 3NSNA 4RGNC 4E9VA 3PB2A 4NBXB 4BQ3A 2B5IC 2IDQA 3VXQA 1AFVH 3RWGA 3UF9A 4KX7A 3IANA 1VEMA 3O6KL 2H7WA 1AD0A 4D94A 2BSDA 3Q5YA 5DC9B 3Q8BA 1IXPA 3UWYA 4GRLC 3GH7A 2W0KA 3MRFB 3ANUA 1AR2A 3G1DA 4G5DA 1A4KB 3L7FA 3BWAB 3FQRB 3KPMA 3MN8A 5IM7B 1KBJA 4JQXC 4EI6A 3Q06A 2ZZ5A 2Q7AA 4O11A 3ZKXC 1K3IA 3TW7A 1LL6A 2P8PA 3NEHA 4Q9RH 1HOCA 3FT3B 1OTUC 2OW6A 1BLNA 2AXFB 2VR5A 1E7UA 3VGAB 4EDWL 1MCKA 2OTWB 3MLYL 1B3OA 1Q6EA 2PLMA 3KBMA 1RVFH 3MSRA 5D8WA 1S46A 4AT6A 4PP2B 2YFNA 3U6WA 4I0PA 5CJBA 1KM5A 2C26A 1WOBA 1T3FA 2XV2A 2XWRA 1NDTA 1OCZB 4GBXD 2VCCA 1LZOA 3EO9L 4B7LA 4LCWA 1F8TH 5TPWL 3TLLA 3U7YH 1BZ7B 1JUFB 2DQUL 4KK8C 3S34H 5IMMA 2CUAA 3NFSH 5JW3L 3BIBX 3RWFB 5C0DB 2Z4QA 2J6EH 4M7JH 1KRBC 3M0KA 4IP5A 2KX9A 3NZHH 4N90D 1IIHA 4AY8A 1KFLA 3GO1H 1V6XA 5HI5C 3P4LA 3QI9D 1HS6A 1JDFA 1US2A 1BVKB 2CZ5A 3EKLA 3T81A 2YWZA 4M7KH 4OLYH 5E9XA 4PVBA 1ONQB 1BFVH 5C08A 2KKQA 3FUJA 3GZOA 4N1CA 2Y9RT 1DQUA 4AZBA 3QEQE 1K8YA 3SBQA 3V5KB 5I02A 4TSCL 2H2SC 1QSEB 1P0DA 4AIEA 4PRHE 1LE9B 4IFRA 3V0UA 1XCFA 5AC5A 5C0ND 2BMKA 3L9YA 1BAGA 2VT0A 3W27A 1EXHA 4Y5XB 4Z76A 5D9SB 4JDZB 1V3LA 3ESMA 4POUB 1SHSA 2XWJA 3C60C 3NEEA 3JUZA 4LRIC 5G1MA 3N1AA 5LXEA 4GSRA 3O9WD 3MSGA 2YL8A 3HB3C 3SGJA 1PW3A 4AXKA 4LFHD 5LG1A 3QHOA 3R10A 3APFA 5GRVL 3U7AA 1HL9A 4F8OA 2XFWA 4N0FA 4P5TB 3GC5A 3B56A 5KSUB 1MH5B 1EUAA 4J40A 2VQ1A 2EVGA 5CGQA 2TRYA 3TIMA 3MLXH 4Y9EA 3BZFA 3PZUA 1QWNA 1KJMB 1PKQB 3RPKA 4OOUA 4R0LA 2OFQA 4PIBA 4RFOL 5AAWA 1F07A 1RJCA 1WP6A 2UWFA 4NAJA 3CUHA 3TCLB 2XZAL 3CFCH 3HR5B 2QPDB 3QHTC 4MJ6B 3WJJA 1TYGA 2XKSA 4WJ5B 3QDMB 2IBGA 3WKMH 2C9QA 4B7IA 5CD5C 3P9MB 2EHHA 4QT5B 3W70A 5TJWK 4EUPG 3H54A 4W8LA 4RW3A 2WXFA 4LKCB 