3WY1A

Crystal structure of alpha-glucosidase
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
535
structure length
535
Chain Sequence
b'NMMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLDNMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSRPENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEVASDLPVAHFTATRDGSTLTLPAYQAAFMQVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-glucosidase
publication title Structural analysis of the alpha-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism
pubmed doi rcsb
source organism Halomonas sp. h11
molecule tags Hydrolase
total genus 193
structure length 535
sequence length 535
chains with identical sequence B
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3wy1A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3wy1A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3wy1A02
2VO5A 3AMGA 4NRRA 5JBFA 4S3KA 3WH5A 2XIIA 4AZ5A 4W93A 2GJXA 5GNXA 5LA1A 1H11A 1B30A 3M6DA 4H8VA 4CKQA 3GH7A 4CCCA 1SYTA 3SCSA 3SEPA 1BQCA 2WSKA 1Q6DA 2VJXA 3CHEA 1CGUA 3F5KA 3QHOA 4AIEA 4PMZA 3O2LA 1E73M 3TV8A 5FCZA 3AIEA 2F7OA 2EPOA 3PTKA 4AZBA 3QOMA 2BS9A 1CENA 2F1AA 3EYPA 1A47A 3LRKA 5BWFA 2WKLA 2EO7A 3K8KA 2EEXA 1QI4A 4PEEA 2V5DA 2XPKA 4J7RA 1D2KA 3EJTA 2BY1A 1V03A 2WXDM 4H41A 3UG3A 1CLXA 2D0HA 3GBEA 4IPNB 1KBBA 1XSKA 2UWFA 1JIBA 1F4HA 3IANA 1WDSA 3CZSA 3OIHA 2OSYA 4L4PA 4PMDA 4MNJA 3WH8A 1HKIA 4U5IA 2FHCA 4EE9A 1UKOA 1GOOA 1K9FA 5CPQA 4J3SA 3AMCA 1H3GA 1TVNA 2VVSA 1UR2A 5A8MA 1M7XA 1V6WA 2G3MA 3M7SA 3ZR6A 4D6FA 1H2JA 2ZICA 1V6XA 1R7OA 3B9EA 1LG1A 2YIHA 1PIFA 1TQTA 3CZJA 1IZJA 4PUDA 3T0DA 5EMYA 3CMJA 1WZLA 2DT2A 1WP6A 2RGMA 1JXKA 1W3JA 4A3HA 3ARTA 4Q22A 1HL9A 4GQRA 4WF7A 3GXPA 3BVXA 5HPCA 2G3IA 5BXPA 1QNOA 4FNSA 1VENA 2VVNA 4BQ4A 3VIJA 4U31A 1XV8A 3EJUA 3VDCA 3DX0A 3F5LA 1PS3A 3WDHA 3ARWA 3NSNA 2NT1A 2DSKA 1DWFM 5JBDA 2WHMA 3N1AA 5M17A 2PF0A 4AIUA 2JE8A 1W9XA 4R27A 3WUGA 1ZBKA 1PX3A 2VMFA 3VD3A 1EDTA 1QWUA 4P7RA 3APGA 1HT6A 3LPGA 1J18A 1A3HA 1MVYA 3WQ5A 1HVXA 2UY2A 2E9MA 3VGHA 3BMVA 3THCA 1E3XA 1E1FA 3VDBA 4B15A 1HJVA 4ZEPA 3D50A 1QW9A 4H8UA 1ZBVA 2CKRA 2EADA 3GYCA 3SURA 2OYMA 1LQ0A 2V38A 4NRSA 2GJPA 1JI1A 1MW2A 4FF5A 3BCFA 1JNEA 4KGLA 2X2IA 1UD5A 1OIMA 3W25A 4X9YA 2VX4A 4UR9A 1OB0A 4TOQA 5A8NA 3KL3A 2VRKA 3FN9A 1QNSA 1VBRA 4KGJA 3AHVA 4DUVA 2D0FA 3VIOA 3BAXA 2WCGA 4TUFA 1E71M 4N0RA 2PWFA 4ZE5A 4E8DA 1OWQA 4F8XA 5BRPA 4JKLA 4P8VA 4PCSA 2ALWA 3WEZA 4B3KA 3N9KA 3T08A 5BCAA 4W8AA 3PZVA 3VIKA 1DWJM 1CGWA 2OW6A 2DGAA 1K6AA 2DSVA 4Z2KA 5JUVA 1TQUA 2PWEA 3GXMA 1XH0A 5HDRA 2JEPA 3THDA 3RO8A 2OW7A 5A6BA 4CU6A 3K46A 1U2YA 2IUZA 3TA9A 4M8UA 4AZCB 3ZJ6A 4H04A 5IHSA 4HZ6A 5DT7A 1MW3A 3VGEA 3BCDA 2PC8A 3WNMA 4PTWA 4HA3A 1C93A 3VGDA 3CLWA 4YHGA 5ABEA 4LYPA 4P7NA 4X0NA 3UG4A 2GJRA 3WELA 3E1F1 3LRMA 3WD1A 3NDYA 4OBRA 5DMYA 4UQ9A 5IHRA 4NI3A 4TXEA 4PMRA 1W2VA 2JF6A 1E72M 4IUGA 1H09A 1GVIA 1B3VA 4HPHA 2V5CA 3AYSA 3WF4A 1OINA 1KXHA 3N12A 1HWWA 3UERA 3N11A 3WUEA 1UASA 3VGBA 4MAZA 3NJ3A 3WKZA 2C0HA 5M3WA 1RPKA 1UQZA 1LL7A 3BVVA 3HZ3A 3MI6A 4UCFA 5IFPA 1GQIA 2YA0A 1U30A 1C7SA 1OIFA 1GQLA 3BUBA 1BG4A 2WCSA 4HOZA 1TR1A 4JFTA 2J78A 4NZJA 2WPGA 2A3EA 1XHGA 3AZRA 3CTTA 3SCOA 3U7VA 4CD7A 1Q6EA 1FH7A 3VPLA 3DYMA 2WBKA 3OGRA 2ZX7A 3DX2A 1W9UA 1V3JA 4QLJA 1GHSA 4MNLA 4Q7NA 4W84A 3CGTA 4PSRA 3WNOA 3PZNA 3HG3A 3T2OA 3WDQA 5A94A 2PBGA 3K1DA 1OBAA 2BVYA 5AYBA 5A6JA 2YOCA 3PZMA 5A3HA 4LYRA 4BS0A 2WYSA 4H2CA 2OWXA 3NSXA 4MNKA 1QHZA 2ZX6A 4FK9A 4W7WA 4F66A 3VNZA 2Y4SA 3HN3A 2WMHA 4HMDA 4J27A 1CYGA 2WVVA 2TAAA 1UWRA 3SUSA 4HZ8A 1MWOA 3VGGA 1DTUA 1UZ1A 2DSUA 1M04A 2VR4A 4W7UA 1GPFA 4QFUA 2XN0A 3RM4A 2J77A 4JKKA 1G5AA 1TCMA 1DP0A 2YBTA 2W61A 2XVKA 1H0IA 2XVNA 3AHYA 2ZWZA 3WEMA 2EPKX 4UQEA 2O9RA 2AOSA 1J0IA 2VZVA 3N18A 1PZ2A 4ATWA 2VQUA 4PMXA 4FNRA 3EDDA 3GZAA 3D5HA 1EDQA 4OGZA 5I23A 2VC9A 1R87A 1O7DC 2ZXQA 3CH9A 5E9AA 5EB8A 2OSWA 1X6LA 7A3HA 1J10A 1X6NA 4CU8A 4AYSA 2WZHA 3W26A 1Y7VA 3MUY1 1HL8A 1U33A 4CGTA 1EA9C 4FNTA 3VIIA 4MB1A 5DEZA 1XSIA 1VRXA 3WMSA 2X05A 2VZSA 2V3EA 1ODZA 2WSPA 4AMXA 1EIBA 2UY4A 4JFSA 4LXFA 1B3YA 4D71A 1FFRA 1XYZA 4M29A 2X0HA 4PMYA 1QHOA 2QLYA 1ZS2A 5LYRA 3TTQA 4GO9A 1UUQA 4AZGA 4AD3A 5C71A 2VX5A 3U5UA 1M03A 3SCRA 3WBEA 4AD5A 2VOTA 3W81A 1CECA 4D72A 4LX4A 1SZNA 3AI0A 3WY3A 1LLOA 1XC6A 1HJQA 3W24A 1JI2A 1DWIM 4PRWA 3FHAA 3W82A 4PN2A 5I79A 2CITA 2CETA 4W5ZA 5EFDA 2PI6A 1C92A 4HU8A 1WB0A 1G0CA 4M56A 3G6LA 4AEFA 1P6WA 3NDZA 2VNCA 2XFYA 2WMKA 1J01A 3VX0A 4AW7A 3AICA 1TZ7A 1BG9A 4P8XA 2XFRA 1OT1A 3D3AA 2ZUTA 1D3CA 1CXHA 1ZU8A 2J7EA 3FY1A 3ZT7A 1FP8A 4PYSA 3WQ8A 3VU2A 2D23A 4W88A 3CC1A 3WD3A 3AS3A 3A47A 3EMQA 4P8UA 3OZPA 1K9DA 3I3EA 2E0PA 3ARSA 2FH6A 2PBOA 4XUYA 1V3KA 1JFHA 1V6UA 3WNPA 2ZX8A 4UFLA 4AZHA 4PMUA 2YDSA 3BVTA 1JAKA 3AZTA 3CHFA 2BHYA 1LL4A 3AXXA 4BQ3A 3SUTA 3WNKA 5CSYA 3GXDA 4YHEA 1E43A 2WWDA 3PZTA 3DX4A 5A6BD 2VQTA 1MXGA 1D7FA 3CIVA 3WBAA 4TTGA 2O92A 3POHA 2WLZA 4W85A 2J25A 3LRLA 2CESA 4DUXA 4FLQA 3BLBA 4ZXOA 3CV5A 3RJYA 1V0LA 4ZENA 2XVPA 4YN5A 3WD4A 4AMCA 3AMKA 3GXFA 2CBUA 4WKAA 4NXSA 4JFVA 3AISA 4NSBA 2XSAA 3QHNA 4HTYA 1HJSA 2D22A 