3WY2A

Crystal structure of alpha-glucosidase in complex with glucose
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
535
structure length
535
Chain Sequence
NMMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLDNMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSRPENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEVASDLPVAHFTATRDGSTLTLPAYQAAFMQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-glucosidase
publication title Structural analysis of the alpha-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism
pubmed doi rcsb
source organism Halomonas sp. h11
molecule tags Hydrolase
total genus 192
structure length 535
sequence length 535
chains with identical sequence B
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3wy2A03
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3wy2A02
2XN0A 3A22A 1NM9A 4U2ZA 4M56A 4HP5A 3AMKA 2Y5EA 1XH0A 3UG5A 1Z32X 1GJUA 3DX1A 2XWDA 1ODUA 2X2HA 2E8YA 4AEFA 4UZUA 2WPGA 1HXKA 1R75A 1TQUA 2XIIA 3CZNA 1U30A 4GI8A 3WEOA 3A4AA 4LXFA 3VX1A 1U2YA 3H54A 3LXCA 4UZSA 1B0IA 4J3VA 2WSKA 3BH4A 4BZYA 1SMAA 4FNPA 1U33A 1Q4NX 5I5RA 4FNTA 2YKKA 3H53A 4H2CA 3VGHA 7CGTA 2WVSA 1MFUA 4HOWA 6TAAA 1XH1A 2ALWA 5CLTA 4CVWA 2WSPA 3WY4A 4J3UA 1BF2A 3LXAA 1UD4A 1LWJA 5E9AA 1WZMA 5CLWA 1DEDA 1D7FA 3DDGA 4NX0A 5HPOA 3GTNA 1GVIA 1OSEA 1AQHA 1JL8A 3HZ3A 3WNLA 1VJSA 4GQRA 2QPSA 3BSHA 2WKLA 1VFMA 1UH3A 1JXKA 2G3NA 2XN1A 3UG3A 5C8BB 3DC0A 1XH2A 4UOZA 2D0HA 3D52A 4W93A 2VT0A 3BUQA 3BVVA 3L2LA 1QI4A 2BXYA 3EDFA 1JI2A 1UD2A 1EA9C 1RP9A 3BCFA 1EH9A 3KE0A 4CGTA 2XIBA 3EDEA 3LRLA 2DH2A 1HNYA 1A47A 3OLDA 4PSPA 4CN6A 1MW1A 1WZKA 1JD7A 1QX1A 3A23A 1R33A 3BAXA 5HDRA 3IJ8A 2WVTA 3VX0A 3VU2A 2ZUVA 4B9ZA 3A47A 4UQDA 2WC7A 1EO5A 4JFUA 3VMOA 3GXNA 3BMWA 1QI5A 3ZSTA 2E9BA 3IJ7A 1CXKA 2E4TA 2ZX5A 3TTSA 1BAGA 1NOFA 3VGBA 1QWNA 1BVZA 3QGVA 1E3ZA 5I23A 1VB9A 3BAWA 4PCTA 1CXHA 3DDFA 3RILA 2X2IA 5DFAA 2GJRA 3TV8A 5BRQA 1ZJBA 3WEMA 5A2AA 3L4ZA 2ZXBA 4KWUA 3S2CA 2ZX6A 1VFUA 2F7QA 4UCFA 2FYVA 5E6YA 4UQBA 3IGUA 1CXFA 1MXDA 1RP8A 2YIHA 2PWHA 3L4UA 2NT1A 3D4ZA 1VFOA 5DO8A 2QMJA 4J3TA 3ZR6A 1DTUA 4PEEA 2GVYA 1XD1A 1BG9A 1CGYA 4J3WA 1UASA 2WKGA 2ZICA 1CGUA 3WNKA 3ZQ9A 3S5ZA 3BUPA 1PIFA 3BAIA 4AW7A 2V3EA 1G94A 1TQTA 1VIWA 3OLIA 1GJWA 3VSUA 4GO8A 1TQWA 2WVUA 3GXTA 1XSIA 1JGIA 3L4TA 1WPCA 3A21A 3W37A 2FHFA 1XCWA 4E2OA 2J25A 2ZXAA 5A6LA 3ECQA 2EO7A 9CGTA 1E43A 3CZLA 2BXZA 5KEZA 3A24A 3FW6A 1R34A 1C8QA 4FNUA 3BVXA 2WCGA 1KWKA 1J0JA 3WY2A 3DX3A 4WSKA 1E40A 1RPKA 4JCMA 3EJRA 2FH8A 3CGTA 4BA0A 1WO2A 1MFVA 2OSWA 1KBKA 2D3LA 4GIAA 4TVUA 5BRPA 2BHYA 4DO5A 2FH6A 4CKQA 1MW3A 3WY1A 4GI9A 1WZLA 4WF7A 1R7AA 3LRMA 1XSJA 4DO6A 3AXHA 3LXBA 1PZ2A 1J0IA 1TMQA 2Z1KA 2DIJA 2TAAA 7TAAA 2ZWYA 4U3CA 3WFZA 3LRKA 4OKDA 1KGWA 2QLYA 4UNIA 5CXPA 4PCSA 1J0KA 3A5VA 1PEZA 2YFNA 1WZAA 4U31A 1M53A 1UH2A 3LX9A 1XD0A 1QHOA 2OSXA 2VRKA 5I0DA 3KWXA 2D2OA 2EQDA 2C7FA 2EADA 2CXGA 2BY1A 2XVGA 1CGXA 1JAEA 2D0GA 3UERA 1KXVA 3OLEA 3ZT6A 1MW0A 3BSGA 4FNQA 1KGXA 1JF5A 3VGFA 4DO4A 4OIFA 1JDAA 4J3XA 1P6WA 1PJ9A 4CN1A 3VMPA 4UQ9A 2EEXA 3VMNA 3GXIA 2EAEA 4UQEA 5CGTA 1JFHA 1QI3A 3KL3A 4J27A 2PWFA 2WANA 4GO9A 2PWEA 3BVUA 4FNRA 4FLRA 3EDDA 3L2MA 1G1YA 1CLVA 1CIUA 1PAMA 1R47A 4HOZA 2ZXDA 1QWUA 1T0OA 2XWEA 3CV5A 1M7XA 1JDCA 2WNWA 3EJPA 1KTCA 2EABA 2QV4A 2XVKA 1QW9A 4UQAA 3KL0A 1OT1A 1HX0A 3WELA 1CYGA 2AMGA 3LPPA 2F61A 3HG5A 2YA1A 1D3CA 1EHAA 1KCLA 2ZE0A 4HOXA 2GDVA 1KCKA 1UH4A 3GXPA 3HG3A 3W38A 3AXIA 3L4XA 2WCSA 4PSRA 1IV8A 1HL9A 1KTBA 4J7RA 1CGTA 3WNOA 4GINA 2VUYA 2BY0A 4AMXA 2FE0A 1AVAA 4HA1A 5E70A 1BPLB 2ZX7A 3GXDA 3ZOAA 3CTTA 2ZIDA 3GXFA 3IJ9A 4GI6A 4M8UA 5EMYA 3S5YA 3L4YA 3M07A 5HXMA 1CPUA 1KXQA 1E3XA 1OB0A 4UOQA 4GKLA 2PWGA 1KBBA 3BUIA 4AIOA 2CPUA 3BLBA 3IK2A 1UOKA 1S46A 4J28A 1OT2A 2OYMA 3L4VA 1UKSA 4JFTA 1CXIA 5E1QA 2PWDA 3WDIA 3EJQA 1JF6A 2BHUA 2QPUA 4NI3A 1XV8A 2E8ZA 3TTYA 3FAWA 1JDDA 3BAKA 1UA3A 2IGTA 2X2JA 4NZFA 2F7RA 3VM5A 2F7OA 1J0HA 3ZT5A 1XCXA 3ZSSA 1MVYA 2GJPA 4JL1A 3TOPA 2OYLA 4AYSA 4WLCA 1HWWA 1MXGA 4OJYA 4JFVA 3VGEA 2YA0A 4KMQA 4MAZA 1BLIA 1QPKA 1R46A 3BVWA 2FHCA 3VSVA 1PPIA 3DHUA 2DH3A 3BUBA 4X9YA 3BAJA 2BY3A 1GCYA 3KLKA 5F7UA 4GQQA 3VM7A 3D51A 8CGTA 3HG4A 2OSYA 3UCQA 2YFOA 4LPCA 4ATWA 2ZXQA 2NSXA 2WVVB 3DHPA 2YJQA 3EJSA 1JXJA 3CLWA 2F18A 4U2YA 2ZUSA 2XN2A 1DHKA 1XSKA 4FNSA 1IZJA 3LPOA 4OGZA 1AQMA 3VGDA 3AJ7A 3EJTA 3WN6A 1V3JA 3WNNA 1V3MA 2OYKA 1UD5A 5A6MA 2DIEA 4UQCA 3CPUA 3K8LA 4QAWA 3RIKA 1O7DC 2ZUWA 1G5AA 3VO0A 4FLSA 3EDJA 4JCLA 3CZGA 2V3FA 4H7VA 3BLKA 3OLGA 1L0PA 1MWOA 3HG2A 4JL2A 2F1BA 1ZJAA 4NXSA 3A6OA 2YOCA 4J3SA 3BMVA 4NZJA 2FGZA 3CZSA 3EJUA 2OW6A 1KGUA 2Y4SA 1PIGA 1BSIA 3CC1A 1TQSA 1KXTA 1HL8A 3CZEA 2YA2A 3K1DA 2VRQA 3WDJA 3GXMA 1PS3A 1KWGA 2D3NA 2XVLA 4MB1A 3GBEA 1CXEA 1JI1A 1I75A 1LWHA 4H8HA 3BVTA 3AMLA 1PZ3A 2GUYA 2F7PA 3BCDA 2EACA 2AAAA 3BAYA 3HJEA 2F2HA 3CZKA 2CHNA 2ZX8A 1HTYA 1HT6A 2ZX9A 3WMSA 1EO7A 5E6ZA 1CGVA 3DX4A 2E0PA 3K8KA 1JIBA 2VNCA 3WY3A 2BY2A 2ZWZA 3GBDA 3KL5A 2D0FA 5TD4A 2FHBA 1MW2A 5I24A 2ZUTA 1CXLA 3VNYA 4B9YA 3WNPA 5A2BA 4AIEA 3ZR5A 4H8VA 3KEHA 1SMDA 1VAHA 4H8UA 1KXHA 1CDGA 5CGMA 3ZT7A 1UD3A 4CN4A 1B2YA 3ZO9A 4LQ1A 1TCMA 2OW7A 3UEQA 3VGGA 5A2CA 2BHZA 3DX2A 2V3DA 1XGZA 1JD9A 1KB3A 1UKQA 3VSTA 1QHPA 2VR5A 4WSJA 1IZKA 2Y24A 2GDUA 3FAXA 3D50A 1G9HA 1HVXA 4JFWA 1WP6A 4U33A 3VNZA 3WDHA 2C8NA 3II1A 4FMVA 1WE5A 1CGWA 1Y7VA 3BUDA 4NXKA 3BC9A 1AMYA 3DX0A 3WENA 3KLLA 4X0NA 4XB3A 4HPHA 2NT0A 2G3MA 2D73A 3L4WA 1V3LA 4FLOA 1OGSA 1W9XA 2EJ1A 3BLPX 3UG4A 4AEEA 1ZS2A 5E0FA 1TQVA 3D4YA 1UD6A 6CGTA 1BVNP 1H3GA 2WVVA 4FLQA 3WNMA 1UKTA 2ZUUA 1SZNA 4JFSA 2F1AA 1QW8A 4AYGA 3EDKA 3MI6A 4AMWA 1UD8A 1UA7A 3H55A 3K8MA 3TONA 1JG9A 2Y2WA 1V3KA 2QMKA