4G7VL 4FA7B 4WOQA 5F89B 2G4FA 4NNAA 4JN2B 4MMYB 3QTGA 5EZJB 2AI0L 2AZUA 4FZEH 3TOPA 2DSWA 4ZE5A 1ESWA 2DQTH 2H3KA 1DBJH 3RGVC 4XMXA 2QDVA 3GMRA 3QJAA 4XQ6A 4F66A 4MS8D 3WMBA 2E7LC 3CDZB 2ZP9A 3BGJA 3DH7A 1DE4B 2AANA 1ICQA 5MKGB 2Z1VA 1XMEB 5TE7L 4W9ZA 4DPPA 3ZL4L 3EGSB 1YEGH 5AHEA 4ZMVA 3SZ6A 1UMYA 4AIBA 1F18A 1QFWH 1Q0XL 3APCA 3B37A 3TXAA 3EB3A 3BLBA 1H19A 2VJ0A 2WSKA 1DLHB 43CAB 4CEUC 2WQSA 4DZIA 1V55B 4LHJB 4PCFA 5EFFA 3L4CA 3MRBA 4FQJL 5FD0A 4B60A 1VKXA 2YEZA 1LL4A 4LGSB 5JHMA 4FP8H 1EQWA 1IIIA 1XAKA 4RMBA 1E6ZA 1SFSA 3LA4A 1LP9B 3C6LD 4GW4A 2X4SB 1NEYA 5EZOH 5B3JE 4PU2A 3UZ5A 3VCRA 1W8NA 5FKPB 4HCLA 4ETYA 2ZTBA 1VJZA 4PCTA 5DDHA 3HPXA 2FTYA 4HFUL 5MP6H 4LL9A 4WWKA 3X17A 4L8CA 4GUHA 4LS0A 4Y9NA 1WCBB 2YAPA 5CZSA 1AQ0A 4MNHB 1H09A 1P6CA 3GDLA 1E4XI 3EHBC 4X4YA 1Z7JA 4GYJA 1V10A 1FL5B 2XYCA 2DIEA 4LBEB 4W70A 3W29A 1KBVA 1KTNA 2Y1HA 2E09A 3BZDA 2WC3A 3ANVA 4H9ZA 4ESKA 1KJ2L 5AN7A 5HVHC 2J8UA 4PJDB 4AM0B 1BYDA 2YR1A 4EF3A 1TTGA 1WDRA 1EJOH 3QC6X 2IPGA 4KQ3H 4OLEA 2W67A 4MAZA 3LCXA 4MYAA 4IMEA 5KSAB 2ARWA 1GOHA 4NKMA 3KCOA 1WS8A 3HQNA 5H35B 3MXVH 5KOMC 4XAGA 4N2HA 4ATLA 2FLBT 5H94B 2FGLA 3NGJA 1T0MA 1UH4A 3WEXA 2VITB 1JTOA 3Q3GA 4OGAD 3TEZA 4NP9A 1G5AA 1NFBA 3E7JA 2Y7QB 4I2XB 4XH2A 1GHFH 1M04A 2EEFA 1HH9B 4QXGH 2B31A 4QEHA 4RSYA 1P4BL 3TN4A 2VFEA 4M48H 3MWAA 3WEZA 2Z6FA 3IVKB 1S4IA 3PABA 3T0XA 1KPVB 5EN2B 1TT6A 5TQ0H 5F7KC 1GC1H 4X4XB 5L8KB 2X1RA 2OTPA 1X39A 3NEVA 1RUML 3KPMB 1B0RA 4KRPD 4YC2C 1PZSA 1XD0A 3ZQWA 4NX5A 4OI8A 2IANB 2WWOA 3APMA 3NABL 4JMXA 3NDYA 1KGYE 2H0JA 4LLWA 2V3DA 4MJ6A 3VXME 1UWFA 3WO3B 3D69A 1BEUA 1KQYA 1EDHA 3FCPA 2X87A 5IHZA 4RWYH 1ZQ5A 2CHDA 4HSCX 3AADB 