3WY1A

Crystal structure of alpha-glucosidase
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
535
structure length
535
Chain Sequence
NMMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLDNMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSRPENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEVASDLPVAHFTATRDGSTLTLPAYQAAFMQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-glucosidase
publication title Structural analysis of the alpha-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism
pubmed doi rcsb
source organism Halomonas sp. h11
molecule tags Hydrolase
total genus 193
structure length 535
sequence length 535
chains with identical sequence B
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3wy1A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wy1A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3wy1A02
2WNWA 1ZS2A 2J74A 3AXHA 3WDHA 3WF4A 2XHYA 4GZEA 3OIHA 4YN5A 3CIVA 3BGAA 2DT2A 3B9DA 1UUQA 3LPGA 4UQCA 1V03A 2EPNA 2BVYA 1JNDA 1OGGA 3VX0A 3K46A 4HZ6A 1FHLA 1BGGA 1PX3A 2WMIB 5HPOA 2X8RA 3BLKA 3WN6A 1UD6A 3WDPP 1W3LA 1SFSA 2XTKA 1LWHA 1QWUA 7CGTA 4D6JA 1VBRA 3WKZA 1E1FA 3ARZA 2G8ZA 2CBVA 2QF8A 5E0FA 4AYSA 3DYOA 2YL6A 1K9FA 2QHAA 3WL0A 1ISVA 2J7DA 1PEZA 4BQ4A 3QOMA 1JYWA 3VDAA 4MB4A 1BPLB 4WSJA 3EJPA 3CLWA 1JZ2A 1V6UA 2J7BA 3WH6A 2YDQA 3BUDA 2V3GA 4TUFA 4JHZA 4PRWA 2ZUUA 3MO4A 1UH3A 1RP8A 3QOKA 2J8FA 2DPEA 2G4FA 5BXRA 2VX5A 3ZR6A 4FF5A 3RIKA 1PIFA 5I0DA 4RE2A 3AICA 2WC3A 1LJYA 3WQ4A 3UG5A 4JHOA 3VGHA 3U7BA 3ZOAA 1JYNA 3WDIA 2NT0A 2VZOA 3IJ8A 1GJUA 5D9OA 1OCQA 1UZ1A 4MDPA 2JALA 4CU7A 3FY1A 4UOQA 3NDZA 1O7AA 2BVDA 4M81A 3WQ8A 2WBKA 2VVNA 5CQ1A 4KRTA 3I3DA 1GVIA 1MXGA 2PWHA 3ZJKA 4NZJA 1LG1A 2OLHA 1EHAA 2IXUA 1DP0A 2VUYA 1JZ7A 4W7WA 1P6WA 1FP8A 4GPNA 3WNMA 3WBEA 4CN6A 1MXDA 1OB0A 3WY4A 5JBFA 3D50A 3FN9A 3VUPA 4W87A 2FHFA 3IJ9A 5E6YA 2VOTA 2FH8A 3H54A 4EANA 3TTOA 1DWAM 4GO8A 3PBGA 1JD7A 3WY2A 2OW6A 1ITXA 3PN8A 2EQDA 5KEZA 3QR3A 1XD1A 1ODUA 3WDQA 1UASA 1MQQA 3VIFA 3GXFA 3VDHA 2GK1B 4WKAA 4QP0A 3VOCA 2CHOA 2XPKA 3WH8A 4UFIA 3AXIA 2F1AA 4DUXA 2C8NA 4Z2KA 3VSTA 4WJXA 2F61A 2F7OA 1E4IA 5EFDA 4YPJA 2GSJA 3BUPA 2DT0A 2O9TA 1NP0A 3VGDA 2V3FA 4GI6A 1E15A 3VD5A 2WCAA 5A8QA 3VM7A 1GHRA 3BMWA 4Z2HA 3SUTA 2ZE0A 2QPUA 4DM1A 1E71M 2A3CA 1ODZA 4J3SA 4WKFA 5LA2A 1O6IA 1PX4A 3CH9A 4ZXOA 1V3KA 3CC1A 1RD6A 2ZWZA 2WMFA 3W37A 3D4ZA 5GNYA 4PUEA 3NSNA 2JF6A 4IPLA 4YHEA 2EXOA 4AIEA 1KFWA 1W32A 1DWIM 4DWSC 1JG9A 4AZIA 1CENA 4AMCA 1VFOA 3MMUA 2WVUA 4WK9A 1A47A 2XN1A 1JYVA 2GUYA 3VD9A 4CCDA 2D20A 3D3AA 3OA5A 2BS9A 2J7CA 4DUWA 3ZJ6A 1R34A 4CCCA 2BNJA 4CD5A 1UG6A 2B31A 3K8KA 4OUEA 3LX9A 4BS0A 5A8MA 3BUQA 1HKMA 1G94A 1GVYA 3DYPA 5HNNA 3L2MA 1TZ7A 1PZ3A 4P7OA 1H41A 1JI1A 3NJ3A 4V28A 5JBEA 3EDJA 3WUFA 1HF6A 1QVBA 3N9KA 5D9PA 4PEEA 2X2HA 1K9EA 3NSMA 1GOWA 3CZLA 4HU8A 2WVTA 2OSXA 3L4VA 3GBEA 1JZ8A 1G9HA 4HA4A 1ZL1A 2GJPA 1IZJA 2F18A 4MNMA 1OD0A 2IGTA 3VMOA 1HKIA 3PZUA 1SYTA 2E4TA 2VC9A 3PZTA 1E55A 4AZ7A 5ABFB 2XVKA 3I3EA 4J3UA 2ESCA 3AYRA 2IXVA 3II1A 3ALGA 1KTCA 4TVDA 3ZT5A 3AHTA 4ATDA 2J75A 3K4DA 5F7UA 5A6BD 1UD2A 1YQ2A 2ZUWA 3RM8A 4DO4A 2W92A 1UZ4A 3MSDA 1UWIA 5IFTA 2Y8VA 4UOZA 4OBRA 3AMLA 1TA3B 1V0NA 3N12A 4XV0A 5HXMA 2JEPA 4U5KA 4AYGA 1QHOA 3A5VA 2YFNA 2WMKA 4OKDA 2FGZA 4TVCA 3VM5A 4GZIA 4IUGA 3VILA 4FNSA 3PZOA 2DH3A 2BHUA 3LXCA 1MW3A 5D4YA 3LRLA 1V0LA 4AD2A 4R27A 5E6ZA 5HBFA 3OBAA 2WLZA 5CPSA 5AY7A 4C7GA 1W3KA 3FNDA 4YHGA 1HKKA 3DYMA 3NSXA 3BVXA 2ZWYA 3WF2A 1TUXA 2D0GA 1NWTA 3M6DA 3KE0A 2ZXAA 1JDAA 3OZOA 1HJQA 1LL7A 2WHKA 5A6AA 2W62A 1E70M 1W9PA 3AHVA 1WP6A 3SCTA 4M8UA 2VMFA 3CZ8A 5DEZA 1E5NA 3GH4A 4MNLA 3ZMRA 3T08A 2E8ZA 4AD0A 2XVPA 4W88A 3TTQA 3AZRA 3ARWA 3ZT6A 4W8LA 3GTNA 3WNLA 3WENA 1V3IA 1B3VA 2WZEA 1LL4A 1V6VA 2UWFA 4GI8A 3EBVA 5DF0A 1V6XA 2XYLA 1H0IA 5A94A 1DWFM 1H5VA 4AD3A 3WDRA 2PWEA 3CUGA 5JIPA 1M03A 5ABHA 1BSIA 4PMNA 3WUGA 3PZIA 1LWJA 5A6MA 2XFFA 5DT7A 1JFXA 2XN0A 3VIJA 4AZGA 1QI5A 2ZUVA 4M82A 5E0CA 1E9LA 1HJWA 1XC6A 4WIWA 2AAAA 5AC5A 2V5DA 3AZTA 2CYGA 1B9ZA 3BH4A 2WMGA 2WB5A 2CKRA 2VX6A 3QHOA 1VIWA 1X6NA 3U5YA 3RJYA 1WKYA 1ISWA 1JL8A 3AIBA 3SCWA 5A2AA 2GFTA 1UR8A 1VBUA 1JZ3A 4C7DA 2VZUA 3VIMA 4PBGA 2YOCA 1E6RA 1QNPA 4AZCB 1W9UA 3AMGA 4CD7A 1XD0A 1W9BM 3QHNA 2FDMA 2F8QA 4Z2JA 4AY1A 3SCNA 3UG4A 1GJWA 3AIEA 2X09A 4E8CA 4AWEA 1OT2A 3AS0A 1UD8A 1V02A 1E56A 1H2JA 5M03A 4JL1A 3CUIA 3FXYA 3CPUA 1UD3A 2WLYA 1JGIA 5BROA 1XSJA 3BLPX 4CD4A 2J4GA 5A6KA 4MAZA 2GVYA 3BAKA 4LQ1A 2ZIDA 5IHRA 1GOKA 4BF7A 1ZBVA 3AHXA 3PZVA 3ARVA 4FNPA 2BV9A 3RO8A 3BCDA 5ABGA 5D8ZA 4QCFA 3THCA 3CMJA 1H1NA 3WBAA 1J12A 4D6HA 4AZHA 3S5ZA 4PCSA 1JXKA 5ECUA 1QI3A 1HX0A 2WZHA 3AYSA 1IV8A 1VJZA 3O2LA 4XX6A 4U31A 1BQCA 1JXJA 1OINA 1CYGA 3GXTA 4UQ9A 1AQMA 2O9PA 1E72M 1NH6A 2UY5A 1E3XA 4GIAA 1VFMA 1KXHA 2EACA 4P7LA 3AZSA 4NXKA 3W82A 3AIWA 4AW7A 3ZSTA 2VRQA 4B9YA 1AQHA 4AEFA 5IHSA 4WSKA 5D9MA 3VMNA 1HJSA 2CETA 3RM4A 3CZEA 4JCLA 1H0GA 1M53A 3D51A 1BVNP 3VIKA 1J0ZA 4ZEPA 3BVWA 4NZCA 2G41A 4TTUA 3CMGA 3VNYA 2PWGA 2XIBA 1ECEA 2XM2A 2NSXA 5I78A 3HZ3A 4AD5A 2V5CA 4CGTA 1ISXA 4AMXA 3E1F1 1HL9A 4ZENA 3HG4A 