3WY2A

Crystal structure of alpha-glucosidase in complex with glucose
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
535
structure length
535
Chain Sequence
NMMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLDNMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSRPENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEVASDLPVAHFTATRDGSTLTLPAYQAAFMQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-glucosidase
publication title Structural analysis of the alpha-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism
pubmed doi rcsb
source organism Halomonas sp. h11
molecule tags Hydrolase
total genus 192
structure length 535
sequence length 535
chains with identical sequence B
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3wy2A03
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3wy2A02
1Y7VA 2EAEA 4J28A 5HDRA 2F18A 4UQEA 1TQSA 1MXDA 4UNIA 1V3JA 4JFTA 4PCSA 3BSGA 4AMXA 4OJYA 1JIBA 1MW2A 1AQMA 1T0OA 1AVAA 4UQDA 4CN6A 3L4VA 5A2AA 2OYKA 3DX3A 1WZKA 3H55A 1HVXA 3BUIA 4FLSA 5CXPA 3RILA 2OYLA 3WY3A 2WVVA 4PSPA 4DO5A 1OSEA 3WDIA 1CXHA 3D50A 1JFHA 1PZ3A 2WVVB 3VSUA 1G94A 1CPUA 2XVKA 2EQDA 5A2BA 3OLGA 1RPKA 4FNTA 1V3KA 1XCWA 3OLDA 4HOXA 1KBKA 1XD1A 4WF7A 1KWGA 3CTTA 1R46A 3LX9A 3EJSA 1R47A 2GJPA 3VGGA 2ZWZA 2D3LA 4J3UA 4NXKA 1EA9C 3VU2A 1E3XA 3L4UA 4AW7A 4UQ9A 4CKQA 1R7AA 2EABA 2YA1A 4J3XA 2E8ZA 1Q4NX 3MI6A 3VX1A 4AYSA 2Y24A 1PIFA 3LXBA 4WSKA 3TV8A 1JI2A 1UD2A 1VB9A 2NT1A 3DX0A 3CZEA 4NZFA 3ZR5A 2E9BA 1IV8A 2V3EA 4GI8A 2YFOA 3K8KA 3BLBA 2EACA 4UQAA 2OSWA 1BVZA 1SMAA 1XSKA 1E3ZA 3BVVA 2VRKA 1JDCA 3VMOA 1UA7A 3BCFA 2YOCA 4JFVA 2F7OA 2VR5A 4J3TA 3GTNA 4HP5A 2F7RA 2FHBA 1KTBA 1U30A 3VMNA 2XN0A 3GBEA 2FGZA 2XN2A 1J0JA 1U33A 3CZGA 1V3MA 2PWFA 2FHFA 1HXKA 3LXAA 1TQWA 1SMDA 2ZUTA 3WNNA 7CGTA 1RP8A 2DIEA 2WVSA 3AJ7A 3VM5A 8CGTA 1UH2A 1JAEA 2BY1A 2FH6A 2GJRA 3LRLA 4HPHA 1UD8A 3BUBA 4U2YA 3EJTA 3HG3A 2YIHA 3DDGA 3QGVA 3D4ZA 1WZMA 2WCSA 3H54A 4GI9A 1BPLB 1CXLA 2V3FA 2D2OA 1EO7A 1XV8A 1JF5A 4FLQA 1KXHA 3ZR6A 1LWJA 5E9AA 2VNCA 3BSHA 3K1DA 4WLCA 4FNQA 1WO2A 1B0IA 4GKLA 4U31A 1UKTA 2D0HA 1C8QA 3BMVA 4FLRA 3WY1A 6TAAA 2ZWYA 2ZE0A 3DDFA 1E40A 3EDFA 5KEZA 3VGHA 2FH8A 1BLIA 1UKSA 3UERA 3VM7A 2NSXA 3KLKA 5EMYA 1UH4A 3W38A 3A4AA 4LXFA 1EH9A 1KCLA 3ZOAA 2ZUUA 1J0IA 2QPUA 2C7FA 3WEMA 1G9HA 1AMYA 4PSRA 3ECQA 3WDJA 3VGFA 4UOZA 4KWUA 2XVLA 1HTYA 2ZUSA 1MVYA 2XWDA 4X0NA 1JF6A 3HJEA 3WNMA 4GO8A 1XCXA 3IK2A 2BY0A 1GJWA 3WMSA 1OGSA 1LWHA 1XH0A 1DTUA 4DO6A 1QI4A 3WY4A 5DO8A 4GO9A 2WNWA 2ZX8A 2DH2A 2EADA 1QWUA 3TONA 1BVNP 3L4XA 1VJSA 1QHOA 3DX4A 3WNPA 3D52A 3VGEA 2QV4A 4GQRA 2ZUWA 3WENA 4U3CA 4LPCA 4H8UA 3VNZA 1DHKA 1XH2A 1XSIA 1B2YA 2ZX6A 1V3LA 1BSIA 2BHUA 1WPCA 2FYVA 5E0FA 3CLWA 1J0KA 2EJ1A 1UKQA 4FMVA 1W9XA 3L2MA 5E6YA 1QWNA 2XVGA 1CGVA 1PAMA 3BAWA 1UD6A 3EJUA 2Y4SA 2YFNA 5HPOA 3WN6A 1KWKA 2QMJA 1HT6A 1CGWA 1PIGA 4B9YA 3KL5A 3UG5A 3EJRA 1MW0A 1G1YA 3IJ9A 2ALWA 2YKKA 1PS3A 4FNUA 3TTYA 2X2IA 1XD0A 2ZX5A 1ZJBA 2D0GA 3AMLA 3GXDA 1CDGA 2QPSA 3DX1A 4B9ZA 4AEEA 1I75A 1XSJA 5CLTA 3DHUA 1G5AA 3LPPA 2GVYA 3DHPA 4MAZA 1CYGA 1OT1A 1CGUA 5E6ZA 5C8BB 1CXKA 1KGXA 1QI5A 1UH3A 2BY2A 2DIJA 2Y5EA 1HL9A 3VGBA 3EDDA 2WCGA 5I23A 1GCYA 2YJQA 4HA1A 5F7UA 1JDAA 2WKLA 1QPKA 4H8VA 2ZUVA 1XGZA 4E2OA 3EDKA 4GINA 1ODUA 1O7DC 1AQHA 2ZX7A 3UCQA 4NI3A 1VAHA 4NX0A 3WFZA 1M7XA 4W93A 2PWDA 3LRKA 4XB3A 3HZ3A 5A2CA 4CGTA 3CC1A 3BH4A 2PWHA 3AMKA 4OIFA 4UCFA 5BRQA 4BA0A 3BMWA 1KXVA 2FE0A 3IGUA 3BVUA 2D0FA 2ZXQA 3II1A 1R34A 1PJ9A 1WP6A 3ZO9A 2V3DA 2BHYA 1CLVA 1BAGA 4QAWA 3KWXA 3VX0A 3A23A 3ZSSA 1IZKA 2XWEA 1MFVA 3CZSA 3WELA 1BF2A 3IJ7A 1KXQA 4KMQA 2D73A 3LRMA 1CGTA 1CXIA 1MWOA 2WKGA 3A24A 2EEXA 4CN4A 2XN1A 3L4ZA 2GDVA 2OW6A 3KLLA 2ZICA 1TQVA 4J27A 1J0HA 2WVTA 1QW8A 3CV5A 1D3CA 1CXEA 3BVTA 4WSJA 1CIUA 1R75A 1MFUA 1TCMA 1TMQA 3S2CA 3GXPA 1HX0A 3ZQ9A 1DEDA 4H2CA 4PCTA 2TAAA 3WNLA 2BY3A 3D51A 