2Z2BA 4P8VA 3E2VA 1JPKA 3KPSA 4QXWA 3P69A 5LNVA 1TRDA 2PLKA 2ALAA 4L8DA 4OGYH 3U0TA 4HKXB 2WUCL 3F7RA 3BWUC 3L4UA 3T4AB 3WIIL 5FEBA 5F6IB 3BQUA 2PGFA 4PODA 4V2XA 5A8OA 3WL9A 1IEAA 2ICWA 1HOCB 4IG2B 1CQKA 2N59A 4S0TD 3PUEA 2UYLA 4MZRA 2CHRA 1T66C 4YDVB 2A5HA 1FH8A 4QG8A 2R94A 1C1EH 5AFDA 4DJFC 2PWUA 4J3OD 4YK4B 4HK7A 2XZZA 1OGAA 4PJ9A 5EOQH 1GQNA 2VP8A 3G3LA 3PLYA 3IJEB 3F5KA 3HGJA 4LVNC 3ZRSA 1KCWA 2XN0A 2FJHB 2X2UA 3GNMH 4W7WA 2CZFA 4NJKA 2P8MA 3NQBA 4WEEA 3OYZA 4Q6XA 5H8MA 3RY6C 1TPB1 1UOWA 5IMKB 2EP6A 3ULUH 4P2AA 3BL3A 2EDQA 2XJLA 2ZP8A 4PBWD 2C3WA 3WDRA 3E8UH 1YC7A 3MODL 1H7XA 2Y2WA 3KM2A 5DURD 3DG3A 4JFDE 3B05A 5EIQA 4DP5X 1OCNA 1ZAGA 4DP8X 1I8AA 3N44B 4UB0H 4PEKA 3T7VA 3AT0A 3R0UA 3A23A 2YIHA 2HS6A 1CGUA 3G8EA 4QRRA 1FL6A 3FQXA 1BTMA 2CBIA 1M6JA 4K9EL 3EYOA 2G9HA 1W54A 1BD2B 2Z8SA 4LCIH 5ERWB 3AYVA 2D2GA 2X38A 1VLWA 4L4VA 3HR5A 1L5GA 2XWDA 3ARGC 1UQSA 4DHGA 3FW6A 5T5FH 4XMKL 1FG2A 5HGAB 3D8MA 4NP4L 1MXDA 4IGHA 1FUYA 4P8UA 4JQXA 2NR6C 2RAGA 2MNWA 2H2SD 5SV4A 2VYRE 3NIGE 4AK2A 3TEVA 3EBGA 2ARJB 5K59F 3FRUB 4PJ8C 4K3JH 4QHKJ 3B5GA 5CJ5A 2B14A 1O9VA 2HH0L 2QQ6A 3QUGA 5EC1B 2Z6IA 3PBYA 1KG0B 4B3ZA 2INEA 1OM9A 4GBXA 4JKLA 4L2LA 3SPJA 1XKYA 4W87A 2EXTA 5G2HA 1WWAX 3P60A 1O7SA 2NY4C 1CLYH 3OHXC 5DZOA 3W71A 4YMPA 2AMGA 1W1TA 3NJJA 3S5LG 5I8KH 4LSSL 4WTWA 2QIIA 4Y8AA 2ATAA 5GZND 2XN9B 4Z18A 1B4EA 3TT1H 8FABB 3FT0A 5F0JB 2R8SL 2XBDA 3OG6B 4G8GB 1FWBC 1TCDA 1RY7B 2BWQA 3RAJL 5I1LB 2V63A 3URBA 2DBJA 3EG9A 1DN2A 4I1PA 1A0DA 4L8SB 3FQNA 4QDMA 5KVMC 4BI6A 3TVMD 5CZXC 4KVNL 3N2OA 2OXGA 5G2WA 1IWAA 5F9JB 1MCHA 3WY1A 4OFKA 4NRYB 1OCJA 3ZSSA 3TA3D 2CDFB 5BQ7A 4LY4A 3VE9A 1ECYA 1NFAA 4GQ0A 3AU6A 