2YL9A 2Q8XA 1Z32X 1UWUA 2CERA 2G8ZA 1X1NA 2WMIA 1JZ8A 1TQWA 3VD5A 1OD0A 3A24A 3WENA 1E4MM 2J47A 1UQYA 5C70A 5D9OA 4JAWA 4P7LA 4AWEA 2ZOXA 3UESA 1SR0A 2YFOA 3W29A 3PZUA 4P7OA 4GXPA 3EDJA 2J7GA 3ZT5A 1J0JA 3MO4A 1WDPA 1HKMA 3L4ZA 1V0NA 4M24A 3DYOA 1AQ0A 4DO4A 1HP4A 1W1YA 1V02E 2QHAA 4EANA 3DX3A 6TAAA 1HXJA 3WN6A 1CDGA 1UD6A 4U3CA 1VBUA 1JYXA 1BF2A 1TMQA 1V08A 3S5YA 5I5RA 3WL0A 3WQVA 1UD4A 3WL1A 4D6HA 4AD0A 1J12A 1QI0A 1J9YA 2Y24A 4CCDA 2GSJA 2DPEA 4GQQA 1BVZA 4LPCA 1QBAA 3DDFA 3BAYA 3WFLA 2YKKA 4NF7A 1BGGA 5HXMA 2E40A 4U33A 1XRVA 4NX0A 4PTXA 5A2BA 2G4FA 1VEPA 3U7BA 1EQPA 2DIEA 3CZGA 5BYWA 3WFZA 3VMPA 3AIBA 4GPNA 3FAXA 4OUEA 1JZ7A 3LXBA 4FMVA 2VI0A 1TFVA 5FL0A 1CBGA 4IISA 4V28A 3W27A 2DH3A 1RH9A 3H55A 4AZ7A 2WM0A 3WEOA 1V3IA 1WNOA 3VMOA 4F9JA 3ARPA 1EHAA 3WNLA 3EDEA 4EK7A 1E56A 4F9DA 3IGUA 3AMLA 1XH2A 3MMDA 2V3DA 3WQ4A 4JCLA 1H49A 2QV4A 4D6GA 1H4PA 4P7QA 5DO8A 5FKYA 2YA2A 3O6AA 1G94A 1BVNP 4AD1A 3WQ6A 4GI8A 3AHTA 4JFWA 1GOMA 4AEEA 4J3XA 2VCBA 3QHMA 4JHOA 3ZR5A 1UKSA 2GUYA 5HNNA 3N04A 1GOQA 2QMJA 3M07A 1V02A 1W1VA 5FL1A 2WKGA 3BH4A 4QLLA 3HU7A 3RIKA 1L8NA 3MANA 4TX8A 1E0VA 4A4AA 4UFIA 1JL8A 4LQ1A 4CN6A 1W9PA 4GI9A 3AIVA 4ACZB 5AY7A 3L2LA 3OZOA 4CVUA 2WMFA 4DWSB 1BAGA 2YA1A 4AC1X 1W1PA 2ZUVA 1CXLA 4W8LA 4OOZA 1DEDA 2OWCA 1KB3A 3ARRA 2EJ1A 1HX0A 3AXHA 5I6SA 2XWDA 2NSXA 1KXQA 4KRTA 1E70M 4HOWA 2VRQA 2VL4A 1E4NA 1WO2A 4UFJA 4FNUA 1QNRA 4ML4A 4N42A 1W1TA 1XSJA 3QGVA 3KE0A 1ESWA 1OD8A 1VJSA 2WC3A 5KZ6A 1C8XA 1UD3A 1V3HA 1E0XA 4GINA 5CPSA 3BSGA 1R33A 1ZBWA 3L4TA 3FXYA 5CZKA 1FOBA 3MUIA 1XGZA 4PTMA 3BLKA 2D0GA 3U5YA 1PJ9A 3A4AA 5KEZA 4DWSD 3TOPA 3VDHA 1CGTA 5HBFA 4DUWA 2D3NA 1C8QA 4F79A 1QI3A 2W67A 3BGAA 4JKMA 2J7BA 1B90A 3GNOA 1QPKA 2J7HA 4YPJA 5C8BB 3A4XA 1GCYA 4Z2IA 3W4RA 3ARQA 5BXSA 5I24A 4HPGA 3WDRA 3VD4A 3AFBA 4WIWA 3SCQA 1VF8A 2WW5A 1VB9A 3BUPA 3IJ9A 2A3AA 3WQWA 3ARUA 1NQ6A 1TE1A 1CGXA 5D9PA 1JZ5A 2VZTA 1MQQA 1BPLB 2JF7A 1NP0A 2BY0A 1KBKA 2BNJA 1SFSA 1MFVA 2X09A 4HMCA 2CBIA 2DT1A 1G01A 2ZXDA 3I3BA 2XUCA 3GH4A 1ITCA 5CPTA 1EOKA 3OGSA 2GJXB 5A8PA 1MFUA 1KWKA 3GXIA 4PUEA 4W7VA 1YHTA 1JZ3A 1WKYA 1JYWA 5D8ZA 3CHCA 3GDBA 3LPFA 5I77A 4PMNA 1EHNA 5HOSA 9CGTA 4U2YA 5CGTA 4WJXA 1RP9A 5E6YA 1VFUA 1OM0A 3FHQA 5E1QA 2GFTA 3ZM8A 4BF7A 3CZKA 3LXAA 2CHOA 3AZSA 2XN2A 1TA3A 1EOMA 1GQJA 3NSMA 3VIMA 1HJUA 5DT5A 1M53A 1JDAA 2PWDA 4WSJA 3L4VA 3AS0A 4E4PA 4E2OA 2EPLX 2F7RA 2W62A 4MB4A 3AQUA 2X2JA 3EBVA 1JYVA 3B9AA 4AXNA 4FNPA 1ISZA 2WHLA 2WK2A 5CQ1A 5I78A 1NP2A 4MTVA 4GIAA 1FH9A 2O9PA 4TVUA 5JIPA 2W66A 1KGUA 2VRJA 2WMGA 2YJQA 3F4VA 2VZUA 1EH9A 4AYGA 2CBVA 2YL5A 5D8WA 3A23A 3OGVA 2IGTA 1T0OA 1KGWA 1AVAA 3BUQA 5ABFA 3ZSTA 1HP5A 3VIFA 3ALGA 2BVTA 5JBEA 4CU7A 3WMBA 3WF0A 1UH2A 3DHPA 1NOUA 4ACYA 4M81A 5A8QA 1EO5A 1B3XA 5A6SA 1J0KA 1QVBA 4NZFA 1GW1A 3VD7A 2DH2A 3FNDA 4DWSC 2EXOA 3WIJA 3GTNA 5ECUA 2EPNA 3CZ8A 1PZ3A 3M46A 3RM8A 4H8HA 1IZKA 4HZ7A 2D1ZA 4ZXLA 1ISWA 2XWEA 5E0CA 3WF2A 1OGBA 4PTVA 2NT0A 1QHPA 4WKFA 2NW0A 1UKQA 4W89A 2YLLA 3AS2A 2GK1A 1WE5A 4UTFA 3II1A 5CXPA 4MB3A 1ZB5A 3WH9A 1XD1A 3KWXA 2VT0A 3GBDA 4AMWA 1UR9A 4MDPA 1CXEA 2D73A 3AROA 1LL6A 1YQ2A 2ZX5A 1UKPA 1TQSA 2DDXA 3MUZ1 3ZIZA 1G1YA 1XYFA 4DO6A 3WUFA 3W28A 1UYQA 4CD6A 4HP5A 2B31A 5HPOA 1K9EA 3ZJKA 4MJ4A 4ATDA 5A69A 1CLVA 3ZMRA 4X0VA 2JFEX 2XVLA 4WK9A 1KTCA 4AISA 3WUBA 2F7QA 2WHJA 3AOFA 2OWWA 1C91A 1Q6FA 1R7AA 2EAEA 5A1AA 3BXWA 3T2PA 1RP8A 1I1XA 3W6MA 3WH7A 4HA1A 1FA2A 1PIGA 3VMNA 4B3LA 2YDRA 4R5EA 3D4ZA 3MU7A 3RJXA 1IV8A 5ABGA 3VD9A 3FAWA 1UWSA 3JUGA 4J3TA 2G41A 4CD5A 1C7TA 2X2YA 8CGTA 1B3WA 3PZOA 2E4TA 3AS1A 3SUVA 4D6JA 4CUCA 1PPIA 5CLTA 1XCWA 3DHUA 3PTMA 5AC4A 2BXZA 4UQCA 1FH8A 5A6AA 2QMKA 2V3FA 3EMZA 1R85A 2XHYA 3BAWA 3LMYA 3DX1A 2E8YA 1UKTA 4GKLA 4Z2LA 2WAGA 3RDKA 4B16A 1E40A 4BA0A 5I2UA 4UQAA 3VSTA 2XM1A 5A2AA 3UR7A 2XM2A 2Y8VA 1C3FA 1PX4A 5A6LA 3K4DA 5I3DA 1PBGA 1BSIA 4W86A 4CD8A 1V0MA 5EFFA 1W9BM 3WMCA 3L4XA 1W9VA 2J7CA 3J7HA 2FHBA 1RD6A 5TD4A 3HMCA 3PZ9A 1H1NA 3CZEA 2FYVA 1OCQA 2BY2A 2ESCA 3L4UA 3MV11 4TTUA 1WZKA 3OG2A 3U57A 1W91A 1J0ZA 2YDQA 2J74A 2QF8A 1W3LA 3UEQA 2FHFA 3PN8A 2GDVA 6A3HA 4ATLA 4J3WA 2IXVA 6CGTA 4KMQA 4OZOA 3SUUA 1GVYA 3AJ7A 7TAAA 5A2CA 1JG9A 2OLHA 4JHZA 3NYDA 1GJWA 1GOWA 3T0AA 3VTRA 1UA3A 1OGSA 1W3KA 4UFHA 4URIA 3G6MA 2JEQA 2BV9A 3IK2A 3AIUA 3ECQA 3SUWA 1BYDA 3A4WA 4FNQA 5GPRA 1V3LA 2F1BA 2FDMA 1JFXA 1FHDA 1FHLA 3ZQ9A 3BUDA 2WVVB 3BSHA 3ZJ7A 3W53A 2J4GA 2WZIA 3MMWA 2ZWYA 4QCEA 4DM1A 2WMJA 4WSKA 1KTBA 3BVWA 4DO5A 2WC4A 4LGXA 3EDFA 4H7VA 3VDAA 1VEOA 2JIWA 2C8NA 2PWHA 1CGVA 3GNRA 3VSVA 2O9OA 4UZSA 3DC0A 3WF1A 1KCKA 2DQXA 1GONA 4MJ2A 1CXFA 3LPOA 3BVUA 2VCAA 1KCLA 1CEOA 1QNPA 4CCEA 1NOFA 3KZSA 2F7PA 2QPUA 3AIQA 1NM9A 4MADA 2HISA 1NWSA 2GDUA 1W9DM 1EDGA 4BQ5A 2PWGA 3DECA 1E3ZA 1VFMA 2ZXAA 1E6QM 3W0KA 1HJWA 4AZCA 2A3CA 3PHAA 1JGIA 4GI6A 1H41A 2DSWA 3I3DA 3VIPA 1Q4NX 1E5NA 3EJQA 2XYLA 3BAIA 3QOKA 4KRUA 1TG7A 1EQCA 3RM9A 3EDKA 3TONA 4UQDA 2VR5A 1G9HA 5E0FA 4P8WA 4Z2GA 3ARYA 2XIBA 2EBNA 2X8RA 5EBAA 1KR1A 2D24A 1MQRA 4UZUA 2X0YA 5DFAA 1LG2A 4AD4A 5JIWA 2J75A 1FP9A 2QPSA 2VURA 4MNMA 3PBGA 1V6YA 4Z2HA 2WBGA 1DWAM 3KEHA 4Z2JA 