4HPGA 4NI3A 4PTWA 1UQYA 1GHSA 2XFRA 3PHAA 1W3HA 1R33A 2WBGA 1X1NA 4QLLA 3KLLA 4LPCA 1CZ1A 4XUYA 3SCQA 3VKKA 5FCZA 2WHMA 1KXTA 3UR8A 5CJ5A 1UD4A 4PMQA 2PI6A 1W2VA 4FLOA 2VVSA 1CXKA 3DX4A 4DO6A 3SUWA 3CBWA 3MUAA 2WKLA 3CHFA 1QNQA 3N15A 2PF0A 4ZFMA 2VJXA 2ZXDA 3A22A 2CBUA 4Y7EA 3AOFA 4MB3A 2XG9A 3GYCA 4E2OA 2YBTA 7A3HA 1J0HA 1F4HA 2ZX6A 4AZ5A 5CSUA 4GQQA 3ARUA 1V02E 1H11A 3SURA 4F66A 4B9ZA 1B3XA 5FL1A 4W7UA 1KGWA 1B3YA 4HTYA 2CBIA 3OLGA 4HA1A 3WL1A 3EMCA 1OIMA 1MFUA 1BHGA 2EEXA 5CPQA 2E8YA 3A4WA 2Y2WA 4RL3A 1WZAA 5BRPA 2WC4A 4EE9A 2J47A 1B3ZA 3VO0A 1CNVA 1NWSA 2X0HA 1D7FA 3SCUA 2WXDM 4DWSD 9CGTA 4LYRA 1QNRA 1GQKA 1C91A 4OBSA 3IANA 4MJ2A 3DDGA 3VGBA 3MUIA 3VGEA 3SCSA 1K6AA 2EPKX 4WKHA 1OSEA 1ISZA 3KEHA 2QLYA 3WELA 3J7HA 2CKSA 2YBUA 2ZX5A 3ARPA 1FHDA 4HOXA 4U2YA 1WDQA 1C93A 4TTGA 1VENA 2YL5A 3AMCA 3AMKA 3WQ5A 2PBOA 4GZJA 2X05A 2WK2A 1BG9A 1WE5A 4UCFA 3W38A 3UETA 1EDQA 4CCEA 3WQWA 2EPLX 3WEOA 1E6PA 2PWFA 5IDIA 1KCKA 2GDUA 3DX1A 3WEZA 2YL8A 4D6EA 4Z2IA 4W8AA 5DO8A 1W9DM 4P8XA 4B15A 4NSBA 1SMDA 1UH4A 4AZCA 2DQXA 5I3DA 3CUFA 1TQWA 4QAWA 3CGTA 1VF8A 1WO2A 5HOSA 3VIHA 5BRQA 2X2YA 3U7VA 3T2OA 3L4UA 5LA1A 3A23A 3AIVA 2J25A 3G6LA 1XSIA 2XVLA 1KGUA 1WDRA 1VRXA 1KQZA 3F5JA 2Y4SA 1B0IA 1U2YA 3HMCA 3ALFA 2W61A 5JUVA 3AHYA 3NYDA 3VINA 2D3LA 1R87A 1FOBA 1WCGA 4TVUA 3T0AA 1GQLA 4PN2A 5FL0A 1E1EA 3KL5A 2OW7A 1G0CA 3CTTA 3B9EA 1EO5A 1JFHA 4JFUA 4S3JA 2ZICA 2XGIA 1CTNA 5A6BA 3DX3A 1FA2A 1UWQA 2F7PA 2RGMA 4ML4A 1V0KA 1CXHA 4X9YA 3WQVA 1SR0A 4AC1X 1FFQA 2CESA 2DSKA 1JZ6A 3U5UA 1NOFA 1M01A 5A8PA 1CBGA 1R7OA 1VAHA 4OOUA 3DC0A 3QGVA 4JIEA 1WZMA 4CVWA 1J10A 4EK7A 3W25A 2RGLA 5I23A 2JFEX 5CG0A 4RE4A 3AMDA 4HZ8A 2XN2A 2OYLA 3UESA 2ZUSA 2EO7A 3VD7A 3L4XA 2ZXBA 3BAYA 2DIEA 2V3EA 1HT6A 1AMYA 3EJUA 5D9NA 4EAMA 4U2ZA 3W4RA 5A6JA 1W2PA 1CGXA 3A4AA 2ZOXA 3M07A 1W3JA 3AIQA 1G5AA 5FKYA 5BXPA 3AIUA 4K68A 1U33A 2XVNA 1KB3A 3VU2A 1VEPA 4GINA 3OLDA 4HP5A 1KXVA 4CUCA 2ZUNA 4GXPA 2EPOA 1KTBA 5A8NA 1E0XA 5M17A 2VQUA 3CZNA 2EAEA 2A3EA 3N11A 4GKLA 1GONA 2DT1A 1DEDA 2D3NA 4PSPA 1H4PA 2UY4A 5BXTA 4HPHA 1VEOA 4HA3A 4D72A 5IXEA 3F5LA 3W0KA 2OYKA 2WANA 2VCAA 3AISA 4KMQA 3VX1A 1CXEA 5I2UA 4CKQA 4JZ5A 4D1IA 1J01A 4BQ5A 2G3MA 2D73A 4W85A 1B31A 2FGLA 4WF7A 4PSRA 3WD4A 5A6SA 3GH5A 1UYQA 2CEQA 2OWWA 2JIWA 4BZYA 2DT3A 4D71A 1TQTA 2AOSA 1OWQA 4UQEA 3CZJA 3K8LA 3SIMA 2E3ZA 2WCSA 1R8LA 1TQSA 4UFMA 2X1IA 5C70A 3IAQA 4HMEA 4KWUA 2JIEA 3WF3A 4OIFA 1QWNA 4OGZA 2YDRA 2WMJA 3ARYA 4W93A 1E3ZA 3EYPA 4PMRA 2X2IA 3PZGA 5CGTA 1ESWA 3AIRA 5GQBA 1ITCA 4FNTA 3N18A 4AZ6A 1JD9A 1UR9A 3BAIA 4LGXA 3LMYA 1EIBA 2IUZA 1C92A 3WNKA 5DFAA 3BAWA 3CUJA 1QHZA 3EJRA 5E9AA 5CPTA 3A21A 1C8QA 3H55A 4E4PA 2OSYA 2X2JA 1J18A 4M29A 2W91A 1C90A 4TOQA 2C0HA 2W67A 1Q6CA 3GNRA 2GJXA 4AD4A 3UERA 4A3YA 3L2LA 2E40A 4D6CA 1BFNA 3WFLA 3CO4A 4PMUA 1J0KA 1MYRA 3APGA 3VSVA 1Z32X 1QPKA 5C71A 3OB8A 1PS3A 2YA1A 2ZX7A 5EMYA 2CPUA 5BCAA 2NW0A 1HWWA 4GQRA 2VRKA 1KR1A 3L4ZA 3A4XA 1WAWA 3GH7A 5ABEA 2F7QA 2CHNA 1MW0A 2GJRA 1EQPA 1DWJM 5I6SA 1Q4NX 4GO9A 1EH9A 3WH5A 1ZBCA 4CU6A 1BYAA 4J3WA 3WD0A 1PJ9A 2DSZA 4IISA 4DUVA 2BHYA 3KL3A 1QW8A 2DIJA 4UZSA 2J79A 3HN3A 1BG4A 4CU8A 5GNXA 1X6LA 4AMWA 1HP4A 3EMZA 3LRMA 1R7AA 3OG2A 3ZSSA 4F8XA 2F1BA 4HMDA 1HVXA 1HTYA 2XSBA 1KBBA 4IPNB 2W5FA 3ARQA 1XYZA 4AZBA 1IZKA 1MFVA 5CXPA 3BSHA 4ZE4A 2FHCA 5A2CA 1R86A 4W5ZA 1MQPA 1J0IA 3JUGA 6A3HA 3BMVA 1TFVA 4NF7A 2GDVA 3NCOA 1E4MM 3VGFA 1FH7A 4AIUA 2Q8XA 2YDSA 5LYRA 2WKGA 4PMXA 3MUZ1 4HOWA 2DGAA 2PWDA 3HG2A 2JEQA 1ISYA 2TAAA 4JAWA 3TV8A 4H7VA 3CV5A 3W6LA 4X0VA 1TMQA 4CN4A 3MI6A 2D23A 3VIPA 5A3HA 3WMBA 4JFTA 2XWEA 1WZLA 1V0MA 1W9XA 1BYCA 3MSGA 3BVTA 1V3LA 3BXWA 3UG3A 3OLEA 3KWXA 2J77A 1CLXA 3PTKA 3W81A 1S46A 1JIBA 4D1JA 3CZKA 3CHDA 4HMCA 3W28A 3WFZA 3BC9A 1EDGA 2OSWA 4M56A 2DSUA 3PTMA 1UR0A 3W27A 1H09A 1UKTA 3MKKA 4M24A 1SMAA 3A6OA 2BVTA 1G01A 1T0OA 1WDPA 8CGTA 1UQZA 2VURA 4Z2LA 3RJXA 6CGTA 3VMPA 3WSUA 2WZIA 1JDDA 4PCTA 3FAXA 4A3HA 3MUY1 4UR9A 1UR2A 1W9VA 4PYSA 4Q7NA 4FNUA 4DWSA 3ZQ9A 2UY2A 3CZGA 2J7GA 3A24A 3DX2A 2EABA 3HU7A 5GPRA 2ZX9A 1GPFA 1NARA 4UQAA 3W24A 3SUUA 2D2OA 2G3NA 2YA2A 1OM0A 1QNSA 4UFLA 3ZJ7A 1D3CA 2CITA 2JE8A 3S5YA 4XZWA 2O92A 1V08A 2WWDA 4UQBA 1Q6EA 2ALWA 4TXEA 3KLKA 1UWUA 2G3IA 2VZSA 1LF1A 1JAKA 1XH1A 3O6AA 3LPPA 2DSWA 3WH7A 4B3LA 1MWOA 2W4XA 1MW1A 1UH2A 3DX0A 3IGUA 1LL6A 4RE3A 3I3BA 1LG2A 3GNOA 3MMDA 1JZ4A 1V3MA 3BLBA 3RDKA 3SCRA 4JFVA 3AFBA 1ZJBA 1HXKA 2CIPA 3OGRA 3WD2A 5I79A 3PTQA 1WZKA 3HJEA 4W84A 1KBKA 1KXQA 4U3CA 4MNKA 2VX7A 1QI2A 2BY1A 3VNZA 3N13A 2XWDA 2FE0A 2E9LA 4M80A 1UR4A 4W89A 2YL9A 1OGSA 3POCA 1QW9A 2YFOA 2VO5A 3VVGA 2QMJA 1M7XA 2VQTA 4UQDA 1R85A 3M46A 3NUKA 1BVZA 1GOIA 2XIIA 1HNYA 4DM2A 1UR1A 2HVMA 1E4LA 1PIGA 3GXMA 1E6XM 4NZFA 3K8MA 4UFJA 4ATLA 1CGYA 3W53A 1PBGA 4JKLA 3SUVA 1UA7A 1JDCA 3GM8A 3WF0A 3LXAA 1UA3A 4J27A 2WVVA 1C7TA 1CDGA 3D4YA 1QI0A 3ZIZA 2J78A 1NWUA 3RM9A 5BXSA 4PTVA 1UWTA 3EJQA 1US3A 1XYFA 2D0FA 4QLKA 4MB5A 1RH9A 4MAVA 1XRVA 5LA0A 1XV8A 2O9RA 4MNJA 2Z1SA 1KWKA 2QPSA 1FH8A 1PAMA 3L4TA 5I5RA 1GOQA 3MS8A 1WPCA 4KH2A 4ZE5A 1HIZA 4LXFA 3SEPA 2JF7A 5DMYA 1TCMA 3IJ7A 