2JQAA 3DSNA 4MWAA 1P7TB 4G2AA 2CC0A 5JQ9A 2IFFH 3H9SE 1TIMA 5G4OA 1JGDB 3C8HA 1I0BA 3A6OA 4C56E 2VERN 3H9HA 4EBQH 4CVXA 1JULA 3SGJC 3O9WB 5HYFA 4GVFA 1K7EA 3RITA 1I7ZA 3O3EB 5D1ZD 4JHZA 2O93L 3N11A 3FKRA 4AQEA 3T2QA 3H4WA 4PV9B 5HVFB 3E2QA 1V51A 5FUZH 5CC6A 2EAEA 3DKLA 3M7SA 4FO4A 4RCAA 1N2VA 3CXOA 1HILB 4XBEH 4PUJA 3WFHB 4AMWA 3GFXA 1U21A 2LABA 5D2LF 3SSGA 4LANA 2JVUA 4Y1AA 5IQLA 4EKXA 4CQ9A 1VRXA 4GUPA 3KH4A 1PHQA 2YL9A 4DWSB 2Y6TE 1U6AH 2YGNA 4JQVA 4KVCH 4XVJL 1P7QA 4U28A 1RY0A 5EOCJ 5EOTA 4AQAB 4KITB 5HDQH 3VXQB 3EG9B 1Y0EA 4IRSB 1ZLVH 4BWLA 3WFBL 1U2HA 3BWSA 4E41A 2V5BA 4X6DB 3WLBA 3EFOB 2DICA 1KCXA 1BVNT 1D9KC 3FXIC 3QWOA 4KRUA 3VDHA 4YN3A 4KUCD 3KOXA 1AMYA 1LYQA 1ISYA 1BREA 1J0ZA 1KCSL 3EJUA 5GGRB 3IVSA 4AI7A 3MLXL 3UBPC 3RFRA 4P61A 3SGEH 4P5UA 2XBZA 5IUCA 1XCTA 3QYNA 2FSDA 4P2RA 1PD6A 3MROB 4PV8A 4WWPA 5GHWL 1UZ8A 1T8XA 3NZGA 1CYGA 1JWMB 4EQ3A 4KO7A 2XQYG 3CZUB 4QJ3B 4B4FA 2L5HA 3RTQA 2HTMA 5FHAL 1EJXC 1CFQB 3NJKA 1E9OB 4Z08A 12E8H 2G3IA 1MRDH 2ARJA 2FBOJ 1W3TA 4N2LA 2XU2A 1JRBA 5I77A 3PJWA 1WJ3A 4WU7A 1L6SA 4NPKA 1H3XA 4J6IA 5DS8A 1XS2A 4WOZA 4O5LH 4ZSOB 1Z9NA 4OZFH 4PJ9C 3KWUA 4Y19E 3EFFB 1I4FB 2FIKB 3S37X 1D8WA 2FKPA 3E3QC 3PN8A 2QR0A 2VLKA 3HNTH 4FTVD 2H8ZA 5LIKX 5JZ7D 4FEZA 1TWDA 1IR1A 3AHZA 1JIBA 1IE4A 4NZTL 5EH1A 1MZYA 3VKCA 4CQBA 3S6OA 5D6DC 1WBZB 3A3XA 4HYVA 3MFFB 3P30L 3V0AC 4Z3TA 5AVSB 2WZIA 1RULL 3WXVL 4CQAA 4J5NA 1JFQH 1H1NA 2DZVA 1TU2A 3DDFA 2Y7FA 2OZTA 4TXVB 4G7SB 4WW2C 3PB0A 4ZX6A 3CVHB 2EE6A 1VGEL 4LDLB 4GI8A 3ZJ7A 3IM1A 3HFMH 4RRPG 4J28A 4JS7A 4JAWA 3FH5A 1F73A 5REQA 2BP5M 5DD5H 3F2BA 1E6QM 4LUIA 3F3HA 4BZ1H 3VZXA 4GQBA 1M6OA 3MOBL 1YE6A 4Y5YB 1O4UA 4LHUD 