chains in the Genus database with same CATH superfamily
1OPGL 4XP6H 3FRUA 3LNEA 1YY8A 3RY4A 1T1WB 2QR0B 5FV1L 2P3YA 2NLJA 5JHDE 3G5VB 3QIWB 4AVJA 1KIQB 3SN6N 1X4XA 3BYYA 4ADGA 4UILH 3LRHA 3IJEA 3TH3T 1WITA 2CDEB 2A6JB 2OJEA 3GJFB 4HEMA 1MCNA 1HXKA 5CD5D 2PXYC 3GS7A 3RVVD 4Z76B 4G8FB 2V2XA 4LXFA 5IWLC 3VX1A 3VI3A 4AK1A 3WIHL 2WSDA 3HE7C 4E9LA 2DQGL 3P9LB 5E9DE 3DIVA 3MYJB 5BUGA 4ODHH 1H15A 2B39A 1CGSL 1HHIB 1X5ZA 1C7TA 1OF2B 2R0ZH 3C8KA 3FU8A 3U46A 4XO4A 2X2UA 1S9KC 4DP6X 5HHOE 2NW3B 3RAJL 1E4HA 1IKFH 3FRPA 1GSMA 4RGMC 1NCAH 3FT4A 3L9RB 2BVUA 1JZEA 1YMME 3CUPA 2YZ1A 12E8H 4JDZA 2JKIS 3IJSA 2CJSA 5D1XE 2RQ8A 2QTVA 3ZTEA 2DAVA 4KDVA 2ESVD 2B8OT 2J1ZA 2NY0D 4XOEA 5L2KB 1NDTA 3QS3A 2P5EB 3C09B 4W93A 5A40E 2OP4L 3ZN6A 2EIEA 4NC2B 4X4ZA 1MAML 2R4SH 1XF4B 3CBJB 1G7PA 1J05B 5F9OL 1MCKA 3D0VA 5LGJA 1NGYB 2DLFL 4EN3D 1RY7B 2FO8A 1GGTA 2OL3H 1XR9A 4YLCA 3ZDWA 3WXVH 4JG1L 4KAQL 3M1OA 3UBXB 2OMXB 4NN5B 4GSDH 3QJSB 4P2AA 3D39B 1CWVA 2CDGA 3QEGH 4PSPA 5ISZD 1XGQB 1HCVA 1ZA6A 4OCMC 2K9FB 4RGNE 4WU5B 2WVTA 3HLAA 4G5ZH 4LAJH 4ESKA 3V6OE 4YPGB 1M7DB 2F1EA 5IROC 4NM8L 3VYNA 4DZ8B 4ZFFA 2PXYA 5D9SA 2DY2A 2WWMC 3CVDA 1BMGA 5JPNB 4AL8L 3HE7A 2R56L 3DPBA 3HZMA 3O4LB 2ZAIA 1LO5B 4M7LL 1P5VA 3AUVA 4MB5A 2GJRA 4ZUUA 3KDMA 4IDLA 1ZJBA 3KPRD 1O0VA 1YLBB 3VG0L 4G6FD 1X5IA 3MROA 2F7QA 1YJDH 2ICCA 3JZ7A 3O45B 1YYLH 3VFWA 3HE6D 1I9IH 4UB0H 3HCVA 5EU6B 4ANWA 5JZ7D 2Q6WB 1KV3A 3MLZL 2X4PB 2YEQA 3IM1A 1FYTD 2H2SD 1AGFA 4J3WA 2XWBA 1DVFC 3REVA 1FZMB 4PRNB 2HRPL 4M3HA 3WNJA 4A7VA 2B0SH 5EO0B 3AB0C 1QUNB 4ZUSA 5I75C 1TF4A 2A0LC 5DMKB 4LCWE 3EBGA 1BZ8A 1DQQB 3QFGA 5I1JH 4Q0XL 2P7TB 1CDUA 3QJFB 3VQMA 4XN7A 5F7NC 4DVBA 3ATFA 2VR9A 4KQ4L 2VB5A 3QCVL 5ENWB 3DV4B 1XIWB 2XWJB 1JPGA 3GSUB 4H1LB 1JNNL 3ARBD 3HFFA 2IPUK 3KPQB 2W60B 3Q8CA 5DJYA 5IQNA 1IBBA 2PP8A 2VDLL 4AIXA 2CIIA 3DV6A 5DWUL 5A6LA 1EXUA 4F58L 2ED7A 2P4AB 2D7PA 1O5PA 3EF7A 2R1XB 2NCMA 1J8HE 1EMTH 1I8LA 3PF2A 3UYPA 3UTTE 5EOQL 5C6TL 1DZ0A 4O2FA 4NNPL 3I74A 3MLWL 2OMWA 5D1QB 2C1OA 1TR7A 2YC1A 2FX9L 5EUKB 5C0AE 4YSSA 4HQQL 2ADFL 2A6DB 3QEQD 5LAXA 5KAQF 1JWMA 2APFA 1Q94B 4FQXA 4D7PA 3QUMA 4GQZA 1S7SA 2W95A 1IM3D 4L9LC 5K1JA 1ML0A 3GFUA 3TIDA 2BZCA 5C0FB 2NNFA 1ZAGA 4E9XA 3Q01A 4OJAA 1ET7A 4IOSA 2VXVL 3G5WA 1HINH 4JO3L 5TTRA 1ND0A 2BOLA 2UWEE 1UXSA 4DKFL 1DVFA 1KPRA 2QZ5A 3BKJH 2XNAB 4JANB 4N5ED 5ETUB 4PJXF 1QNZL 5HYJD 4Q89A 2PCYA 3WO4C 3FUMA 3QJOA 2Y6SD 1FNHA 4N0CC 1XGYH 4ZRGA 4TSBL 4L8CB 1J1PL 1UA6L 1QUPA 3MKKA 4GS7C 5E2TH 5JHAA 3NPZB 4JFFA 4Y7OC 3VI4F 3N40P 1GGUA 3P2TA 4PQXA 5HJDA 4FXKA 1CFNA 1R3HB 3VXMA 1JAEA 3VVWA 1KXVA 1ACZA 1QSEA 4L48A 1J88A 2NY2B 3U25A 3VFOA 3OHXB 4ICWA 3FTVA 4LCCC 3UJIL 2F5BH 5FFLA 3NCEB 2HJLB 4FQJL 2DQFA 1PW3A 2GJJA 3TWCH 3KBHE 4N8CH 1WZ1L 4OLYH 5CILH 3WI9A 4X8JA 1ZHBB 3O2VL 2ZOLA 4YAQB 3HNSL 3QJUB 4PJHF 3GUFA 1LP9E 2JI3A 2W65B 4XX1E 1AYOA 5D1ZI 5GGSB 1N67A 2MCAA 1U8HA 3LPFA 2WV3A 4D8PA 1M2VB 1WWAX 1S7WA 4WI0A 3OHMB 2W91A 3INUL 4MCYB 3REWB 4OI7A 1V05A 1JDCA 3B9KD 3MVSA 4LEOA 4E41D 4ZODA 2XVKA 5DD6A 5E2UL 25C8H 1ZLUH 2EYSB 1T3FB 4B7LA 4L8BA 4KZEL 1KPVB 1H5BA 2BCMA 2YRBA 5CFAA 1A6WH 2AQ1A 4CVZA 2ZUQC 4ES8A 4F8QA 1KCLA 4LPTA 5L8JB 1TYRA 1WBXA 3BSZL 3N43B 5IG7A 2MJWA 2WXQA 1KN2L 2MNJB 3RZWA 4JPQA 4NQDA 5DDHB 1NCTA 1RUPH 4PIBA 1FL5A 2WTPA 1IM9D 4PAZA 5B38G 3VH8B 1LQBC 3LRGA 3NN8B 4XNUL 3U9UB 5LG6A 1WT5A 2FQDA 1E5YA 4KJQD 2MQCA 5C7ZA 4KRMB 3ABZA 3CSBA 4I0PD 3ZMEA 3RTQB 4MRBA 1BPLB 3K6FA 4MD4B 2DD8L 4ZDHB 4FHBD 1LK3L 1K72A 1YMMB 3KHQA 2HB0A 1E6JH 1ROCA 3JV4B 4OR1A 3KYAA 3MYZA 2QADB 5CUSL 2B9AA 1XGPB 3C6LB 4D0CA 1I3GL 2BWDA 2W0KA 4U4BA 4QXGH 3ARFB 3MRFB 4QRUA 1FFOB 3I3EA 3RVXD 2HRHA 3IMTA 1Q1JL 3L4VA 1S9YB 3OKMB 2BCKA 4ODSH 2HKHL 4J6RL 2QPUA 4GRLB 2VN4A 5LAPA 2Q20A 1NL0L 2ZOOA 4MS8C 2FEDD 3FTXA 3A4FA 3GSRB 4YFLI 3PQYB 4GAYB 2X3CA 4PJ8B 2BO0A 4E36A 3NUKA 5HGBA 3HG1E 4IBQA 3VFMA 1EFXD 3DX9A 1BLNA 1JNLL 2E86A 2IPKB 3IMBA 4PGEA 2ITCA 3KH4A 1MEXL 1NLBH 1IGIL 1KTLA 3U4AA 4AI7A 4RGOH 4H44C 1I9RH 2VW7A 3F7KA 4AEHL 4QTHB 2WUCH 4N0FB 3FT1A 2FHCA 1KJ3L 4HIHB 1ANUA 4RFOH 4I18B 4N3UA 5F7UA 5DRZA 3KLKA 1OSZB 1SEQH 1FRGL 5JOFB 3HG4A 4YIQA 1ZT4A 4LSSL 3UCQA 5DI8A 1OQXA 1TFHA 3O41A 4U6XA 3VQLA 3QAQA 4G72B 3MHZA 4QYAA 1MI5E 3IBEA 4PLKC 3O2DH 4OZHB 2WWOA 1AXSA 4QOKE 2WMPA 3BO8A 3JVGA 2QQQA 3GIVA 1DJXA 4OGZA 4UNVA 1A7QH 1BYPA 2M26A 1FI8C 4LZKA 4WUUE 3WN6A 3MLSL 1OLZA 2Y07L 3MJ7A 4W9EC 4KNSA 2DF3A 5H2BA 4HS6A 2P8MA 3T2NL 3VRLE 1KCVH 4YDLB 4EDXA 3GMQA 3IDJB 3RGVD 4EVNA 3T0BA 4LLUA 1XH3A 5EZJA 4OJCA 2WQWA 4Q6IC 