1CGYA 4M56A 5CGMA 1NOFA 4HOWA 1JG9A 3LXCA 2E4TA 1OB0A 1WE5A 1KTCA 4JCMA 1HL8A 5HXMA 4UQCA 5CGTA 2XIIA 3EDJA 2E8YA 2ZXDA 3OLIA 1UOKA 2VT0A 2J25A 4JL1A 3A22A 2BHZA 3GBDA 4J3SA 3VGDA 2ZXAA 1KB3A 2NT0A 2OW7A 3VNYA 4J3WA 1UASA 2VUYA 1XH1A 4FNRA 3WY2A 4ATWA 1A47A 2D3NA 2X2JA 1ZS2A 4FNPA 5A6LA 7TAAA 4BZYA 2G3MA 3EDEA 3KEHA 2WSPA 3K8MA 3KL3A 1PEZA 4UQBA 3L2LA 2E0PA 1JDDA 3S5YA 5E1QA 2VRQA 3BUQA 1ZJAA 4OKDA 1UD4A 2AMGA 1UD5A 3KL0A 2QLYA 2WANA 1GVIA 1KGWA 1KXTA 1JL8A 4CVWA 3BVXA 4H7VA 2PWGA 1CXFA 3ZT7A 1RP9A 1TQUA 1WZAA 4NXSA 3KE0A 1QHPA 2C8NA 3WDHA 2BXYA 1CGXA 2EO7A 1HWWA 3CPUA 4M8UA 2CXGA 3ZT5A 4CN1A 4AMWA 2GDUA 3S5ZA 2ZIDA 1SZNA 4AEFA 3W37A 1GJUA 2CHNA 2YA2A 1PPIA 6CGTA 3GXMA 3K8LA 4U33A 4UZSA 2IGTA 1VFUA 1R33A 4FLOA 2CPUA 3UG4A 2DH3A 2OYMA 1JD7A 3WEOA 1P6WA 4GQQA 1VIWA 2WC7A 3BCDA 4JFSA 3AXHA 4H8HA 1EHAA 4DO4A 3A5VA 1IZJA 2F61A 2OSXA 2X2HA 3GXNA 3IJ8A 4LQ1A 1OT2A 3BAXA 2F7QA 3EJQA 1HNYA 1MW1A 9CGTA 2OSYA 1KBBA 4AIEA 3A47A 3HG4A 1D7FA 4MB1A 1JD9A 3WNOA 3BLKA 5I24A 3EJPA 3RIKA 2ZX9A 3WNKA 1VFOA 4NZJA 2FHCA 3CZLA 3HG2A 2Y2WA 5BRPA 5I5RA 1JI1A 3L4WA 3DC0A 3AXIA 5TD4A 2QMKA 1MXGA 4U2ZA 3ZT6A 4UZUA 1S46A 3A6OA 3HG5A 3CGTA 3GXIA 3BAIA 3BVWA 2WSKA 4X9YA 5E70A 4HOZA 1QI3A 1UD3A 5DFAA 3L4YA 4AYGA 1EO5A 1NM9A 1VFMA 3OLEA 4OGZA 2WPGA 4J7RA 4JFWA 3BAYA 2BXZA 3LPOA 2YA0A 1PZ2A 3VO0A 3GXFA 3BUDA 1JGIA 3FW6A 4JL2A 3BUPA 4GIAA 4FNSA 1MW3A 1U2YA 1KGUA 1TQTA 2AAAA 3DX2A 3H53A 4JCLA 3TOPA 3UG3A 1E43A 3BLPX 2XIBA 1JXJA 2F1AA 1QX1A 4PEEA 2G3NA 3TTSA 3L4TA 5CLWA 3FAWA 4GI6A 3A21A 3VSTA 3ZSTA 1KCKA 3GXTA 3UEQA 1JXKA 4UOQA 3M07A 4J3VA 2GUYA 4JFUA 1QW9A 3BAJA 3D4YA 1Z32X 3FAXA 1H3GA 1L0PA 4AIOA 1UA3A 2F2HA 2F7PA 3CZKA 3VSVA 3CZNA 3BC9A 2ZXBA 3BAKA 4TVUA 2Z1KA 1WZLA 2WVUA 5I0DA 2F1BA 5A6MA 2PWEA 3VMPA 1BG9A 1M53A
chains in the Genus database with same CATH superfamily
1U8CB 1X5FA 5CLYA 4GRLD 3VYPA 1MXDA 1SYVA 3BGFB 3QDGB 3KM2A 1NPUA 1AQMA 1T0OA 4JFPA 1S78D 1ZLUK 3WFBL 2DF3A 3HI5L 3HHSA 4EZJA 2KT6A 2OQJB 2LTQB 1NBYA 4KKBD 1M57B 2GC4C 4B9IA 4GKSA 3T4AC 1X6NA 4PSPA 4AYFA 1AHWB 2QSTA 1OP5H 5I66B 1TOXA 3D7PA 3O4LA 2YQ2A 3OLGA 3B56A 4HVBA 1Z1WA 3IFNL 4UAOB 3PWLA 1XIWD 4FEMA 4KK9D 4OCSL 3VXPA 2EVHA 3T8XA 3MLSH 4PGEA 4RQQA 1VA9A 4K9EH 1EGJL 3BZ4A 3ML8A 3H3PL 5JXEC 2DWDB 3WHE0 4ELMA 4XXDB 5LAXB 4I9WD 5JQHC 1YEJH 1WUZA 3H7BB 4NM8L 4O58H 2R83A 2Q0ZX 3FRPB 4PS4H 3GJFK 2E8ZA 3KYNB 1VKXB 3VX1A 4K94C 1DBMH 4IRSA 2H1XA 1BFOB 4OUUB 4PRHB 5KSUB 3NFPA 2HLAA 4Z7VF 3UBHA 3WUWA 3LVEA 3QDJA 1QATA 4L4VD 5DJ6A 4QCIB 1SEQH 4WWKA 3TEUA 3ULUD 3BD4A 4Y19D 4Z9KB 4KZDL 3ZYJA 5IFJA 4QXGL 2HPOA 3I02B 4RSYA 3FCUB 1VACA 2MQGA 4P2QE 1FZKA 5GGQL 4JAMB 5FA4B 1RK0B 4CKVX 5AW7B 3IEAA 3NIGB 2H6OA 3KLHD 2FEEL 1E2WA 4NEHB 3FC8A 1T3FA 4Y8DC 1KF9B 2H0FA 1H6TA 1SLWA 2EC9U 4L8SC 1J0JA 2Z93B 1U8MB 3DSNB 3HI6L 1F13A 1MHHA 4YXKH 1JNHA 3LKNA 1SOXA 5BS0B 1NIEA 1HSBB 3BAEH 1YC7A 1PZ5A 4YIQB 1YYCA 4MA8H 1OLZA 2UY7B 4G7YH 1B0WA 1U92B 3U9PL 4ZMZA 1ADQA 5EDSA 3SB3A 2OTUA 2EVIA 4HFWA 3ROLA 1NFKA 4XOBA 3LJ3A 1UXSB 4XT1C 2X28A 1GHFL 3DUHA 1QSEE 4XX1G 2J88H 3PAZA 1CF8H 2WQVA 2ZCKL 2D2OA 3FB5A 3S97C 2DQEH 3DUUB 1CL7I 2WY3B 1ML0A 1I8LA 1PLGL 3L3OC 3CN4A 2H2PC 2QQKL 1KB9K 2JKRM 4R4FL 5D4HA 2HKHH 2CA4A 4YO0A 3IDXL 3WY1A 3BOVA 1CK0L 3CU7A 4FZEH 3QXAA 5DI8A 1KY6A 4P2YA 4F7MA 3AT8A 4CVXB 4KNUA 5I6PA 4AJWA 1DCLA 3B6SA 2YD1A 1AI1H 2DTML 5SV3A 5CFAA 2DS4A 2Y1AA 1WCQA 3LEYL 3LKSB 5DVMA 1V8HA 2JB5H 3BQUA 5FYLD 1OAZH 3O41A 4MKTA 4OAWA 2CUIA 2CKBA 1AO7E 3H2QA 3VD7A 1G7QA 2XG5B 3PGCB 3BIAX 1SF5A 1Z9OA 5GQBA 3HMXL 4JANA 4Y1AD 5DZVA 3RY6C 3VVWA 3FT4B 1ZCRA 3ZDYB 4UOZA 5F6HI 4LHUA 3RTQB 1I1YA 3TFKC 4HJIA 4N0CC 1R3KB 3LZLA 3D4CA 2BC4A 2P3YA 1CT8A 1IQDB 4UINH 2AQRA 1EMTL 5KW9L 4GKOA 1JWUA 2WZ5A 1KZQA 5D7IE 4AIZB 3GMPA 1PVHA 1ZT4B 4YXHH 1QR1B 3DX8A 3ZDXE 1NAKL 4WI4A 4S0HA 4GPVA 3MNWB 1ZHLB 2KZ1B 5FPIA 4L5FE 3WL9A 4MJJA 3KR3H 4I88A 5A40E 3DX4A 