1E6QM 2ZXQA 1XCXA 2D0HA 3WMSA 1UKPA 4HZ7A 1CECA 5JIWA 4Q22A 1BYDA 3VGGA 2F7RA 4XZBA 2DEPA 3WNNA 5KZ6A 2GJXB 1FP9A 4URIA 2ZX8A 3CHEA 5GNZA 2WVSA 1KR0A 2FH6A 3A47A 2VRJA 1C8YA 5A95A 5HPCA 3DDFA 3WNOA 3OGSA 2J7HA 3WF1A 1R75A 3W6MA 1DTUA 5JBDA 1FFRA 2VR5A 4FLQA 4J3XA 4MDOA 1CGUA 1MVYA 4B3KA 4MB1A 3PZ9A 4CN1A 1UOKA 3EDFA 1HKJA 1XHGA 2XJ7A 4KRUA 1V3HA 1KGXA 4R5EA 1QNOA 2XSAA 3F5KA 1GQIA 4OZOA 4UTFA 4UFKA 3G6MA 4XB3A 4H2CA 3T0DA 2E9BA 3THDA 3VDCA 1I1XA 3B9AA 5AC4A 3ARTA 4P8VA 1DHKA 4U33A 3GDBA 1I75A 2WSPA 4TX8A 3SCPA 1HJUA 1XSKA 1EQCA 4QLJA 5A69A 3ZM8A 5A8OA 3ARRA 1PPIA 2OYMA 3BVUA 1B90A 1E6NA 2D24A 1MQRA 1ZBKA 1L8NA 1CGVA 2QMKA 3EJTA 1QHPA 5C8BB 4NRSA 4HU0A 3RILA 2VI0A 1EGZA 3BAXA 3EDKA 2XM1A 4OOZA 4F9DA 3CHCA 3WUBA 3TA9A 1OBAA 4AISA 5FIPA 3N1AA 2YIHA 3SCOA 1JF5A 1UD5A 4P7NA 5AYBA 2VCBA 1EO7A 2EJ1A 4WLCA 5E70A 3GZAA 1NOUA 3AQUA 1Y7VA 3BAJA 4NRRA 4JFWA 1BGAA 1XH0A 1TQUA 1MW2A 4AD1A 5BYWA 4LYQA 1B30A 1R46A 1GOOA 3BVVA 2Z1KA 3VD4A 5D8WA 4MJ4A 1XGZA 1XCWA 3AXXA 1B3WA 1EOKA 4BQ2A 1TVPA 1QX1A 1HVQA 1QBBA 4F79A 3WEMA 4V27A 2VL4A 3ZT7A 1V6YA 1CIUA 2F2HA 5FOOA 3LPOA 2A3HA 3AS3A 1Q6GA 1EA9C 2BY3A 1NM9A 3A3HA 1C3FA 3WUEA 4B16A 1C7SA 3FW6A 2V38A 1NQ6A 2W63A 3RPMA 2E0PA 1E43A 4CD6A 3MV01 1E0WA 4DWSB 3UEQA 3LRKA 3MANA 5CLWA 4FNRA 7TAAA 1OIFA 4P7QA 4BCEA 5M3WA 3MV11 3PZNA 4N0RA 4NX0A 3GXDA 3K4AA 2WSKA 5E09A 1JZ5A 2YJQA 2J7FA 4W7VA 4MADA 3KZSA 4GI9A 2ZUTA 2CCRA 5EBAA 1E4NA 2WYSA 1VJSA 3ARSA 1TQVA 3HG5A 1W1TA 2Y5EA 4H04A 2J8GA 1F4AA 1JF6A 1KWGA 3LPFA 1ZBWA 4EKJA 3EMQA 1K9TA 1CGWA 4FLRA 2VX4A 1CGTA 3ARXA 4PTMA 2BFGA 3WMCA 2VR4A 4CVUA 3WY1A 1EDTA 3VIGA 5CZKA 3VD3A 1H3GA 3FAWA 4P8WA 1LLOA 4D6FA 1UKSA 1TG7A 2VZVA 3WH9A 1NOWA 1UWSA 1V3JA 1SZNA 3UR7A 1H49A 4E8DA 5A1AA 1I1WA 1Q6FA 4QFUA 2WMIA 4J28A 3W26A 1K9DA 3IK2A 1VEMA 5EFFA 3K1DA 1VFUA 1N82A 3DHUA 1B2YA 1OT1A 2A3BA 4J3TA 4ACZB 2BXZA 3CUHA 1GZJA 2FHBA 1ZU8A 2CNCA 4U3AA 2EADA 1GNXA 1QBAA 5EB8A 3QHMA 1JYXA 2CBJA 4H8UA 3AS2A 1W91A 2NT1A 1J0YA 3D52A 4PMOA 8A3HA 1ZB5A 2BHZA 1YHTA 2Y8KA 1HJXA 4OJYA 5A6LA 3MMWA 3EDEA 1GORA 2QV4A 1JNEA 2UY3A 2XFYA 2PC8A 1KCLA 1GQJA 3BUIA 2XVGA 3L4YA 3ZR5A 4KGLA 3NDYA 4W8BA 2WCGA 2VT0A 2WVVB 4L4OA 3VPLA 2WWCA 3ZO9A 5DT5A 3F4VA 1PX8A 4UFHA 1BAGA 1E5JA 4JCMA 1D2KA 1CXIA 4IM4A 1NWRA 1AQ0A 2G3JA 1CXLA 5IFPA 4J7RA 3VDBA 1PZ2A 3N04A 3PZQA 4PMVA 2WHLA 4PMDA 1HJVA 3WQ6A 3TP4A 3EDDA 2E9MA 2W66A 2EPMX 4J3VA 1E40A 5HDRA 1KQYA 2WAGA 4H8HA 4ACYA 1O7DC 1U30A 1OD8A 4N42A 5CLTA 2C7FA 3VTRA 4DO5A 4X0NA 2V3DA 5M5DA 1J9YA 4Z2GA 4BQ3A 1CEOA 4KGJA 3T2PA 2VZTA 2PB1A 1ZJAA 1UKOA 3GBDA 4D6GA 2BXYA 1JI2A 4AEEA 3B8SA 2WM0A 1DWGM 4PTXA 2AMGA 1GW1A 4LYPA 3BUBA 3GXNA 4AXNA 3OLIA 3AHZA 4ATWA 3GNPA 2XGBA 3DECA 2GK1A 3KL0A 2EBNA 2VTFA 3WIJA 1VFFA 2J7EA 4V2XA 1US2A 1UKQA 3GXPA 4ZXLA 1E6SM 2D1ZA 3OZPA 4NXSA 2D22A 3FHQA 3UCQA 4W86A 1BYBA 2BY2A 3FHAA 1XH2A 4PMZA 1TR1A 3VSUA 3IAPA 1M04A 3WNPA 1UHVA 1WB0A 1HP5A 3DHPA 2WPGA 3ECQA 3LXBA 3BSGA 1W1PA 3VIIA 4BA0A 3AJ7A 3H53A 2MANA 6TAAA 4H8VA 1FH9A 1CPUA 1RPKA 4PUDA 3SCVA 4JL2A 5I24A 2DSVA 1A3HA 2WHJA 2A3AA 4FNQA 1VB9A 5TD4A 4JKKA 3W29A 5E1QA 1HN1A 3MU7A 1R47A 4L4PA 4S3KA 1AVAA 1E73M 1GOMA 3T2QA 3D5HA 3TOPA 2WW5A 3VIOA 4PMYA 3BCFA 2CXGA 3HG3A 1RP9A 3O9NA 3RCNA 3SUSA 5CGMA 3N17A 3AROA 2J62A 2PBGA 3TTYA 3S2CA 1J11A 2FYVA 1EXPA 1WDSA 5I77A 3NIYA 3EJSA 3WD3A 2DH2A 4JFSA 2ZUMA 1JAEA 1UWRA 3T09A 2YKKA 3AI0A 4TX6A 2O9OA 4MPKA 3POHA 1HXJA 1QI4A 3T0BA 2BY0A 4AIOA 2YA0A 1GCYA 1CWYA 3M7SA 1CXFA 1J0JA 3TTSA 1E6ZA 2VNCA 1BF2A 4FLSA 1EOMA 4QCEA 4P8UA 1Q6DA 3GXIA 1QOXA 4HOZA 1LQ0A 2OWXA 4D6IA 4M1RA 2CERA 1V6WA 2HISA 5AYIA 4QDMA 4MTVA 1IT0A 1GUVA 4W5UA 4FMVA 3ZJ8A 2OWCA 5FD0A 1WNOA 1BLIA 3U57A 5ABFA 4U5IA 1W1VA 2Y24A 1TE1A 2XUCA 4F9JA 2WC7A 1OGBA 1NP2A 5CSYA 4C7FA 4UNIA 3WD1A 5A2BA 1BTCA 4LX4A 3WY3A 4D6DA 3AS1A 3RMEA 2X0YA 3S6TA 2DDXA 1HL8A 1DWHM 2YLAA 4JKMA 4FK9A 1W1YA 4CD8A 2VCCA 1C8XA 3WDJA 5BWFA 3CZSA 4A4AA 3OGVA 4UZUA 1TA3A 1CLVA 1EHNA 1E0VA 2WMHA 4UOJA 3PZMA 1TVNA 4ACZA 1B1YA 3TONA 1L0PA 4P7RA 3L4WA 1G1YA 4H41A 2YLLA
chains in the Genus database with same CATH superfamily
1ELSA 4QWWC 1EUTA 4YN5A 4BKTC 2EC9U 1MFBH 1TCDA 3VX0A 1XGUA 2VN7A 2VGBA 3EJJX 4HZ6A 3ZZQA 1BGGA 1A5BA 2WMIB 4K2UH 2VLRA 5KN5B 1M7JA 3P0XA 1AIZA 5DJ0B 5LSMA 2D7TL 3LH8A 1VBRA 4I3SL 1FFNA 5FJJA 2GEQA 1AZ1A 4BQ4A 3QEUB 2OZ8A 3UPBA 1E2VA 3J07A 3RHWF 2Y69B 3IGXA 4G8EB 3RVWD 1HEHC 5D4JA 4WWOA 1FYTE 4JHZA 1NKOA 3R0DA 2I17A 3FQNB 4ZPTB 4FF5A 4E2DA 2PU1A 2E46A 4JYFA 1EZVY 2WIMA 4TUKH 3CHVA 1DE4A 1HXYB 2NR6A 2QSCL 3CAWA 2XSKA 2CZ5A 2AVGA 4UTBH 8PAZA 4ODHH 2OX1A 1MXGA 4Q8PA 1VPOH 1RMFL 1U1UA 2IXUA 1TJ0A 3L3GA 4W68A 3WBEA 1EEYB 3NXLA 2N7BA 5AW2B 5D7JC 1VH7A 4O1AA 3KPSA 3R5EA 5KJ7E 2EDBA 1K77A 2IXQA 1TPXB 5AC6A 2A74A 4Y9BA 3S96B 3D1MC 3LMJL 1LQBC 3GI9L 3LCFA 4XXDA 4GKSB 1JPMA 4XB7A 5DBUA 3VDHA 4BBWA 1F41A 1FIEA 5F6IC 3LKPB 4Y5XA 3QZLA 4Z77B 1PYWB 5IUCA 4NRYA 4PJ5E 1N6QH 2JSFA 3GSRB 2CHXA 3KTSA 4DP9X 3VM7A 3VI3E 1CU4H 4WKFA 5LA2A 3MJ8A 4GXVH 5DQDH 1I8UA 3W37A 3IFLH 2MNUA 1KCUL 4QDWA 1K5WA 3ZE1B 5MI0B 2FJKA 4DWSC 1A4CA 1QABA 2Y07H 4AYFB 1KPRB 4F37K 1RZIB 1OFPA 4LT7A 