2DT3A 3BAJA 2V3GA 3GH5A 2J8GA 3A5VA 3OLIA 3VUPA 1GJUA 1MW0A 1W3HA 2AAAA 2BHUA 5LA0A 5IXEA 1VIWA 3PZGA 4XV0A 4S3JA 5CGMA 2EABA 3K8LA 1JDDA 3RCNA 1QNQA 2Y8KA 4V27A 4K68A 1VAHA 3LXCA 1CXKA 4CD4A 3KLKA 1UH3A 2WWCA 1UA7A 2WZEA 3S6TA 2Z1SA 4AZIA 4BZYA 3VM5A 1B31A 1ZJBA 3CZLA 1AQMA 1DWGM 2F61A 1QI2A 1HVQA 3CUGA 3WSUA 4QDMA 3L2MA 3AHXA 4XZWA 5GNYA 2W92A 2JIEA 3VINA 4RE3A 1C8YA 3CUHA 4PBGA 3A21A 3GXNA 4UNIA 3TP4A 4LYQA 1QOXA 5A8OA 3VM7A 1DHKA 3CZNA 1C90A 3HJEA 2A3HA 5D9MA 3ZOAA 1M01A 3MSGA 5CG0A 3VNYA 1QWNA 3S2CA 1CTNA 3CUFA 4JL1A 1O7AA 4AY1A 1NARA 1PX8A 2YLAA 4TVDA 4IM4A 3GM8A 1JYNA 1ODUA 4OBSA 1GOKA 1VEMA 4UQBA 2C7FA 1HXKA 3RILA 1OT2A 3L4YA 1UG6A 3OLEA 1E1EA 1ZBCA 3VKKA 3AYRA 1US2A 4D1JA 2D2OA 3WDPP 1Q6GA 2WCAA 3TTYA 1MW1A 2WMIB 5A6MA 2D20A 5F7UA 1UR4A 4XZBA 2EQDA 1EO7A 1ZJAA 4J3UA 1HIZA 1JAEA 2CEQA 5A6KA 3CMGA 4WLCA 4IPLA 3N15A 2CHNA 4PSPA 1OGGA 1WPCA 1BFNA 1PEZA 2BXYA 3H53A 4FLOA 2O9TA 4MDOA 3HG4A 4AD2A 1UH4A 1JF5A 5A95A 4RE4A 4D6CA 5I0DA 2WNWA 2CPUA 5BRQA 2ZXBA 2Y5EA 1E0WA 1O6IA 2E8ZA 3MKKA 4HA4A 3SCPA 3T09A 1XCXA 3RPMA 4U5KA 1J0YA 1ISYA 5E09A 2XFFA 3SCNA 1CGYA 2DSZA 4GZJA 1JNDA 2WHKA 1LJYA 4EKJA 2F2HA 4W5UA 3F5JA 3ALFA 4MAVA 2A3BA 1JZ6A 1GUVA 3OB8A 5IFTA 5FD0A 1UOKA 5D9NA 1JD7A 4OKDA 4MPKA 1CZ1A 1QX1A 4TVCA 4HOXA 1MXDA 1QW8A 2BFGA 1E6ZA 2FGLA 4W8BA 4W87A 4ZE4A 3D51A 5AYIA 3VGFA 2ZE0A 4JFUA 1UD8A 1S46A 2G3JA 3VIGA 2CKSA 4KH2A 5FIPA 1WCGA 4NZCA 3AXIA 3ZT6A 2WC7A 2XVGA 3HG2A 1VFOA 3SIMA 2ZUWA 1E6XM 3BLPX 5LA2A 1KR0A 4TX6A 3KLLA 1XD0A 4M80A 3L4WA 2CIPA 1E55A 3WF3A 1KWGA 1L0PA 1NWUA 3GNPA 3PTQA 3SCUA 4OOUA 2FGZA 4D6DA 1LF1A 1WDQA 3TTOA 4B9YA 3H54A 1R86A 5AC5A 3IAPA 5BROA 3BMWA 2WANA 1DWHM 1E4IA 3AIRA 1ITXA 2EPMX 3EJSA 2WB5A 1HJXA 4FLRA 4UFKA 1EXPA 2Y2WA 3IAQA 1VFFA 1GQKA 2XG9A 2UY5A 4U3AA 1UR0A 4OJYA 3A3HA 2WVTA 2J79A 4PMOA 3NIYA 1H0GA 4ZFMA 1JD9A 3N13A 3ARZA 5FOOA 1UD2A 4QCFA 3BUIA 4C7FA 1E15A 3DDGA 3K4AA 2YBUA 2UY3A 4PMVA 5GNZA 2X2HA 2D3LA 4GO8A 2GVYA 3VILA 4U2ZA 4CN4A 1VJZA 5BXRA 5IDIA 1K9TA 4L4OA 3VOCA 2FH8A 2E9BA 4JCMA 2XJ7A 5D4YA 1QI5A 3OA5A 3VSUA 3WD2A 5E6ZA 3EJPA 1HKJA 1HKKA 3SCWA 4JIEA 4D6EA 3NUKA 4Y7EA 5BXTA 1PAMA 2AMGA 1GOIA 1E4LA 3OLGA 3W6LA 3BAKA 1UZ4A 2VCCA 5DF0A 1V6VA 1CPUA 3MSDA 3K8MA 1WZMA 2W5FA 2W91A 4FLSA 1NH6A 3SCVA 5CJ5A 1MQPA 3D52A 1B0IA 2VUYA 2XTKA 1E5JA 3T2QA 3EMCA 3OLDA 4M82A 1GHRA 4JL2A 4AIOA 1BYCA 2F8QA 2VX6A 3UG5A 1R46A 5ABHA 2E3ZA 3S5ZA 4GZIA 2HVMA 3N17A 2RGLA 2DEPA 4UOQA 1V3MA 3ZJ8A 2W4XA 2YL8A 3AIWA 1TQVA 4RL3A 3WH6A 2MANA 1ECEA 3EJRA 1I75A 1NWTA 1BYAA 3A22A 2BHZA 2IXUA 3POCA 1KQYA 2VZOA 3FW6A 1WZAA 2CYGA 1US3A 1HNYA 1N82A 1J11A 2XGBA 3DYPA 1E9LA 1QBBA 1WAWA 3ARVA 1UWIA 1KFWA 1BLIA 4AZ6A 1I1WA 2VTFA 1ISXA 3B8SA 3WY2A 1HTYA 3ARXA 3B9DA 3AHZA 1CIUA 2FE0A 2PB1A 1OSEA 1IT0A 1JXJA 2CXGA 2XN1A 4DM2A 1SMAA 1E6SM 1KGXA 1KXVA 4UFMA 2YL6A 1LWJA 3UR8A 2J62A 3T0BA 3TTSA 1GNXA 2ZUNA 4UOJA 1HF6A 2WLYA 3PZQA 4J3VA 3ZO9A 1GZJA 1B2YA 3MS8A 2W63A 4OIFA 4XX6A 3W37A 2EACA 8A3HA 2E9LA 3MMUA 1H5VA 3KL5A 4E8CA 3VO0A 1AQHA 4HU0A 1EGZA 3WD0A 2F18A 5M5DA 1UWQA 1V0KA 1BHGA 1TA3B 4D1IA 3RMEA 1ZL1A 3IJ8A 4A3YA 5E70A 5CLWA 3MV01 2XGIA 4C7GA 1R75A 4ACZA 2DT0A 1JZ2A 1W32A 1NOWA 2CNCA 5M03A 4XB3A 3O9NA 2ZUSA 1F4AA 3OBAA 3QR3A 4DWSA 1R47A 1ISVA 2BY3A 4QLKA 2BVDA 2OYKA 1W2PA 4EAMA 2CCRA 1MYRA 2XSBA 3UCQA 2G3NA 1XH1A 3LX9A 1CWYA 4MB5A 4CVWA 3MUAA 1AMYA 1KQZA 2CBJA 2YFNA 3CO4A 4C7DA 1BTCA 4UOZA 1Q6CA 3CPUA 4D6IA 3ZSSA 3WDIA 1TUXA 3GXTA 3CBWA 3CUIA 4QP0A 1E6PA 3KL0A 1NWRA 1UWTA 5GQBA 3WDJA 4KWUA 3HG5A 1GORA 1UHVA 1TVPA 3VIHA 1BYBA 5ABFB 7CGTA 4J28A 1WDRA 4PCTA 1J0HA 1KXTA 1JDCA 3WNNA 2J7DA 4B9ZA 3BC9A 2J8FA 2X1IA 1E6NA 2VX7A 1UR1A 1B9ZA 1BGAA 3SCTA 1UR8A 4BQ2A 2WVUA 3PZIA 4V2XA 4NXKA 2OYLA 2ZUUA 1CNVA 3A6OA 2ZX9A 3UETA 3VVGA 1HN1A 3CHDA 5CSUA 3LPPA 1B1YA 2DIJA 3W38A 3D4YA 4CN1A 3VX1A 1SMDA 1JF6A 1CXIA 2Z1KA 2JALA 4M1RA 4QAWA 1LWHA 1B3ZA 4BCEA 4WKHA 2GK1B 2J7FA 3NCOA 1R34A 3WY4A 1FFQA 3CUJA 3AMDA 1JZ4A 2ZIDA 3WY1A 2WVSA 4RE2A 2ZUMA 4HMEA 4GZEA 4PMQA 1R8LA 2OSXA 3IJ7A 1E6RA 4JZ5A
chains in the Genus database with same CATH superfamily
3S35X 1KDJA 2NV1A 2PNDA 1JS4A 4GYBA 4NAMA 5DJZA 4U1MB 3UJIH 2YKLH 4XN4A 1QU4A 1XRSA 3NL2A 4LCUB 1I2NA 4Q56A 3GZKA 1UROA 2VJXA 4PS8A 4WGVB 3AIEA 1KPVA 2CLRA 3BPCB 1CENA 2QS8A 1XW8A 1X7SA 1KIUB 2FPYA 1WWBX 3G0UA 4QNWA 2QADB 3IVSA 4KCUA 2E59A 3QQDB 1NMCB 2VDIA 3V75A 1PNCA 3UVAA 3GU1A 5GRXG 4TQHA 2GFBA 1KFAL 4JQIH 2XFXA 5MERB 1SM9A 4H9UA 1A14L 4FQXA 3D0LA 2FHCA 2FATH 5FOJA 3JVAA 3T40A 3MTWA 3PS6A 4OCLC 5FJIA 1H3PL 5IK3B 3CFCL 3QJFB 4KO9A 2DQHH 4D6FA 3VCNA 3VXUA 5B7YA 4XCYA 2RGMA 5D7LA 2GDQA 2DWXA 1M41A 4Q22A 4B7LA 3T9PA 3VFTA 3WFBL 5BZAA 4AH2B 2Q8ZA 3G1AA 3G1YA 1CU4H 2R14A 3F5LA 1MCCA 2BZ7A 3W1PA 1NUNB 1RSFA 3U2IA 4ENZA 3HQ1A 2AGTA 1WHPA 1AS8A 2QSQA 4ZUWA 4O1CA 4KZ0A 1XCQA 3NEEA 3VDBA 2Y06L 4Q9QH 2QT6A 3FB5A 4FI7A 2J27A 3EJYC 2OYMA 4BF9A 2GJPA 3RX9A 5DWUL 4KGLA 1IEHA 3B9KC 3L3HB 5A8NA 2EUXA 4O10A 5JW4Q 1YDYA 5E1AA 2H32H 2KUTA 5EU4B 4AM0B 5CINL 1DZ0A 2X5PA 3B37A 1QBLL 1MEXH 3CBKB 1OIOA 2H8ZA 2PWEA 1XH0A 4ROQA 3TBYA 4TSBH 4ZMXA 1M2VB 4J5NA 3EA1A 1DBJL 2VDRL 