2JVUA 1G87A 2YAFA 1M4KA 4OCLC 2DS4A 3CXHJ 3SY0B 3U4EA 2CNZA 3VD4A 1O7DE 5AAWC 5KSUA 5IBTH 4PJGE 1KJVB 2FGZA 3UACA 1IVLA 4S0HA 1KY7A 5CMAA 5DT1H 1YEDA 2VRQA 4CSPA 3FN3A 4UT6H 4K8RH 2CHWA 4O9HH 4I77H 4RDBA 4O58H 3K2KA 1TG8A 2N7BA 1HXYB 2QTEA 2OXHA 1T7WA 2XVLA 2NXZB 1KLFA 1N6VA 3QHZH 4KUCF 1LWHA 1F3JA 4KQ0A 3AGVA 4XNBA 1BQLL 3NEOA 2K4AA 2DICA 4G8GA 5KSVA 3PP3K 1DBKL 3GMPA 1K8IB 2WQXA 4B9GA 1MFNA 2CGZA 5C1MB 3L1GA 4LIQH 3GO1H 4XT1C 4YL4A 3QORC 5GSVB 1WFJA 2DTMH 4N2CA 1E9OA 5K33A 2QJDA 5IHZA 2D0FA 4YBQD 4IRJC 1H9DA 2XCMC 1UWEH 4YSCA 1R5VB 1BXXA 4CL7A 3IXTA 5LN4A 2BSRA 2YMXL 4XXWA 4H8VA 5ITBH 1QRNB 4OI9A 1JFQL 5DRXB 2BRRH 2ZP0T 3WBDA 1KFGA 4FXGB 2WLYA 2GSGA 4AX3A 4BHUI 2ZOUA 5EN2A 4KJPD 4HUWA 1XFPA 3P0GB 3EGXB 2BLFA 4M9OA 3U1PA 5IV2A 5I74C 4PBVC 5F0MB 3MV7D 3Q44A 4AJWA 1KB9K 1A9EA 2CAKA 3MNVB 5DMIL 4RCAA 1J1XH 4QCIB 3BXNA 2OSLB 1HQRA 1BEYH 2JQAA 4KHXH 1NDGA 2DW5A 4G80A 4P5MA 1B0RA 1CFBA 1BJ1J 4K5PA 4NRYA 4XR8C 4JFYB 5C8JA 4LRNL 2WNGA 3QG6B 5FKAB 2CRMA 3INOA 3O3DB 4AUYA 3GZKA 3QAZC 4JFSA 4LQFL 1ZA3A 5LN8A 3CIQA 3BISA 3HNVH 4JR9L 3CFEA 4U1IA 1U2HA 1WAAE 4GXUN 1ITCA 4PHZA 2QSCH 2IG2H 1SHSA 4Y5YC 3W81A 5KBPA 3GI8L 2FRGP 3WUZA 3S2AA 5HPMB 3DHMA 4BZ2A 4U4IA 4U49A 3V0HA 3NZUA 4N6QA 1EAPB 3ATBA 3U83A 2EH8H 4PRHA 5C0CB 4PJ5A 4Q4IA 4GW1B 5FW7A 1U8CB 3TFBA 1AE6L 5L2KD 4TUOB 1N68A 1CDJA 3E1F1 5GPRA 2Q8AH 2DQEL 1L7TH 2P5ED 5CAYB 4GI8A 1YNKL 5AFAA 3FDWA 4PI0A 4BH7A 5EC1B 2RHEA 2MOGA 3N1FC 3TN0B 1YEFH 2VO8A 3TPUB 3RWCA 4B5ZA 4TMPA 4FQ2L 5BV7B 3ZIYA 1R6VA 4IDJH 4XCYA 4A6YA 5HGGS 3BZDA 5AB0A 1UATA 4HOWA 3OF6D 5DQJB 5F89A 5IIEB 2H0FA 3D39D 4KVCL 3BKML 5DJ0A 4HX1A 5AW2B 1N8OE 3WY4A 4BYHA 3RFZB 1D9KA 1LWJA 2NRDA 2VE6B 3VE0B 2UWEF 2N7AA 3CVCA 4LGSB 5I16A 1JL8A 4G42B 4YE4L 4XZUA 4GQRA 4Z3HA 3PHQB 1NOLA 3FB7A 4NDMB 1KYOJ 1VFMA 5AZEL 3DJTA 5MHSD 1RSFA 1XH2A 2LAAA 1QBLL 5DK2A 3WTVA 1TJXA 1F2QA 4ZO9A 1D5ZA 1DLFL 2JJVA 3P0YH 5FYKH 3TT3H 3FQWA 5EIIA 3D3VD 1E2ZA 2GITA 3IEAA 3C5ZA 3VWJC 4JW3A 3WOVA 1QLFB 2DQDH 2FIRT 3DXAB 3GT6A 5IHBA 4ZT1A 2AJXL 5JOPD 1KN4H 5I1GH 2NR6D 3A67L 2XICA 4APXA 1ZT7A 3NSYA 3DTDA 3MZTA 4WEUD 4N86A 4MDJB 4NQQA 3NCBB 4P2QD 1JD7A 2GUOB 2GEQA 1LP9F 1AGCB 1EZVX 4JHAL 3HUJA 2OYPA 4LDOB 3T5WA 2CGRL 4B9ZA 1URIA 5JHLH 3JV6A 4S1DC 5CR1A 2HXAA 2MSPA 3NAAL 5CLXA 4Y5VB 4MNGE 5I17A 1BAGA 4FG6D 1F1GA 3DECA 3NK3A 1BBJB 4GMTL 1IILE 2CCLA 2CLZA 2RGSA 1AXTL 3AAZB 3E1ZA 4QOKB 4ZUTB 5FECB 4XP6L 5SWZA 4YHNB 2HJFA 3DYPA 4P2OD 4CBZA 5C0GA 1T7ZA 2LLLA 4KY2A 4ZMAT 2BK8A 1T1XA 3MR9B 3ZTDC 3MRDA 4ZW5A 4PV9A 4UILL 4JS7A 2WQUA 3FFOA 1EZLA 2X9WA 4HIEA 3N9GH 4NZRH 3IAPA 4YHMH 2QMJA 4NKQB 4APQC 2YEZA 1G7MB 2JCCA 2V7NB 4F8PA 1S7TB 3ETBF 2QVKA 5ALBL 2JLPA 5AOJA 3GMOA 4QHPA 5TK4A 5KVDL 5FB8A 3L3OA 3FYIB 4RESB 3BUPA 5GZOD 3BAIA 4PJGB 3TF7C 1CE6B 2UY7B 4PRIB 1G7IA 1YYMH 2E46A 3VWJA 4MD5B 4WTQA 2FSEB 4H5SB 3WLWD 5KAQG 3L3IA 3NJFA 3VSUA 3UBXG 4AGOA 3KG5A 4QO1B 2X70A 1WPCA 1GIGH 3HRZC 4CBPA 4EI5A 2BVEA 4PBWD 2JQZA 2XTJC 3ZMNA 3BDXA 2R69A 1RCYA 5LCVH 3IAGC 1F58H 1U6AH 2NY7H 1FORH 1XTMA 2FJSA 3PRZA 4TNEA 5LBSH 3WY2A 2R4SL 3ZDZE 4WFHD 1OAKH 4JQVA 4D3CH 5EF1A 3CDGB 4Q9BA 4GRWH 3CGTA 2VLJD 1RZJH 2W8CA 3BZFA 4ABUA 2H32A 1IT9H 2OL3L 1N0XH 3ES6A 3OSKA 2NY2D 2B14A 5GIRB 2BHYA 1MCLA 3FH8A 3L1EA 4FG0A 1FG9C 3TURA 3OMZA 3VXQA 4P06A 2ARJA 3QEGL 3P02A 43CAB 2ZP9A 3I50H 4N25A 3C6EA 3RZCA 3MLRH 1KT2B 2EIBA 1PG7X 7TAAA 3ZHNA 1LO4H 3ALXA 3CCHA 4XBGB 1AIFA 1YAIA 1ED3A 2G2PA 3QDMB 3UYRH 1QTPA 5FOBA 2CUHA 4JGJA 4RMUA 3QWRA 5JHDD 4HIQA 5KSAA 3WIHA 1UZGA 3OAUH 5DQ9A 1G6RB 3X3GH 2FZ3A 3SDYH 5I5JA 4DWHA 2NZ9C 2R2BB 4E9QA 1QVOA 1YJDL 1BZDA 2J5LB 1NFKA 4H1LG 3MRRA 1ZGLM 1I9IL 5EV7A 1WEJH 1A6TB 4LMQI 5D2NA 4BFBD 4M29A 3VRLF 2XBDA 5H8DA 4GT0A 3DVIA 3HRZA 4TLSA 1OGTB 3HHMA 1RZKH 4AYFB 2VLRA 5E9DD 3D4CA 4CN1A 1V27A 2FB4H 2QSQA 2A38A 2P8PA 3QUZB 3RVWC 4PWIA 4G71B 3K6NA 1LO0H 1A7NL 1TZHA 3PJSB 5ANHA 5FO7B 1KNOA 4YO0A 3VXUE 5HHOD 4AYMC 4IK6A 2A9ML 4WO0A 1XF5A 2FR4B 1D5BB 3EDDA 3RTQD 5I1JL 4EAEA 4AYEC 4IRSC 5C3IA 2FATH 3FCBA 4KKNA 3DVFA 1GZPB 5E6UB 1IGYA 1YMMD 1GTFA 3TV3H 2IC2A 4XNDA 1KTCA 2W07A 5D7IA 4KV5E 1HCZA 3LIZH 2H3NA 3NEXA 4IOFC 4XC3H 3ETTA 3K2UH 5KVEE 3ARFD 3G9AB 2AMGA 5J3HD 4KTDL 4I9WE 3G6JE 4JJ5B 4X8GA 1VGEH 1T6VN 5JHBA 1EMTL 1NFDB 4ZUWB 2DYRB 1U4FA 4RH4A 5GS1C 1Q0XL 5F8QC 1W6LA 1YNLH 2TSBA 1XWVA 5LDSA 2ZXCA 4HZAA 3VD7A 5CBEB 1HL9A 3MQIA 1IKNA 1CT8B 4WO4A 2D7OA 4NZUH 4HBCL 1G7HA 5E2VH 3WFHB 4B3VA 2OLDA 1ZY9A 2Z31B 1D7CA 2ZX7A 4EKXA 3MBEC 5J11B 2V5MA 2XWTA 4RGND 2J20A 5F3HA 3DMMD 2FT7A 3NCXA 4L8SB 4M8UA 1E50A 3AXLB 1WFOA 1YPZA 3G5ZA 3SDAD 3CMOH 4XPGL 5F7FA 1PL3A 2V2WB 2B77A 1O75A 1HINL 3BLBA 4ZO7A 1LEKA 1IGMH 3TS8A 1IKOP 5CCKH 4UT7H 4RRPM 3BKJL 1CR9H 4WWKB 5LNEA 1H9VA 2PWDA 3IU3A 2EH7L 1OAYL 1UOLA 3VU1A 4WFEE 2EC9U 1XGYL 1NUNB 2DI8A 4NI3A 2NY5L 1GW6A 5E2TL 1E5ZA 1D6VL 2AEIT 3L54A 4NZFA 3IMSA 5AKTA 1J0HA 1Z5LA 2HT3C 1VZIA 4P49A 4XCEA 4AT6B 3ZT5A 3FSVA 1E5CA 4ANKA 1MVYA 1TEGA 1OW0C 2ZKHH 3R06B 4PTTA 2BS9A 3MZGB 1SF5A 2X6VA 2AJYH 2B16A 3CH8A 3TWCL 4J4PA 1U8PB 1S2EA 2IH8A 4OLYL 3SQBA 5CN1A 1Y0LB 2X89D 3DIDA 5F7WC 4LCWD 5E8OA 3VXME 1HSAA 1WAAF 