4NQEA 3V4UH 4CADA 5C0GB 4A22A 3PG2A 3BQ5A 1FDZA 1RZGA 3L1EA 1MHHA 4F93B 1DQDH 3IDIB 1MRFH 3EKLA 5G2HA 5CPMA 3Q6FB 3TBSA 4XOCA 4N2CA 1XDLA 5AVUB 2A6KB 1JGMA 3MV9A 1F90L 4NZ4A 1KXTB 3MLVL 4TRPH 1V0NA 2K9UA 1F4WH 1FCVA 5I82A 2NY0C 4XIMA 1BFOB 4F48A 5LAXB 1MFAH 3VILA 1TJ1A 1R0AH 1U3JA 4K73A 4F8PA 3HZVA 2WLZA 1HKKA 2WXOA 3M6YA 3P3BA 2HNEA 3OZOA 4G8EA 2W65B 3DVFA 3FB6B 4XD4A 3NK4A 4K9EH 2OMTB 3SKOA 3I2CL 3P67A 1KLZA 3X11B 1UCBH 4PBVC 3PGCA 1HXYA 4MS8C 4AD0A 2WY3B 4R9HA 4K3HA 3GTNA 2OFJA 1UACH 3U9PL 5FPIA 5TE7H 1LTDA 1U42A 5JPNC 5D6DC 1V6XA 3BP6A 5FA3B 4H6EA 3LZLA 3CUGA 4W9CC 3THUA 3PZIA 3O0RL 5A6MA 2Z8VC 1IEHA 3HNTH 3T40A 4FG4A 5ICUA 2B1HH 3S96A 3AZTA 2WMGA 3UAJC 1X6NA 3BX7C 1WKYA 4HUKB 1I1FB 3LKPA 1UR8A 4Z77A 4KDTC 4UOW0 4WEBH 3K7UA 3OKMA 2B2XH 2CO7A 4L0ZA 1H6FA 2CW6A 1IXOA 4MFEA 2OMYB 1WEJL 1GJWA 2JKAA 2VR6A 4PL1A 2LU4A 1Z89A 1VKFA 2HKHL 5IJBC 4KNQA 4ROPA 5A6KA 1L9SA 4XIAA 4ZMPA 2ZDRA 4BI7A 5HI5D 2PCYA 4UBDC 4BF7A 4H6RA 1RJCA 3CUZA 3W7HA 5I6KA 5FSEC 4TNVK 3VRLF 4AYFA 1S5NA 4LCIL 4GUQA 4LCQA 2ZKHL 1KPRA 3TJHD 1IAII 4ENED 2WZHA 4A6YA 1SHXA 5HHOD 2BNQB 1OINA 1AQMA 4WHYH 3BT0A 1MKFA 3SIKA 4O54A 3VXPA 2V2TB 4JO5A 3ILQD 5C0GA 1RZJH 4PJEA 4B9YA 1P4CA 3RX7A 1TWDA 1HH6B 1S3RA 1MMFA 3GR7A 1X97A 4YBQC 2FK9A 5BWAA 1ISXA 2YPLD 3Q6FA 2BRRL 1VLIA 1GHSA 3EJCA 2UUDK 4FP8L 1B4KA 1Y0LA 2XQYK 4EI6A 1CZ1A 1YTKA 1OPOA 5FCZA 3UAFA 1KXTA 3UR8A 3NSYA 3O6ML 4BSVA 2QHRH 2HTLD 4QQUA 1BFOA 3A22A 1D8CA 5JW3L 4MYWB 3HE6B 4JREC 1J0HA 3N6HA 2VEKA 1AFSA 1KIRB 1M9SA 4N4YB 2ZG2A 5FL1A 4KKBC 3UPAA 2W65A 3OLGA 3SE3A 4ZX6A 1HUVA 4FI4A 2OMTA 4EE9A 1CNVA 2LAGB 2X0HA 5GGVY 4H0IA 2DZXA 4GRMB 2X12A 3WFAA 4X6BA 4ES8A 4LT9A 3G04B 3FCTB 3P0YL 4LNYA 5BOJA 2J1WA 1QNIA 1TCRA 2F7IA 3GRWH 3E9AA 2ZQKA 1VENA 2YZ5A 4KAQH 1PSKH 4G6KH 3CDZA 3B2VL 3EWBX 3DX7B 4OW6A 3L9EA 2PGRA 4BH7B 3QJAA 3NTCL 4Q89A 1I1FA 4TULH 4LSVL 3VB9A 4B15A 1T1XB 5I3DA 4QEEA 1NFGA 2XWTA 1BWMA 3T77A 5BRQA 2A77L 2P43B 1UZHA 3WUWG 5FGCE 4Y2WA 2NYYD 4MWAB 4BWTA 3V52L 3RGVD 2V5TA 4XE5B 3ENLA 1UB3A 2W61A 3BDYL 4O0ZA 5F7BA 2CZVA 3T0AA 4F24A 3KX6A 4ZOBA 2VR2A 4I9TA 2WAQA 5AW7B 4B9PA 2DI9A 2BNQA 3G5XB 4Z95H 1I1AB 4IMLB 5J6SA 1BXVA 5ENLA 4M1CC 3CBRA 1T0MB 4LCWD 4A2GA 4ERAA 1MLBB 5CG0A 2R0ZH 4JS7A 3UA3A 1SSDA 3UESA 1NANH 3PWLA 4PTDA 4XNDA 5C09B 4XO9A 2V3EA 3EJUA 2B0MA 4PWGA 1J96A 4F8QA 1RLBA 1U8PA 4N2AA 4JG5A 1RIUH 3O9WC 4X0KA 4KKAC 2OCZA 3GHEL 2VLJA 1UTDA 3E2HB 1RH8A 1H62A 3ILPB 3QDMD 3WAKA 4AVKA 4JCWA 4B9IA 3O6MH 5D1XE 2D7OA 1QFUH 3WLRA 1RKRA 2AJXH 4LPTA 2VCAA 3BJ91 1Z7AA 2NLYA 3WFDL 4HUUB 1RZKL 3QDJD 4C4KO 4Y2OB 1KIRA 4Z7UB 4QUOA 4D1IA 4WIQA 1EV2E 4DEUA 3V0EA 2VD8A 5BRZB 1BWWA 3OR6B 3FA4A 3SDCD 3NFPB 2Q86A 4NM8H 1FAKT 3QYMA 1OAJA 3FK4A 3QYQA 1GRWA 4NQVB 2BP0A 4GRMA 1R8LA 2NQDA 4GH3A 4UFMA 2XQBL 4OIFA 4YCOA 4L1XA 5GS0C 3ARYA 3NQ7A 2CUAA 4HPOL 1FI8C 1OGAE 4GQPH 3EYPA 5EEZA 2OR8A 1W16A 2X6UA 1GYVA 1SOXA 3D6GA 1OCOB 5TH2A 4WCJA 2LFEA 4LV9A 5C7VA 2IUZA 3IPFA 3BAWA 3CUJA 4FEZA 1YPFA 1C8QA 3BWUC 2NQJA 1J18A 3OWRA 1H0DB 4HA0A 4BH7A 1IGIH 1I82A 2C1OB 2PDQA 3B2VH 1WA0X 1SBSL 5DD6B 1T1XA 4WKZB 4MQSB 1WXYA 1D5IL 4ERSL 5C71A 4XKYA 2G60L 1ZLWK 2CPUA 4PTTA 3STFA 4KVNL 2GJRA 5TJWK 3M7OA 5AKSA 2A77H 3FJNA 4MWAA 4J3WA 1NEUA 4PJ7F 4AZUA 4NKCA 4UZSA 3HN3A 1M05A 4I3RH 2J79A 1HP4A 4PJDB 3EMZA 1JNNL 5EU5B 1GMEA 4ONOA 2XFGB 3ZU8A 4IPNB 3ARQA 5C7ZA 3FB7B 5DLMH 4BI6A 1EPXA 1I8KB 3DO3A 3GC3A 1F8MA 1R86A 3BMVA 2E6FA 4ECLA 3BP4A 4WI6A 4HT3A 2Q8XA 2ESVD 1JS4A 3G5XA 3JVAA 1I1AA 4IMLA 4CNOA 5AD0B 3B0YA 3U79A 1T0MA 1XG4A 1P4UA 3OVUB 1MAML 4AJWA 3QIWA 1BYCA 3FT2B 2FMNA 1KB9K 3B2DC 5J6HA 4AHPA 3IFNH 3TNMB 1Y6MR 1GL4B 1R3VA 4K7PX 4I1RA 3SBFA 1YNLH 2VRAA 3MLYH 3VZZA 3MV8E 1UKTA 4HETA 2DLTA 5TFSH 4LSQL 2BCKB 5J0BA 3NA4A 1O5DT 4LAZA 1JDDA 3ME0A 5C9RA 3PSVA 2PYEE 2EG6A 3A24A 1F6FB 5FCSH 2VEGA 4HUUA 2CITA 1MFEL 1XF3A 4UQBA 1LQSR 2NW3B 2CBTA 1SJAA 1K8DB 1QO2A 1FORL 1WT5C 2AHIA 5BRZA 3OR6A 2MOGA 2W3ZA 1TF4A 5D1QD 3K6SB 1QRND 4IF2A 3IGUA 4H9UA 4K8RL 3S37L 2P8MB 4PP2A 1JZ4A 3A9BA 2QGHA 4NQVA 2O6EA 1AE6H 5EWIL 2WO3B 3EA3A 4RMWA 3ZLFA 4MNKA 1KN2L 1QSFE 1TJIH 3RPKA 2CCLA 4UAHA 4Z7NF 2VDMH 4QY8B 1GOIA 3C5QA 1A25A 4F0SA 2AL2B 4YPGB 1ZVSA 2CWRA 1E6XM 4S0TD 2WSQA 3W88A 3DVIA 4IFKA 3KPMA 4X6FB 1OAYL 1CG9B 3KGTA 3W7IA 3WF0A 2GY7B 2F19L 1H0DA 3VXUE 2BJML 2C1OA 4MCYB 3QQXA 4PLKD 3D4YA 2AXGB 3S2NA 1A7BA 4ZFFB 4S0SD 1RUAH 1SBSH 1N0XL 2EXWC 2IGFH 1HIZA 1U58A 5GSVB 4JG1L 5MKGA 1JVLA 3VNLA 4PS3A 5BS0B 4MY1A 1RHCA 5D30A 3TA3C 3QEQB 1H61A 4HZ7A 2ADFH 3VGGA 4HS8H 4XZBA 2HWZL 2HRPL 5EU5A 2YGVA 1WAAF 3V4PH 5F3HB 4C56B 1FVPA 4F7EB 1KR0A 4IZGA 3FB7A 4JM2C 2ODHA 2NRDA 3QXTA 2J7HA 4FJ6A 3NRPA 1DTUA 1R6VA 4PEKA 3MRCB 3V6OC 3OHXA 1X9QA 4MB1A 4JTRA 5GS0H 1XHGA 3F83A 5A40E 4OZHF 1X7SA 4APQD 4OZOA 1EMTH 2K3TA 3LHPH 5D4IA 3NA8A 1Z41A 5LDUA 3PQYB 3PR2A 1PL9A 3TNMA 4JZNB 4NN6B 1S2VA 3FBKA 1B3OA 2YGOA 4EF8A 1F3XA 4KITB 4LLYA 2YRBA 3FCBA 2C1GA 1P2CB 3QMRA 2DS4A 2A1WH 1HFUA 4LSQH 4JQIL 4L3FA 5JQIB 5I1IH 1N5AA 4PV8B 3EG9A 4KI1A 4U1IB 4JFWA 1JGDB 2PCFB 2YB1A 3BVVA 4KJPD 1XGZA 1IWBA 3MYJB 1VP5A 3KUMA 4FFVD 2ADYA 3NL3A 4PIRF 3T6ZA 3K5XA 4Y9NA 5HNRA 