3NIDF 3BRDA 3ZTCC 1U42A 1QRNB 3G5YA 5B8CB 5LDSA 2IALA 3EH4B 1A6WH 3CVHL 5E6ID 2E47A 3D5OF 1U0QA 1V3LA 1FSKB 5EO9B 1WPCA 3VWJB 3L5HA 3MKKA 1J0KA 1EFXB 1W9XA 2YLKA 1HS6A 4NQDA 4O5LH 4X8GA 1CE6A 2DDQL 3MRNA 1B90A 3QDHA 3L3JA 4LCWA 5GISL 5KAQG 3HZVA 1XO8A 3WEBA 2EH8L 4AENB 3CFBB 3RHWK 3QEHA 5E8PB 2JKNA 1WAAF 1G4MA 4G6JL 5J3HC 2ALWA 4UQIM 1PS3A 5ESQA 4OKVA 2HTLC 4PP2B 2HT3D 1TDQA 2ATAA 1RPUA 1S7WA 2FVNA 5B1JC 2J6WA 3T65A 3PWPD 1NOLA 4KHXH 3P30L 4ODUA 5DQDL 2CJTA 4K94L 4UT6A 5AW2B 3REWB 3HZMA 4L29A 4OZHA 5HVGB 2DQFA 1JUFB 4OLYL 3EO1A 4O2CB 1TZ8A 3QR2A 3PL6A 4JO3H 2F5AL 4WFFD 4FQQB 4IBYA 5D7SH 3FN3A 1M7IB 4Z7UE 1G43A 3DIVA 5DSCA 1WEJH 5F93C 5DHVB 2A6KB 2V5SA 4UAOC 2I9LA 5ECGA 1EJ8A 2HT2D 3MV7B 5ESVB 3V0HA 4B53A 2ICEA 4XN4A 4BQBA 1P0SE 4Z23A 4ZXBA 1RQ5A 1KMGA 5BRZE 4YSUA 1ZANH 2Z92B 4S2SA 4AWJC 3N55A 3TNMA 1OB1B 4AQZA 1Q94B 4W4NA 4BA0A 1LVEA 5GRYA 1CIDA 3S5LG 1XGPB 2FE0A 1A3RH 3QFJA 1U8LA 1D7DA 3X3FH 1FC2D 3N9GH 1T21B 3ZO9A 4OF8A 4BELD 1IILE 4S1RH 3PHOA 4GMTH 2BHYA 2EXTA 2J5LB 3SKMB 4L1HA 4RSVA 1KT2A 3MLVH 4ZFFB 2YAMA 5I9QC 3DVGA 1BF2A 5EU5B 4HGMA 1AGFA 4U1HA 5D1QC 1L3NA 3GLAA 1BQUA 3WFDH 3QRLA 1CGTA 2DQMA 1AGEB 4W1TA 1MKFA 3U0TB 1DFBL 1A7PH 4PS4L 5D70H 4Z0BH 3MV9D 3BEVB 4YLBA 2GCYA 4YFDB 4Y2DC 4CC4A 4AEHL 3QW9A 2J8UA 2QADD 2DM2A 3QXDB 1SEQL 1R75A 3S3JA 1C5DB 1CD9B 3IU4L 5CS7A 5IIEB 4PJGF 1HX0A 3FQUA 3L3HA 1MHPL 5ITBH 3CLFH 1N18A 4M56A 2YUZA 1BAFL 1TZHA 1J5OH 3F84A 3D12B 5KYXA 4HV8A 5L8KB 2R23A 4ZW8A 2E4TA 1NBVL 4L8DA 4WTWA 4WHTB 5DD3H 5LQBH 2HN7B 1D5XA 4N5UA 1GZQA 4P23D 3FT3A 1UYWH 1SDAB 4RMVA 3TCLB 3F05A 2YWZA 1ZA3A 3P9MA 3S37L 1EO8H 3BAEL 3EDJA 1T5WA 1DVTA 1ZLDA 3SGDI 4JO4H 1MI5A 3B1UA 3H9HB 4MA8L 4G7YL 2GW5A 3QUXB 4OSUH 4DQAA 1BYPA 3UJTH 4HCRH 4PWIA 1JYWA 2X4TA 1FN4B 3MRFB 2VDRL 1CF8L 3UDWA 4Q9RH 1UZ8A 2WZPA 3V0JA 2PN5A 3EFDH 3ULSA 1JZ8A 5J1SC 4P4RB 3GUTA 3JSSA 5IQLA 3KW8A 4O02B 1ACYH 2NX5D 4J1UB 5EF2A 1NEPA 4HUUB 4F37F 5IBLD 4GKNB 4P59H 4HGWB 4FZEL 3RTQC 2MQ3A 3CFKB 4PLKD 4B9FA 2ESVE 1QSFB 4WAFA 5BCAA 4GSRA 4FA6A 3VTAA 5FCSH 1AI1L 4LSUH 5DWUL 1CXFA 5C9JB 2JB5L 5E94A 1N4XL 4UILL 1OAZL 3K80A 5GGUB 3BFQG 4F8TA 3L3DB 2NTSP 5DC2A 3WDHA 3TN0B 3UTTD 2JB6B 2M1KA 1NDMA 4Z7VE 4P5MA 4JRLA 3D0LA 5DHVH 3QNZB 5C86A 3NSJA 3CSFA 5KYNA 2QVIA 4P3DA 4EI5C 4ENEC 1W0WB 1AOZA 4OLEA 6CGTA 2JJSC 5B8CC 4UINL 1EJOH 2GTWA 4HX1B 4I3RL 3ORJA 5I1JH 3PS6A 3UG4A 5IHZB 5HHOD 1FSKC 3VWJC 3V0VB 1IEHA 3X11B 1THCA 3BCDA 1OZTG 4Q0XL 4C56D 3WOVA 3QHFL 1JGEA 2H41A 3KR3L 4LQ1A 4NC1C 5D1XE 4FG2A 3SDAD 2OSYA 3VQMA 1QTPA 2R2CA 4TS6A 1S5HA 1A6WL 4WJ5A 4QMEA 2UY6A 4HWEL 1WD8A 3D85B 5JW4Q 4HF5L 1LYQA 5J6HB 2X9XA 2IOOA 5E2WH 3GZQA 1UWGH 1K8IB 3AY4A 4O5LL 3KPMA 4DPAX 5CD5D 2WO4A 3RVUD 1FG2B 5JIIA 2FZ3B 1W8NA 3UJJH 4Z7QF 3AU1A 5DO2C 4U6TA 3PXJA 1WG3A 3IKKA 1OK0A 5HDLA 3L48A 4WJKB 3T4YB 3V4PB 2BS9A 5DU7A 1YG9A 4BBWA 3WU1A 5T3ZE 2LLGA 1JTPA 4IRJD 5EOQH 5I75B 5L8LB 3UZQA 3QUKA 1Z5HA 4KHXL 5JDSB 2GUOA 5D93C 1WUNT 4IU2B 5JIDA 1JERA 4JFQB 5IMKA 3WN5A 1NFDB 2Z31B 3QJQB 4L4TA 1KPRB 4TSAL 2F6AA 4OIIH 2CLRB 4ZFZB 1NCOA 4JO3L 4NBYB 3P9LA 1RULL 2NY0B 3OGOE 4OZGB 3U82B 2ZCHH 4MZIA 1WIPA 5C0BA 4P04A 1XGQB 5D4IA 1WEJL 3APDA 3HLKA 4Y1TA 4FNSA 1K4DA 1YN6A 3US1A 1HYSC 5C2BH 4NAQA 3BKJH 5AUMA 4H88H 4R4NC 5GSVA 2RALA 3QNXB 3UTPE 3DGGB 4NZDA 3WI9A 1OP9A 4ZX6A 1KELH 1F6FB 1ZANL 4YSEA 1TCRA 2OMNA 3AAZA 2NXYB 4PJDF 5KBNC 2F5BH 4P46D 3FU5A 2EXYD 3W2DH 1U9KA 5SWQB 3FOLB 5GZOA 3QRGH 4HPYH 2EYTA 1MCIA 1XL6A 3X3FL 3E7JA 4ODWA 3KPRB 2WBJB 4HJ1A 5ANHA 3T9WA 1YEIH 4O02H 1ZVSA 2XWZA 1V10A 3LRGA 1BF8A 4JKKA 4PJFA 5DEGB 1AH1A 2HRHA 3MLVL 1F4YH 3OHMB 3I75B 2WO2B 2OMZA 3VSVA 5FYKU 4Z7WB 4GT0A 4KFMA 4N2IA 4QYOA 4LKXA 1WZLA 3M1OA 3WFDL 4N9GB 5E4EC 3U4EA 3U6XA 4LHQB 3FOMA 2Q7NA 3V0EA 4BRVA 1T1WA 1A7PL 5D70L 3IXAB 4FRWA 1O5PA 4D0DA 5DRWA 3FQRB 4KK5C 4NO5A 3MJ7A 5ALBL 1KCWA 1I8KB 2F19H 4KMLB 2D03H 4AMXA 4OJYA 1B4TA 5CCGE 1RZ8A 2QGBA 