5FYLL 5FYJL 2V5TA 2DDQH 2Z1KA 5HYJE 4L29B 3LIUA 4L61A 1LE5B 4WVXA 2FJHA 1E2ZA 3IDMA 3SGDH 3A4JA 2OYKA 1S3KH 4IQEA 5B1CA 2G3MA 5DK2A 1N64H 2DF3A 1F8TL 4PJXE 5TPWH 3BZ4A 3MLZH 3RDKA 4HNTA 4ZDHA 1CLVA 4Y9FA 3QFJD 1L9WA 1H51A 3KZ8A 1LO0L 1T20B 1OT2A 1U8KB 1Q0YH 3KPNB 3QDGA 5AFAA 5KZCB 4NJJA 2C91A 1B9BA 1FIEA 2DQFA 4HMDA 1D5XB 4LCSA 2IQAA 4OZOA 3ITCA 2O61A 2JJSA 2R1LA 4CNSA 2XFXB 3RVWC 1HHHB 4N0UE 4R97C 4TKWA 1G9EA 4XPHH 2PTTA 3STBA 1YMHA 4QRTB 4O4WA 2YMTA 4LYQA 4UT7L 1A4JA 1I45A 1GOWA 3R6IA 4CNUA 2ZNXA 3LAFA 2I26N 5MEQB 3F58L 1G7LB 4WWKD 1YUKB 3VFOB 4XZHA 3UGUA 1NIDA 3F62A 2F8QA 1UQSB 4EVNB 3ALGA 1H3PL 5C09A 4NUWA 2EO1A 3K72A 1E6JL 1Z32X 3B8YA 3N1PC 4D0BA 5D1ZC 1BX2A 3S2CA 3MSPA 2SODB 4OFQA 3FAXA 1UT2A 3JZYA 5DA0B 1SM3H 3W00A 3KMDA 1FZKB 2WWKO 2Z4TA 5F7YC 3M0JA 1NBZA 1K3UA 1NMBL 3P11L 5FW6A 3N9GL 1GZQA 4G9FA 3IGSA 4C6NA 3E74A 1E2WA 3MRKA 3BZ4B 3U1QA 3ZKSD 1QNZH 2MSPA 3FTGB 2O92A 3PPGA 2AC0A 3QSTA 5FAAA 1YEIL 2EVIA 3ETBJ 5LAXB 3DVGA 4RFOH 2I56A 1USZA 3AYSA 4J9JA 3TU9A 1M2OA 3ABMB 2W94A 4NKMB 4H7ZA 1QNIA 3LTYA 4QBXA 1M3JA 2FX7L 3FUHA 4ZVJA 2O5XH 2PDQA 1BVLB 2JTDA 3EOAA 4HA0A 4OV4A 4POCA 5DQJA 3VIFA 3GQFA 3ZWTA 3QEGH 3AISA 2IDTA 1FL5A 4PJ7F 3PBWA 1OB1B 1ZANH 3R4DA 3KRSA 2IAND 4QRTA 4XVSH 4GZEA 3MRDB 3IRPX 2ISFA 4PE8A 4JTSA 2PLJA 4JB9L 5DS2A 3E6FA 1K6WA 1W0MA 2XVLA 4HU8A 2QVNA 1TPFA 1JL8A 1RCYA 2PTVA 3RR4A 1XKJA 3V4VA 1OK0A 1PY0A 2PCPA 4FTVA 1RFDL 1X5FA 3RVVD 5B8CA 1GG1A 3HM7A 3MVTA 1WKFA 1NICA 3NACL 1MJUH 3K4ZA 1P1ZB 2VDMH 3P4NA 3FB6A 3OXSB 4JFEE 4R8WH 3UBXG 1TIUA 2WNWA 1Q38A 2CLVA 2PP9A 1XH2A 4KO5A 1P7KB 3RI5K 5CSZB 2HISA 1NCTA 2PBOA 3UW6A 1TWSA 4M7KL 4OLYL 3T8MA 4UQIM 1T0OA 2J66A 