3EOOA 3CLWA 3ZK0A 1QHQA 3NDYA 4N26A 1FVEB 4NUQA 2PDMA 4ICCX 3L0KA 4KEMA 4DP9X 5ABDE 5IMKB 1OV8A 3DETD 3HVDA 1MKFA 1OINA 3L17A 1RBOB 3GNMH 3MXWH 1XLKA 3GMRA 3MI6A 4L3EA 2VZ1A 1GQIA 1C7SA 1U30A 2PYFA 3CLEL 3RR4A 2UX7A 3OP2A 2EDWA 1CD1B 2OPJA 3S1XA 2UYLA 1OF6A 3RX2A 4CD7A 4IMEA 2K7PA 3LMJL 5G1MA 4NJAL 4MNLA 4KROD 1ONQB 3Q48A 3RFZA 4PRHD 1ZSXA 4W9LC 5A3HA 4ODXA 3C75A 4NBYB 2C79A 1D5ZB 2AEQL 4WI6A 4R85A 5CP3H 2Y5JA 4NQXA 3T81A 1VERA 1KT2A 2APFA 2VR4A 2HK1A 3P11L 3RPKA 3VZZA 2GVEA 2EVIA 4JKKA 2XQYA 1YEIH 4PZVA 3O4LA 3L21A 1MWAB 1BX2A 4P2CG 1HFBA 1TJHL 4FNRA 4I3SL 4DLFA 4PCYA 4FSAA 1UB5A 1KCSH 5EB8A 4EO5A 2EF9A 1S7VB 4DKDC 4R3SB 5LCVL 1KIRB 3QQ1A 3PWIA 4PRNB 5F88B 4GAAA 1MUJB 4AG0A 1TPDA 3NSDA 4UWQB 4D71A 2MPAH 3U4BH 5CBAB 5IJDC 4AMKH 3VFOA 4EIZC 1LJMA 4Y16B 2J2ZB 3NFPB 1E28A 3B9OA 3B40A 3BLLA 2WQSA 2X87A 2XNAB 3NK4A 4M9PA 4QLRA 5D6CA 1A9EA 25C8H 4RRPA 1FHNA 1AXSA 2FX9L 3SPGA 4BWLC 3OVUB 1WB0A 3WJJC 1C5DB 1J01A 3RPIB 4P8XA 3GFUA 1C9SA 2P8LB 1J48A 4DVRH 3ZT7A 1HXYA 4TX9A 1FBIH 2G2PA 3AS3A 2O6FA 2D8KA 5JQIB 3LG3A 3ARSA 1EEYA 5DJCA 1FZOA 3DX7B 2LU4A 4Z1DA 4J39A 4I9XA 1V05A 4C6FA 1SOQA 3SCMC 3JWNE 3XISA 5CC5A 4HALA 2UZIL 4LY8A 4KDVA 1C5CL 2J25A 2YC1B 1KJ2L 1XCTA 4IU3B 1AZBA 2WUBH 4TNEA 2E5CA 4OI8A 5DU7A 2HA1A 2Z2UA 2AW2A 3G5XA 4NU7A 1OPGH 1LE9A 3ZTJH 1DN0A 2K0RA 2WMIA 4D8OA 4NC0B 4QROA 2XX0A 1CFMA 4AY7A 4FA3A 3OHXC 3UX9B 4P7LA 5CJMA 4OLYL 2FD6H 2YJLA 4L64A 2PLKA 5GGVY 3LVTA 3PAJA 3GG0A 4CMHC 3KLSA 1EMTL 2QKIA 2W59A 6TAAA 3ZLGA 4M7LT 3TT1H 1S39A 5EPDA 3EYVA 4IP7A 4LL9A 2FTPA 1W1A1 3MV8A 3V5HA 4NO5A 1CO1A 5D05A 4LL1A 2ARWA 4HS6A 3AXMA 3BW2A 4LHUA 3WFLA 4NF7A 3VFUA 3WXVL 4HFWA 2ZWNA 1XISA 4IEFB 1CE1L 1RR2A 5CIPA 3ERXA 2J71A 3G5ZA 3GC4A 4GEJA 1BM7A 4V28A 4WI4A 3SY0A 1TRDA 1V3IA 3Q2VA 4S3DA 1OXYA 4QOKA 4G1MA 1V77A 2EKCA 4EX4A 3X13A 2UBPC 5F9JB 1E2VA 3TF4A 4QT5B 2ATAA 4JCWA 1EEXA 1B6DA 2GTZB 1BM3L 1MJJA 4IQDA 3KM1A 4XGZA 1BVNP 4AD1A 3IU4H 3L2IA 3GJFH 4J3XA 1PQZB 4ZMZA 3AU1B 2H8XA 1OF2B 4OQTL 5FA4A 2QVNA 3Q45A 1LO2H 3O41A 4PHXA 2DEXX 1K2DA 3CQPA 4OZHE 2FZ9A 5GRVK 4WO4C 4NG3A 1KF9B 2OJ1A 1OSZB 4Y4FA 3GW3A 1A7OL 3WTWA 4DY1A 5DEFA 4WHDA 3N2JA 1YC8A 3BWUF 1UFGA 4KZEH 1D7DA 3QK0A 3HC4H 5HSFA 3LEPA 2VRQA 2FIRT 4ZFQA 3NQFA 5CCKL 2P8PA 4I0PA 5D1ZC 3HE7B 4QKTA 3QC6X 2APXA 4WK2B 4NGHL 1F3DJ 2PDPA 5LO7A 2AQ1A 4WTZA 1HEHC 2Z91B 4AF0A 1IKFH 3U6XS 2YCEA 4PI0A 4HSAC 7PTDA 4X7TB 4QJ4B 3ARQA 3O6ML 3US1A 3QJRB 5I24A 1H5BB 4CNOA 4WIWA 3WHE0 2JJUA 4IGBB 1X98A 1SYVA 5C9WA 2VZTA 3L1OL 1ZV2A 3U0PB 2VL5B 3NQ6A 3NQDA 1UJ3B 1T6WA 1RUKH 2XUCA 4TOYH 1ITCA 3VKJA 1YNPA 1KWKA 4UWMA 2EDLA 2VDQB 1YUHA 4BRJA 3GDBA 2QEJA 2FRGP 8RUCA 9CGTA 5CJQH 2X7VA 3FHQA 4PC8A 1OC6A 1LNUA 1UUSA 2HRHA 4GY1A 3O11A 5JPNA 4XAYA 1RD5A 2AERT 1W5MA 1HJUA 5ICZA 1F1GA 5ESQA 3ZVVA 4WZ9A 1A4LA 3LU2A 2NDGA 4DUOA 5I66B 1LRNA 3H4WA 4F7EA 2E74C 3RL2B 2NNAA 4OZGB 3AQUA 4WW2F 1MG2C 5TQ2H 1V93A 4Z5RB 5KSBF 1XF1A 5B22A 1E8WA 5KVGH 3G6AA 4IHCA 5DURD 2VRJA 3BZFB 1QFHA 2FEDC 3FU8A 3C08H 3HI5H 3RU8X 4QNPF 1QZ1A 1G4MA 2BVTA 4A8LA 1UH2A 1F4XH 3FGCA 2JTYA 4PEKA 5A8QA 3DX8B 4CEUC 3I6GB 3LZLA 1C08B 4AIXA 2JVUA 2GK2A 5A6SA 4NZFA 4GJTB 4PLKC 2P8CA 1GKRA 2J8HA 1N0LB 3D1MC 1A1OA 5DVLA 4YDKH 2GSIA 2MOVA 3QEGL 3WEXB 2CLMA 1FWAC 1EJTC 4C83B 4UTFA 3II1A 2G0KA 3EKLA 3C2AH 5LNRA 2JXMB 4J4PD 3AYVA 3QI9C 4MDPA 4AG4H 3AROA 4ZI8A 3QIUC 1MIEH 3LB0A 4YHKL 6FABL 4JHUA 1A3WA 2W0LA 2B3RA 4XCNA 4GX9A 1QNZL 2H32A 4W9EC 5E2WL 4YGVA 4HP5A 4NJIA 2B5IC 3ZMRA 4G5DA 4KXZI 3RB7A 3LCWA 5I3JA 3AXLA 1S9WB 4NRYB 1PY4A 5EO9B 4CD5A 2DI9A 3NPXA 3QCTL 5CSZB 3NZRA 2Y89A 4AEHH 1BMGA 1UOZA 2VN6A 3MGOB 4OFVA 2KQNA 3E0WA 3WIHH 4XOCA 3N3TA 2EDEA 3CK5A 4JANB 2H9AA 2VKZG 4H8PA 3VSTA 3PNZA 1MCNA 4W86A 5AVTB 4Q8BA 3FS9A 4JY6A 4KJYA 3FOKA 1MVFA 4Q4EA 4JZNA 2DP3A 3U57A 1ZTMA 2R7EB 1V54B 3OPUA 1GSMA 2PAJA 2DZUA 2FUTA 1OP3K 4Y4KD 5GS2D 1ZHNB 5EORL 1W3KA 5CP3A 4IIHA 3CO8A 3SN1A 3TV3L 4K94C 4LRNL 3EB3A 5LHEA 3TZVA 1IEXA 4MA8L 2FDMA 2CJ3A 1EBGA 4G72B 4N6FA 1G7HA 2W9EL 3DIDA 5IQ9A 4G1NA 4ELMA 3SZ6A 4KQNA 4HS3A 4P9MH 4DO5A 5HYJA 1UJPA 2O5NA 3R8QA 3ABMB 3ABRA 2WNKA 3BRFA 2D3VA 1DO5A 4W9CC 3BVUA 5EIVA 4ZPVB 4LE8A 2QPUA 4MADA 2MNJB 1F8MA 4AMAA 1W9DM 3DOSB 3HNSH 1X1OA 5LIUX 1Z44A 4E6MA 1MN4A 5D4IA 4AVNA 5CGYC 32C2A 1YY9D 5IFHL 4KVCH 4AWJC 2LABA 4XD3A 3RLHA 4B53A 1MH5A 4M1DH 3I3DA 5LAXA 4R83A 4TPRL 1TG7A 2XLLA 4IF2A 5E0FA 1TJGH 3VXMA 4GSDL 1NGQL 3TWAA 1ETZB 5IHHA 3WLTA 3S97C 5FR3A 3KCWA 3PR2A 5IVXB 1IGWA 3OLIA 3ILEA 4QCIA 4FFWD 4U7MA 5LA0A 3CWOX 4IH3A 5KYUB 5C9ZA 1M6OA 4XV0A 1Z9PA 3CNYA 2YQGA 3M16A 2XINA 4DWDA 2Y07L 4NO0A 4H8WL 5F7NC 4HIEA 4B3ZA 3W7HA 5C2UB 1AKJB 4ISVA 2A7RA 3FU6A 1DL7H 3MP4A 2A7PA 3SN0A 3SRFA 1C8YA 4HJ0C 4PG9B 3THML 4AC7C 3IRDA 3OAWA 2OX4A 1I7ZB 4G3YL 1XGQA 1QUNB 2F5AL 4CVZA 2VR9A 3NZHH 4MD4B 1TV4A 3H3KA 4AL8H 4Z7QF 4IYKA 5FO8B 1VEMA 3GMPA 3EYFA 1TETL 1MFEL 2WXPA 5JNYA 4FLHA 3HFMH 3VKKA 3QCVL 1US2A 3QFGA 1Q6GA 3O9WD 4Q6IA 1PDKA 3W7LA 1A6UL 1WUEA 1EO7A 5A6KA 1WKFA 2Y6ZA 4PSPA 3EPMA 1X5FA 4FL4C 4ONGL 4A38A 1Q94A 4ZTOL 3QVAA 5BZDB 5IB1A 1LP9B 3EWYA 1GZGA 1BLNA 3E5PA 3MODH 2JH2A 3RDTB 1T1YA 2XA8H 4S3GA 3IJHA 