2E7HA 3FQ2A 4UQDA 5C08A 1NIBA 4X6DA 2DWYA 5H4YA 4E68A 3B9EA 3OM3B 1NQBA 2V33A 1TZOA 1TENA 4XI5D 4RRPA 3RWHB 3CLFL 1MHEB 3H3KA 1J5OL 4G3YL 2Y7OA 3G5XB 4P8QA 4Y2OB 1MNUH 5CHNB 4APQB 1F1DA 4MZ3A 3EH5B 1M3IA 3E8VA 4FNTA 5DD3L 5LQBL 5HGHA 1P7QA 5HPMB 1UYWL 1DVFC 3PJSB 2OK0H 2RQEA 1EO8L 4IDJL 4IBTA 3QIUA 5KBKA 5AZUA 3N1FC 3HZYA 3QI9D 2NY4D 4CL7A 2YZ8A 3BZDA 3VI3B 4DEUA 1WRFA 4EDWL 4HJGA 4JY6B 1RMFH 4OSUL 3DMMB 3PRZA 4NKMB 3MRLA 4CKQA 1MIEH 5EZLA 1URZA 2EXSA 2AQ2A 5C0IA 4MA3A 4QF1A 3QNYB 4TSCL 5J1AB 5MERA 2N7AA 1P1ZA 4AYSA 2NY6D 2YK1H 1EAPB 1A3LL 5AOZA 5EA0H 2AERT 5K9OA 3EFDL 4LLYB 2Q87A 3JVGC 2VDOB 2ZJSH 1C7TA 3A0OA 5GS3A 3V4PH 1BQRA 1DSFH 2OJEA 4XO9A 1ACYL 1EVTC 5F9AC 3JV6A 4JHUA 5I2IA 4X6EB 3BCFA 3HFMH 4X7TB 3D39D 5GGTA 2XWTB 3TN0C 4NQED 1AOHA 3UYOD 5E1HB 3ZL4H 4ZMVA 5BZZA 4P59L 4RGND 2WLNA 1JZGA 5JOPE 3C2AL 4NJ9H 3KXFE 3APCA 4GKZA 4F7KA 2H26A 5HHXH 1J9RA 2PMZA 5BZWA 3TH2T 2NOYA 4ZOBA 1ZWIA 3BISA 2WVSA 1KLGB 2FB4L 1UH2A 1JAEA 5ACMA 4IRZA 1IC5L 1NBQA 4PYGA 3R19A 3ZPDA 4UBDC 3HNSH 3O8XA 2VLKD 3EOTH 2EE3A 5ANME 5F9DC 3V0WL 5C0DA 2J2ZB 3J07A 5IKCA 1JWSB 3H54A 3GHEL 5I1JL 2W80C 5KVFH 4OCYH 2AV1A 4KZCA 1TTAA 2XKUA 2TSAA 4P48A 4X5RA 2OTPA 4RLDA 4N6RB 1MFDH 3U30B 5ABAA 4HH9A 1FQ9C 1UKTA 4IIQB 2BVYA 1DUYB 4N2AA 2XU9A 2KH2B 2ZE0A 5AOLA 3KCWA 2VAAB 4WFHD 1BLIA 3EHBD 3EFOB 2NSXA 3WD5L 1YMMB 4WI3A 2AEWA 5GGSY 1MCEA 3G5WA 3LPWA 3CSGA 5E2WL 1KCLA 2NUTB 1COBA 1S9YA 2WXGA 4FDWA 4JFZH 1UWGL 4JO2L 5MEQA 2BDNH 1E9OA 1FFPA 2FGWH 2NW2B 2XWRA 4CJ1A 4G8EA 5HI4C 1WC7A 2A73A 3P77B 1P7KA 4E5XA 3WFHB 3B8SA 4UMSA 5IBUB 3TO4B 5CJ5A 4TQ8A 2XG4B 3HG1E 4R4BA 4F9LC 3T09A 2XZCH 4GG6A 3SY0B 5KYUA 1DANU 2R1YA 1QI4A 3DI2B 3WY4A 4DUVA 4JQVC 3BN9D 3VXSD 2FYYA 4NENB 1HK6A 1SF3A 2OS7A 1UEYA 3BP6A 1OGTA 5HDBE 1EGJA 3ARXA 5DS8B 1OD7A 2NR6A 3LNFA 5D6CA 3QZWB 1KTLA 5ID0A 4ZS7H 4WFED 4GNKB 1KPUB 4J8RA 3GJEB 1QBBA 2M83A 2ZCHL 1B2YA 3SPCA 4PJ9B 4FAAB 1FA4A 4L48A 3HAEA 1Q9LA 4U0RB 4E41D 3X1FA 3CLWA 3BKJL 3CFTA 4H88L 1F02I 3CVDA 5KANI 5FOBB 5FGCE 2ODHA 1TSHA 4KI5E 1KELL 1MEXH 1PAMA 5EO1A 5IVXA 2FQEA 4IOSD 5EEYA 4FMFA 2EDKA 1AYOA 3CK0L 1L9OA 4GSUA 1HT6A 4HPYL 4N26A 4U6YA 4UIKH 3UFIA 4ADGA 4OZFG 3IDYB 2VDOH 2MOQA 1ESOA 1YEIL 2MPAL 2FQGA 2XNAB 4O02L 2J21A 3X1GA 2O4EA 5GSRA 1HE7A 2QVTA 2Q1EA 1F4YL 3HLAA 15C8H 3K6DA 2CNYA 4WHYH 5IHUH 1CDGA 1HU8A 3HB3B 3JZYA 3U2SA 4Y9GA 4AEEA 4IU3A 3T6XA 1U3ZA 3SY6A 5KTEH 5IB2B 5ICZB 1P5UB 2CO1A 2AABH 4XTRC 1N64L 4P2RD 3HHMA 1ETZA 2IV8A 5I23A 4K5PA 3H42H 3KPLB 4KOBA 5F88A 5B1BB 4U3SB 5DQJB 3SSGA 4E2OA 3Q8BA 1AQHA 5EO0A 5T3XH 5CMAB 3GBLA 3SDCD 3EYFA 2B1OA 2PPDA 4QJ4B 1T7VA 4A2HA 1T83A 4P2OD 5FGBA 5KSAA 1W80A 1CQYA 5IUSA 2UVEA 3Q01A 2VOTA 3PWNA 4UM9B 5C6TH 1JZFA 3X12A 1J0ZA 2G3XA 3KS0J 3NZHL 2Q7YA 1B2WH 4FYTA 4PGBA 3A67H 4GMSL 3SGEH 5CBEB 2IAMD 2JKLA 1FCCA 1GGCH 1YNTF 3GIVB 3C60D 2UWEA 5B3SB 3IPFA 1ZK9A 3GTVA 1KXQA 4QO1A 2FO4A 5FYJE 3D09A 1D5BB 2KI6A 3Q2WA 2BNRB 4BFRA 2WKGA 1JBJA 1O6SA 1CFBA 1DLFH 1A6AA 2FUTA 3C5JA 3CBJB 4N0FA 3NSCA 3HMXA 1RJYA 3DPDA 1LEGB 3CZFB 3RX7A 1CICA 2HMIC 5FHAL 5AB1A 3ULVD 3QUZB 1WHOA 2FIKB 2K7PA 4I0PA 3V4PL 3CQPA 3QG7H 5F7LB 1I1CA 2L7JA 2QVMA 5DHYA 5JR1L 3S3CB 1S4IA 4PCTA 3RHWF 4JM2A 3C8DA 4EXKA 1J8HB 2P48B 4HEMA 1X4ZA 3ZL4L 3IN0A 5K93A 3CFDA 1U8NB 2DN7A 1OB0A 3TPKA 4DZBB 1GGIH 1IAII 4PS8A 1XF5A 3BP5B 3CVHA 5I1KH 4HIJB 4N9OB 1BQLH 1NOAA 2E8YA 4EMZA 3RJOA 2XRAH 2BSRB 3TPUB 2OULB 2OPCA 4QWWC 2A4EA 2IEPA 1SVZA 2PP7A 3AVEA 3NA9H 4K71B 5K39A 1FLTX 4QHKJ 2XWXA 3HNSL 2P80D 5DHMC 1FFNB 3EOTL 1MCSA 2JXMB 1WWCA 3TEYA 4X5WB 3C8HA 5KVFL 3QJXA 5JXEA 1UENA 4OCYL 1XH1A 1SHSA 3V9CA 4AQ1C 4DSYA 3TWCH 4AUUA 5DK2A 1WJ3A 3KL3A 2EIJB 1LP9B 4YPGA 3S5YA 3CQFA 4BZ1H 5SWSE 3LIZL 5CSGA 4RETB 2XXFA 4OKDA 4ZNCD 2V2WA 1XR8A 4GT7A 2GQHA 5AW4B 1DDTA 4WEBL 4CVWA 4H7VA 5T5FH 4NO0D 5DJYB 3V6OC 5FF6A 2PW2B 1AZUA 3F5WB 5CU5A 3VXRD 5EC1B 2B1HH 2BDNL 3FRUB 3SYOA 4BFIA 2BXYA 