4IMAA 3WK0A 4GEJA 3SYAA 4YWGH 3TH2T 2NR6A 4P57A 3SDXE 1GZJA 3KOWA 1IAMA 3WCYA 1U8OA 3CVDA 3DV6A 4IHCA 4GMEA 3SBWA 3FO9B 2FJUB 3D4ZA 3OHMB 3V79C 3QDJD 5K9DA 3VOIA 3MUIA 4B50A 2W9EL 5HDLA 4DAFA 5DJZA 3NM3A 3EO9H 3HB9A 1TTPA 3HCVB 3UO1L 2WJFA 3QZ6A 4M6AA 4GJIA 1O60A 1SF5A 3KRBA 4PZVA 3RDTA 4IOTA 1KLUA 1FE8L 1J0KA 2MOGA 2R0ZL 4BZ1L 3ERXA 4ZAKB 1J8HA 5D7LB 2DTMH 4XZBA 1TVBB 4B9ZA 2KAUC 5DFAA 1PL9A 4AJVA 3N6HA 3HZMA 4HT3A 4JTDA 2EIMB 4HCRL 5E1AA 3AICA 1GPOH 5T1KA 3WX7A 5DC2A 4WIWA 1DEEA 4K15A 4Q0XL 2IOOA 2P49B 5C2XA 3QZNA 2P8CA 3ISYA 1OC7A 4Q8VA 2F8OA 3QDMA 3CZSA 2IQDA 4JX5A 2CKBB 4Y6GA 4YX2L 5D9MA 4ZZ9A 1JV2B 4ADTA 4RK8A 1MJ8H 2F54A 3SQSA 3UR5A 4WV1B 1GKQA 3BYTA 3A3HA 1CDYA 4JTLA 1EYWA 2B7QA 4OZIE 2H9AB 4L9ZA 3HJZA 3UZZA 2IADB 3MKGA 1MI5E 3W2KA 3QFEA 3MJ9H 4WU7B 3WJXA 3WQVA 4K2SA 5CSSA 3FYOA 2CSPA 3TH3T 3T0ED 2OLSA 3VH8B 4Y9MA 2DW6A 1EEYA 5CPMA 2ZZ1A 3JUYA 3BZEB 2ADAA 1PG7X 1XIWC 5D7IA 5AUMB 3FO0H 1UD8A 4ALDA 4LPCA 3VXSE 5AG8A 2FWUA 2FX7H 1BWVA 1XHHA 5CAHA 3UZJA 1HEZB 2DMHA 2CUIA 3HC3L 1MCFA 1SFTA 2FL5B 5E2VL 3QRGH 1BVNP 2V7NA 1G9NC 1Q4NX 4M4RB 2GUOB 1OY3B 3QQ9C 3BUIA 3HR6A 1ALDA 2HZHA 3SDCB 3F1QA 4WO0A 4IZGA 4NC1E 2ICWI 1OWRM 3NXFA 3BIKA 1GOGA 1IL1B 2BSTB 5F7DA 4LUTB 4QX4A 5D37A 3UCCA 3FO0L 3RTLA 2B8OT 2XFYA 3H4FA 5FA3A 4OJEH 5IHUH 4F7MB 4RAVB 4JTEA 3UNDA 4DWSD 3GK8H 1TUXA 3V7MA 3DX6A 4HUUB 1B3WA 4E41D 2ZRYA 1RJLA 4RNJA 4DF0A 5C9WA 1EZVX 3RY5A 4Y1AB 5KUMA 4UXDA 2ZOLA 3HC3H 1A5KC 4UCGA 4IWWA 1S9XB 4IGBB 5FCUH 3EWUA 3T9PA 2EIDA 1QTSA 4UCFA 1R3JA 5DUMH 3PWVB 4K7FA 5DY2A 4F8XA 5CSZA 5IJBC 5A2BA 1NTDA 4OLUL 3GUTA 2J7HA 3KLSA 4AEHL 4J5VA 3ILDA 3OLDA 1VF8A 2DPEA 4JJ5A 4H25A 3WNMA 2IAMB 4GKSA 