5IVZB 5LBSH 2CR0A 4KZDH 3QW4B 3CFJB 1R2TA 1A6ZB 4W9JC 3VGFA 1O5RA 4YDLB 1VJIA 4EXBA 3B34A 2H1LM 4MCZA 4PJHB 3VIGA 4KH2A 3MOAL 3AXIA 1XD0A 2BNRB 3D34A 3C8FA 1TTBA 3T0XA 2C19A 1XINA 1LF1A 1R86A 4KTDH 4GUQA 1GWJA 3SDDD 3R8BB 4P57B 3IAQA 1FZMB 4RX4D 4MA3A 4U3AA 1L7TL 4EP8C 3EZ4A 5JOFA 3V18A 4HIPA 3GO1L 3KDOA 3RJDA 1S8DB 4KK6C 2C3WA 3BD4A 4RGNB 2GVYA 4U2ZA 4H88L 1H5YA 4YHYC 4WV1A 3FT9A 3RWHB 4LUYA 2QQLH 3OA5A 3VSUA 5E6ZA 1NCAH 1WAUA 3SCWA 1X7QB 1RI8A 4Y7EA 5DQ9A 1PHWA 3APDA 4AKPA 1S1PA 1EAPB 1KENL 1UFUA 4FTDA 2ADYA 1S5NA 2DD8H 2B0MA 4Q32A 2AXFA 2R2BB 2IWGA 1L8PA 3IGXA 1NH6A 3QPYA 1AE6H 2WXOA 3BMXA 4IIFA 1SXNA 3C0SA 1OAXH 5JDSA 3N2OA 2VMEA 1UB6B 3K5XA 2D7PA 2IPKB 1NEZB 4U1HB 5JR1L 2B1AL 1J8HA 5ISZA 4CQCA 4BCYA 3P4LA 2I9TB 2OEJA 1G7IB 3IU3B 1VESA 4YN3A 4AEIH 3BV7A 1JWMA 4KKNA 4NC1C 4XXCC 4S1SH 3V0EA 1J88A 4X7DC 3PFUA 4UBDC 2XGBA 1UWIA 4XBGB 2O61B 2GGGA 3L8QA 4XBEH 5JMOC 2TMDA 4PP2B 2Z29A 1FZJB 1DVZA 3ONCA 2RCSH 1KLYA 2DJSA 2ODOA 3SPCA 1MNUL 1E4KA 3D33A 1KYOJ 3VYLA 3IGAB 1FO0L 3QO0B 3B3DA 4TSAL 3NZGA 3QJOA 4B5UA 3P60A 2EIMB 5AUMA 5CJOH 2OL3B 3CL8A 4LUIA 1LK2B 1UWQA 1MDRA 3RMEA 3C6LC 2UUDH 5IHZA 1I0BA 2NQZA 2X41A 4JQXA 3ISYA 2NR6A 4Y5YB 1P0DA 1W32A 4UINH 5FSEC 4QO1A 1SDDB 5M03A 2PW2B 4E0RB 2G9KA 4MXWL 3DGRA 4QLKA 3WO4B 3GT6A 2G3NA 3LGGA 4LV9A 1NBYB 2CO1A 2P8MA 4PV9A 4PB3A 3V0DA 3ZSSA 3W9ZA 4ZZ9A 3CBWA 4QP0A 3QT2A 3W11D 5AW0B 4XAZA 4FG6D 4KWUA 2NY3D 3LS5L 4HH8A 3RVXD 2EICA 4FXKC 2NY7L 4G8GA 1I60A 4IRZH 5FHAH 2AJUL 2J7DA 1AI1H 4OZGE 4G5AA 2X6AA 2NUPB 4K8HA 3QNZA 4Z7VB 1T66D 3WAKA 4K7VA 2Z1KA 4I4WA 4IL2A 3WO8A 2QCNA 4XN5A 3OV6A 2J7FA 3V0IA 5B3SB 2QQNL 2VN7A 1E6RA 2ZZ2A 3TCSA 5GGRA 1EUAA 5GNXA 1E4WL 4GMSH 1OVDA 3IAGC 5FO7B 2BASA 3V79C 3I50L 1TZAA 3O3UN 2OQLA 3OBEA 1XTMA 3A4JA 3QVQA 1L9SA 3LRKA 5BWFA 1FZKA 1DQUA 3KTCA 5C0EA 4FXSA 3BKCH 3PLYA 4IPNB 3B1UA 2E7DA 3UPRB 2UX6A 1IT9L 1HKIA 5KWYC 1UKOA 2XDFA 2ZPKL 4MKSA 4S1RL 4MKNA 5EUKA 3HS8A 3KDPB 5A8MA 4A7SA 1M7XA 2BH0A 3JUYA 5C0AA 3NACH 2QADD 3M0YA 2DT2A 2ED7A 3VH8G 1T89A 1XRFA 3WTTA 3CZFB 2G3IA 1QOKA 3LV3A 5DK0B 5DS8A 3VDCA 2BOCA 3D2TA 3STZB 2VDQL 4A22A 1FDZA 1JHKL 1XP3A 4CNIB 3OG3A 2PLTA 1TWDA 1ZBKA 1TTPA 1BFOB 2Z93A 3VD3A 3MOQA 2OMNA 2JGQA 2R56L 4M3HA 1NCCL 7FABH 3BUTA 4XNUH 2BK8A 4ZEPA 1P7BA 3FB6A 1OAUH 1A4BA 4XP9L 4X9YA 4TOQA 3UTZB 4F0HA 3MBFA 1VD6A 2UXVA 4NJHA 3M17B 1X9QA 3NCYP 2WB1A 2QGDA 2F6KA 3KR3H 1OWQA 4RPQA 5INCA 2NXHA 3QJAA 2DGAA 2YD3A 3OAZH 4KX8A 3OA3A 4OCRL 1TQUA 3HMXL 1ZRUA 4P59H 3UC2A 3GMNA 4YMPA 1QRQA 2HG5B 4QRUA 1UVQA 5IHSA 4H04A 2OMUA 1C93A 5DEGA 7TIMA 4ZFZB 4ZJ9A 1OAQL 1T2QH 3FU7B 5T1MB 3KOWA 3FTUA 1H7OA 1COBA 3RQ3A 1O6VA 1G84A 2ZTKA 1B3VA 1A6AA 3SGUA 1V51A 2YXOA 4A2MA 3R8GA 3BAEH 1UQZA 3D25A 4JEGB 3KD4A 2DV0A 4XBPA 5FF6A 2C4XA 4BKSC 3PP3K 1JWUA 3QNYB 3NJLA 1Y6NR 3VRJA 4C4BA 2VCOA 4NOFA 3VWKB 1JTPA 1IGYA 4KQ3H 1IQDB 3PP4H 3PNWA 1GL4B 3ABLB 3DX2A 3LKQB 2ZBTA 2QIWA 4UYQA 2E5EA 4O5LH 5DTFA 4QTIL 5EUOA 3S3DB 1DBKH 4Z3EA 1L6ZA 2V8LA 3GHUA 5IVXE 1EC9A 2X1UA 1HH6A 3BWSA 3HURA 2P45B 3B8YA 2ZX6A 3WTVA 1IEIA 2H9GA 3QNXA 4X8JA 3KWTA 4ILSA 3EH3B 4HMDA 5I3KA 2MEJB 2W94A 2TAAA 4GG8A 3CNKA 3TIDB 3WIFA 3L95A 4QFUA 3N43B 2NY5H 3B43A 1DP0A 3V4PH 4DVBA 1H0IA 3D4CA 2EPKX 1UG9A 2O9RA 2ZOOA 3TEUA 3PJLA 3BVDB 3GZAA 3U0TB 4Q58C 3SYAA 3AWFA 1R87A 5J12C 4ZO8A 3E6FA 2V17L 4RMSA 4PJ8C 1U8PA 4P48A 4FO4A 3OMNB 1PSKH 4FAAB 2VZSA 4GT7A 1OCWH 2V3EA 3WFDL 4ZAKB 4WWOA 4PMYA 2J44A 2FWOB 1PKOA 1QHOA 2OMYA 4XNYL 5LBSA 1I53A 3UMNA 2QVHA 5AL0A 1E1CB 2BGNE 3NZ1A 2YXFA 4PRRA 1PKQB 1TIUA 4AX3A 2ZRUA 1Q9KB 1UXWA 5C2CA 1T1XB 4X9HA 1QQDA 2YD2A 5I1IH 3W7PA 3QEUA 3NDZA 3VX0A 5K7JA 1YYLH 2P24B 3ARBA 4P23A 1ZT1B 1LP9E 5IEKA 3QTPA 4IOIB 4Y16D 1YLBB 4B3EA 3QUZB 4CSPA 1K9DA 1IQWH 4XD6A 1S1RA 4UFLA 2I5YH 2BB0A 3ZZLA 3KPNB 2OMAA 4LEEA 5E8DL 1GGBL 1MXGA 1KBGL 4GQ9H 4PJHE 3AU6A 1MOEA 3W1XA 1PNDA 5IIEB 1QFEA 3RZCC 2D2GA 2QFPA 1G6VK 4P4RA 1MCHA 2BNRE 1U0QA 3RAOA 2OP4L 1PDYA 2O26U 3PM6A 2CLZA 1XF3A 3GG8A 3WS3B 2HKAA 43C9A 3GDLA 4C57C 3TPUB 2J47A 3GTIA 3C60A 5LIWX 4OZHF 2WSQA 4ZTYA 3B7RL 3JWOC 3RP1A 4WSHA 4PWKA 4GRWB 2PO6D 4X8CA 5B1CA 1A7QL 3UZQA 3DYOA 1V7NH 1HP4A 4TUJB 5I76B 3UWEA 4E36A 1HXJA 4LV4A 4RGNE 4JHBA 3FO2B 2A77H 3QBUA 1J12A 1ML1A 3DXAA 1BVZA 1ADQL 4GAJL 1MJ7H 3TNMB 3HF3A 3HE6C 4EDWL 2G4FA 1VEPA 1RJQA 7ENLA 3LXBA 3KM8A 3VXTB 3CYVA 3WIIL 4DGYL 3NM1A 4F9JA 3UABA 2LTQC 3EDEA 2RFGA 4MD5A 4EUPB 2PTVA 1FWEC 4X99B 2OTPA 5H91A 1YBQB 1P6CA 4KKLD 1QAPA 4AV4A 1SGKA 1T8QA 4EI5A 4QXTA 1QP1A 2DZPA 5DI8A 2DQCH 4LCWB 2HTLD 3S96A 3FO0H 1A5FH 4QX4A 2R0ZH 1R24B 4FI6A 4GP8B 3SQOL 2OXHB 4AFYA 1M2OA 3V1HA 1HL4A 4LLMB 1NIDA 2AQQA 1VPOH 4L3CB 4CN6A 1NDYA 1QK0A 2EE3A 2WOYA 3OZOA 3GAYA 4CVUA 2WMFA 4QXGL 1BAGA 4O02H 4KT2A 4AV0A 1KZQA 5AYTA 2J88H 2NY6C 3KS0J 4BFBD 1DEDA 1QLFA 3EIFA 4F7MB 4FC3E 5L9DL 1DFBL 2DWYA 1LO0H 4EIBA 2J8OA 3QUXB 4F2UA 1PS9A 1L6YA 4YYCA 3T4AC 4IRZA 3BO8B 2F68X 2XZQH 2WC3A 5KZ6A 1P7QA 3ORJA 2GHZA 4WKZA 2PGFA 2R1YA 1CQKA 1WBZB 3TR9A 2PODA 2DZEA 2WMPB 2NQCA 4Y5VA 1T0MA 3MRBB 4UT6A 3VRLE 3GSVA 2KT6A 1R3KA 2J7BA 4XPHH 1B90A 4MMYB 2XXMB 2EG7A 4ROPA 4MDIB 1K5NA 1T4KB 4XP1H 