4LOEA 4RX4A 3PL6A 1GCYA 2B9BA 4MNGB 2B1HH 3VH8G 1TTCA 1RIHL 4KK8D 1DQJA 2SODB 2Z9TA 2BNRB 3AROA 4YZFE 1U8MA 4R4FL 2O5XH 4KKRA 4LVNB 4LCYB 5GSRA 2H1PH 5DVKA 1HI6A 4Y9GA 3ULVE 3DHPA 2FL5A 1FO0H 3X3FH 5G4NA 2ED9A 4HWBL 3SJVE 3UBXI 2WKOF 5C9KA 4WFGE 4DP7X 4JO5A 1PMYA 4QRTB 1PX4A 4MAYC 1NFAA 1J8HD 2CBMA 4XRCA 3UTTD 1DBAL 2NXZD 2HPOA 3AS3A 1UD5A 2WUBH 2XY2A 3FRUB 4NQCE 1YY8B 2VERN 4BM7A 2NLJB 2W9LA 1HKLH 3ZU8A 4AV0A 5EDSA 2EO1A 1RUPL 1X6NA 2IAMD 3IJEB 2AQSA 2OJEB 1DN0A 4N1EA 5MEPA 4C83A 3N91A 1PKQE 2CBOA 1WISA 4JL2A 4V2CB 3UDWC 1KF9B 1QEXA 2CM6A 2V2XB 5BMFH 3CSFA 1ZDSA 3VI3B 3MJ9H 1N0LA 1YEIH 2X05A 2C9SA 2Y4SA 1E6JL 4JZOA 1PTZA 1H15B 3C8KB 3U46B 1RK7A 4PWKA 2VO5A 5F1OB 3UTSA 4QXGL 2BNQE 4ODVL 4F91B 5TE7H 3SGDH 3VTMA 4MS6A 1TXKA 3QFJE 3S36X 4B9PA 4NO0A 3FRPB 5EZPA 4F33A 5IP4A 4OFIA 3FT4B 3DYMA 3CUPB 3T6WA 4JDZB 5C07E 3IJSB 4YQXL 2IH1A 1I8AA 3UFIA 2ROYA 4JVPA 2DMGA 3GKZA 4GBXC 3B2UC 2ZOKA 2OBGA 4YFEA 2HP4A 2VNCA 3Q43A 2BY2A 2DQHH 3E6FA 1EJ6A 3KL5A 2VL5A 1O6VA 1SOKA 3D85A 1G7PB 2FHBA 4M48H 1KUMA 1NLBL 3B1UA 3D0VB 4MAYA 5FF6A 5LGJB 1YUKB 4PD4K 2NY3B 2WNKA 4JDTH 4OCNC 1XR9B 2WUCL 1OOWA 4MASA 3VGAC 4RFOL 1HFUA 1B2YA 4XN2A 3FT9A 3NSCA 2CE6A 2CDGB 2V3DA 1UXWA 1XGZA 1ZA6B 3BSZA 3ZY7A 4K3EH 3QYMA 3I9PA 3HLAB 4KXZI 3PUCA 5LXVA 3FH5A 4ZFFB 4DJMA 4IBWA 2PXYB 5D9SB 1FUNA 3DUUA 3D0AA 2PO6A 4P0DA 5C0CD 3HE7B 3NSJA 4FJ6A 3AM8A 3DPBB 3HZMB 1MF2H 4MZ2A 2HG0A 3ALWA 1P5VB 1B4TA 4ZUUB 3KDMB 1IRAY 3NK4A 2EVIA 4UDUA 1KCVL 3MROB 4G7SB 4JKWA 4M9PA 4KH9A 4PJFE 4RGMB 5HSFA 2WVVA 2VUKA 3VFWB 2XN9E 4KVNH 1WBYA 3BE1H 3HCVB 5J7CC 3TIEA 1EHLH 3MI6A 2KLTA 1AGFB 2VXTH 2HVKA 1MFCL 2J1KA 5JW3H 2XWBB 1W0VA 3REVB 4DHLA 3MFFA 4N8VG 4R4ND 2WN3A 3CE1A 4QXTA 3A22A 1X9UA 4ZUSB 1NM9A 4XGZA 4OD1L 3N06B 1CICD 5GS2D 1NCOA 4UT6L 1FF5A 4K8RL 4O9HL 4O58L 2DLTA 1GGCL 2XWDA 4DVBB 2C9RA 1HJCA 3QHZL 3LMJL 3ZDZF 5I6NA 1TQUA 2H6UA 3NJXA 1JPGB 2TRYA 3A4AA 3K2IA 5KVGL 2DJ4A 4J3OF 5DJYB 4N2LA 2CLVA 4NWTH 2CIIB 3DV6B 3HG1D 4HFUH 1ZLEA 3BH4A 1EXUB 2HWZH 4JCWA 4M1DH 4OZIF 3PPSA 4OQTH 4LIQL 2COVD 3ESOA 5B39A 3IDUA 2K1MA 3RVTC 1Q4NX 3UYPB 2DTML 4LK4A 4O2FB 3CFBA 4HLJA 2OMWB 5E1HB 2VITA 4JREB 1UWEL 1QOKA 2C1OB 3D09A 4PMEA 2YC1B 1SYSA 1IO4C 1CBVH 4L3CA 1RPQA 5LAXB 2G5RA 4P2RA 4OCXH 4UTBA 3O6FA 5JA9A 5KUKA 1JWMB 4CRPA 4FQXB 1OP3H 3QUMB 5B1AB 5ICZA 2BRRL 1GC1C 1I8UA 1A8ZA 4DSYA 1T21A 1S7SB 2L8AA 3S98A 2YMTA 4HGMA 3TIDB 3TVMC 1KGJA 3PHAA 3L2LA 2QPEB 4QOKD 4DF9A 4LDCA 4XP1L 1AQKH 3UJJL 5A43C 4QTIH 3CQPA 5KSBE 4Q56A 1ACYH 4K3JH 4NQEA 4X4KA 3E9UA 3F7PC 1X44A 1ND0B 2MCG1 5KJRH 1S5IH 3FFDA 1UXSB 4UM8A 4WUUD 1DVFB 1KPRB 2PP7A 4I5BA 3DYOA 4YHIA 4EDWH 1J1XL 4FQ1H 5I75B 4LNRA 5DEGA 4YXKH 1BEYL 2O1AA 3BWZA 4KHXL 1BWMA 1K4DA 1N12A 3C08L 3OQ3B 5KVFL 3VFRA 4JFFB 1JOIA 4X80H 2DKSA 1WFIA 1D5MA 3X17A 4FXKB 1A65A 1CFNB 1VFBA 3VXMB 1Q72H 4R3SA 5LWYH 1F1DA 4UDTA 1QSEB 4ELME 2JK5A 5DXWA 4D0DA 3VFOB 3ZRCC 3MA9H 3KXFA 2FAUA 3B9VA 1X7TA 2R0WH 5HHME 5INCA 4YOKA 5T1KA 1NGZA 3HFMH 3BMWA 3WGVB 2DQFB 5C08E 2QSCL 4P5TA 3D4GA 5IGXH 4YSAA 4KV5F 1ZLDA 4X8JB 1PSKH 2NQCA 2ZOLB 3KS0J 3QRBA 2H1XA 2AANA 2RIKA 4JRXA 5BRQA 5IQ7H 1MQKH 2P5WA 2Y5QA 1V10A 3G6JF 3HG0A 4KITB 3CMGA 1U8HB 1SOSA 3O6LL 4A63A 4D8PB 1PU0A 3QJHA 2Y1ZA 2QKSA 3EO1A 4W4NA 1S7WB 4WI0B 1NOAA 2DRUA 2L0DA 1L7TL 4WDIA 4HUKB 4LEOB 1MG3C 4TNFA 4XMVA 2X7LA 3RGBA 1D5RA 2VZ1A 4WQOA 3ZDXB 5DD6B 2O6FA 2XV6B 4L8BB 2WXKA 4F2MA 3H3PH 4P57A 1YEFL 1H5BB 4LHUB 1UUNA 4CVZB 1UM6H 1QFUH 2W9EH 2PKDA 1WBXB 4IDJL 1NGQL 1MCOH 4WHTA 2I5YH 3BAEH 3EFFA 5IG7B 3ARQA 1IBDA 1EZVY 4NQDB 2GTWA 3ROOA 1M9SA 1OP9A 1FL5B 5IKCA 5AZUA 2CUMA 3ARGD 5DRNA 5TE6H 3NFPA 2Q3AA 3QJTB 4G9FA 3V79C 4NZDA 3JVFC 3TA3C 4LPYA 4YDVA 1CUOA 3ECQA 5F7MC 4HWUA 5GHWH 1C08A 5CZXD 3OR7A 4ODUA 5E6IC 3QDMD 4J2QA 4KROB 2E76C 1IEAA 5K9QI 3BVXA 3M7OA 1B9ZA 1H3VA 3MBXH 5E7BA 5FYKL 3TT3L 4X9GA 4D0CB 4WSKA 2HA1A 1SBBA 4K23H 4QRUB 1O9VA 3EJRA 3DO4A 1TTAA 2BFVH 5LHDA 4JJHA 4JM2C 3V5KA 2XXFA 4TV3A 2BCKB 1MJUL 1OZTG 3WEXA 1KN4L 1T89C 5FUCE 5I1GL 4IKLA 2L7QA 2XBZA 4JQXA 5HGHA 3GPSA 4KFZC 4QHUA 3S9DB 3EYQC 4GW4A 4NPJA 4OVVA 5HGBB 4LSPH 5SWSE 1DVQA 3VFMB 3QO1A 1NA8A 3DX9B 4KJYA 4YZFF 1BLNB 1L3WA 4UNIA 3AWFA 3SPVA 4K15A 4YBHA 2ITCB 5DZNA 1FGNH 4N2HA 2IBGA 1KTLB 3F5WA 2BP8A 3NFNA 2OSXA 4GXFA 3L7FA 3TEXA 3KWXA 5JW4N 1IFGA 1PFOA 1IBGL 1AJ7H 1IEBA 1OZUA 5DRZB 1KIRA 4QJ5B 2BY1A 2XVGA 3LB6C 2H5UA 4YIQB 1ZT4B 4ZG1A 3O8XD 5DI8B 1RIVH 2A73A 3O41B 4KK9C 4U6XB 2OTPA 4F9PC 2H45A 4EN2A 3N9GL 5I1KH 4NGHL 2RB8A 1AXSB 1CTMA 2F54A 4NZRL 2WMPB 4YHML 3BO8B 5SV3A 5LGYA 4OIFA 3FTGA 4X6DE 2R39A 3GIVB 4AKQA 1DQKA 2ADJA 3D6GA 4K94C 4MRCA 4ODWA 1BJ8A 3VMPA 3L3JA 2ZWKA 2K45A 3RDTD 1UGKA 3MJ7B 3KL3A 4CU6A 3GMNA 5K69A 1KEGH 5H2BB 2WXNA 4HS6B 2P8MB 1CLVA 1PAMA 2IOMA 3N44B 1QWUA 4EDXB 3GMQB 1DCEA 2B15A 4EVNB 1M7XA 1T89A 4LLUB 2EABA 1XH3B 1GIGL 5EZJB 1MCJA 1ZGLA 5GJTH 3PPEA 4P46D 1OT1A 1P69B 3ZYOA 1DE4A 3U4EB 2WAQA 4BDVA 5KSUB 1OXYA 4XBPA 5LCVL 4DERA 1F58L 1U6AL 2NY7L 1EAOA 2EEFA 5GRVL 3WN5A 5CMAB 3WHE0 1YEDB 3HMWH 4NUJA 3TWYA 1OAKL 4D3CL 3ZK0A 3APNA 4LNVA 4P05A 4F3FA 1RZJL 5JIHA 3D08A 2OXHB 3I9GH 4GSQA 3HN3A 1KLFB 