2P50A 5J89A 2DMGA 5E9DB 4JTCA 1FZJB 3LIUA 5J13B 1M57B 1IT9L 1TVHA 2X9YA 4IMCA 4JJOA 2E0PA 2EXYD 2JIXD 1ONEA 1IQ8A 4RR4A 3LB6C 4A1RA 3MANA 3LJ3A 4NAEA 4UTTA 1XIIA 4FNRA 2M83A 4P7QA 3PWJA 5M3WA 3S37H 1MCBA 1U5HA 2R27A 1FYTB 1JJKA 2FZ8A 4KHTH 4QM1A 3WJMA 1IBZA 1RSCA 5FYLL 1TQVA 2Y5EA 2C4FT 2BW4A 2AJUL 2Z0IA 2JJUA 1CGWA 1G7HA 4P57B 4PTMA 2BFGA 4QY8A 2VR4A 4KV5E 5IBTL 2QQKH 1AGEB 3AVEA 3GMMB 3DBXB 1LLOA 2KL6A 3OJDA 2DMCA 2NXYD 4X6FA 4L23A 3W0WE 3IK2A 1MCPH 4DB7A 5DRCA 4MCYA 2RFGA 3O7UA 3EAKA 2AXGA 4YJ5A 4ZFFA 4ACZB 4YL2A 3MRDA 1M7PA 2OXNA 4MNQE 4KWSA 3KWUA 2VZ3A 3AS2A 5F93C 5GSVA 4X60A 2PTUA 1N0XH 3QG6A 5BV7C 4PJ5B 5CMAB 2QV4A 3QEQA 2ISFA 4XCCH 1NOAA 2A6IB 2GC7C 2FPYA 3E2SA 3VI3B 3JV0A 1XLCA 3QS3A 3FFSA 1RCQA 5FAJA 2PMZA 4WWKB 3UWVA 5TDOB 3UPWA 3UT0A 4N2KA 5GGTL 3EWXA 4F8TA 3MRCA 5J3HC 5DZNA 1ICQA 2IJ0C 4U6HB 2IBZY 4DUOA 3VTRA 2XTJC 2G5BB 1CMOA 3BQUA 1UKOA 3SGJA 1JI2A 4AEEA 1J5DA 1HCFX 3PQYA 5GGQL 3BUBA 3GXNA 3OJGA 3ESVF 4LPXA 3T0TA 1KIQB 4LEBA 4DEPB 1A3RH 1VFFA 4POZD 4HDIB 4QDGA 4NXSA 2D22A 1XB8A 1BYBA 4IYKA 4Q52A 4XVUD 4ZFOA 4NAFB 3SKJH 4PV8A 4U1IA 3ECQA 1RXOB 4O11A 1JGDA 4IRJD 5F9OH 4KT2A 4Q14A 1ZIAA 5EZOL 4JHWH 3MYJA 4A2EA 2QYGA 3TO4D 4UBPC 5I66B 1JNHA 1NBZB 2NY2D 3SUSA 3ANVA 3AROA 1FZJA 3TWAA 1A5UA 4TLTA 1T1WB 2XKSA 2AK1L 4YIQB 1HK6A 4ZFCA 5ANME 1PB0A 5HDBF 1FYTA 1CXFA 2CK0L 4R97B 4H0GA 3UXLA 3QRBA 4K2SA 2ALAA 2P46B 3GVRA 2DDQH 1V6WA 4CNNA 1SJEB 5TE6H 3WLNA 2JBMA 3ZJ8A 2CO6B 4P57A 4FXFA 1PSCA 3DBXA 5IM7A 5GGTA 4O14A 2I16A 4DIAA 1GPOL 3QQ1A 3CT7A 2X0YA 3LTYA 2YLAA 5AYUH 4CD8A 3ELAT 1GGCL 4XCYB 3QORB 4HIJB 3IGHX 2WMHA 2RFXB 4ACZA 1YYMH 4G7VL 2DJXA 4GIRA 3AXHA 5IREA 4GZEA 2H3BA 3BGAA 3HZMA 4ZZ9A 4DLMA 4RISH 1NFPA 1PKQE 2NY7H 2PZNA 4PJ5A 4P2OB 3G5EA 2NX1A 1IFRA 3C6EA 4PJ8B 5H2BB 5ACMA 4NT0A 4DKTA 4HN4A 4GAGH 2A6IA 3ATDA 5CILL 5JW4R 3ZE1E 3VI3A 3WLLA 1HH9A 3QAZB 1HNGA 1R3QA 2GTZA 4IFRA 3WKZA 3QWOB 1ZLSH 2J7DA 3IXAA 4D0CB 4U6HA 1JYWA 1SRDA 4K36A 5FF0A 1ML0A 4NJ9L 3ULUF 1NFDE 3B3DA 5U7SA 4PJ9A 1KJ2A 1RP8A 2DPEA 3K80A 1ZV2A 3UWWA 1NDYA 2VX5A 1A66A 4M1DH 2YJLA 3QDGE 5DJAB 4L05A 4O5LL 3VGHA 2A85A 3M0VA 4BRJA 4XVJL 2OL3B 1HE8A 5EU7E 3TM6A 1Q8AA 1WCBA 2GOUA 4N9BA 2HS6A 5HHVL 4Y89A 4Q6IA 4PREA 4O1FA 2P8PA 4EIGB 1MXDA 1HL5A 4MQXC 3FN9A 4IJCA 5GS1B 2DQCL 5CGBA 3IARA 1PTGA 4BXSV 4IGBC 4PB3A 4PPTA 3EJYD 3GNMH 1PL3A 1BM7A 4BEIA 1GVSA 5DXYA 5GRVK 2F1AA 4YS4A 3VD2A 4QQ3A 3X13A 3ZN6A 1KZQA 3V0GA 4P59H 3QUZC 4HPXA 1T1WA 5FYJD 4HYTB 1IM9B 3OGCB 2TSYA 4R26L 4NZRL 1AHMA 3H6OA 1TITA 3LZFH 2WMFA 2JKJA 3ECVA 3SBWA 4GJIA 2FLBT 5GJTL 5DMIL 2OL3L 1F3DJ 1WIUA 1AL7A 2Y8UA 2GQ8A 2C4XA 2QQLH 2VE6B 2I5QA 4NQTA 1A47A 5L4FA 3CFKB 3AUWB 2GUYA 5E24E 1SJEA 1L2QA 2WZPD 3TXZA 1JWMA 4OUEA 5HINA 1H41A 2IAND 4XCYA 4XXCC 3SO3B 4JDYA 3KVMA 4JXCA 3LPWA 3V6ZA 3S35H 1TYEB 2NUYA 1JZ8A 4C6KA 5ILTL 3BKML 2K3HA 1OD0A 3HC2A 3W7OA 1KJMB 1E9IA 1HINL 5FOBB 3DIVA 1NSNL 3HRZB 3TS8A 3N3EA 1SSGA 4WDIA 4P2OA 5I1JH 4DO4A 1FWCC 1UWIA 2HTKD 2QBWA 4UNVA 4S3CA 4DF1A 2Y9RT 5JZ7D 4MBRA 5DQPA 1G5GA 5FGCB 3X3FH 4GZIA 3VFPB 3TYUA 1XLLA 1MW3A 5E0KA 1N26A 4C7GA 1O94A 1GYUA 2YXWA 4PB9L 3NSXA 4DVBB 2NW2B 1MUCA 5KYWB 1YNKL 2W62A 4M4PA 2OMXB 2XZCL 1B6UA 3TCEA 4X6CE 1E5NA 5DJAA 2Y5QA 1B0GB 1AW1A 2IAMD 4EIUA 2Q6WA 3MU3A 3GWJA 4O5LH 2OL3A 1R3RA 3AUJA 1DJZA 4U6VL 2K45A 3BVNA 1AI1H 2YD3A 1F3EA 1BSIA 1RZ7H 2O55A 5E1AB 5E94B 1M5WA 3GK8L 2EINB 4X83A 5G5IA 3KVQA 3UZVB 4HUNB 1E30A 1VPYA 3GO1L 4ZX3A 4P4KB 2AEIT 4LS0A 3HS0C 2CKRA 1XIMA 1Q1JL 2GFTA 4L4TD 3RZCD 1A21A 3IDGA 1W9BM 1QNZH 4L3ED 4L2YA 1BAFL 4DP2X 1PKOA 2DZBA 1WKFA 1AKJB 1R19A 3WBDA 4HJ0C 3LCGA 3OGCA 4S3DA 2J9XA 3ARDB 1E56A 1KLGB 4KK5C 1UD3A 3ETSA 5CM1A 3GKWL 4OJEH 5D96B 3KH3A 3DIDA 2GWGA 5GJTH 1JF1A 3A3XA 4CNPA 1BIHA 2VE6A 3W9DB 4DPPA 3CFKA 2FX7H 1XR8B 1JCKA 5B1BB 1DE6A 5CIPB 4UTJA 3R19A 2DWYA 1TV5A 2IQ9L 2ZUYA 3A0OA 4ADGA 1MJ7H 3TYCA 4PMJA 5E5MB 4MMYB 4GS7C 1NH6A 5LXGL 3TC3A 4BELD 1K02A 1IWAA 2PUZA 1Y1UA 5IP4A 2CLOA 3FT4A 3UYPB 3BP7B 1SQMA 3OKYA 1DVYA 1ETZB 3LEVL 4JQ3A 4F2MB 1CUOA 1GGYA 2DICA 2VFHA 4ZUWA 2QKIB 5I74C 4AD5A 5C08A 1XPGA 1QWHA 2V2HA 2J66A 3E1F1 4TQTA 1FO0A 5C0DB 2GWNA 2VQ1B 2DYPA 2DW6A 3OXRA 4JFQB 4DQAA 1EJOL 3ECUA 5GHWL 2OMAA 2QIWA 3B04A 2WKLA 5CJXA 2HPMA 1QNQA 4OT1L 4HW6A 2AVFA 5DC4B 3CCHA 1KO0A 2CQVA 1RFDH 4KTDL 4L1WA 1E8ZA 4XOEA 4DVBA 1M9HA 5AAPA 2NW2A 4YHNB 1R3HA 1VZWA 1MG2C 1AXTL 1ADQA 3S3PA 4ORZC 4TVSa 4BDVA 4S0HA 5GZOA 2HK1A 5J5RA 1K8ZA 4PI0A 2XZCH 1B0GA 5C09E 3UAAA 2RHEA 3E2QA 1QXLA 3FPXA 3VGBA 1QASA 3RLSA 2AXJA 1RI8A 3OYXA 5E1AA 3UJJL 4I18B 1KFAH 1P0KA 1NDMB 2J72A 3MHGA 3TEWA 3MV8B 4AC2A 3UZVA 2NXHA 1HYSD 5BOFA 1EDQA 1P6CA 1B3IA 2O4MA 1E6PA 2C3GA 4X4YB 4Z7UE 5F3FA 1IGCL 2PYEB 4AUJA 5DJYA 4NKMB 5D1XA 3G8RA 2V6HA 3GMRB 1UH4A 2DQXA 1TQWA 3QJZA 3W1RA 4DELA 3WHE1 1TV3A 1IEBB 3SKMA 4LUSB 1L6GA 5T3ZL 3ZDYE 2XRAH 2IPUK 3DGDA 1OKEA 4BFFA 4AX3A 2QJMA 1IBFA 1EBPA 1XDMA 3PJUA 3VCCA 1M41A 3V0FA 3NYDA 3REVB 1FL6A 2PXYC 2QHLA 3OHMB 3HC3L 5HYQA 1FWFC 1H8NA 3VGAC 3K30A 3SPVB 3D33A 1WBXB 2OW7A 3RGTA 5DEFA 1PLGH 5HJYA 5CIPA 2XGIA 1CTNA 3DX3A 1OGAA 4HK7A 4ML4A 3MNWB 3PAOA 2X0UA 2E6AA 4MMYA 