2WJDA 2Z65C 4HPGA 3OJDB 4LF3B 3WNIA 3HE7D 3IJ9A 3E0IA 5D2WA 3T71A 1CGXA 1Z5HA 1RZKL 1LM8V 4R4ND 2SODB 4XMLL 1VLIA 2BNJA 2KAUC 2DT1A 2VDLL 4NYYA 3CXFA 4M1GH 2GT9A 1O6SB 1JYWA 1JXGA 3KH4A 4Z7VE 1N8FA 3V8CA 3W72A 3WJZA 3X3FL 3GYEA 3TYUA 2ZZ4A 2GFTA 4OCSL 2ARJA 1F4WL 4JRXB 3GMOB 4K5PA 2F7RA 4JG1H 3RRQA 4MB4A 1TPVA 3ZO0A 1ZVYA 3TEXA 2FYYA 4B5WA 3U6RA 3MBEB 4U0QB 5A2JH 3IDXH 4TVUA 1HI6A 4TQ8A 3AM8A 3F4VA 3S98A 3DEQA 2BVUA 3BW9B 3CCHA 1SEQH 4A8NA 7PAZA 1EK3A 5H8MA 2BSEA 4IFRA 4QS5A 1U3HC 5G4NA 4MNGA 3B9KA 4UU9A 3VIFA 2WSRA 1HL2A 3RG6A 1JE6A 3S1VA 1UGKA 5J1AB 2GJ6A 4GP4B 4TUOA 1YYMH 5ACZA 4KFMA 3AVEA 1FPTL 3QS3A 3FQTB 4I6VA 3AT0A 2EPNA 4L4TB 2GY5A 5FDYA 3WSQL 1OGBA 4PTVA 2OL3L 3L6FB 4JB9L 3DARA 3FYYA 4DZ5A 4OFPA 2NQ3A 1OHLA 4YHML 3DIPA 3W1MA 2EILB 1YNLH 3IYLW 1W1ZA 1I8AA 3VNJA 3QZAA 1KM5A 3EBHA 2FQDA 3W6YA 4Q9BA 1AJ0A 1LLZA 2BIMA 4OCNC 4CC1A 2X1SA 3QKEA 2JB5H 2JFEX 2ANUA 5DO2D 1KTCA 4OF3A 1VGKB 3GQYA 3V6FB 3BXWA 2GTWA 1REQA 4LLYB 4E5XB 1BKHA 4NAEB 4BY3A 1XPGA 2X1QA 5A3ID 4A21A 1FP5A 3VD9A 1FWBC 4A37A 1UWSA 4GIRA 5EDSA 2FJKA 1ZA3B 2JKPA 2I14A 4UM9B 3Q06A 1XYMA 3DESA 4FMFA 1HKLH 3KZPA 3BAWA 4OIAA 1K85A 2E8YA 5DS1A 3V52H 3W39A 3QPZA 5I2UA 3IJYB 2GL5A 2DLFH 1KRCC 2Y8VA 2IQAB 5A6LA 4DEPB 1JPFB 3T77B 4CD8A 3IWVA 4UTAL 1W9BM 3WMCA 1BGXL 1PCSA 4S2SA 1ACXA 4LCRA 5DC4B 1OGAB 1ZKAA 2BP5M 4R0LB 3MV11 2OELA 1WXYA 1QSFA 1PZSA 4P5KB 3QFEA 5DLLA 5HI3C 3GU9A 2CCWA 1WEJL 4MRBA 3CVHB 3GSXA 4WGWB 2K4WA 3NYDA 3BXNB 1RJLA 3U46B 3R1GL 5JOEA 3QW9A 3L12A 4UFHA 4KRMB 4JOMA 2OA9A 2HFTA 1BYDA 1JZFA 5EIQA 3CMOL 2L8AA 2J1XA 4F0MA 3BUDA 1P4LB 4IUOA 3R58A 3FC8A 2PDXA 3BP4B 3W53A 2J4GA 4WSKA 1FGNL 1KTBA 4N8VA 1OM3H 4PB0H 3RX8A 1PCXA 3IBOA 4QXVA 2OTUA 1XLJA 4MUPA 3MV7B 5JH1A 1U8CB 4FABH 4BWLA 5E9NA 2POZA 3AWGA 4X7FC 2IC2A 2Y7FA 2GITB 1LBLA 4ESKA 5I30H 3WJJA 2J73A 3VUAA 4ZCWA 1ID2A 5J5RA 1RV6X 3OHIA 2JIXB 1HJWA 3QJUB 5FWRA 2NXGA 4WJ5A 3NRQA 2C71A 1UWGL 1WIPA 3KWWB 5C86A 3B0XA 3LENA 2X4RA 2GGEA 3S5SA 2LLNA 4JYEA 1EPXA 2XSXA 4EPDC 2X0YA 2J5LC 1LG2A 2NQ5A 2WXQA 2D7MA 4Z7UA 3SCMA 2MNWA 2HFEA 1ZP3A 5DJ6A 4DW2H 5HJDA 4LY4A 1JR1A 2HZHA 4JX5A 5F8QC 4A2DA 1Q9WA 3HMWH 5IXEA 4P05A 4GISA 2FNWA 4M6OL 4QEEA 2YUVA 5BV7C 1VACB 3EBGA 1BQLL 4MQTB 4MSSA 1Y18A 1GC1C 1L7IH 5J7CC 4N2LA 4G5ZH 1J96A 3IM1A 4AK1A 3RYMA 4Z0JA 3COOA 5I1DA 3MZTA 3W73A 3QHFL 3AUOA 3OHXA 1S2UA 3L9RB 2MWCA 1HHHB 4LLUB 1ACYL 4X5WA 4YTQA 4P4KC 1QDSA 3EG9B 1PKQE 1TG8A 3OM3B 3ESMA 2CLHA 5K39B 1DHKA 5KSVB 5ALBL 5E51A 4AX7A 1UOWA 4LCCB 5DJ0B 1I3RA 1SJVA 3X11A 1HNGA 4H0HB 1AIFA 2Z92A 1NMAH 4C1KA 1N67A 3P73B 4TVDA 4YLCA 4YXGA 4DJMA 1JYNA 3PHQA 4Q3MA 3K0WA 3MO1B 2A21A 2F58H 1AKJD 4HV8B 4I18C 1NA8A 3KPPB 3MOBH 1Y0EA 3GSNB 4B5NA 2PEVA 4IT1A 5C07A 1OX4B 4L8CA 1CFSA 3U79A 3B4UA 4NHUA 4J3UA 3T0VA 5CZSA 1B0RB 1OGGA 4FLOA 3UXAA 3EFOB 4HWNA 1JF5A 2WZTA 5A95A 4O17A 2NY0D 1SO6A 5TDNA 1RUML 3KPSB 4I85A 1J0YA 3ILPA 1ISYA 3UDWC 3EX2A 2ZRVA 4GZJA 1FN4A 3RN6A 3HNVL 5JIKA 4W5UA 4J23A 4MVBD 4E2BA 3MC0A 1U8HA 4KFOA 1UOKA 2XWTB 1JD7A 1OQOA 4L05A 4MGXA 3QMSA 3HB3C 1JERA 2ADGB 4GRWE 4K3JH 4J40A 4LS1A 3NRFA 4WO4A 4KOBA 2CO3A 2EG6A 3BLPX 2EDMA 1A4MA 4O4YL 1T5AA 1E55A 1IXQA 2BSDA 1P1ZB 4Z3FA 3TSMA 5ADOH 4B9YA 3RDTD 2Q87A 3CU7A 9PCYA 2WWNA 2WB5A 4H9MA 2J6EA 5C7HA 3VXPA 1SLXA 4UQ3A 1T1WB 2B0SL 2VSKB 5F6IC 5D1ZA 2XG9A 4BI7A 1T40A 5JPMC 4OJYA 3A3HA 1Q90A 1HG3A 1IX2A 1GOGA 3ABXA 5FF7A 2D31B 2K4AA 2OODA 4D9LH 3BUIA 4O02A 2BNRD 3TW7A 4CQ8A 4PMVA 2YBUA 2J88A 4LWWA 5ELIA 4AYDC 1U5JA 2APBA 3GR7A 4BFIA 2PDCA 1RVKA 3S2AA 1AH3A 5ALCH 1OTUD 4LCWE 2BW5A 3ZKND 1HKKA 3G6JA 4XVEA 1KBIA 3VFRB 2PDUA 3MSDA 2W91A 4M5PA 4M7KL 3ZWTA 1BWKA 5FPIA 1GKEA 2YPKA 3ETBJ 4RGND 1ULVA 3B2UD 2HT4D 3TCTA 1OP5K 2DLIA 3GIVA 1J1XH 1E9OA 3SSJA 3SPVA 3DROB 4UI2A 1O5QA 1RA5A 1BBDL 4MNHB 4IGHA 1V3MA 4HU2A 4X4ZA 5D33A 3AIWA 2R2EA 3MA7A 1ECEA 4M93C 3VFPA 4OZGF 4UUJB 4LLWB 1I7RB 1JEZA 3GUGA 1Y6KR 2P49B 3JVGC 4HK3J 1J9RA 3KBFA 4KAQH 2OSLB 5AZ2L 3IXTB 1XZWA 2NQHA 3B9DA 3QXDA 2VZ3A 1IC1A 2J1YA 1PSCA 2A6KB 2COQA 1CLCA 4L0PB 2YGYA 1QFWM 3WBWA 1IR1A 3T0BA 2A73B 2B7NA 2AABH 1LZOA 5IFJA 4B0MM 1AHWC 2RJHA 3LKPA 2EDXA 2OQJB 3WD0A 5M5DA 4N7QA 3S36H 4LARH 4C7GA 3JV0A 3P6LA 1UT2A 1N5YL 4XTIA 2Q8BL 3MUXA 1TJXA 3R06A 1J8KA 2IDSA 4O54A 3TSDA 5TFSH 1EXUB 5GGSB 2QFRA 4YDMA 1MF2H 2WIIA 1TYGA 3WLNA 2PO6B 1JK9B 3QI9A 2VFDA 1TUXA 3QIUA 1QRNB 3MLWH 4NVTA 2V2TB 3M1BB 5I07A 3N40P 4JQVC 2IADA 1UHVA 4JRXE 4PY7B 4HKXA 5ABFB 5T1KB 3V9FA 4YL4A 1T2JA 1YAZA 1EQWA 2B59A 3OL2A 1CNVA 5CJ8A 1PWMA 3V4VH 1HN1A 5G2WA 3A67H 3IDMA 1H63A 2X1WL 5DJYA 4S2BA 2CM6A 4RDQG 1QW7A 4OKVA 3Q1SH 2G60L 3S1WA 5HYQA 4FQIH 1VHNA 1MCLA 4NJ9L 1Z48A 1GW0A 1M9HA 5B38B 4PLJC 5EBMB 3EFDH 2J5WA 4WR3A 2GVJA 2XIOA 1QO2A 3FF8A 1H9VA 1J05A 1WFJA 4LP4A 2ZQKA 1K4CA 4ONFH 1TV8A 4GSRA 1P2CB 2A6IA 4UT9L 4DKEL 1G6CA 1JUFB 4L4TE 3NOIA 4YDNA 3TV8A 4DP4X 2IPFA 4DBEA 4NQTA 3PTKA 1WKEA 1I8JA 1CDYA 2CBQA 2BOLA 3OKEA 1MRQA 1NBZA 3FCPA 1EPVA 2LFGA 2BY1A 4PR4A 5I28A 1F1AA 2IPUK 1RZGB 5DJDA 4PMDA 3ALWA 4PRDA 3T07A 5MEQA 4N2BA 4B5TA 2VDNH 3SE8H 2J8TA 4YHLH 3WI9A 1IC7H 5CZVL 4PBXA 1DQLH 4BQ9A 3ZZSA 3C3NA 1W3JA 4ZO6A 1E9QA 