1N0XL 3N50A 5JPMC 4PP2A 1Q0YH 1F3JB 4HSCX 5B1CA 5JXAH 2BMKA 3QZWA 3A3YB 5EORL 3SBRA 4G8GB 3MC0A 4QHMA 5KSVB 3WTSA 4UMGA 3GMPB 2IDSA 1S7XA 2W88A 3IJ9A 3I50L 3MLRL 5E95B 4H8WC 1ZD6A 1RUAH 5BZWA 2JELL 1E9OB 5IHZB 5ANMA 1XL4A 1OAXL 2GFBA 4Z78A 3IXTB 2BNRD 2VLKE 2BSRB 4OLVH 1FFNA 3UYRL 4WTZA 3TT1L 4L1DA 5FM8A 2QKIC 1ZKAA 3OAUL 4FRWA 3SDYL 4FTVA 3FULA 5BQ7A 4N2OA 1WD8A 2GSGB 4GKOA 5EN2B 4G3YL 4HUWB 4XP4L 4XCCH 1WEJL 4QDGA 4TUKL 5IV2B 4KNTA 2APXA 1NBCA 5DA4A 2OFQA 4PJFF 1A9EB 5GGTH 4NCDA 2NY4C 2YA0A 6PAZA 1N64H 1X5GA 2AKRA 4OIIH 5HHMB 2E5EA 3FQTA 5D2LA 1PPIA 3IDYB 3BXNB 3PAYA 1HQRB 1LO0L 2HT2D 3Q2VA 3CVIL 4XXDA 1NDGB 3DX7A 4G80B 4P5MB 5HVGB 1B0RB 3RVUD 2E75C 4NO3A 3OX8A 1U36A 2VM9A 4NRYB 4ZS7H 2VMEA 1YA5A 2FATL 3NRQA 5C8JB 1NUDA 3D48R 3BESR 1A4AA 3GD1C 4X9FA 3TV3L 2GJ6E 2EIJB 3ML9A 2VDRH 3LIZL 3P54A 1JVLA 1ZA3B 2OL3A 5D70L 3CFEB 3K2UL 4U1IB 4XPAH 3TFKD 1ZHLA 2V4LA 1KULA 4W68A 1I1FA 4N0YL 3KCPA 1L9TA 2KMWA 2LQRA 2A74C 4BWUA 5C0JA 4FI7A 3HC3L 5ACLA 2NNRA 4ZS6D 4OZGA 1G0YR 4M43H 4PRHB 4J3OD 2WWNA 4RFEA 4PJ5B 3E2HC 3QQXA 3V9FA 4FLSA 3C60D 3EHBC 3NRFA 5L4IA 4NHUA 3RP1A 4NZUL 5TE4L 1OCCB 4BH7B 4XBEH 2XTLA 3F58H 5T3ZD 2X6AA 2EDXA 4KKAC 3RWCB 2AXJA 4R5XA 4UWQB 3CX5K 1BXAA 2VSMB 1A6AA 3CMOL 3CBRA 3FUDA 1JXDA 1QNIA 4U0RB 4XCYB 1UJTA 3VWKA 4A6YB 4HZLA 1CC3A 5F89B 5INDA 1IGML 3O4OC 5CCKL 4UT7L 5DJ0B 4HX1B 5KSBF 3L08A 2YLHA 1CR9L 1D9KB 2WXOA 4XHQA 4PRPA 1MFMA 2V5RA 5I16B 4I3SL 4XAWH 4NC1E 4XZUB 3OZ9H 2FVNA 1JF1A 2J4WH 3FB7B 4HD5A 5DVOA 4BJLA 3TH2T 1KENL 4JB9H 3EW3B 4XVUC 5DK2B 2ZWZA 3ULUC 2CG9X 1D5ZB 2YD9A 3QUYA 3FQWB 5EIIB 2BIIA 2AJYL 4ELMF 5C6PB 2GITB 4KK6C 3C5ZB 4FDWA 1X5FA 2D7QA 1MZZA 4WEBH 2CA4A 3VXUD 2A74A 1SFHA 3ZT7A 3ZTJG 4ZMQA 4APXB 1ZT7B 2B1HL 2VWEE 5AD0A 1DJSA 1F3DJ 2O5XL 4P4KA 2H1PL 3X3FL 3HUJB 4DGWC 1S9WA 1BFOA 4QF1A 4EUPH 5A1AA 1F6FB 5AVTB 3JV6B 1EEZA 5JR1H 2YGOA 3IFPA 4I9WD 1BGXL 3HB3C 5CJOH 2ROXA 4R84A 5I17B 2CLZB 4OFKA 2COQA 2WUBL 4Z7QB 1HOCA 5SWZB 3TO4C 2HJFB 5BOPA 3UROR 5C0GB 1CURA 1T22A 2QPDB 1T1XB 2AS5M 3T0EA 2JJWA 3MRDB 4PV9B 1N2RA 4A1RA 1E28A 2D03H 3MRNA 3MBWA 4J3OG 4HIEB 3TZVC 1ASPA 3AREC 1KLUA 4Q8BA 3U79A 2YEZB 3LZFH 5L9DH 2JCCB 4UOJA 3K8MA 3UAJA 2DZEA 5DLMH 1YEIL 5CNHA 5IHWA 3GMOB 3PGDA 4PCKA 5I71B 4FQXD 5FB8B 3L3OB 5L0QC 1T5WA 4OZFG 1M6OA 1GZHA 4MJJA 1G7IB 1EUUA 3VWJB 1T66D 5EU7C 3FB5A 3L3IB 5LNGA 4V1DA 4UZUA 4WFED 1QSZA 2O61A 2IPUG 5KBNC 1U30A 2IWGA 2ADGA 2X70B 3ULAB 2KLSA 2VDNB 4IOSD 4EI5B 5I19H 5DYOA 1CTNA 3NRPA 3OZKA 1Q9KA 3MV8A 4FMKA 3RX5A 5IM7A 3BYTA 1VF5C 5DURD 1SXNA 4L3EA 2DB8A 2DQHL 2C4FT 2NSQA 3HZYA 3SDXE 3LZPA 2K7PA 5T5FL 4J3UA 3QQ9C 2X9XA 3BZFB 3ARDA 4ONHA 5CLWA 3VXMD 1D7FA 2H32B 4NX0A 4JDTL 3ES6B 3ZE2B 5AEAA 5KS9A 3T1WA 1JS4A 4Q58C 3QK0A 3GSVA 2NOYA 2YBGA 2YKLL 3W3BA 3VXQB 2E27H 2ARJB 4GH7B 4DFHA 3O9WA 2B4CC 2Y3AA 4KKLC 3ULVD 1R17A 2AGJH 4K3EL 3RZCB 5I8KH 4WVRA 1L9PA 1SXSA 3CCHB 1XEUA 3P4MA 2OZ4H 3MRHA 3JWNC 1AIFB 3AABA 1JPST 2OI9C 5IQOA 3GWJA 1ED3B 4TQ8A 1MDAA 4CGTA 2V33A 1V7ML 2NDFA 1HYSD 5HI4D 5FOBB 5DGRA 4NQCD 2QQKL 5I73C 1T0NA 3NIFE 4X6DF 4BZ1H 5KSAB 5DQ9B 2VZOA 2VRAA 1O7SA 1EZSA 2FZ3B 3WKPA 4KRLB 3F8UB 1P4IH 2OMTA 2DQUH 1QVOB 1M1SA 1QFPA 4NPKA 4LHUD 3MRRB 3RI5K 4RETB 5D2NB 4KVNL 3JWDC 1TZ8A 2OM5A 3H9HA 3HMXH 2ZJSH 1ETA1 2XTJB 2ZCKH 1EHLL 3G04A 4EI0A 2VLRB 2VXTL 5DK0A 5JW3L 4M8QA 2IV9A 5I23A 3T2OA 1VB9A 2PCFA 2WLIA 4MCNA 4YLBA 2P8PB 1I53A 4ZMPA 4IRZH 5CJBA 1TZHB 2Y06H 4HH8A 1KNOB 4YO0B 3QUXC 3SY6A 5A2AA 4QMEA 1XF5B 2Q10A 1CD0A 4UCFA 3QFJD 5E6YA 2VW4A 4Y4KC 4GLRI 4YDIL 2ATAA 1IGYB 3ZL2A 4KROD 5ELIA 4L2LA 3D4ZA 3P40A 4U1KA 5IB2A 2W07B 3SDCA 5D7IB 4O02L 2H3NB 5GGQH 5I26A 5EZIH 5ABAA 4NWTL 3ZZQA 4HFUL 2HWZL 2BWIA 3TJHC 4L3AA 4OQTL 5GS0C 2O93L 2G4GA 4WAFA 4WV1A 1PIFA 1MJJA 2ICES 4KKPA 4HLZG 1OARL 1HHGA 3OG4B 3E9TA 3O2DA 1XSOA 1P6FA 2I7SA 4E9YA 1BPVA 4WO4B 4BWWA 4QWWC 1K6QL 5FYLE 3H8NA 3F85A 1G7HB 1P0SE 4CC1A 1D7BA 4QRPE 2HTKD 2XWTB 3GF8A 5F3HB 1C9SA 2E3VA 1PCSA 3ZE0B 1DEEA 3EO0A 4HWEL 5DFVC 4UYQA 1MHPL 3OAYH 3UC0H 1YPZB 2GEEA 3G5ZB 2PYEA 2AHIA 2ZCZA 4QTIL 4LBAA 1W8NA 1ACYL 2R1WA 5KJRL 1LD9A 1OTUC 1LEKB 1S5IL 4TNGA 4IU3A 4TVUA 3EYOA 5FA3A 3AG2B 4WI8A 2E7CA 3APCA 4FQ1L 5EBMA 2HKFH 3LKPA 3IU3B 2Y7NA 4PGCA 4YXKL 4WF7A 1R7AA 3UX9B 3US0A 1S7QA 4HCFA 1J5DA 2FWUA 2W94A 4X80L 5IUSA 3WMPA 5LWYL 1EEUA 1Q72L 4LDLB 3NYKA 1Z5LB 2XN9D 4UT6A 4XCEB 3MA9L 1FBIH 5J4MA 4KDTC 2R0WL 5DJ2A 2GW5A 4PTTB 2CNYA 4LHUG 5BS0A 4Y4HA 3R4DA 3MU3A 4M93B 5IGXL 1YN6A 1N9PA 2NX5A 3SQBB 1PSKL 2VDLB 3IE4A 3MACH 5E8OB 1HSAB 1UT2A 4Y1AE 3CH1A 4GG8A 3PL6B 4EIUA 5CSGA 5IQ7L 2KC0A 1MQKL 1VFAA 1ZEAH 4IKNA 3KXFE 5AB9A 5IJDC 1DQJB 2ZXWB 3AQYA 1HCFX 5KOMC 3GKWL 1U8MB 4X5PA 3V0EA 4AVKA 4PM1A 5ACZA 1JZ6A 5GSRB 1HI6B 1A4KA 2FL5B 4EPSA 4KRPC 5E0QA 3UZVA 5MEOA 3QYNA 1NAMH 1GKOA 2FECL 1QACA 4EQ2A 1OWRM 4J3XA 3V10A 4QPEA 5SWQA 3RHWK 1P6WA 3FO9A 2NXYD 5GS2H 3H9ZA 3H3PL 5AW6B 3HTLX 1G9MC 2CKBH 4OFYA 4XRCB 4QHLA 5CGTA 4G43A 3V0WH 2XFXA 1QFUL 1TJGL 4DPRA 3ZL4H 4RDQG 1MCOL 3S96A 1MVUA 3BAEL 5LXGH 4FEIA 1XF2A 3SE8H 4HEPA 2Z7UA 5B4MD 5J89A 1CDIA 3CU7A 4YGVA 4AENA 5D7JC 4PB9H 1EZUA 5TE6L 1DN0B 3LH9A 5MEPB 1MDTA 