1FI8C 4LARH 2J73A 4Z0XB 3A3WA 3Q5TA 1KJ2A 1YPZB 1CYXA 1JXKA 2AK4E 3FU5A 3MV9D 4H1LB 1MCWW 2HDJA 3EH2A 1OP5K 3F04A 3RPBA 4JKWA 4PJ7A 2IQTA 1G6RA 1II4E 2OL3H 1BZ9B 1T7VA 2PXYD 3CWOX 1MF2L 2CQVA 4HJUA 4DPAX 1EHLL 1WTLA 4WJ5A 1E15A 3BDYH 3VTTA 2DQFB 1ADQA 4DGYL 3CJPA 3N4FA 2WWDA 1NUFA 1OX5A 3G3DA 3EX3A 3QW9A 2AMUA 4BKLB 4Q6YA 3PWGA 4TNEA 1AXSB 3C60A 4LKXB 3R8GA 2R0KL 2YJQA 4IRJD 4LVOC 2PDCA 4LUTA 1Q5MA 5I6NA 2C6QA 2GTZA 4XKYB 1HQTA 4AUBA 4MD5B 5JXAL 1X6UA 4OJYA 1RZFL 4FERA 1KB9J 5ILTL 2VGGA 4GGHA 4IFKA 2K4WA 3LENA 4HUUA 1NDVA 1SO4A 2QKIA 3SB0A 4CD8A 3IJ7A 4HLZG 1MCLA 1NWSA 5AB9A 3MO1A 4Q9BA 4CQCA 4Z7VF 1FV1B 4A8IA 3NA8A 4L4LA 3L2NA 2IDUA 4DVBB 2WM1A 4H26A 4N1EA 5MEND 2YPVA 1SFLA 1UG9A 3BWWA 2WZEA 3VTAA 3HGSA 4PP1D 5KYUB 1AJ0A 1L7IH 1NIAA 3R18A 4LKCA 3D46A 1BWMA 2VXUH 4FQ1H 4PJXF 1ZY9A 1T89C 3AITA 1CIUA 3MRBB 1TU2B 4KKAD 4ZS7H 1TFHA 5IB5A 1DWJM 4OCWL 3MU7A 4RCXA 1OPOA 3OV6A 2CH8A 1E4IA 4C54A 4GCXA 4IMDA 1M03A 3MMTA 3FYEB 3S98A 1DJXA 5MHSE 1CIDA 4J4PD 2V8LA 3EGSA 5HK4A 3OKMA 3EOEA 1ULVA 1FG2B 1L7TH 1IEBA 3CXFA 4GMTL 5HGAA 1U3HD 4N22A 3CV6A 1T1XB 3VMOA 2VFIA 4UFLA 4O13A 2Y36H 3DROB 3UIZA 5LKYA 3DIPA 2YCEA 4FLRA 1QWHA 3K4AA 3S36X 4NCDA 3C6SA 5KZCD 3QIWA 3NJHA 3QDJA 4TQPA 2BNUA 3DHMA 3NQ7A 1SHXA 3WUBA 2PPFA 1JPTL 2R2BB 1QPXA 4IGBC 3P3BA 3NDOA 3NAAL 3WQFA 3NVDA 4D8ZA 4FTVB 1FYTB 4OCMC 4OJFH 2ADYA 1ADOA 5LBGA 1F58L 1QPOA 4HJJL 1LQBC 35C8L 5ANMB 5T1DL 5BXFA 1R8LA 4YHIA 4GRLA 3CH1B 2NY6B 4IRSC 3EOLA 3HI6H 2EIJB 1H6FA 3M6YA 1ZPLA 1IEHA 2FPVA 2JE8A 1ONQA 5C08B 3U0WH 2IF7A 2D1ZA 1XXXA 4RDYA 1XB3A 1N5YL 1O7AA 3DBPA 4JANA 1I6NA 4CNTA 3PF2A 4G42B 1B5TA 4M82A 2ZG3A 7TAAA 4G3YH 4PMOA 3RE0A 5HMEA 5TF1L