1TQBB 4GQRA 3OAUH 4NUWA 1MCPL 5KOVC 1K8DA 3TMLA 1U41A 4ZUTB 4MJIA 4KRPB 1PS3A 5EU3B 2A6NA 2H6UA 5C8JB 1J5OH 2NT1A 4LASH 2E5BA 3DPBB 1II4E 1RZMA 4B90A 2W60B 2DM4A 3VW3L 1FWGC 3VJ6B 3IN2A 4HAKA 3WD5L 3H56A 3V0SA 4YBLC 3VGHA 3ROLB 1OGAE 2EIZA 3UWUA 5E08L 3WJMB 3HFYA 4B15A 3RLVA 3L3GB 5CH9A 5I71B 1KTDA 3BCFA 3PSWA 1OIMA 4KJQD 1A7BA 3W00A 2VRKA 3LKOB 4DUVA 5J4MA 5HY9A 3S8HA 2QJHA 3T0WA 1QSEA 3QWNA 2GPZA 1TSRA 1QLEB 1I7UA 3QISA 1DLHB 5TF1H 3WL9B 3NA8A 1X44A 3ARFC 3AAMA 1S7UA 2ZDRA 5I2IB 1U2YA 5F3HA 3BLIA 4WNJA 2FZ3B 2J6VA 4L18A 1S7RA 2QULA 4LGRB 4YHGA 5C0JA 4P7NA 2ZWLT 1K77A 4U28A 3MV7E 1EO8H 3PFMA 4IUGA 4N0CD 2YAEA 3QPXL 3I75B 5C0CA 5FV1L 2APTA 1H3UA 4Z1PA 2R1XB 1THFD 3TR2A 3SOTA 1JV2A 3ZKXC 2VITB 4ZUSA 1K6QH 2WCSA 2F5BH 3QQ9C 2EDHA 4R84A 1UWEH 3QS2A 2HT2D 3IRZA 3UG8A 3P3BA 1NJ9A 1NIAA 4L65A 3CSYB 3HOJA 1XVSA 3MNZA 4FQJH 3NCBB 2VSCA 3F7YA 4W84A 4N5EC 3PXLA 1IT8A 3K1DA 1LP9F 5C0NC 3EFFB 5KN5B 2KZHA 4NM8L 5DHYB 4POZC 3ESUF 5F0JB 2XH0A 2L7QA 3SUSA 4HSNA 3GM0A 5I5IA 2GVGA 2AEIT 3VWKD 2A3LA 1DN2A 3FTZA 2BTMA 2CO7A 4BH8A 4PJHF 3V6ZB 2NYKA 5GVJA 1K7XA 2ZXQA 3RA7H 5CCGE 5DXXA 3ECBA 1FQ0A 5KTEH 2PDYA 5FJRA 5KVEH 1I4NA 1GGCH 4XH2A 1W0WB 1BDYA 1OPOA 1XSIA 2PCEA 4Z0XB 5KINA 4H2HA 3MWAA 2QELA 1XGYH 1OL0A 4WGHA 1X5ZA 4PYHA 2X0HA 2OR9L 1NQBA 3CVHL 4PGEA 1AK5A 5HGHB 1NCOA 4HJUA 1W72H 1DBMH 3W81A 4PRPA 3IGSA 2V7NA 3IFOA 3HI1A 3F8UB 3B9NA 5I8KH 2ADFH 4G6KL 4E42A 5IUSA 5I79A 5DMKB 1PYWB 4N8PA 3Q6FA 4WI0A 3G6LA 1B2WH 5KVMC 4ZAKD 4AW7A 4JDVB 1KPUA 3KPSE 1GHFL 5KUMA 1D3CA 1A6TA 5A2LH 2VFFA 3BQUC 5FK9A 3ES6A 2D23A 4RLIA 2JQMA 3UGUA 4C56A 5C08B 1EP3A 2WV3A 3AZTA 4BQ3A 3HBGA 3WKML 1MVUA 3JTBA 5GGQH 3JWOH 5FJOA 5A6BD 1YNQA 4JMXA 1D7FA 5J8LA 4Y9MA 2DM7A 2WWMC 2X4UA 3QFJA 1WKDA 4LSBA 3LRLA 3PHOA 4ZXOA 5SWSB 5JA9A 2YGOA 3BZDA 3LSCA 4HZMA 4AX6A 3HR5B 4JFQB 3HZMA 3U1SH 3ISIX 3QUZD 5FLUA 1NQKA 3VKAA 3MRFA 4UXDA 2OT1A 3TC3A 3UR5A 5GJTL 4XXCA 3V8OA 4HCLA 5SX5K 1J5TA 4JO3L 1B4KA 2JKLA 2O5ZL 4GLEA 2OM5A 1Q8MA 3NPZB 1J87A 4L9LB 4C6IA 2W88A 4A3QA 1CDGA 3VVVA 4RW5A 4QWWC 1UD4A 2A0LD 3MZNA 3LQLA 1QBAA 2ZWKA 1BGGA 1G7MB 1TV3A 1JF1A 4F15C 3U7BA 2NVDA 5CKSA 1JZ7A 3C6LA 2VD8A 2ZXWB 4B60A 2GWNA 5GRUH 1ORQB 3SQSA 3ZXAC 1YMHA 5I6XB 5TK2A 3VRLF 1L9WA 3LDBC 3ARPA 3Q9PA 3W7DA 4QRRA 1NGPL 1D5BB 3W7MA 4TV5A 2VLLA 4Q8PA 3UPMA 4TKWA 5AOMA 3EH2A 1RUQL 5IREA 4G2AA 4WHBA 1I9IH 1J5CA 4Y2NA 1CK0H 1DV7A 1AACA 4GI8A 2IDTA 1JRCA 4DQAA 3KPRB 2X7LA 3ELQA 5IP4A 1AY1L 1UADC 4L4VB 2VEGA 3KOYA 4YSQA 1TPXC 5FYLH 3LA4A 1IEBA 4QLLA 2W3ZA 4KK9C 4JKPH 3GK8L 1MFAH 1JL8A 1YNTB 3UPWA 1OHZA 3GHEL 1Z3GH 1XUUA 4ETYA 5JU6A 3O4OC 4Z77B 4IBVA 2YD6A 4MMXC 1MAJA 4ZMAT 1XJBA 4Z1BA 2L3BA 4NO3B 4LCWD 2OWCA 1YNKH 5I6SA 2DM2A 3PJSA 4PS7A 5DXYA 3NGBC 2J9XA 3DBXB 2NY0B 1VC4A 1QFWH 1TQCB 4ML4A 3R0UA 1W1TA 2HVJA 3BE1H 3C6SB 3IFLH 4ZSTA 2O72A 4FHBD 2ITEA 4ZK8A 5I19H 4FFYL 3V4VA 3VI4B 3QCUL 1SFHA 3A4AA 2R69L 1YLVA 2AF2A 3ETBF 4NFCA 4XZUB 4LLQA 4JDZA 1U8QB 1QPKA 2J7HA 3MROA 2GUUA 4H6QA 4YZFE 5SV3A 2Y7EA 3QUXD 2TRYA 1TVHA 3U7WH 3LDVA 1QRNE 3W1LA 4CRPA 4D0BA 1ED3A 1G6RA 2CIKB 3CN0A 2JF7A 1RJPA 1UUMA 3EEGA 1SFSA 1FVDA 3STPA 1G01A 5AW7B 3NH7H 3H23A 5D2VA 4XIMA 5J0BA 3DWTA 4PUEA 4YH6A 4MM1A 3JU2A 4PMNA 2X9WA 1RIUH 4U2YA 2I57A 3LNPA 4IBQA 4NNPL 1OM0A 4FG2A 3DVIA 3X1GA 4HEMA 3BUVA 4LKCA 3ARDC 2ZADA 3WLHA 1MWAL 2FT8A 3K5RA 3IUHA 3L4VA 1F2QA 3V16A 1IO4C 2RUSA 1K6WA 5AB9A 1JYVA 5T8GA 5J13B 5I78A 4UZGA 2CO6A 3WAJA 5AYYA 2ICWJ 3QIWC 1TVBB 2IH3B 1JK8B 3HPLB 3QPQC 1SXZA 1BEYH 2YBGA 3Q6GL 4CKVX 1IBGH 2IGTA 3QQ4B 3QZLA 1CLYH 2X6BA 4H1LH 2A4ZA 1GOFA 2NXZB 4JRXD 2OJZL 5E8OB 3QE5A 4K3DH 1RIVL 3WMBA 5DRWB 3PHSA 1XR8B 2HFFB 4N2AA 3AFLA 2CALA 3U4KA 2YPVL 1QFUL 3BHBB 1OT4A 5KBDA 3MBED 5GJNA 1GW1A 3OPZL 3WIJA 4N0FB 2PE4A 3RM8A 1ETJA 5EU6E 1IZKA 2NT0A 5E24E 3FDWA 4JG9A 4QAMB 1RMFL 2QGYA 2E86A 2D9QB 3MBWB 3C09C 3QZWB 5G4EA 4GKSA 4HLJA 1EERB 5MKGA 1TQSA 3MUZ1 4BWTA 3ZIZA 1S78C 1OTTD 3NIDB 4IQEA 4CD6A 3LV5A 3MCMA 3VXRA 1BOGA 1G69A 4WK9A 3MRNB 4L4TD 2DZTA 2WHJA 4EPEC 4IGSA 5LHFA 4HA1A 3HI6H 1FYHB 2BW4A 1Z2KA 4C58B 2EUVA 4IMKC 3QXUA 1ZLEA 4OV4A 3CUPA 4PTTA 5DUJA 3SUVA 3QEHA 3MA9H 3OB0K 1NFAA 4KTGA 5GZOD 4EWJA 4N6QA 3O45A 2Z64C 3CVDA 3C12A 3C6CA 3CAQA 3E38A 4NAJA 3VAEA 3K6SB 4QE1A 3BKYH 5I1LB 4BKLB 3ZLHA 1U42A 3EJJX 3VACA 1PX4A 1K72A 3N43F 2RTTA 3BV4A 1RD6A 4NQCA 4FOMA 2NY4D 3PZ9A 1H1NA 1FNFA 4IMGA 4UTLA 5CP7B 3P9MB 3GGWA 3OG2A 3FT1A 1J0ZA 4UM9D 4BWWA 3UEQA 3VFMB 3VXNB 2I7GA 4J3WA 3FQUB 4UM8A 1JVLA 2CHWA 1H19A 5IROD 4QMEA 4K1GA 3PWGA 1UA3A 4PJ8A 3M44A 1YQVL 5J6GB 5EEXA 4WY7L 1Q45A 4OJDH 3C86A 4Z95H 4XCFL 3CFDB 2Q6WB 1OGAD 1RSCA 5HHVH 4HK5A 4U3SA 2R0LH 1BV8A 4JHWL 2NX3A 4QLWA 2RAGA 4YNYA 5ETUB 3C5JA 4KHXL 4LVNB 4U1JA 3VSVA 4F3HA 3ES8A 4X4XA 2EDOA 4Y8AA 4F5CA 4UT6H 4TLSA 1IEWA 3LQAC 3KPLA 4YR6B 4GIOA 2CMRL 5I73C 4HZLB 4FHKA 2VDKB 1DPMA 3HC3H 1E3ZA 1BOYA 4AZCA 2A3CA 5BV7H 1KRAC 4F2ME 4GIEA 5FKAA 1H41A 1Q4NX 1UM5L 1W72A 1GC1H 5CZXC 2DLTA 1B88A 4JN2B 1GKQA 1XYLA 2VXTH 5DVNA 2C9UA 4FULA 1I9JL 2DWDB 3MV7D 5GGUB 1RJYB 4UQIM 5TE7L 4MNMA 3PBMA 1F07A 2YLHA 3SJ3A 2V3GA 3TAKA 3QN3A 4TUKH 3RZCA 5FKPB 3D4GA 