1TZIB 5KBKA 4EE2A 5CBBA 3H42H 1CBGA 1VGEH 1HZYA 3P9MB 4UTAA 3GBMH 5GSRA 3UYPA 3BP7A 1ETZA 5EU6E 2EO7A 3IK4A 4QIUA 4KK9D 1G7IB 3GJFB 2DP3A 4U2ZA 3LEVH 3VXUB 2ZOXA 1W0WB 4FQCL 1A0QH 4O2EA 2ZYRA 5GZND 5C0DA 2P1YA 5DO2D 1KB3A 2BIMA 1PV8A 1S9YA 4BXVA 1KXVA 4JFQA 1P5VB 1BWLA 4PJDE 4X50A 5HHNA 2EAEA 4IWWA 5HJXA 1E4JA 4LANA 5C07D 1DEDA 1ZHBB 5AL8A 3NL5A 5GHWH 1FCGA 1XB3A 2ZC8A 4QMEA 1HW6A 4DJED 3MJYA 3VRIA 5HGBA 4YHNA 5EPMB 2XZQL 4OZ4B 1HQRB 5GVJA 1RUMH 2VD9A 1OP4A 1U3HC 1XRFA 1DDHB 5D6CA 3IAQA 4KWUA 3DJ9A 4A3UA 2W60A 2WMJA 5EULV 4Z3HA 5CG7A 3W9EA 2EDWA 3KPRD 2X2IA 1O5RA 1XMEB 5GQBA 2HJKB 1ITCA 1KV8A 4I18A 1SW7A 4R4FL 2LAAA 3IGKA 1ZHNB 4K2UL 4H8PA 4EO5A 1FNLA 5K69A 3A4JA 1CFTA 3S37X 3TJPA 3MLWH 3DUSA 3UERA 3L2LA 2B0SH 4ACPA 1IBDA 3GMRA 2UX6A 1WBYB 4A63A 3N19B 5EMYA 4AEIH 4QEHA 1IEBA 4LUSA 1J05A 2WAHA 5IBXA 2VUNA 4OGQC 3IFOB 5J4MA 3FF7A 5T3ZH 4UMBA 3WD0A 1OQFA 3KL3A 2BZCA 3QI9A 4TUKL 4ABWA 3REVA 4L9LC 5BW6A 4RDBA 4XPFL 3MTXA 5MF5A 4UTBL 3SPVA 1WBXA 5B3SB 5CXPA 3JUZA 1VPOL 3BSHA 2P4AB 2ZADA 4ZE4A 1AMKA 1QSFA 4P2CG 4YBHA 2ED8A 5DA4A 1I3GH 2OKMA 3ZMEA 2D2GA 1IE7C 1TZIA 4HOWA 1WBZA 2OZ3A 4XB8A 1MFDH 1SFDA 1KF9B 3KWXA 3W0WB 2Y5TB 4XR8C 4PY7B 3VXUA 3LXUX 1N6QL 2CUHA 5FSDC 4RZBA 1H09A 2XX0A 3I85A 2QF7A 1T0OA 4MNQB 2FWSA 3IMRA 5BS0E 3BSMA 2J7LA 5FO9A 1UZ6E 3UX9B 1UR2A 1AGBB 1P5VA 4GXVL 4A68A 5DQDL 4AMKH 1CCZA 1NC4D 3IFLL 5FYKD 2J7GA 4QLRA 4C56E 2PR9A 1EF2A 2P1FA 1GPFA 1T6MA 1X5LA 1IB5A 1HE7A 1S7WA 3S97C 3GFXA 4UIKL 4MXQD 4QT5B 1EYWA 1TJGH 5DVKA 2AF2A 3PWAA 4OZ4A 3SJVB 2HJFA 5FJIA 3KTXA 5KAQF 3RMJA 1US0A 3N2MA 4DH2A 3V4UL 4JRFA 3V7AG 4H2AA 5LGXA 2R9HD 4JFVA 3RPIB 2XA3A 4C6NA 3FH5A 1TQJA 2CDFB 5F2FA 3QXDB 3M86A 2WN3A 4M80A 2GIMA 1YMMA 4DOHE 5DK0B 1DQDL 1OT4A 1R85A 5FYLE 2HJKA 3O45B 4R85A 1BVZA 3RDTB 4UTBA 2JKNA 1Y1DA 5EU3A 4Z7WF 1E4LA 2VFIA 4UDTB 2YCLB 5IIEA 4PRHB 3TYFB 1YY9C 4R4FH 3QUXD 4TRPL 3REQB 3KBPA 2ILLA 5D09A 3HZKA 3CVHH 3LY6A 1F4WL 4E9SA 1MFAL 1IT7A 5G4EA 5ECVA 1UEYA 4WHYG 1R0AL 4MB5A 3PWNB 3TF4A 1WBYA 5E9DE 3ITLA 4J2MA 2Q9OA 1O1HA 3IFOA 2P24B 3HIJA 3GZ3A 4K9EL 1U8LA 1CECA 1OOWA 2FLMA 3EBIA 4Q22A 3SDOA 3TIDA 2F7RA 2GJXB 1UCBL 4REQA 7REQB 2GEEA 3N85H 4Z1YA 1X5KA 5ANMB 3U9WA 1UACL 1ULVA 4IMDA 5TE7L 5A95A 2RCSH 4YVXA 4XPFH 3WNOA 4Q8MA 4MZIA 2Z26A 4HJEA 1P0NA 3QP3A 3QRFM 4B3KA 1NGYA 4HJTA 1DVUA 2XJ7A 5E8EB 1F2QA 3EF4A 3PREA 3HNTL 1S9KC 4NILA 1GYAA 5AC7A 4UTFA 2B1HL 1OADA 3E9TA 2E9BA 2ZYSA 3ULAB 4L4LA 2ENPA 5F9JB 3V7MA 2OLAA 2PAJA 2YPVH 1DHKA 1H5YA 1FCBA 3FULA 4W9ZA 3FTGA 2LLEA 3W0WA 2HSAA 3B0XA 2CUIA 4WEBL 1MEIA 2D24A 5D7JB 5ISZB 2B2XL 4WJEA 3V4LA 4KETA 4MNQA 3TNBA 3QO0A 4P23D 1LOSA 4EWJA 3P84A 4DN4H 1NMBH 4HCLA 2Q3ZA 3RVVC 4MY9A 3T1WA 5F6IB 4NRXB 4C6CA 4P5TA 1PKQB 4GQBA 4GQGA 7PTDA 3BZJA 2LQRA 2Y62A 3CIXA 3MBDA 1HOCB 3B7RL 4QXWA 5FF4A 3RN6A 4NNBA 1B3WA 3HV8A 4G7YH 4JO3H 3H0TB 5EGRA 2WINB 4IJ3C 4ODBD 1S3HA 2BY3A 5CJOH 3NOYA 3N44B 4UIKH 2J55A 4IBUA 6PCYA 3WUEA 5MEQB 3QSTA 3TN6A 3LKNA 3NBNA 4BCXA 3NZUA 3U9IA 3WQDA 4KXZH 4DWSB 5K33A 4XOBA 5CLWA 1RZJL 3MV11 2F1EA 3RPIA 2BSSA 1YNYA 1BVKB 1NFDB 3U0TA 1WDDA 2YJQA 3PS7A 2CDFA 3PAZA 1SBBA 3WGVB 2PDXA 2JF1A 3QDGB 3CQKA 4E9YA 3MPCA 4AV0A 2JWYA 1OVZA 3ARXA 3RDTA 1KCZA 4UDTA 5M2FX 3TO2B 2J6EH 1SZNA 5DCEA 5FDWB 3C9NB 2QHRL 2WMIA 3RVUC 5KN5A 2E5DA 5IWLC 2G3FA 2RALA 5DJ0A 4LKXB 5E2UH 3ASOB 2CNCA 3PWNA 1QBAA 5HYFA 3WFHB 4XMLH 1J0YA 3D52A 3GIZH 3QEUA 2NY0B 3R8GA 3VU1A 3QIUD 3B56A 4TSAH 4R0LC 2EG8A 5H2ZA 2EE9A 4LOFA 2XZ7A 1AYRA 3FQNA 4XN4A 4ZD3H 4ZPTA 2VGFA 5AYYA 4PG9B 4Z3IA 1SUHA 5K2ZA 3GRWL 2JCCF 5E8EA 1U30A 1EHLH 4KAQL 5CLTA 3LZ5A 1EEYA 4X0NA 4G8GE 2AQTA 5IJVB 1PSKL 4Z2GA 4JFFD 3T2PA 4A2DA 4G6KL 3GBDA 5CR1A 5F9JA 5JPNB 4O1EA 5DRXB 1ZPTA 4ZW3A 2REQB 1PLBA 4TULL 4GKSA 2HPIA 4Z0SA 5AKQA 3KL0A 2EBNA 4X7FC 4XN8A 1PYWA 1J8SA 1DQJB 4V2XA 2EKCA 3FHQA 1KFLA 2Z6IA 3GSRA 1HI6B 3NL6A 2ZKYA 4NRXA 3VA6A 3BV7A 4BA0A 5CBEB 4HV8B 4JPKH 1NIDA 4FNQA 2DYRB 4PJIE 2DVUA 1OPGH 5E1QA 1UM5H 3H0TA 1DQQB 2GK0B 2Q8BH 2G4GA 1ZVNA 1FP5A 3P82A 1P0SE 2WJEA 3DN5A 3GPEA 3TTYA 2PBGA 5ACLA 3H2QA 1XF0A 5MEQA 2AAVA 4Z95L 1RZIA 4GLRH 4MPKA 1S9VB 3RG6A 1BVKA 1NFDA 1XGDA 5L88H 2R0ZL 1NGQH 4GQZA 1Q6DA 3LU2A 3U46B 3CZFB 4X6CB 3QDGA 4J2PA 2POZA 5AYIA 4QDMA 5C2CA 5E23A 4DP1X 1BLIA 4HJ1A 3IDIA 1RIUL 1PGRB 4UNIA 2ZBTA 3D34A 3TO2A 3W2NA 3C9NA 2A6KA 3GRWA 5IQ9B 1DWHM 4NUPA 1C8XA 4H4NA 1QFUL 4B3EA 3HZYB 5LAXA 2AJXL 5E5CA 4HTBA 1INDH 2A3TA 1SXBA 2XX1A 4KI5F 1ZS2A 1HZLA 4IRZH 3MCNA 1H3TA 3OIHA 5I18L 1P69B 4P5MB 4ZMAT 3T3PB 4RZ5A 4Y19E 4G8AC 1TWSA 3QWNA 1HNFA 3VFCA 4M00A 4NM8L 4JREB 2APSA 5KSBF 3A67H 3D4GA 5IFHH 3FB6A 3ECBB 5E8PB 1RY8A 4MJHA 5C0CD 1IBBA 1XINA 4OUOA 4QYAA 3X11A 1S7RB 1XW8A 2X88A 4U28A 1D7BA 3D85B 4ZOEA 2CRZA 1NANI 3ETBF 5DD3H 4X9GA 2A2IA 4V1DE 3FEMA 3IE4A 3OVPA 2EO1A 5F7KC 5FA3A 2DVTA 4EZJA 5DJ6B 4IIBA 3EPOA 3RIKA 4RE2A 3AICA 5D6DA 4GG6E 2UX7A 2L7QA 1JYNA 3KBHE 1IGIL 2REQA 2WXFA 3IJEB 3QISA 2VDHA 5TTRA 2Q8AH 1LG1A 4BFAA 5B7ZA 1C8PA 3UAJA 1BWKA 2BPBA 1HI6A 2OMYA 5DVMA 3VUPA 2VGGA 1XBYA 4FIQA 1DWAM 5CBEA 4I3RL 1D9KC 1R30A 4MOZA 4GOSA 1WUFA 4CSTA 4WO4B 2E3VA 3BKCH 5DLML 3ULVD 1Q9KB 4KXBA 