1TTRA 1ZV9A 3GRWL 4UM9D 4C83B 3A4EA 2O30A 4FEMA 4R90H 1HC1A 3FQ2A 3GM8A 2RMNA 2A1WH 1N0LB 4X98A 1F13A 4X2UA 4P23D 1MIML 4JZOB 3US9A 4HOXA 5A3ID 3SODB 3SBWA 5JMOC 3CK0H 2DQTH 1VZHA 2C9XA 2J6EL 3UTSB 4N90D 3QPQC 3D5OF 2MNUA 4NO0B 3FS9A 4F33B 5HVHB 3MTXA 4MNQA 5ISZA 1X5XA 2KQMA 3HR5A 5A2LH 1S78D 3EJZD 4MGXA 2PPAA 4H13C 2OXGA 2IH1B 5DSCA 5J1TC 3SPHA 2XQBH 3CN0A 4PWHA 4DGYL 1LDSA 2HUEA 2ZOKB 4LSPL 2P8LA 5HHMD 3UPAA 3N1MC 1TSRA 1F86A 5C08D 3E6FB 1UOKA 2VL5B 3TBSA 1NCDH 1FGNL 2OYMA 3D85B 3L1OH 5GRJH 4MAYB 4U1GB 4JFTA 5FF6B 4DN4H 1RUQH 2EDRA 3K6DA 4FFYH 4M03A 1JF6A 3VTTA 3CFKA 4PJCA 3MLUH 2N59A 3KLAA 2OMNA 3KPPA 3NH7H 1JDDA 3WS6A 1AJ7L 2VDQH 1UXWB 3V0AC 3NIFB 4LU5L 1M71A 1IL1A 1XCXA 4C56A 2YS4A 5I6OA 4DCQA 4A7UA 3IS0X 2ODHA 3B7TA 1G0XA 5I1KL 5AENA 4KNQA 1HWWA 3DUUB 1MXGA 5CLYA 3RL2A 4PLNC 3TESA 3OB0H 2PO6B 3EH4B 2BP5M 5IVNA 1DJYA 4NZTH 3SCMD 5I0YA 4ENZA 4LEBA 4M5YL 2EZ0C 4NCC1 8CGTA 4MXQD 1AKJD 3B5HA 4KKBD 5FAAA 4UDUB 5EUOA 4F7EA 2NMSA 4GFXA 4TQEH 1A7OH 1EV2E 2WVVB 7FABH 3FOMA 3GLEA 4Y7MA 4LSUL 2VZSA 1WBYB 2BJML 2PCXA 2XWZA 5CJXC 5D1ZC 5GJTL 3EOYG 3DUSA 1SJXA 4OSUL 4YR6A 3TIEB 3VXSE 2H26A 2YK1H 1J9QA 1A9BA 1MCDA 2HVKB 1W0VB 3MFFB 3T2LA 2OYKA 4QXTB 2VTFA 2QLVB 4JKMA 3WJLA 4LCVA 4XGZB 2NY6D 3HMWL 4R7NA 1YEEL 3RTLA 3BP7A 4GXVL 4F8NA 4Z7OB 3BP4A 2APWA 2GTZA 5JHLA 5FS5A 4CA4A 5KZCB 1ZHKA 2AJSL 1JZ3A 3SDXF 3LH8A 1AO7E 3MLXL 5JXAL 4OW6A 4J3SA 1YEKL 2CLVB 1RZQA 5FDWA 3CHSA 4LAQH 3CZSA 1RIUL 5SWSD 2FCBA 2CD0A 4BBWA 4K0OA 3MCG1 1KXTA 1UVQA 2X4QA 5B39B 5HDLA 1RUAL 1EERB 1T03L 4ORZC 3LHAA 2AERT 3CFBB 2GK0A 4GY4A 2A77L 2O6DA 2VITB 4PUBH 4FYRA 3B83A 1GJIA 1EDHA 3SOTA 5C9JA 1SYSB 4OLVL 2OTWA 1SUHA 1U3ZA 5HHXH 2RCSL 4L3CB 4P2RB 2OQJA 3O6FB 5AVZB 2F5AH 2F7PA 4PV8A 2AAAA 2WIIA 2BIPA 5HTSA 5ICZB 5EIVA 1T21B 2DDQH 4IJ3B 3WMSA 3AQZA 1CGVA 1SN5A 2I25N 2F15A 4XCCL 4F7TA 1XR8A 3WY3A 4B41A 4OY9A 5CJXA 2XDHA 5LKNA 3BEVA 5HI5D 4AMKH 4NQEB 2Y25A 4U7KA 2ZUTA 1P1VA 3IDXH 3FFDB 5GGTL 4BQ8A 3OKLA 1G7JA 4UM8B 2HT4D 1U42A 3A6BH 4IOIA 4OIIL 4I5BB 4YHIB 4AYID 4CU8A 3GHPA 1RZKC 5KVDE 1TSHA 4LNRB 4IBZA 5DEGB 2A9CA 1KCRH 5LCVA 2OW7A 1K4DB 3UEQA 3DX2A 1I7RA 1SLUA 3P2BA 3VFRB 1TMCB 2JKWA 3F3HA 4FZEH 4ZS7L 1D5MB 1QZ1A 3SO3C 1VFBB 2A9BA 5GXBB 4R3SB 4UDTB 4WW2A 2JK5B 1V7NH 3IFOA 4JFWA 4D0DB 2MCPH 3OGCA 5CD5C 5GGVH 3HBQA 3KXFB 1H3UA 3QC6X 5INCB 2J73A 5T1KB 1NGZB 1WE5A 3GSNH 3GSQA 1P7HL 4ZXBD 4P5TB 3KWWA 3UC2A 4X0NA 2CIKA 3ELAT 3NQIA 1QKZH 2FJGA 4M7ZB 1JZ7A 2JKXA 1TVBA 4R7DA 2K4WA 4JRYE 4JRXB 4DGIH 1W9XA 5ECGA 4UAOB 5IQ9A 4A04A 2P5WB 4XP5H 1QYGH 4EI5D 1T5KA 3KYKL 3Q0HA 1MJ7H 2AQTA 2QFPA 3KPSA 3QJHB 5E5MA 4B0MM 3EO1B 1RUKL 4IMKC 4AQ8A 2AK4A 4WDIB 4A55A 3CN2A 4LPXA 2X7LB 3FT0A 2VN7A 3OAZH 2NY0C 3S8GB 5HHQA 3TONA 1MRFH 1DBJH 4P57B 5ALCH 3QRGH 1RH8A 1EO8L 3WKMH 3L4CA 1V54B 2D8KA 1SLVA 4WHTB 3EFFB 1T0PB 1XH0A 3CLEH 3CVHH 3ZKND 3K4AA 2Q76A 2GTWB 3ROOB 4EN3C 3UZQA 1CD8A 1U91A 2EDNA 5IKCB 1NEUA 3U4BH 1G9NC 5DRNB 1MCIA 3E7JA 3NFPB 3GGWA 1FH5H 3WEBA 4G9FB 3HHSA 4MA3A 5L2JA 1AG6A 2ZQKA 3OZ9L 4YDVB 4XNZB 3LS4H 2J4WL 1B0IA 4UZSA 5GRVK 1C08B 2CJ3A 3NP3A 3OR7B 4ODUB 3LCYA 4ACPA 5AAMC 2DYPD 1IEAB 3FC8A 1DBML 1HZHH 2Y2YA 3DPDA 1V55B 4G8AC 2ALWA 2C5DC 4NN6C 1NINA 1RZPA 1F4YH 3LIZA 4HAGA 5EFIA 3KDPB 5EPMA 3IGLA 3V5KB 4WEBL 1OSEA 1MFDH 4Y0GA 3WEXB 3WNLA 4MQXD 2QGDA 4ISVA 3WTWA 3U0WL 2J8HA 5HGHB 4QHUB 4EZKA 4GW4B 2YAOA 4WJ5A 3DBSA 3ZTJH 4JDEA 4N85A 3MRQA 1HOEA 3H3BC 1CFVL 2PR9A 3QO1B 4QRRA 4KJYB 3SPVB 3V7MA 4X83A 1ITBB 2YZ8A 2H2SC 1UB6A 1G7QA 5IBLD 1BQUA 4DPBX 5CJOL 3F5WB 2DLGA 2BP8B 3NFNB 2VYRE 3L7FB 4D9QD 3UTOA 3QIBD 1C5CL 5JDJA 1IEBB 1NANI 3OJVC 4UV4H 3PXLA 1J7VR 1KIRB 1RULH 4XP9L 3A23A 4BKTC 1QLEH 1R33A 3M86A 3CQFA 5GRXG 3COOA 5ID0B 2A73B 3U6XS 4BD4A 3KLHD 1X5LA 4RNRA 3A47A 3ARBC 4I13B 2VN3A 2NUTA 2F54B 1A3LH 3LZQA 3UGXA 3W11D 5BXFA 3LZFL 3FTGB 5L9DL 1A6VH 4FAAB 2ADJB 5DLML 4J3OH 5D6CA 4ODWB 5EOCH 4XOCA 5AAMA 3V4VH 2FJUB 3L3JB 5K5YA 4MNHA 4K9JA 3T0EE 2AXGA 2LU5A 3IPFA 1TJMA 3GMNB 3L4ZA 3S2CA 4PJEE 3VFTA 4Y9CA 1NCWH 4POYA 5CS7A 4F7CA 1NMCB 2HX9A 1HEHC 2GIXA 2X3AA 1MREL 1GCFA 4OIAA 4OZFH 3H9SE 3KPRA 2WOBA 4P9HC 4NRZA 3T2QA 1ZGLB 4LSDA 1XB6A 4Z9KB 1DE4B 4LCIH 4ODTH 3ILPB 4N1CA 1FLTX 3HE6A 4BDVB 4BSWA 2WKGA 4XBPB 3Q2LA 4AQOA 3NMEA 3WN5B 1CQKA 2YJLA 4S0SD 3O81A 1FYTA 4NUJB 3VD2A 2XRAH 4N5EC 1FO0A 1Z9MA 5CGBA 5DJZA 4F3FB 4GO8A 2ZOTA 3MMEA 2NUPA 2F7IA 3QDHA 2Y6SC 4LASH 4PP2B 2QVFB 1FFPA 1VLXA 1NAKH 3DK2A 3F7VA 2BMKB 3QZWB 2J25A 1AYRA 4FQIH 4Z7WA 4AG4H 4M00A 4EXPX 2DQCL 2E27L 4PJIA 4QHMB 1OCRB 3MN8A 4L3EE 5F7EL 1AR1B 1I1CA 4QEGA 4QY8A 5AW5B 3BGAA 1S7XB 4F37K 1A7PL 4RMTA 5KTEH 3EXLA 3ARBA 4UT9H 4NUGH 1J0JA 1F02I 5BZWB 3CPLA 1OAUH 2OZ4L 3M88A 4K3HA 3PL6D 1RPKA 4JCMA 4RX4D 2FH8A 1CDYA 5ANMB 4OGXH 1NCHA 2GFBB 4NKDA 1OANA 4Z7UA 4OM1H 4Z78B 1MFVA 2X38A 1FFNB 3ZBMA 4A67A 5B38A 3FUFA 1AIZA 5F71A 1R3JA 2DWDA 1Q9OB 4PJ9A 3HNTH 3MJ9A 4BZ1L 3AXHA 1JTTA 5KVEH 4FTVB 3QEQA 5BQ7B 1P4IL 1U3HD 2DQUL 2K3TA 3LPWA 1KYAA 2QLYA 1Q90A 2BVQA 1IM3A 5EA0L 5I6PA 4NAMA 2XQYA 3HMXL 2A4CA 2ZJSL 3J8F7 1P7BA 2ZCKL 3RYMA 4DKAA 1YEHH 2AKRB 2HVJA 2YPVL 1T4KA 5F0LB 3CFCH 3FQTB 