4YDVB 1WBZB 4RMSA 1HZKA 5I73B 4HIIB 1KUMA 4ZUSB 3IAGC 5HHMD 1KJVA 5D7JD 4NO2A 1E6JH 3L3KB 2HX7A 4L8SA 4YMPA 1VCBC 1XF3A 1ZGLP 3F01A 3ROOA 3T2NH 2SODB 2XZCL 4KHTH 5DTFB 1TF4A 1W6LA 4PI0A 5DQ9B 4F7TA 1JD7A 1FZJA 4YPJA 1MVUA 6PAZA 3AXHA 3OAWA 2VUOA 2BWIA 4RMRA 2F61A 5LGKA 5E4OA 1WF5A 3F12B 4JRXE 1O7SA 4X7SL 1HOCA 1NGXB 4Q56A 4DUXA 2NCMA 4G6FD 3ZDZB 4GBXD 1HNYA 4YNYB 3F3HA 3TIDA 4H40A 2I5YH 2BNQB 3HG4A 4U4IA 1G9NH 1H6UA 1IBYA 1IGFH 1WV7T 4ODSL 4PREB 4WI7A 3L3OA 1SUHA 1UWEH 5AL0A 4OT1L 2OXGB 3UYRH 1HQRA 1MEXL 1YEDA 4MB3A 4N5EC 2YQBA 1A6ZB 3JV5A 4R7NA 4I4WB 2JCCA 5BRPA 3N1GC 3MYZA 3O9WB 3R18A 4ES9A 2HT4C 4UIKL 1IMHC 2CIIA 3QORB 2BX5A 1DQJA 3GSNB 3A6OA 1C5BH 1UUSA 2VSMB 2BIHA 1HILA 3L1GA 4ELMF 1IEBA 3NFSL 1FL3A 1RZFH 15C8L 1R3HB 2DQUH 3C5ZC 1E27B 1TETH 4XCYB 3RIAF 3TVMB 3X3GH 5IHUL 32C2B 4RX4A 1I3UA 4ORGA 2NUPA 2H32A 3RY6A 1OQOA 5I76A 5EU6B 2CK0L 2G9HA 5FEBA 3OLEA 3TYGH 5KTEL 4I18C 1AGBA 5D2NE 5IZ7A 1MCPH 2X2UA 3FCTA 2XFXA 2DYPD 3ARGB 4K3HA 2AABL 2Z6FA 4JFHD 1MUJB 4U6VL 1QEWB 2Y3NA 4KKZA 2YA0A 1CD1A 5A2JH 3BUDA 5L88H 3BUPA 4XNDA 2BOLA 1MW3A 5I17B 4J2XA 2FEEI 4GRWB 1FF5A 4KTDH 5BOPA 3M1CA 5C97A 5IMMA 5JW5B 1OANA 4P5KA 5IEHA 1LEIB 1N70A 4RDBA 1S9WA 3LSOB 1R5WB 5CSBA 1G9NC 1GS7A 4LCCC 3TGXA 4APXA 3ARWA 3FFCA 3MO1A 4R5TA 1FVDA 4HIEB 4HLZH 4UI2A 4UOQA 4L3AA 3RUGA 5JOEA 3IGKA 2JKJA 3D4YA 1T2XA 1DVYA 2WNKA 3KLQA 4LSDA 4PUBH 1B2WL 1IFHH 3EJYC 4QXVA 4BSVA 1JHKL 2DMGA 2EDLA 4WY7H 5TGBA 1L6ZA 1AKJD 4LLDA 3CBRA 1DQMH 3QUZC 3EGDB 4B3VA 2Y1ZA 5HYSA 5L8JB 4OI8A 2GIXA 4FEIA 5B4MD 2ADJA 3ZKXC 1DLFL 4WU7B 3RGBA 1NCUA 1E90A 4LOUC 4ZRGA 1Y7VA 1PDKB 3IS0X 5B1JA 1ZA6B 1A7QH 2AKRA 2PXYD 3X1EA 5EBMB 1EDYA 4K2UH 3UJIL 4B0MB 4MX7B 1HH9B 3S8FB 3QG7L 1SNRA 2JKXA 3LNHA 1KYOK 5D2LA 4PRIA 2YUXA 2WJ7A 1AHWA 4HMDA 2OYLA 4MRCA 1RY7B 3RVTC 3ZL2A 1MCWW 1L9MA 3VSUA 3IDNB 3NQKA 4DGWC 5I66A 3LHAA 2ZKHL 5TQ0H 4P2QD 1NCDH 2ENSA 1GGIL 5DVPA 4AV4A 3MRKA 5EG6C 3BUYA 5AW8B 5KSBB 4ADIA 1R46A 1J7VR 2CBOA 1BQLL 1BCIA 2DWDA 2IH8A 2DBJA 5DURD 5HI5D 3FCGA 4JFEB 4G83A 3KYNA 1VKXA 4Z0XB 1MF2H 1BLNA 3GIZH 1BFOA 1L9PA 1CLOL 4YL9A 2X6BA 3ZUNC 4F8LA 1UWFA 2AK4A 4QCIA 3U4BL 3LEVH 1UT2A 4N1EA 4TLSA 3NK3A 4AXWA 1QSED 2P5EE 3OXSA 3W11D 3IDGA 5C2UB 5M95B 3GSNH 4TLKA 4JAMA 3HA0A 1DJSA 4YC2C 5DJXA 4BZ1L 2W95A 2NRDA 8PAZA 5I73C 2PPEA 4HKBB 1W0VB 3VMNA 4L18A 5DUJA 3TBWB 3GI9H 1CD0A 3RVVD 4H0HB 3O4OB 2KHAA 4KUCD 2Z93A 3DSNA 5BS0A 4S0TD 1BM7A 5T5FL 1HSBA 5DF0A 1FVEA 5KJRH 2B1HL 3JTSA 2VSCA 2UY7A 1E30A 5D5MB 5DJDB 5MENA 4Y16B 1DSYA 1QASA 4CNIB 2EIEA 4Y9EA 1UFUA 3LRLA 1NC2A 3SCMD 2AZUA 4NOFA 4Y5XC 4GRWH 1T1XB 1H3WM 4PWHA 4FQLH 3JUYA 3DRTB 4OZHF 4LMQI 2RFXB 2IFFL 1KTKE 3DUUA 4KHTL 2EEAA 3U2JA 3VG0L 1OSZB 4LVEA 4N85A 3K1DA 2VDLB 1JYNA 1A14H 1CLCA 2COVD 2G0LA 2P5WB 4M7JL 4NIYE 1WSST 1U3HD 1J5HA 4H44C 2WD0A 2J5WA 1HZLA 4OH2A 1IE5A 3DLQR 1NIAA 2DQDL 2KPNA 3ESNA 3H0TA 3ARED 1A1OB 4CVXA 1SOQA 4GOSA 1G9NL 5IR1B 3CQQA 3P3UA 4JQIH 1XZWA 1I3GH 3JT2A 4HWUA 1N12A 3UYRL 5FDWA 1X7QA 2NY3B 4LCYB 2H3XC 2XG5A 3GGWB 3PGCA 2Y7MA 1GMEA 2A6IA 3OZ9H 3JYCA 3QUYB 4RMBA 4W9GC 3DA0A 4XHQA 2LGNA 3FT4A 1FDLH 3VGFA 3RTQA 1IC1A 3MRCB 1C16A 3RAJH 2XWDA 1T89C 1LL1A 3IJEB 3MCG1 5CNHA 5EU3A 4QTIL 5IHBA 5KN5B 4C57C 1VPOH 1FJ1A 5B1KA 2NNFA 2DQUL 4XN8A 3A4DA 4FHKA 1S7XA 2GBTA 4M1DH 1FL6A 3MNWA 1L5GB 5T1MB 4ZMNA 1N19A 3TYGL 5HI3D 1V27A 4NSKB 4OCMC 4EI5A 1MCPL 1QRNA 1MCWM 2JJSA 3HFFA 1J1PH 4M43H 3UYPB 2J8UF 5B8CA 4UDUA 2QZ5A 2PO6B 3PHQA 3D87B 4U3XA 1OP5K 3SDXB 4NPJA 5L88L 3VWJA 2CZNA 1V7NH 2UX6A 1S5IH 3B83A 2BHUA 3C5SA 4BZ2H 2R1XA 1EFXA 1ZLVH 4KTDL 5J11B 4FMVA 4G1EB 4U05A 1CGVA 5B38B 4LVHB 4H1LG 4HEPA 3LH2H 1WBYB 2PCYA 1IKFH 2YFNA 1FIEA 1ZHNB 3WUZA 4AENA 1KB9J 4JFDE 5BRZD 2C7UB 2WXQA 2R69H 5DCCA 4YHPB 5LWYH 4PUBL 1AQDB 1Y6NR 4H25B 3ILDA 1EVUA 1EXUA 1IFHL 3TBVB 1N5YH 1PZAA 1I7UB 3REWA 3PJNA 3TJEH 3O2WL 3OKOB 1FFOB 4L1DA 5LHDA 4F7CB 3OGCB 4O2CA 3LPPA 