2PDMA 2KAUC 1IAMA 1TVLA 3B2UD 4YQXH 1NP0A 1U1HA 1BD2D 4GI6A 3MRMB 4BI5A 3O6CA 3FQYA 1G4PA 4BUQA 3W01A 1S9VA 2V2TA 1I0DA 1Z3NA 4G5AA 3IFNL 3BANA 2GSHA 5CEYB 4X6CA 3E80A 1HH6A 2R7EB 2YO3A 1YNLL 1T83C 3O4LD 3MLYL 3D3AA 3OA5A 2J7CA 1V8EA 5TFSL 2B31A 3LX9A 2JK2A 2NSOA 1UWFA 4LHJB 1G94A 2VDMB 3WUWB 5IB4B 2WKOA 4HX1B 4FFWD 5T1MB 3WUFA 4FXSA 3PPCA 1IZCA 5FA5A 3HZYA 3QNFA 2HYMA 3WGUB 5DWUH 5ICXB 1HJCA 3U1SH 3HE6A 3O9WB 1LJMA 3AWFA 7ENLA 4FG2A 4AQLA 3SODB 5D9SB 4P5MA 3W00A 4XVTH 5I18H 1RVGA 5JIMA 3S2AA 4LH8A 3MSDA 3WK3A 1UR3M 1SO5A 4HGKC 1AE6L 3ZDYB 3Q2WA 4DY1A 3D85A 1TJIL 1NGPH 1ZAGA 3RTQD 1V0LA 1TTFA 2VDML 3G04A 3FCTA 3V4PB 3FNDA 4ICWA 3ULUC 4KNSA 2NY6C 2CZNA 3WF2A 2UXGA 5CZSA 3ZFHA 3SCMD 1CCWB 4P9MH 5L8JB 1B0WA 1UPPA 3SCTA 2A73B 4MNLA 3U3HA 4MMZC 4IK6A 1V05A 3T4AC 4F2ME 5BJTB 2AQSA 3TTQA 3VUSA 3IJEA 2MFNA 3DX6B 3DX7A 3TH4T 3GLCA 1V3IA 1DVTA 1F6AB 3L8QA 3FZUD 5IMOB 2B81A 1RUAL 2JJTC 2FGBA 5EU6B 1DWFM 1FWBC 2PWEA 2WNKA 5E1GA 4LOVA 2IGFL 3FQXB 3H7BB 2BC4B 2VC2H 5AG9A 4XAPA 2VDLH 2VMJA 5E0CA 2ADFL 1I8AA 4HS8L 4C55A 2WB5A 4S1FA 3QHOA 3URAA 4MKSA 3IIXA 1A80A 5JDJA 2VAAB 4H7CA 3V4PL 3GIVB 4WO4A 5AWNL 4KNTA 4WI8A 3ZKSD 3VIMA 3TX4A 4E0CA 1PU0A 3LG3A 1P84J 4ZQMA 4MKTA 4R4BB 2F6KA 4X7TB 5GS0L 3KM8A 1CDIA 2V5SA 4GRLD 2WZAA 5JXQA 2IDTA 3FQWB 2X38A 1TRIA 4XBGB 5T3ZE 1EMTL 3LHPL 4CD4A 4GT0A 2J4GA 1G84A 1IEQA 5BOZG 5IHRA 3EHBC 1GGIH 4Q74A 1MLBA 5CEYA 3ARVA 3WJXA 3AWEA 5SWUA 3CMJA 5C09A 3GNDA 3WBAA 1XR9B 1LTXA 2JKXA 3D25B 2A1WL 1QLFB 3WUWA 1RUQH 5IB4A 3R2GA 1RLCL 3SDDD 5I1IL 4DNLA 5D1ZD 1MCCA 3ILPA 5E5LA 4AEFA 1Z48A 2O6CA 1B3JA 2ZAIA 5FKPB 1T03H 2ICCA 3LDVA 4Y2OA 5D9SA 4Z7UA 3TEYA 3P4LA 1PYMA 2ZFAA 1DJXA 1JWSB 4JRYE 3Q7JA 3NFPA 1QTWA 4PN6A 4JQ1A 3H2FA 3NCXA 3AGVA 1FH2A 2M26A 2CBUA 4KHTL 3BRGC 3GYCA 4OCNC 3CFDB 3FQRB 1OZQA 2J3SA 1ZJIA 3F58H 1UYWH 3V4PA 4A2SA 2YCIX 2MKLC 3ESNA 3CB3A 3KDPB 4N5UA 2QQKL 4G9FB 4NUQA 3EBGA 5KOVC 5A6TC 4HHWA 5CPQA 4RL3A 2E6JA 2B8OT 1A7RH 1B3ZA 1MCPL 4DIXA 1R5YA 5BJTA 3V4VH 5EBMB 3VGEA 3RB5A 4DRSA 4GMSH 1K6AA 3P69A 3C2RA 3VWJD 5DD6A 4WKZA 5EU6A 1DEEB 4EN3D 5AHEA 2A83B 1FHDA 2NYKA 3OVGA 5J7CC 4LQFH 4BQCA 3MBED 4XCCL 1WK0A 4O51B 4MAYC 5I16B 3N6YA 4XN9A 2G0LA 4NNAA 3DX1A 4PJDA 4KNUA 3TN0C 3Q94A 4D6EA 5AWNH 3H6AA 4QAWA 4UTIA 3Q5OA 3TA3B 1FWXA 1WO2A 5HOSA 1I8KA 3FQWA 1BPVA 1GXEA 1N70A 2J71A 1M7DB 2KERA 4XBGA 3W1LA 2IPTH 1QFWH 5AD0A 3ALFA 4Q2ZB 5F1SA 2GBVA 4DF9A 4A8RA 3FT2A 5E1IA 1LYXA 1BXXA 1AW2A 4AE0A 4O8AA 1A3RL 2BOEX 3MJWA 3O6KH 3NH7H 2CLMA 1EO5A 2OM5A 2F58H 3OPZH 1HWGB 5A6BA 1I8MB 4DOHB 2BCKA 1NF7A 3FJTA 2PLMA 3SKJL 4YE0A 1GAFH 3WKMH 3QGVA 1W0YT 3WTUA 3WO4C 5F9OL 4JHWL 2EH8H 5FKPA 1FKWA 1R5VB 4LLVB 1VZGA 5C86A 5DZJA 1GK8A 3ZYIA 1UWXK 5A6JA 1FWHC 1X38A 2ZAHA 4X4ZA 3AIUA 2Z4GA 1QUMA 2NW3A 1F3JB 1K8DA 3E0VA 1JWSA 4JTHA 3FTVA 4OCYL 3K6SA 2I69A 3HM7A 2YXFA 4XX1G 3RR1A 1RBAA 2P8MA 2YZRA 2ZKMX 3CFDA 2DDQL 3FQRA 3AU0A 2FT8A 4H19A 3AISA 1NWPA 5TE6L 4IQEA 1WH0A 3QUYC 3VQ2C 2OULB 1FC1A 2D73A 1EGJH 2FGLA 3IDNB 4GYPC 1JDEA 2R1MA 2J4WH 1JVNA 3TZVD 2CDGB 2CEQA 5AN7A 2AL2A 2DT3A 4HCIA 4YPGA 2OGYA 4D71A 5CEZH 5AYUL 3GSNH 1N8OE 3RYMA 2RHGA 5GGVH 2E3ZA 2E7DA 1FY6A 1I60A 1CG9A 3AO0A 2JIEA 2GBTA 4JGDA 1YYML 4EX4A 1DEEA 3NZPA 4RISL 2A83A 3QUMH 4WVRA 3N34A 4Q56A 5F1OB 3C2AH 2WXQA 3SHSA 3PYCA 2NY7L 2NUPB 2J2ZB 3O16A 2HZGA 4O10A 3ELFA 5BS0A 1AZ2A 4GAGL 1FUYA 5I16A 1K6WA 1PFOA 1XPYA 4A3YA 2LLGA 4O18A 4JQIA 3B8IA 4PMUA 3VA2C 5F3HA 5FOJA 4C56A 1ZLSL 3GI8H 4F7EA 2DYSB 3IRPX 2ZX7A 4Y5YC 4H13C 1A1MB 1E9PB 2NV1A 5DY2A 3SJVE 4QNEA 4K5PA 5DJDB 1WAWA 4P07A 3SDXF 4Z7IA 4B7IA 1EQPA 1M7DA 1DWJM 3IFPB 3FSUA 3MY9A 3C0LA 1TFPA 4IKNA 4M1DL 1QW8A 1RZ8B 4BD4A 4OD3H 4JZNA 4B27A 2XTJB 5EA9A 3F62A 1QG3A 5A2CA 2GDVA 4JX4A 3NCOA 1IQWH 2ISWA 4PRHE 1I8MA 3IIZA 3B8VA 1P2CA 1U8MB 2EDKA 4DXVA 3MYZA 4G7FA 5DMLA 3MBFA 2D23A 3CS2A 2VERN 4Y0GA 3GNML 4IS6B 2F68X 4N2LA 2PCFA 4A8IA 1SJMA 3CZKA 3LQZB 4ABUA 3RPBA 1IXQA 2J56A 4XHJC 3U6RB 2X9WA 3HG1D 2BVTA 5BUPA 3V7AE 4P59L 3LV3B 4IHBA 5E9DA 3DMMD 4R7JA 3KXFD 3LZFL 2L0DA 4OCYH 5F1KC 2UY2A 3DARA 3S34H 4BA8A 5CEWA 3MZNA 3S1UA 2QQLL 2K1MA 4K5OA 1D3CA 4FI6A 3SRDA 3T4WA 1CN4A 2ALWA 1PZ5B 5F9AC 3ESOA 2ZA1A 3IDNA 5DHDA 3WH7A 3W7NA 1DDTA 2CDGA 2XV6B 4A7GA 3GVQA 2YD2A 1AGEA 2UXTA 3GMMA 1OTTC 4DF0A 3ZHLA 3QJTB 3P02A 3TURA 1HXKA 3S35L 2PPAA 4G8GB 2IWKA 3ZTJG 1N9PA 4U3CA 5ISZE 4WWID 2YBRB 3BRFA 3G3MA 4N2HA 2ACUA 3APDA 3U4AA 3MXVH 1MUJB 2QMJA 3T6WA 5CGYC 1OK8A 4TQ8A 2XIIA 5I1JL 2ZDSA 3I9GH 3Q8CA 2D4FA 4ZW5A 1AD9B 3K8MA 5CMAA 1BVWA 3CX2A 3MI2A 2NZ1A 1F58H 3X3FL 3NGFA 2H90A 4IBQA 4WOZA 5J1SC 1N3NB 1PG7H 2CLFA 2ZWKA 2PDBA 2FNWA 1UWTA 2C16A 3LCLA 1XYFA 2X6AA 4H9ZA 4DK3A 4WWKA 5FEXA 3BVDB 5TDOA 3LCYA 4M6OL 4PJIB 2W9EH 3BV4A 3RNQB 2G5BA 2X1QA 1WAUA 3BPLC 3JVFC 2PF6A 2ABAA 1BQLH 3V18A 2JGYA 1SN5A 1YDOA 2XSXA 4F0KA 2ZX8A 4XXWA 4E9TA 4CJ1A 1JERA 1BJMA 3UC2A 1KIQA 1V5XA 4JPWL 1AI1L 4M3KB 4J3XA 1K70A 4CN1A 1RZ7L 1TV7A 1YE4A 4HDIA 1U8MA 1V3HA 5SV4A 4GBXC 5CSSA 3HMXH 1I7TB 2DQHH 2ZKWA 1KMGA 4NAFA 1GKRA 4W4OA 3GFYA 4R96B 1ZLPA 1ZRUA 4IS6A 4CMHC 3GRIA 3CL8A 5D7LD 3VACA 5BV7H 3D46A 5TGBB 3ARRA 1XCFA 1B90A 