1JV5A 5D2LB 1QFWH 1B3JA 4HWNA 4NN7C 2EDEA 4LPWA 2Y06L 4XXDB 3T1FA 3DX7B 1A5FH 4NO3B 3OX8B 4Z7NE 5HYJA 3OLEA 5E2JA 4QAMB 1MUJA 3VD0A 1E30A 4KJQC 3HPLA 3X11A 4U6VL 1ZANL 3KJ6L 3RWFA 3GMRA 5GQBA 3DETD 5GGQL 2OL3B 5FPIA 5L88L 3V55A 5F88A 5C86A 3IE9A 1ZHLB 4FA6A 4UQ9A 2HKAA 1WFTA 1I1FB 3GXIA 3KCPB 1JFHA 4J27A 4NO0D 1QR1A 1F4HA 4JY6A 4UIKH 5C0JB 2PWEA 3BVUA 4OU3A 3ISRA 4KI5E 4ONFL 2VSDA 3RVXC 4OZGB 4N2KA 1EVUA 1AD9A 4RFEB 3ILDA 4X42A 5TH2A 1TQCB 4B96A 3VW3L 4WW1A 4CMHC 4NHUB 4HLZH 4KVPA 2FEDC 1KYUA 2BH0A 4E0RA 2G3XA 3FO0L 2B4CL 3WJMA 1XBDA 3D85D 2WN2A 2X42A 1IGJA 3B9KA 2G0KA 4E41A 1W91A 3KM2A 1A6AB 3VWKB 3HG3A 3U2JA 2XJLA 2XQYK 5J56B 4N28A 4HZLB 4U3HA 5E94A 1SVZA 4KO6A 5INDB 4HWZA 4BXSV 2QGBA 4H0HB 2BY0A 2HKFL 3M1BA 5FW8A 3D25A 4FQHA 4PJDE 4PRPB 4PVMA 4LARH 4ZSOA 5F0JB 2HVBA 3UL4A 2WYZA 2X12A 1IM9A 1JF1B 2ODIA 1K2DA 2PO6D 4LOFA 3GI9H 2VC2H 1E42A 2FO4A 2FGWH 3FTSA 1D5IH 1UWGL 4I0PA 3T3PE 4B60A 3T4YA 4HSAC 1KCSL 4BKLA 1U3YA 3KPNA 3HR6A 1CLCA 4XNAA 3QUYB 3M17A 1EXGA 1AMXA 1H6EA 3DSFH 5I6KA 3QR2A 3LOWA 5AOZA 4RISL 4P9ML 3WDIA 1UM5L 3BPCA 2IDFA 1Z66A 3NJIA 3BRGC 2R2HA 2A74B 4QHKJ 1NMAH 2D31A 4KUZH 3X12A 5I1EH 4HUVA 3BAKA 2APTA 3H6AA 4OQTA 1ZEAL 1X3DA 3VYPA 3RGVC 3FFCA 5AD0B 1A66A 3DSNA 4KGJA 1P4UA 4PRBA 3ZSSA 4P4KB 4K2UH 5KVGE 2N3JA 5I5IA 1ZGLP 1H6UA 1S9WB 1BFOB 1VEMA 2EE9A 4QF1B 1H3WM 4OJYA 1EEZB 3IFPB 3FPXA 4KMQA 2AFNA 2J71A 5CN2A 1CZ8H 4ZZFA 5KZCD 5K59E 2CKBL 3NFSH 4F8TA 2CJTA 4GQQA 3ZL4L 1COBA 1HOCB 4YXHH 2ZSWB 1BD2A 1JJUA 2NQDA 2YFOA 5TFSH 3O4OB 1T22B 2B59A 3KBFA 3IKCA 3T0EB 3KYMA 4JG0H 1MELA 1N2RB 5SX4I 4PB9L 4YDJA 4M02A 1E28B 3MRNB 2F18A 3MBWB 4X5QA 3FU5A 5AOLA 5AVSB 3QW9A 3WD5H 5CR8A 1XSKA 1KLUB 3QZNA 4NBYB 4Y1TA 3S4SG 4HDIA 2F8OA 1S9VA 3DURA 4R90L 1F0LA 2A1WL 2QBWA 4YHYC 2DIEA 4U1SA 3PGDB 3O3UN 3O6FD 3TEZA 4RFNB 4YBQC 3ZKMC 2DQTL 1P5UC 2R15A 4AUUA 1T5WB 5IVXE 4ACTA 2HMIC 1M6OB 1NH6A 1RZ7L 3QI9A 1KCWA 4V1DB 2O61B 2FLMA 4KX9A 2IH3A 5D6DC 4DAGL 1G9EA 4XMPH 2ADGB 3SQOH 3FTZA 2GY7B 1ZJAA 5KVFE 4G70B 4MDIA 4TVSa 5DYOB 4JO2L 3AU0A 5JIIA 2HPTA 3CZEA 1Q9KB 2XG4A 3MV8B 3PP3H 5CP3H 3OL2A 5IM7B 4J8QA 4L3EB 2R2EA 4LLAA 1T80A 3QIWC 2E6JA 3HZYB 1NCDL 1OAJA 3L1OL 5GRJL 2AVGA 1JCKA 1CXEA 1OAZH 3ARDB 4ONHB 4FFYL 3AQDA 3CZJA 4Y1AD 1K5NA 2LAGB 1EWHA 3MLUL 5KS9B 3ABLB 3C8DA 2CDFA 1OSYA 3BQUA 3KXFD 3GSVB 3IMUA 1K3ZA 4E5XA 3L7EA 3O9WB 2CJUH 5E6ZA 4BCYA 5AAPA 3VUAA 4XN8A 2M2DA 2OR8A 2OK0H 4MLIA 3P4MB 4ZOEA 3MRHB 5CWSA 5I24A 4L18A 5DWPA 1WIPA 1MAJA 2YMOA 3ASOB 3DVNA 5DHYA 1X9RA 4CN4A 1UWXK 5F7HA 1T0NB 1DQDH 5EHFA 2BIQA 2AJVH 3MLYH 3V4UL 1PCXA 4TS6A 2ZKXA 1NCIA 1QHPA 3DA0A 2OMTB 4A2MA 5CZVL 3L5HA 1CMOA 3FAXA 3WL9A 7FABL 4O5LL 5GRWA 4PJEF 5B1BB 1R5WA 3MUUA 4RBPH 4Z7NB 1CGWA 3H9HB 4PY7A 4QKXB 1XF1A 3G04B 2Q8BL 5DK0B 1HU8A 4M8QB 2DN7A 2PCFB 2WLIB 3FQ1A 3SBQA 3MV7A 4ALAH 3BHBA 4NN5C 3QXTA 2M83A 4Y2DD 5FEBA 2ZD0A 4JY4B 2YOAA 3TPKA 4G6JH 1G1KA 1SZNA 4KPHH 4WI7A 5IB2B 4U1KB 3EJYD 3SDCB 4JFPA 4XVJH 5C09E 5JPNC 2E9WA 3L6FA 4LAQL 3CIAA 2FNBA 1JZJA 2ALAA 4FL4C 3STZA 4UV7L 3Q13A 2WLZA 3OKNA 4J5VA 1LO2L 4WV1B 2JKJA 4R7LA 3PUUA 1MJJB 2AEWA 2Y22A 4MAUH 2JKTM 1TLMA 5FHAH 1KOAA 1HHGB 5F3FA 1A4JA 3OJDA 1N7MH 3BI9X 2XIIA 3U6RA 1DJGA 3WEOA 4A37A 4LSTL 2F5AL 5HHNA 4R5TA 2WBXA 2WZ0A 2Y7LA 2B3RA 5KWYC 2AC0A 3K80A 1DEEB 3EO0B 2HRLA 1BREA 4FNPA 4JE0A 2XV0A 3H53A 2PYEB 2WVSA 3T04D 2WSPA 2X87A 5ITFA 2R1WB 5IW1A 1JZHA 3TCXA 1LD9B 4FG6C 1UD4A 4IU3B 4N8PA 3A6BL 1NICA 1XIWC 3EYOB 5FA3B 5EBMB 1F4AA 3LKPB 3F12A 4PGCB 2WIMA 3OF6A 3VG9B 3QWOA 1KCRL 1S7QB 2F54D 3B7UX 4EEEA 4FZEL 1JBJA 1PZ5A 1NCBH 1JGVH 4L4JA 1UWFA 2XYBA 4URKA 3EDFA 1V7NL 1ASQA 2MCPL 5FLVA 5GGVL 3VXSD 4OTXH 3L3KA 3MKGA 5DJ2B 1RP9A 2ILLA 3P69A 4D9RE 3GSNL 5D1QC 2XIBA 3VFVA 5BS0B 4Y4HB 2GSMB 1THCA 4PJXA 3WHE1 3LRLA 1YN6B 1K5WA 1GL4B 4LEEA 1QKZL 1KXQE 3H7BA 5GRZA 1AQDA 3D3VA 3CH1B 4GG8B 3RY5A 3VI4A 3FH7A 1QX1A 1VFAB 3EH1A 4XP5L 3WLWC 5EEVA 4A66A 3FU0A 4A6YH 1H8SA 3VU2A 1MJ7L 2NR6A 2UX7A 1I85C 5ACZB 1AO7D 4KI5F 1A4KB 3QJXA 2YGQA 3UZVB 5MEOB 1SDAB 4P2QA 4BQCA 3ZKSD 3VGBA 5SWQB 4ZMVA 3FO9B 2DM3A 1AQ8A 4AV4A 1MRFL 2Z34A 4IKIA 1C5BH 5ALCL 3QRGL 4PCTA 4PJHA 1A6UH 4QHLB 3ABKB 4G43B 5D71L 3WKML 2XFXB 5EZOH 1BQHA 4KWUA 1L9QA 2VUOA 1MVUB 2FQEA 3BH8A 1KBVA 4YXLH 4TNWF 3S96B 1XF2B 1WBZA 1SY6H 3UXFA 2YRZA 2NY2C 1NDMA 3S37X 3X13A 4YGVB 4JDVA 3OHXC 3L3GA 4AENB 2Q3ZA 1MCWM 5GGTA 4P2OA 3PNWA 2CO2A 1FH5L 4GUCA 1Q0EA 1TEFA 1Z7JA 2WBWB 1Z1WA 4PJDF 4X98B 2ZKYA 5ID1A 5E8EA 1QLRA 3VXTA 3WIIH 1JGLH 4KBPA 1DSFL 4PVLA 2DEYX 2EIMB 4S11A 3V9EA 2K3HA 2V37A 3N1QC 5AVRB 3FHQA 3T3PF 2BW5A 3S97C 4XZ4A 1F4YL 2I85A 4MB4A 2O5YL 1MFDL 4MNQB 5ISZB 5GZOA 2BNUA 1XCWA 4GP8B 3HR5B 5I8EA 1NIEA 1CO1A 3FZUD 4MZ3A 4EKJA 1L6ZA 2OXGB 1E43A 2W59A 3PWLA 4MMXA 5DSCB 4MWFA 4JFHD 5B1KA 1C8QA 2VLMD 2P8LB 1X5AA 2ZUYA 4Z8FH 3ZVVA 3DX3A 1J8KA 3TBSB 4X6CE 4AJYV 1TJHH 2DQ6A 4F15B 4YE0A 5JORA 4M5TA 1A0QL 3CFKB 4JRYD 4PJCB 5HYQA 1WS8A 3KLAB 2ENJA 3KPPB 2VABB 4DO6A 3RTQC 2CCVA 3QCUH 4XVSH 2VLJA 1KC5H 1RULL 2OV0A 4MB3A 1J0IA 1ZWIA 3LEYH 4G7VH 4ABVA 1TMQA 3MNDA 4QRRE 5K59F 3FB6A 4HJ0C 5B3SB 1GS6X 1IL1B 1M71B 2QADC 3DO3A 4C56B 