4JKNA 3WIHH 4ZW5A 3RZCD 2BVTA 3ISRA 2GJZB 2Z8SA 2DIJA 4FQQA 5HGGS 2Y5EA 5KVEE 3L7FA 3VGBA 1M7IA 3Q1EA 1A7QL 5F7UA 3O4LE 1R3IH 1O7DE 4FQ2H 1EANA 4YBQC 5DHVA 5D1ZI 2ZUVA 5IEKA 5IB1A 5ESVA 2Y2YA 1DLHA 4R90H 3NCBB 4O2FB 1S9VB 3BD3A 4ZUUB 4AK2A 2X3CA 3G04B 1OB1A 2GJ6B 4F7EA 3M6DA 4ELME 1CU4H 3EYUL 5IVOA 4FCAA 2ZSWA 3CC1A 3GSQB 1CFVH 4M00A 1U2CA 2HRPL 4MAYD 1KULA 4MCMA 5C0CB 5TQ0L 4J4PD 4PRDB 5E95B 1T21A 1HCVA 2OJ1A 2VDLH 2VDQL 2ADYA 3BVNB 3C9NB 3SKMA 1I9IH 3ZHDA 2NY2B 1ZHBB 4QAWA 3O3DA 4C4KO 2DWTA 3QDJE 1J1XL 2QV2A 3HJ0A 4LGPB 3KWWB 3IJ7A 5K9JL 3ZN6A 1AGEA 3RDTC 3S3SA 4NKQB 2R59A 1IBDA 1OARH 2A6DB 3BE1H 4UV7L 3PV6A 2OW6A 5T1KB 2GDVA 4Y4KC 5GIRA 3BEVA 3GIZL 2A3TA 4M5ZH 5EFIB 1QW8A 3KWTA 4PJAE 4J3OF 1JN6B 3II2A 3NCFB 4L3EA 3O4OC 3LEVL 4QLWA 3ULAB 1QHQA 4LEOB 3QQ9C 3WFEH 1MFUA 1EZUA 1Z3GH 3S2CA 4M7LL 3N43F 3REVB 1HOEA 4TULH 3ZKSD 4M48H 2OR7A 4ZUVB 1IVTA 3IBOA 2P24B 1SJEB 4ODXB 2EKSA 4Y16C 4DP9X 4ZQTA 4OZIB 2GPZA 1TQCC 3GI9L 4PV8B 4XWOD 3NZ8B 5C0EA 2HN7A 2E9GA 1BXVA 1IM9D 3DJZA 2F15A 4XBMA 4YZFE 3U7WH 4EPSA 4ESKA 1KCSH 3MKGA 1E0OB 3RWDB 5DJZB 3NCYP 5KJRL 2ESVD 4D0BB 4PB9H 2N7BA 3UTSA 4KROB 1BQHB 1N8OE 3QUXA 1XVSA 5B3JF 5TE6L 5KVGH 1SXCA 1KSRA 1FN4A 3MRFA 1DVFA 5CJOH 4POUB 5E4AA 1S8DB 2BJML 4BHUA 4NM4L 3S2AA 2R39A 4P4RA 3LNIA 4XHJC 2Q6WB 4EKXA 4WO4B 4P5RA 3NCWA 4O02A 3BPNC 3RJDA 4KH2A 1A14L 1SOSA 1HNFA 2NY3C 1PU0A 5DS2A 1I8MB 3L4CA 3QUYC 5E1QA 3VQLA 1WHPA 2AZAA 4KJWC 4GKNA 4LGSB 4OJCA 1F58H 3U7AA 1IAIM 4LBAA 3ZRFC 3JVGA 5JIQA 5D1XD 1MFCH 1JGLL 1Q72H 3JWDH 3W9DB 5JHDB 5C9JA 3W5NA 5F9OL 3V0GA 5LGYA 1UZGA 5GGUA 1ZE3H 4Y9CA 3TN0A 4W6WB 3I3BA 1UADC 1GJIA 1CGXA 2YRPA 1KTDB 5TK2A 4D8OA 1IC7H 1KJ2L 2E7LA 1PX3A 1XR9B 4NWUH 4DGVH 4H26B 3QNZA 4PJFF 4AK1A 4AEFA 1W0WA 4KX9A 4A2FA 1YY9D 1E8ZA 4W9KC 4HX1A 1OCWL 1XB8A 1RURL 3HC2A 1NAMB 5F97E 1RV6X 5J12B 1R33A 3V0VA 2EVJA 3X11A 1V5JA 4BSWA 3NJXA 5T3ZD 1DDHB 4M1DL 4ODTH 1FNSH 3QC5X 3SKOA 4GQQA 3FO2B 3T8MA 1SJHB 1ZHKB 2QFRA 5J11C 2AJZA 4QXTA 3E9TA 1BBJA 5GS0D 1N0LB 1WQVT 2P46B 1EWHA 4RIRB 4LCWE 1L7TH 4GRMA 4OBRA 1J1PL 1JSYA 2Q9OA 4M43L 1QPXA 1MZZA 3QH3A 1OF0A 4D0CB 5HBBA 4J12A 5DVOA 1QZNA 4FG6D 5G4MA 4X6DF 5ERWB 5J6HA 5I6XB 1V7NL 1OE3A 1S5IL 5FFOA 1ZOXA 4BZ2L 1FPTH 3WNOA 4Z76B 3FTSA 4MHHG 4DAGH 1R3LA 4HK3N 4PY8I 5HD8D 1Q9OB 3WJLA 2XXGA 1FG2A 2J1YA 5H35B 3LH2L 4X9IA 5I1IH 5IHWA 4NN5B 3UTPD 2E75C 5I6OA 1OAQL 4FFWC 1IM3B 4KBPA 3V4PA 5IW6B 5IJDC 1ZE3C 2MHAA 5TD4A 2PTUA 3OJMB 5LWYL 3CSPA 4HUWB 2AS5M 1U8QB 1UC6A 1N5YL 1IQWH 3ES6B 4J2QA 5JDSA 1YPZE 4UV4H 4YSPA 1X3DA 4IU2A 3S3DB 3A6BH 4HUNB 4JFQA 1EPFA 2EE0A 5I1AA 1NFDA 3JV4A 4NQXB 3VFWA 1YY8B 4U6XA 1CDBA 4OQ1A 3WIHL 5INDB 5DMIL 1NBCA 2K4AA 4OZGA 4F9LA 4RZCB 3QFJE 4MS8C 5CEZE 4FQ2L 4YJZL 1OSYA 4PGCB 4NO3B 3IPBA 2AMUA 4LSVH 4JQVA 4JDZB 3QJSB 1LDPH 2AAAA 3QNXA 3TOPA 2NY2C 1IVLA 1OAYH 4R90L 4MJHA 5FDYA 4HWNA 5ID1A 4X42A 3ARBD 2W9DH 2VZ1A 5E8NA 5IVZA 4ZAKC 5SWQA 3QG6B 1CU4L 4PJ5B 3GMRB 1CFVL 1NZRA 4JZJB 1OXYA 3KVPA 3M07A 1RJZB 2UXVA 5DRXB 4KJQC 4TVPE 1ITCA 1X7SA 4MD0B 5DR5H 3WKML 1I9IL 2D9CA 3LIZA 2FLBT 2C9UA 4WTZA 3I75A 4B0MM 2J8UE 5AZ2L 7FABL 5JHLH 1F1AA 1VZIA 3L6FA 3NCCB 1GSMA 4N9GA 3I6GB 5JPNB 2D7QA 3BE1L 4WI2A 1BF5A 1I8KA 2Y7QB 4MCYA 3W0WA 1QTYT 2JLPA 2GBUA 1CLZH 4N8VB 4GRLB 4UNIA 2VDNL 1CFQB 4XCCL 1JPTH 3VH8A 1WICA 4HK0A 1LE5A 3WBDA 1S6NA 1Z3GL 2KDGA 3JTTB 3L4VA 2OYKA 4GQPH 4TULL 1MI5E 4JQXC 2JELL 2ZYSA 3MYJA 4FHJA 4AM0A 5DC9B 3B7SA 1ASQA 1NAMH 4DO5A 4OCRH 4Y2OA 5CHNA 4APQA 1QBLH 4BQ8A 4NQCB 3P2BA 4JVUA 4LE8A 5ABZA 1KENL 4E9TA 2FEDC 3AS0A 4RA3A 3U7WL 4NHCH 3CTTA 3HIZA 3U9WA 1RCYA 3AROA 4PB9L 3VI3A 3LN4A 5I71C 3N42F 4UT9L 1N6UA 3QZBA 3AG3B 3DMMA 4NKMA 4K8RH 5KVGL 2Y7NA 2CHWA 4KPHH 3RJQB 1AHKA 1ORSA 3T5WA 4GG6F 2GY5A 2ID5A 1ETJA 1AE6H 1D5IL 1FBIH 1Q4NX 3SKNA 4DPRA 4HUXA 1NGYB 2FL5B 2I07B 2NT1A 3U79A 5IHLB 4OFYD 4PLNC 3H1ZA 1QQDB 2V5TA 3CZEA 1T03L 1T5XB 2B77A 3W9EB 1IV8A 