4PJHF 1UJ3C 1F45A 2AI0H 4LAUA 3U6RA 1QNZL 4A35A 5I66A 1QHPA 1NBZA 4C4BA 3RILA 1EGZA 4IGBB 4IICA 2XKNB 3B1UA 4YIQA 4XAFA 4Y19B 1UVQB 1R2TA 1RJZB 43CAB 3RWDB 1DR9A 4BEUA 1NAL1 1I9EA 1WAAE 4BUGA 3QUZB 1HAWA 2YARA 3WEMA 2FX7L 1LWRA 3NCCB 1Q6GA 4U3XA 1IAIM 1MQ8A 3A3HA 2CO6A 1MJ7L 4V1DB 1E0WA 1UB5B 4OZHE 4TL4A 4LSBA 2A0LC 3PWPB 2BVUA 3BD4A 7TAAA 3VWKB 1LUCB 3H2MA 2O4QA 3GXDA 5ESAB 2WSKA 1J5SA 4G8GA 2AXWA 3QORA 1XYAA 4HIJA 3P14A 1B9KA 1QRQA 2YBRA 2RFXA 2TRYA 4GG6B 3FSVA 1JF6A 3CSYB 1MUJA 4U4BA 3TBYB 1O60A 5F0MB 1BEXA 4HB7A 1DIKA 4ZFZB 4D6FA 1QVOB 3D3VD 1GKEA 4PJ8A 5H2BA 3C60D 5C0FB 1RFDL 3P40A 5DLCA 3QWOA 4H8UA 4PJIA 5JHDB 1BAWA 2QQ6A 4M6OH 2QVIA 4D0CA 3MA8A 5E6RB 4OJYA 4XTRD 3RNQA 4Z7QF 4LWWA 3EOYG 1D3HA 1EDYA 1XIHA 3M7WA 2WVVB 3EPNA 4Y4FD 4QE5A 4UFHA 2H0JA 1RY7B 4L64A 2CDEB 3QHZH 4X6EB 1H8OA 3VI4F 5AAWC 4PMDA 3R25A 3W39B 4QRNA 2DWSA 3V9FA 3RZWA 3KR3H 1EEZB 1P7TB 4GGHA 2EPMX 4JX0A 3I7QA 4DGVH 2IIJA 4JPWH 1KQYA 4ADIA 5LBSH 5T1LB 1KFAL 4MXVE 3AY4C 3G1FA 4P46C 1I7TA 1M6JA 3NQ6A 4I1NB 1J4EA 4JQVC 5GS1A 3C12A 3B8SA 4R96A 1D6EB 1MI5E 1FHGA 4C65A 3T7VA 4LCVA 2QADD 4LEOB 2XHNA 4ENLA 5HD8D 4P05A 5DMGD 3T3PE 1UKQA 5EF1A 1E6SM 2H2PC 4IGBA 3UCQA 3HS0B 3L67A 3ZTJH 2XRAL 3M0MA 4UTCA 1PDKB 5M94B 1IM9A 2WPGA 3C0QA 3F00A 1U36A 1UVQA 2IWGA 3WFEH 1FTXA 3AAMA 43CAA 2WHJA 4OTKA 3GX9A 4ANWA 2BP5M 2VDQH 1EZVX 4TVPD 4U1GC 3NA9H 3R12A 2RTTA 1GOMA 5E6IC 5DD0L 1KIPB 2F8XC 4PMYA 1OYAA 1PLGL 2JXMB 4YH6A 3EJSA 1ET5A 4KRNA 3C87A 1KM5A 4D7PA 2OMZB 3F6LA 3H42L 3FVDA 3KS0H 3M1CA 1VGEL 5FF6B 3V0JA 3FT9A 3VWKA 2ADIB 3LVTA 4ZYKB 3UBXG 1NQKA 3B9KC 3FPYA 3GBML 1TV8A 3U2ZA 4UM8B 3O4OC 5CJMA 4LKCB 3QR1A 3SECA 3UA4A 4GB9A 1U8HB 4GS7B 4G7EB 2E86A 1A0QL 3WSQH 1KJMA 2KMWA 1OIOA 5FOBA 2BVPB 3CAVA 2IKJA 4ZFZA 1XF2B 1BTCA 4DW2H 3HRZA 4J4PD 3AS1A 3F05A 1TTGA 3ZRFC 2PRLA 1L5GB 1MI3A 3RY6A 1TOXA 2ZWSA 1XGQB 3TONA 1CT8B 1EXHA 3VFPA 4GW5B 3P5ZA 2QAFA 4BFKA 2KZWA 3GSQB 4OCRH 3CH1B 1RJQA 3NCYP 2MTPA 5GJMA 3BP5B 5KYWA 4N9GB 5CSBA 1P7QD 1XIEA 1RUML 3WN6A 2OMXA 3UVIA 1LWHA 5AALA 2CDEA 4LAJH 2MCPH 4B91A 4ZAKD 2OJ1A 2CBVA 3FSAA 1U95B 3W39A 1NUDA 3M1BB 1EEZA 1K3IA 5D2YA 4AK2A 5T1LA 5T3XH 1BXCA 3RGHA 5KS9E 5E94A 5KBDA 3QFJD 3VE7A 3OOQA 5JLZB 1G87A 3IRZA 3TESA 3ZR6A 2QUTA 4OE7A 3VOFA 4P4KA 5F4XA 2LE9A 1R5IB 3MLWL 2B0SL 3ZKMC 1CICD 2XXCB 3I3DA 4NZJA 4AEIL 3G3DA 1NCCH 3FU3A 1A4LA 1XLMA 1B4LA 4CN6A 3HS0A 4R7DB 1AKJA 4RXGA 2AQ2A 1PDKA 4ZX5A 2FIRT 2UY6B 4Y4KC 1E27B 5E6YA 3ARDA 1KLGA 2EDFA 4E41D 4GO8A 3P3YA 4JRYB 2AK4D 4FLHA 2P0OA 2GK1B 3VOCA 3D39D 4UAOB 3HB3D 4RJEA 5E9XA 3W9DA 3H9YA 2F61A 1BF5A 1XR8A 3VGDA 3QZBA 2A5HA 5DD0H 2JXMA 5IROC 4WI3A 1I3GL 3VXRD 2LT9A 1AD0B 5F89B 1CFMA 3QCVL 3EOTH 2PXYB 5E5MA 1MFDL 2ADIA 3D4ZA 5TF0A 5E2VH 3VGAB 3T0VA 1J7VR 1W32A 5AW4B 2NUWA 1U8CB 3S83A 3OG4B 1JYVA 4F2MA 4N0CC 2D20A 4G7EA 5D05A 2QKIA 2FQDA 2OQHA 3M9YA 2DZUA 1XF2A 4XAKD 1MDLA 3T0XA 5MEOB 4K94C 2P5ED 1GVYA 2QV5A 1TWIA 2VQ1A 3JW7A 1TZZA 4Y2DC 1YRKA 4AMKL 3WFCH 3B40A 2FRGP 5D9PA 1TTQA 2YD4A 3VXNB 4OGAD 4KI5C 4U05A 4LVAA 2CWNA 2C7UB 3CVHB 2IGTA 4BE5A 1CT8A 2BWGA 3G0SA 3ZWSA 3QEZA 4GW5A 5A2LH 5BRBA 1TJGL 1KPVB 4H6KA 4NCC1 1MY7A 1RZPA 3IS0X 5C6TH 1L0XA 2D03H 3BP5A 3NABH 4GJTB 4WSGA 4YTUA 4MYAA 3SYAA 2QT6A 1DHPA 3Q9PA 4RX4A 3L5MA 4PFEA 1OYCA 2MQ0A 5K5YA 2NTSP 3MB9A 4FZEH 2W0FB 1MCKA 3CU1A 4JIPA 2D0GA 4NO0D 1U3HB 1LL7A 3OV6A 5G2WA 1WIOA 2DQFB 4FQJL 1NDMA 1VDGA 3MV8A 5CEZE 1BMZA 2D8KA 2W07B 3CVHL 3R7QA 3NQAA 2E8ZA 2WZ0A 2DZWA 3TVAA 2NZLA 2CA4A 4X4YA 3QKEA 3EBVA 2PYEA 2C71A 2AMXA 2VEFA 4NKMA 5B4MD 3CX5J 1J9CT 4IRSD 3BG5A 3V5FA 4UXDA 3N1FC 2UY6A 3PL6C 4X80H 1TVDA 4X5XB 1F00I 4LEFA 4JRYA 5DD5H 2J44A 3RJYA 4UYPA 3N85L 3FYEB 1EXUB 1ISWA 1EQWA 5EG6C 4LUIA 3KVJA 2RCSL 1YDPB 5MHSD 1FBAA 5EEXA 4G9FE 3TCSA 4AY1A 3AIEA 3G1AA 3V5DB 5F89A 1FZKB 3MNWA 4JL1A 4L9LB 3L7EB 4XWOC 4MLRA 1SJVA 3H2AA 1GOXA 3TYAA 3QCVH 1O9VA 1LDSA 2YPVL 3P9MA 1UROA 1JULA 2QNEA 1U8CA 3KW8A 3BCDA 1X96A 4ES4A 3F2DA 1J12A 2R0LH 4EPKA 1G7IA 3GJFA 4PCSA 2F6XA 2HTMA 2QFRA 1HX0A 3LSBA 3I6TA 1W0WA 4CSPA 4DVOA 1IV8A 4FQXD 1BQCA 5MEOA 3T8MA 4DN4L 2Z24A 1NMBL 2X2UA 1K85A 3BZ4B 1U1JA 4DAIA 1KXHA 4O8RA 2Z28A 4LPVA 5IHSA 1DQUA 2C7UA 4ODUB 1ZHBA 2PGWA 4G7YL 4JO3L 5TDPB 3VIKA 3QY7A 1EWEA 2XIBA 2NSXA 5CJOL 4WW2F 4AMXA 3P4NB 1KPVA 4UM9D 3MV7B 4OUUB 2P5WD 2OJEB 1TENA 5EPMA 2ZSVB 3VKKA 1HQRA 4MJMA 4FLOA 1QOQA 3H3KA 3V6OE 3WU1A 2Y7NA 2PTWA 5BZAA 1DDHA 2E7LC 1BQKA 3TSDA 2WWOA 4JIIX 2RD0A 5IEKB 2QDHA 2W6RA 2W0FA 3LZNA 2AW2A 5CSUA 1V02E 4ZS7H 4BYHA 5I6NA 3ANUA 5DURB 1S78C 4UTWC 4FN0A 2DQFA 2J6EL 2WLMA 1DYZA 1JCXA 1PTZA 5LWYH 5CN3A 5J57B 1P43A 4G82A 1ZHNA 2QCNA 4FQJH 1LK2B 1GQKA 4S1DD 1P7BA 3GSOB 3LVEA 1ND0B 5E2UL 2GG1A 4PR5B 2YPVA 5L9FA 3FTWA 4XNZC 3CNKA 3IGSA 4XMLL 4AYID 1ESOA 2QSQA 1X5XA 3GIZL 1ETB1 5I8EB 1CFNB 4TSAL 1XLHA 3GB6A 3MROB 3JZUA 3H4GA 3HFMH 1ILSA 1WFJA 4XD5A 4UMAA 4ZD3L 4CCEA 4LMQE 1KCKA 3TKFA 5GGRY 1ES0B 1YDPA 4PJ7B 2EDOA 4K8HA 2R2HB 1W1A1 1NCJA 4DN3L 1EHLL 5FF3A 2OOFA 1GVOA 2E6YA 1LD9B 1RK5A 1U93B 1S3TC 1ET8A 1WDRA 1SEBB 2CBQA 1N8WA 2KS0A 1MRQA 3B06A 1I4FB 1OP3K 1HC1A 3KL5A 2Y5TA 4PY7A 2Z64C 3NEEA 4XX1E 1KIUB