4PREB 3UY7A 4KRNA 5F4SA 4ZQNA 2JIXD 2WKOF 2EABA 1T04B 3K8LA 2K3HA 2KL6A 5I5JA 2KERA 3FMGH 4V27A 4JM2C 4NQVA 4AQOA 3IEBA 3MJWA 3MJ9A 1XSOA 4GRWF 4BZYA 4M0XA 2YUZA 2O5YH 1HVQA 1CZ8H 3VINA 4XPFH 5JIIA 1MZZA 1QLEL 4MX7A 1CQYA 4ZFGL 1JQVA 3UBXA 4LYQA 3M45A 4HC1L 1Q6QA 2AJZB 4ZOBA 4EN3B 1HEZB 1WSST 4NLHA 2X4QB 4OGAC 1MDLA 1LXMA 5AOJA 4AY1A 4OUUB 1ODUA 1AD0A 2IBZX 4JRFA 3HE6A 1IKNA 2P80A 1VCAA 1Q1PA 3RILA 1BP3B 1XX1A 3QSTA 2JKEA 2D2OA 5FESA 4HPXA 4HIXH 4J6RH 5C08E 5KSUA 6PAZA 4XZBA 3KVKA 3BG3A 4OIIH 4K39A 2GK0B 1WYIA 4ZT1A 1BKSA 3WLWC 3GBLA 4OLUL 4HIIB 5FUZH 2WNWA 1CLOH 6REQA 5SWSE 4M48H 3GKWL 2K70A 1YDPA 5REQB 4HPNA 3GBNH 1IGCH 4U1KB 3KHOA 2QDGA 2B2XH 3IEAA 1TV2A 5GRVL 2IDFA 1AXTH 2RDUA 1AQKH 5DQJA 4YSUA 3WHE1 4UTBL 2YSSA 4GC3A 3JWDL 1TYEB 4OKDA 1P0KA 4XHJD 4ZDHB 1KV7A 3OSVA 5CLZA 4JPIA 3M1CA 4LH8A 2MUCA 3Q2LA 5HHPB 3MCKA 4D0DA 3FH7A 3TAOA 3RVWD 4CNSA 2ZP8A 3KPSD 2ZUWA 2WLKA 4ZMYA 1GGYA 5DD1L 4K73A 1UWXH 4PJFB 2WB7A 5E2VL 3IAPA 2BS8A 2NW3A 3ULUC 1IE4A 4XVUD 4FLRA 1EXPA 3T4AA 2ICEB 1GQKA 4DCQB 1XRTA 1W17A 5FB8B 4WY0B 1YPZB 4HF5L 4GXWA 3PDGA 4QCFA 1A5MC 2E6FA 4HPOH 2O7SA 3UT0A 4QKXB 3CVIL 1K9TA 3CFBB 3HLAA 3LVEA 3DERA 1ILSA 4HGKC 4ADSA 4YTUA 2FFCA 4J1UB 4UCGA 4GH3A 5CCZA 5I8CA 3KPRE 2VCCA 3ILQD 2BNUA 4L4VE 4U0RB 3GIZL 3ZL4H 1E5JA 3DBSA 5HI5D 2OB3A 4AGOA 5I1EH 3QQWA 4KK5D 4GAGL 2PP1A 4J1OA 5TE6H 3ZYOA 1SXSA 2WXHA 4KI5E 2VB5A 2XG4B 4G8IB 4J8RA 3K1GA 3IETB 5E00B 3NFNA 3NOEA 1N82A 3G22A 1T22A 2VN3A 3UTSB 1XBYA 4AZ6A 1RU9H 3MZGB 2VR3A 2NUTA 4A7QA 4ZD3L 1YEFH 3VZYA 2RJGA 3VI4E 5TAOA 4OGXH 2DI8A 1AANA 4AKOA 2YL6A 4TLTA 1LBMA 5EZJA 4UOJA 1MLBB 1M7PA 5E8EB 3ZO9A 3RWFB 2EYSA 1ZAHA 1KFGA 2EACA 1YMMB 1U3HA 4HDIB 1FH2A 3M9YA 4HEPA 3N06B 5C6TL 3KBHE 3FTSA 1E5CA 1J9QA 1AO7A 1V0KA 1TA3B 3MRJB 3KBSA 5A6TC 3QNFA 3QJSB 3AY4C 2V6AA 1I9EA 3FPYA 1F4AA 3OBAA 3DO7B 2CZ5A 1N6UA 1TPWA 1S9YA 4WUKL 3DENA 1S3KL 3UNDA 1XQ4A 4JN7A 4QEHA 4Q6YA 2ZCKL 1P1XA 1S7WA 5CJNA 4H1LA 3W7CA 4ZS7H 4D6IA 4GUPA 5LXGL 4HJSA 5ICXB 5LZLA 3K91A 2QYGA 2FB4L 1UBPC 4HYTB 2YPLA 1U8JB 3MRHA 3QV6A 1UWTA 3EJZC 1M1XB 1KXTA 4BH7B 3KTSA 3WNNA 1HO1A 4XMKH 3IDJA 5CZJA 4PUUA 3MACH 5AKQA 4HIQA 5B39A 1REIA 3A6OA 2P44B 4NN7B 5EMUA 1VFTA 3VUSA 3LRSB 2X4TB 3L5HA 3SDXB 4PJ7A 3UPBA 1B3ZA 1QRND 3GRWL 5EIIG 3U9UB 1GVQA 3V0HA 5AVYB 5T1KD 4KQ0A 3DIFB 1T21A 1LLWA 3S34L 3KLDA 4R5VA 3TYGL 1OFOA 5JBFA 2ED9A 4ES9A 2EXSA 2XIIA 1D7KA 3UR2A 5BJTA 3E2HB 2FJFB 3A0OA 4D3CH 4PLOB 5HGDA 1CGUA 2A85A 1KYDA 1NWPA 5IHUL 3IPEA 3N4FA 4UTTC 2F1AA 3C87A 3DUHA 3QXVA 2G4EA 3FXIC 1BCIA 1NGXB 4C60A 5D8JL 3F83A 4QHRA 2WXDM 4I5RA 4NQSA 1MCOH 4FFZL 5HJ3B 1LQSR 1J9TA 1BYOA 3NIDE 3O0KA 4U5IA 3QIBB 3HTWA 1GJIA 2XGZA 3CDGA 3KYKL 5FEPA 3UTQA 2R1WB 4YHNB 2VVSA 2PCFB 1NEUA 2PGWA 2J6EH 1DJSA 3LZRA 2JKXA 2EYTB 1EJWC 2JK2A 1GY2A 5I6NA 2YGQA 3ZKMD 4LS0A 3B0PA 1G4TA 4JFZL 3GSQB 1A6WL 4JVUA 3MAWA 4DGUA 3CBRA 3DN5A 3UGVA 5DZPA 1P4BL 1KFEA 3WLKX 4Z1CA 5JBDA 1KG0B 3TBBA 5EU6D 4HCHA 1PX3A 4R8WH 4WK0B 3C6EA 1A3RH 4Y1SA 1HT6A 4A35A 3LPGA 3QRHA 1SJXA 1HVXA 4DX3A 3MRGA 3KRSA 1VCGA 1O9ZA 4XZ9A 3SIZA 5CBEB 4HG4K 3WQGA 4KRPD 3VIOA 3MJ7A 3C56A 4Y9CA 1XL6A 3INUL 2PWFA 12E8H 3TS8A 4B3KA 1Y0LA 4E9XA 1W6WA 5E9DA 3GWJA 2XWCA 4Z2KA 5I1HH 4REQA 1V7YA 4NPYA 4EOWL 5HTSA 1IBYA 4LQFL 5DD6B 1KEMH 1FGVL 4YVUA 1CS6A 2BBFA 3SRHA 1XIWC 3T78A 2LE9A 2DZWA 3R10A 2GBAA 3PRZA 1F3XA 5LKNA 3K2UL 4HPHA 3ROOB 3NJ3A 6XIAA 2ICWI 1MO0A 4HJJH 2TSBA 2E68A 1E5AA 4YSPA 5F3BA 2DLGA 3RWIA 4QAIA 4HOZA 1TR1A 4I18A 4NZJA 3AZRA 1LEKA 3CZUB 1NAL1 1FH7A 1YEHL 3GTTA 2NQJA 1TF4A 1EYEA 1ZSDA 1GHSA 4PRBA 2CJUL 1I45A 1EJXC 4PSRA 1HYSD 1Q2RA 1DIEA 2AXHA 5AOIA 1BJ8A 5CEWA 3G5YA 3BQ5A 2O6EA 3PNUA 3KYMB 3SRDA 1T5XB 2VWTA 3N19B 4WWKB 3UDWA 3GW0A 4I1NB 4PM1A 2XFGB 1MHHA 2AXGB 1RHHB 4L4MA 2XVKA 3E9TA 2DEWX 3U2SB 4M3JA 1NEYA 2MFNA 3IUIA 2VAJA 5DFVC 5AKVA 3QXWA 3TBVA 3CH9A 2Q86A 3M5VA 1X6LA 3S6CA 2WZHA 1U8IB 3KXQA 1IM9D 3NAAL 4MB1A 3D9AH 1Q9LB 3U4EA 2YW3A 1D5MA 2DWSA 1ZS2A 3QA3B 5IB4B 5ANMB 4ZNEA 4GO9A 1I1YB 2H6PB 4XCCL 5JPMA 1MY7A 3CC5A 3N1PC 3WY3A 5EFIB 2R82A 1EANA 2NY4B 1H7XA 3FEQA 1UP2A 5EFDA 5HHMB 4U4MA 5F9OL 3LSOB 5BU9A 2GSHA 1IQ8A 3PWVB 4MD0A 1TJRA 1TZ7A 43CAB 4CEXC 3E0FA 3FDKA 3BJFA 1OT1A 3EF4A 4MY9A 4NENB 1SVCP 4JHAL 3P9WB 2X4SB 4E8GA 4IWWA 3B97A 4W88A 3TQKA 3OZPA 3H0TA 1MCKA 5F1IB 4MA1C 1SBBA 5KSAC 2W07A 2CU9A 2QCMA 4K94H 2DQJL 1GGIH 4Y0GA 3WMPA 2GOKA 1JOIA 2VDKL 2VQTA 1UTDA 5HYSG 2EIBA 3WBAA 1ECZA 4P07A 1R3QA 4FLQA 4M62L 4DXVA 2CBUA 1D3GA 4TVPE 8XIAA 3E9AA 1P6AB 4PJFE 1TO5A 2A5UA 2FMOA 1PLAA 2YL9A 3LHYA 1F13A 5JIMA 1CIDA 3L7FA 2DJUA 3WS6C 2VC6A 5C08D 3H9SA 2FX7L 2PU0A 4AVKA 3JVGA 5D9OA 3VRIA 5EZLA 2HKHL 2J7GA 1YPZE 4NB7A 3FT4A 4EKXA 5I1JL 1WDPA 3OXRB 3ZU8A 5SWSD 1NFKA 4CSSA 4N25A 4ONHB 3OMAB 2WXIA 2Z27A 5FGSA 1SBSL 2ZOLB 1RQEA 1EZLA 1AHWA 2DPEA 4GQQA 4ZO9A 3IVTA 5A5WA 2EUWA 3LNHA 4X6FA 2JQXA 3H26A 3AZUA 2XG5B 5A2BA 3CH1A 4FDWA 2DIEA 1QFOA 2YGVA 3AIBA 5F97E 4OUEA 1KXQE 3FKKA 2ORBH 3RVUC 1WFOA 1DVFB 3W27A 5LDSA 3TNNA 1NCWH 1XGUB 4UDTA 4M1CC 2AJ3A 1BQHB 4OGYL 2VQ1B 3VMOA 1DKWA 4YS1A 3FB7B 1IYXA 4NM4H 4UV4H 2BWQA 1YEKL 1U5VA 1N19A 3AMLA 4YZFF 3KPOB