4L4VB 2J6EH 2BSCA 5H37A 1Z7JA 1J86A 5AW3B 1MVFA 3MNZB 4Y19B 4ELKB 2WXRA 2WXKA 4X6EA 4X7TA 5F89B 2XWTA 1BFVL 1MQKH 1QOKA 2R0KH 2P7TB 3QPXH 3SPIA 1F58L 2DQ6A 1MFCL 3JWDL 2BSEA 5IUCA 2XN2A 5IVXF 5LKNA 1KZYA 3VD5A 2W0FB 1G7JB 3Q3GB 5GHWH 1S7QA 1V3MA 1Z9NA 2MRYA 2MOVA 3KPNB 4BH8A 5LLIC 3ZKMC 1B0GB 2AJYH 3LXAA 5CJBA 5J12C 1LD9A 5HGAB 4XO4A 5GS2H 3WNNA 3MGOB 4PCYA 5EBWA 4NWUL 4GS7B 2WUBH 5I6KA 4TMPA 4FQ1L 1FHNA 4M7LT 2IANE 4UIMB 1H8LA 4ONGH 3SBWC 3MJGX 3Q9PA 2J2ZA 3HG3A 4G6MH 1JZIA 3ESMA 2ZYIA 2NLJB 4K8RC 4A67A 4PD4K 2IG2H 2WIIB 3HS0B 1RZIB 3D8MA 2ZYHA 4ODTL 1TR7A 1UACH 1LWJA 1CG9B 3HG1D 3FF8A 4N6RA 4ZODA 2VZOA 3SPVA 4G43B 4ZMXA 3O3BB 4LVOC 1L7TL 2VXSH 4IIQA 4J3OG 1DUYA 2AJXH 1TEYA 2WMPA 3BUTA 2H2SC 1SHWA 5EHFA 4NN5C 1AGDB 4O51A 4FL4B 4K3GA 3DDFA 1PJWA 3VGHA 4A2DA 1ZTXL 5F1KC 1FPTL 5B3JE 2VISB 4AQ1A 1TSRA 4QT5B 4TVSa 5ICYB 5KUKA 3OKEA 25C8H 2A77H 3QP3A 4N25A 5CBAA 1YJDH 3DK2A 2NW2A 3ARSA 5ILTH 5GGVY 5JW4N 1Y1UA 4JO1H 4Y1AB 4GW5A 4L4TE 4KI5D 4LDLB 3I9GL 1H5BB 4Z5RB 1V54B 3WFHA 3VD1A 2Q8BH 2WOBA 4Z95H 3WNMA 2UWEF 1T0PB 5H8DA 5TDNB 3V6OA 1JPSL 4DP4X 5AAPA 1IQWL 3SY0A 1S9XB 3B9AA 1TTCA 1ONQA 3A6BL 2DQGH 3R8BB 3PV7A 4NENA 3P3RA 1CFMA 1OKEA 4EN3D 3B7YA 2YAEA 4PTTB 3T0BA 1QHOA 5ACZB 4G9DB 3QFDA 3U0PB 2X1WL 2QV4A 1KPUA 4N2KA 2CDEB 4JZJC 5E6IB 1XSIA 2F53D 3OC8A 2BVOB 3I74A 3ZE2B 3PAUA 1GYUA 4LSVL 1BSIA 1LDPL 4JM2F 4PJFE 1OAYL 1KB5L 1LEKB 3B34A 2ZNWA 3T1WA 1QWNA 5E5UB 4JY5L 2CGZA 1A7NH 2A4CA 4BK4A 4YXLH 5JPNC 4TPRH 5F7EL 3ZQWA 4Y4HC 5DR5L 1JCKA 3MLXH 3ULUH 4BZ1A 4KK8C 1IRAY 1X5JA 3G6DL 5EWIL 1ZVHA 2WP3O 3SQRA 3PWPB 4RNRA 3HNTL 1D6EB 3ZZQA 2QPSA 5JHLL 4YH6A 3ZE0B 4OJEH 3DX1A 1I75A 4KMTH 1X7TA 5T5FA 5DFVD 5ICZA 1D9KD 5IB2A 1YLBB 2BH0A 1A7OH 5IJBC 4OF5A 1UH3A 4UOW1 1EDQA 1ET5A 5HDOA 1K3ZA 5FYJD 1H3VA 3KPLA 3C5ZA 2G75A 5DQJA 5JORA 2WBXA 1JDAA 4IKNA 1RIVH 2OL3B 3TBBA 1JPTL 5CMAA 5KVDH 1ODUA 4QHPA 4QY8B 2VMJA 3C6LD 4LB8A 4P2AA 3DVNA 1JFQH 4R7DB 5I74C 2Z8VC 4I18A 1G84A 4MVBC 5DUPH 2ERJB 2JIXA 3Q6GL 2PWDA 1MCOL 3M45A 1HJBC 4LASH 1ACXA 4K7PX 1KTRL 4MNQA 2X89D 4ZNEA 1QBLL 1F6AB 1SM3H 5C0RL 4PRPA 4G8GD 4OM1H 2R9HD 3FXIC 3CXHK 3II1A 3CG8A 4AQAA 1SLXA 2UV3A 2FR4B 5LXGL 4PPTA 1ROWA 4BFBD 4NHCL 5D7LE 3GIVA 3PUUA 4FXGB 1IZKA 1F4WH 1URLA 5D9SA 2XTJE 5C3LD 5MI0C 4X9GA 1G87A 2A74C 4QR7A 4CVZB 2BM3A 5IW1A 4K8RL 2D73A 4KPHL 5JHMA 1C12B 4YDMA 5MEOB 4QYAA 3MUHL 2HCZX 4J6IA 5FYLH 1FBIL 2R2EB 5L6YL 5LO7A 1WWBX 2WWMD 4A63A 4YDJB 3L16A 4A66A 2YD6A 1E42A 2DEYX 1OF2B 3QUZA 3I6KA 3V4LA 2QADB 2FIKA 2DEWX 2J6EL 1AIFB 1THAA 2EDTA 2OMWA 5I30H 2GITA 5AALA 2ITDA 5HGBB 2H47C 3ILQD 4TQHA 4F57H 2MTAA 5E9DA 1CZ8L 1J8HA 3DTDA 4JZOB 2W07B 3I3EA 4UM8B 3Q5TA 2R0KL 2DWEB 1YZZA 3N41B 1S7TB 2M26A 3TA3D 4DZBA 4Y2NA 1EBPA 2YRZA 5SWSD 1Y6KR 4LVNB 4P23B 4PRBB 3LN9A 2X70A 2JCCF 1IGJB 3BP5A 4GAYA 4WK0B 3AC0A 5GHWL 2FD6L 3V5KB 4G6KL 3QQ3A 3TPUA 3LV3A 5MHSE 2YPLA 4PAZA 4QOKB 2IF7A 1G4RA 5FC9A 2WUBL 5HJ3A 1WGOA 5FW6A 4WO0A 1WA2X 2GBVA 3LS4L 1FFNA 3VI4B 3NIFF 1MREH 2JXMA 4LRNL 3HZKB 4UAHA 1VCAA 4GUPB 3OF6D 3H9SB 1VF5C 2IG2L 4QI3A 2Q3ZA 3QCUH 3Q8FA 4A7UA 1IC4H 4HMCA 2ATKA 4IBWA 3CFJB 3KH3A 1QNIA 1OP3H 4I2XA 1ZD6A 3FTVA 2Q3AA 3LN5B 3Q6FB 5E2TH 2FX7H 2VXSL 5IJVB 2AJXL 3JWNG 2UZXB 1RHHB 2BWDA 1GY2A 1ZEAL 2F0CA 3B9KD 5I1DB 4JRXD 3WFCH 2JI1A 5IM7A 1KGWA 3N40F 1OHQA 2XQBH 1SJMA 5DJYA 1DZBA 3F5WA 4XH2B 1TJGH 4G80B 25C8L 3FRUA 1YJDL 3KS0H 1QHPA 2C8NA 3UTTB 3B2UC 4ONFH 1V7MH 3CDYA 3V6FB 2NTFB 2OL3H 3BH9B 3L3KA 2Q8BL 4I1PA 3LQZB 4OLXH 4Z95L 2FQFA 4PJBA 2BVEA 3DYMA 3NPSB 3S4SB 5DTFA 4V33A 4FERA 3GSUB 2R0WH 2L7EA 1UB5A 5HHOB 2DH3A 1PKQA 2DQGL 1XAKA 5IQ7H 2CUMA 1L0YA 3QJHB 3RGVC 1L0XA 3I2CL 5HJBA 3F12A 3HE7D 3IKCB 1KPVB 5IVXE 4Y5XA 5A7EA 2PCFA 1OT2A 4U1IB 4KO6A 3UBXB 4B7IA 5TH2A 4AIEA 2PYED 2BNQA 1DJXA 4ZDHA 2YAHA 5ISZE 4TF4A 4FOMA 1OAKH 5D2LF 3NJGA 2CBPA 2WIMA 1KIUA 4RAUB 1T7XA 2OXGA 3UP1A 3HAEG 4K5OA 3VFUB 4MDJA 3UAAA 