1I8MA 1AH1A 3R19A 5DQDH 3D7PA 4DCQB 3C6LC 1H3XA 1A3LL 1WZAA 3ARFC 1UH2A 3RL2B 2VAAA 5J3HC 2VDNH 1A6VL 4UOW1 3V4VL 5GZND 1CL7I 3P2DA 4XI5D 1J12A 2V8LA 4N9OB 2WXPA 4GRLC 4ZPVA 2C7FA 2ADIA 4IKKA 1GPOH 2IDUA 2B3IA 1MRDH 2DMBA 4XN4A 4QYOA 3BX7C 4KKQA 4ZMWA 1NCWL 2IH9A 5EUOB 1MY5A 4F7EB 4IBVA 5JHDA 4P04A 1KGXA 2WJ5A 3FOMB 3HZKA 4YWGH 4FNLH 5IVXF 4BCXA 3N0PB 1JF5A 1OAQH 4GSRA 4RAUA 4DKDC 3LEVL 3MV9E 3VWKD 3DUSB 4DO4A 4YR6B 2FNWA 2KYIA 1ZT1A 5AVWB 2H26B 5EEZA 4BIKA 3AY4C 1A9BB 4I2XE 3S5LG 4YBLB 3SDAC 2PWFA 3KYOA 3QIUD 1AC0A 1KFAL 3UCRA 4I18C 3LPGA 3NTCL 2EUWA 5E9DA 1CIUA 4R7NB 3VA6A 2XRAL 3BP7B 4JZNA 2LU3A 4EUPA 2LR4A 3BP4B 2GTZB 3BGFC 3AG4B 3CV5A 5AOIA 1ZHKB 3EJPA 3MJ8A 2OCJA 1UCBH 2UYLA 1T1ZA 3FTYA 2YAEA 4LASL 2J56A 1URLA 5HHOA 1NAKL 3FUKA 4P5RA 2AK1H 4YLQT 3WELA 1UXMA 1YNTF 1GMEA 4AG4L 1ZS8A 3LPPA 1IARB 3QUYD 4HAKA 2YA1A 5FDWB 1E4KC 3OD3A 5KTEL 1ECZA 1KXTB 4K4KA 1UVQB 1CGSH 2X4QB 5D1XA 4UT9L 5J1AA 3APDA 4NUGL 4ERSL 3AXIA 4BFIA 1OAUL 4G6AD 4PSRA 2GK0B 4OGXL 4YDLC 4RRPG 1KTBA 4OM1L 4XNQA 5C9JB 2Y6TE 2OTWB 4LLVA 5EC2A 4PVBA 4HA1A 3KCWA 4KHTL 4P4KD 2OQJB 2FWOA 2R7EA 1NC2D 4PV8B 4MLSA 2X1OA 2DMHA 3SKJH 2NW2A 2WIIB 1BFVH 2IOOA 4KK8C 5DVPA 3RIFF 2VR7A 3D18A 5KVEL 2GT9A 2DMKA 5EMYA 3L17A 2YD3A 1H8LA 2JSFA 4PJ7E 1JZ5A 2PWGA 4LB8A 4GUOA 2BVYA 1XR8B 4F7TB 3GNMH 2Q2LA 1MAMH 1S46A 4M1GL 1MCEA 3BEVB 3DMMA 4ENEC 3NCYS 1VESA 5IROD 2VCOA 3LIUA 3V6OA 2DLFH 3AW5A 3OKLB 1G7JB 1OP4A 1ODAA 2NXZC 4IOIB 3SDAA 3T0ED 3CFCL 1EK3A 4KAQH 1VZGA 2BRQA 2MH4A 1A5FL 4PW9A 3M46A 1I7RB 2ICEA 5B1JA 1RUMH 2DBJA 4DTGH 1CK0H 1BAWA 4WW2B 2ITFA 3H9SD 5D7KD 3ZGHA 4NM8H 3IFOB 3OGOE 3OGCB 3N42B 4GRWB 5F9WB 1F3RB 1BJMA 4PS4L 3VGEA 4X50A 3GSQB 3NA4A 3KM1A 4XODA 3KWWB 2CIKB 1OTTD 2FJGB 4V1DD 4XN9A 4Z18A 1FVCA 1TVBB 4R7DB 1CU4H 4UIKL 1DFBL 4JO1H 3DGGA 4CVXA 3E8UL 3G08A 3VG0H 2EECA 1UQSA 5A2FA 5JQHC 5IQ9B 3NT0A 4FXGC 5E99H 3N2JA 3MNZA 4U7SA 3CC5A 4P5SA 2EIKB 1DJZA 4LCWA 2VKWA 2OZ4A 5BO1H 3KPSB 5E5MB 2AMUA 5I6MA 2AK4B 5EO1A 3NIDB 5D5ME 3BPOB 3MLZH 4L3ED 3D12B 1F00I 4CADA 5CF3A 2UZYA 2R29L 2BSED 3N1PC 5HHQB 4BZ1A 2EINB 2HRPH 5A6MA 4IBUA 2XWCA 1RLWA 4ZMTA 3II3A 3I85A 4WI4A 2VJ0A 3MUHL 2Y69B 1YC8A 4QD2E 2CHZA 3NQKA 3FU3A 2Q76B 1J8HA 3UTTA 3QCVH 1U91B 3O9WD 3UZQB 1G43A 2LABA 2V3FA 3HMXA 3OLGA 2PTTA 3I6GA 4I7ZC 4JN2A 4KO5A 5D4IA 1JNNH 5F9DC 3GGWB 1AFVL 5C0AA 5IVZA 2DEXX 2VQ1A 3HHSB 4MA3B 5L2JB 4QNPE 1NGPH 2IAMA 3CFDA 5DWUH 4IRZA 3C6SA 4FULA 3EJUA 5HI3D 1I8KA 4NQUA 4ZUVA 3DX6A 4N8VA 2C9PA 2CRIA 3NPSB 4NNPH 4M4RA 2ZG1A 5IB3A 5IQLA 3EBHA 2JIXD 1CE1H 3DSFL 3T6QC 3GBEA 4B5EA 4HQQH 2ADFH 4WHYG 5DTFA 2K7QA 5EPMB 5EFIB 2KZWA 3ESUF 2UWEA 3ARZA 5K9KA 1G0DA 4KUZL 1WGOA 1Z9LA 5BW7A 5I1EL 3B2DC 2C3VA 4ISVB 2F2HA 1VHPA 2HRGA 1N18A 2ZX9A 3IDGA 3TN0C 1XO8A 4WJ5B 4B7IA 3GZOA 3L5JA 4JDEB 4QKTA 4K2UL 4E9WA 3MRQB 2YSTA 2VXVH 4YHZH 1QWHA 4QRRB 1JWUA 4B9YA 4DKFH 4ZTOL 2NY0B 3WNPA 1UB6B 1G7QB 2ZT9C 2AI0L 3SIKA 3GS0A 5KYYA 1VAHA 4DH2A 3NFSL 1JP5A 3QZLA 1JSYA 4KI5D 4MJ5A 5CSBA 1TKWA 4YXHL 1RU9L 2V6HA 4FG4A 5TFSL 3VSTA 1ETB1 2VR5A 1LP9A 2VDML 4OM0L 4WSJA 1IZKA 1EQWA 2JKSA 2LOEA 3WDHA 4RNRB 3NDYE 5A2KH 4YGAB 3LKNA 2EVFA 2NUTB 1U8OA 1JVOA 2A3TA 3WD5L 4RWHA 5BXFB 4D8OA 1XCQA 1WZ1H 5IR1A 4XWGH 1BD2E 5H94A 5D6CB 5G2NA 4WGVB 5EU3A 3J2PA 4BWTA 5C2UB 2CKNA 4MNHB 4JUTA 2AXGB 2VMJA 3QISA 4LEXL 1FLRH 3WYRA 2Z93A 1IB5A 3GPEA 3MCLL 3VFTB 4X7TA 4YSOA 3MUGA 3INUH 4F7CB 2PNDA 5JW4R 3ZE1E 4OCYH 3GXUB 3KPRB 2WD0A 1ZLSL 1PNDA 3BH9A 4MJHA 4NRZB 4G6FB 3B7SA 4GB9A 5JW5A 3L5XL 2ORBH 4Y5VC 2N56A 5J57B 2H6OA 3HE6B 3LQAH 4JFUA 3HS0A 4WRLA 4BSWB 4HU8A 3LD8B 3F6LA 1Y6KR 3P77A 2CPCA 4Z77A 2HLAA 2FX7H 4FFWC 2OKMA 1ZK9A 4JQIH 1BYOA 2Y5EA 1FYTB 1USZA 3RRQA 2QGEA 1KV7A 5DD3H 1FO0B 5DJZB 4AEFA 1RZ8A 4XNUH 1OAZL 3MMEB 2NUPB 1NAMA 1OCWL 1SXCA 1KGIA 2DI7A 4G1EA 1CICA 3K4ZA 1FFPB 4X6CF 3F7VB 3M6DA 4Z7WB 3H54A 2CKBA 4GP4B 4PJIB 1MWAL 4QGYA 3SOBH 4Z6AT 4HLEA 4QY8B 1SMAA 5ICYA 1ZE3H 3CBKB 3ARBB 4PYGA 1P7QD 4DUVA 5CLTA 3CPLB 3HG1A 1QBAA 1Q1JH 4NKDB 4Z7UB 4QHKI 3KWVA 5HPOA 5B38B 2VL4A 3NJHA 1QTYT 3NGBB 1E65A 4K9EH 2CUAA 1R3JB 2DWDB 2QPSA 2JB5H 1SJEA 3BSHA 4PJ9B 1DQDL 3G3LA 5KBMA 2AJVL 2E4FA 3MLYL 2XN1A 3LJ3A 3TASA 4YDZA 3ULSA 1GY1A 1L9MA 2W0LA 3QEQB 5CJ5A 1UT9A 2Y7MA 3BVVA 2BXYA 1F8TL 1U21A 5EBLA 1JNLH 4X0KA 2BVQB 4HULB 1IM3B 5CZRA 1LK2A 3SQRA 1IGIH 1MI5A 3BKCH 1SFDA 4DNLA 1ZRUA 4F2EA 2E7LC 4KXBA 2HVJB 2KBGA 5CINH 1AS8A 1KJ3H 1HNYA 1T4KB 1YDPA 3BGMA 1JV5B 5FYLH 3T1FB 1OHQA 2VN5A 1BAFL 2WLJA 2EYTA 4WUUA 2BOCA 2XHNA 5F21B 5HYJB 4GUPA 3A4DA 2H41A 1MUJB 3GZQA 3HPLB 3M45A 4KPHL 3X11B 2XJKA 1SBSH 3ZSTA 3RWFB 4FFYA 3GMRB 2VJ8A 4N3TA 2E59A 4PREA 3B6SA 4XVJL 5JOEA 5CZXC 1AY1H 5DGQA 5ESQA 5F88B 3KWTA 3BAWA 3RILA 1WUZA 1XQ4A 2Y07H 4DOHE 3GINA 1QR1B 3ECWA 1ZXKA 3K46A 4JY6B 1QBBA 1XZ0A 3UYOD 3UZEC 5FFOA 2XETA 5HDBB 4ZAKA 1AD9B 5TH2B 3IGUA 2J5LC 4Q9QH 1MXDA 1X5KA 4Y9FA 4ZFGL 1BWWA 4WW1B 3I02A 2QVMA 1M05A 4C4KT 1BZ9A 1T2JA 2GVYA 4NBXB 3N6YA 1CYXA 3S48A 3PDOA 4E0RB 3JUZA 2X9ZA 3WJMB 4ZFZA 1U93A 2JJTA 1IAIH 1HKFA 3DTXA 1IGJB 3B9KB 2V9RA 1GYAA 4E41B 5M94B 5G5DA 3N41F 4CC4A 2ZCHH 1M6UA 3FHAA 4URTB 4PJ7F 3QBTB 5E94