1A6ZA 2CDFB 2OMTB 3FB7A 5KBPA 1S9KC 2B3RA 2ZAGA 3IN2A 5AZEL 2HG5B 1A7NL 2JCWA 3US0A 4I9XA 3L4WA 3KPOB 3QORA 4M4RA 4YXLL 2QMKA 4TPRL 3MLXL 4XZUA 3ULUL 1A21A 1NLDH 4IRJB 4IKKA 3IXTA 3D3VB 1R3HA 5DEFB 3VFSB 1E27A 4TM9A 4BUGA 2W38A 32C2A 4QNPF 4IHBA 1AR1C 5C8JB 1QI3A 3CN3A 4XPGH 3SEPA 1UD3A 3MBEC 3K6SB 4KMTL 1VFMA 3UAEA 2E6QA 1C7SA 2ERJC 3GPEA 1T89A 5JW3H 1A7OL 3EJZC 1JJUA 1MUJA 1PFCA 1QEWA 3IAQA 2ZOWA 3PNWA 4MCNA 3FW6A 4N24A 5FKPB 4BINA 2O61B 1SOKA 1A7RL 5KVDL 5JQ6H 3DX2A 3UG3A 1NKOA 1H3XA 4P4KD 3DWTA 5JW5A 1U8KB 4GLRI 3NIGF 1JPST 1MPAH 4RCAA 1LEIA 4HKXB 1IJNA 2UWEE 3FHQA 4LSRH 5DUPL 4O9HH 4LQFL 5E6RB 4NRXB 3P2DA 1KXQE 2Z7ZA 3HRPA 5PAZA 2MFNA 4HIEA 1KCKA 1U8PB 4OM1L 5F1OB 4DW2L 1JS4A 2K1MA 4LPWA 2WQSA 3WO4B 2JWYA 4K3DH 1Z32X 3KVQA 1S7VB 3BPCA 8FABA 4AIOA 1F4WL 5L2KA 3K2IA 4M1GH 4U49A 1QUNB 4H0LC 1DVQA 3IFOA 2VXUH 4ZUTB 1B4RA 1F90H 5J6SA 1XGRB 1I8IB 3B7RL 2HH0H 4WU7A 4HEME 1AZBA 2WLIB 3MOAH 2Y22A 5FYLL 3CPLB 3TT1L 2H1LM 1ZA6A 1KJ2A 5HGDB 1JZ2A 4X5QA 3UPCA 4DWHA 2AQPA 3UGUA 1FP5A 2F18A 3MX0B 4DCQB 1A6PA 3V95A 2A9CA 5BV7B 1V3JA 2E9JA 4FFYH 1QFWH 3VQ2C 2VQ1B 4LVNC 1WFMA 2VO8A 4CN6A 1NGPH 3A6CH 4K23H 5A2AA 2CALA 3LKOB 4PJCB 1WZKA 2XT1B 4NLHA 2BVQB 2NZ9D 4JFOA 3WIIH 3WY3A 2P5ED 3HS9A 1YYML 3BPLB 2J1WA 2J1ZA 2B0SL 5FO9B 2ZUXA 2ZF9A 3G5ZB 3PCYA 3APFA 3BX7C 4JFFE 1YC8A 1KWGA 2YO3A 4LF3B 3ARDD 2YAQA 4Z78B 3O6FC 1QVOA 3QI9B 5B1AB 2NY4B 3SZKC 4BZ2A 1PD0A 2GHZA 3N6YA 5IV2B 3MMEB 2OXHB 2DIAA 2H8PB 1R7AA 4Z0XA 2LT9A 2XICA 2X4UA 4PJ8D 3OKKA 3VXQB 2D31B 5IESH 3NJJA 2NY6B 4IQHA 4LCUA 4AEIH 2BSSA 2K4WA 3FK3A 2VW6A 2VDPB 3ATDA 2HLFC 3HI1B 3L3IB 2R0LH 3IFLH 5CP7B 4YHNB 3BRGC 3Q8CA 1MG3C 2Y6TE 4HT1H 1YEEH 3AWFA 2WCPA 2W94A 2C26A 4FTVA 2FX7L 1JDCA 4Y4KA 3BSZL 4CDGC 1UXLA 3KJ6L 4NQEB 3IJHA 2LLNA 4G5AA 3TBWA 1KTBA 4OLUH 4OGAC 3WIHA 3WFCL 5E5MB 1N26A 1EHNA 2XQBL 1PCXA 4HJ0C 3NPSC 2IOIA 1TJGL 1RSFA 2PWFA 2QQNH 4GIPD 5IOPB 4PJ6A 2EDXA 5I8CB 2PUQT 4P57A 3ZJAA 4P49A 4Y16A 1SN0A 1KEMH 3NVQA 3NESA 1RP8A 3ASNB 1V7ML 2ENYA 5IQ9A 1NUGA 2FH6A 2OL3L 4N2MA 1D5ZB 1KYOJ 3QPQC 2XKNA 1T1XA 2NQCA 2JI3A 3BHBB 3BUBA 4AQEB 2VLKB 4IGBD 4P3CH 2YIHA 1HAUA 2DQIH 3WE6B 2EDEA 3ARFB 2HP4A 1PLCA 4YK4B 5ITFB 5TE7L 2FJFA 2EICA 2R0WL 4JM0A 4XVSH 1OSZA 2CO6A 4Q52A 4XN9A 4ZQKA 5EN3A 4PLJD 1KXHA 3NYKA 1MLBB 3Q2CA 1Y1DA 4NNPH 5IQ7L 2C4XA 2P49B 2P5WA 3K2UL 3NDZE 2AQ1A 4K3JL 4JGJA 4JVPA 1NANH 3ZZLA 2E27L 2JCCE 3DO7B 5FYKD 1RK1B 1KFGA 3FB6B 4AG4H 1PFOA 1E8YA 4BK5C 2VL4A 1R5IB 3MRBB 4QRQA 5IR1A 3EHBB 3UERA 1OAKL 3IFPB 3KLKA 3HMWH 1OAUL 1UH4A 1OTSD 4ZG1A 4LCYA 2HJKB 3GGWA 3GSXB 3TZVC 3V52H 3QUYA 4N87A 4PSRA 2V5YA 3CWGA 1HCFX 3L95B 3VD3A 1VGEL 5BV7H 5JPMB 4RFEB 1AMXA 2EINB 3MRCA 1BJMA 1F6LL 1T4KB 3OAZH 3GK8H 3IJEA 3JBG7 2XWBA 1HTYA 4O4YL 1NGZB 5ALCH 4X0NA 4ZW6A 3HJEA 5DDHB 3TNNB 2FJSA 2I69A 3CX5K 2VC2L 2C9SA 1DUZB 4Y88A 3IK2A 1NCWL 4JFDD 2EH7H 3OG4B 5HYJB 1I7RB 2CNZA 4IOFD 4P05A 3KWVA 3MRGB 1C1EH 1UM6H 2O93L 1GZPB 1PZBA 3G08B 4FLHA 5DO8A 3IMVA 5E6SB 3RPIB 4BGDA 2AQTA 4IBVA 2IH3B 2ZX8A 5IT2H 5EF3A 4NSKA 2DLFH 2F58H 1BVNP 3CDZB 3UYPA 4YHML 4LU5L 4B9KC 3PDDA 3FFCE 4UT9A 4FKHA 4D7PA 1QNZL 2ZP0T 3D34A 1MRFH 1G7LB 3VNZA 1XEDA 4L1LA 3RUGE 1ZPUA 2VERN 1KBGH 4KKQA 4ZUWA 1OM9A 5F0PB 4E41B 5EV7A 5JQ6L 5IBTH 3KGUA 2WYTA 2ZWSA 4QRRA 2A83B 5B38A 3O4LD 5IF0B 1NGQL 4JKPH 3ZKND 3C6EA 1F2QA 3Q0HA 4JREB 5SX5H 2OZNA 3B2XA 2VDPH 3MRQB 4PW4A 5J1TC 4YHPA 5L4MA 7PAZA 1AQDA 1F56A 1SY6L 2ADIB 1ZLUH 2HYMA 2YXMA 3LZRA 4H5SA 1FV1B 3QIWB 1KYUA 5C6PB 4M1GL 3OKOA 4OZ4B 4OJFL 3B1TA 2G2NA 1FFOA 3OGCA 1F90L 5AOKA 2FWSA 5D2LE 2FJUB 3QDJD 3Q5YA 4PRIE 2GJZA 3FQ4A 1UCTA 4XO5A 3UAJD 3MOAL 5F8QC 4JRFA 5GGSA 1LGVA 3D25B 1HHGA 4JJOA 4P2RB 1F45A 4N0UA 1J8SA 5C3IA 4PIBA 2R4RH 1Q9WB 4G82A 1BMGA 1NUNB 4FFYL 4TUKH 4N68A 2VIRA 3TASA 2OR8A 3SDCB 3N44B 1VAHA 4F2EA 4NX0A 4P2OB 3A6CL 2J8OA 4E9YA 3GSQA 4A7GA 3AQXA 4PJ7B 5B39B 5CP3A 4A37A 3KZ8A 4OLWL 2GKIA 2ZXQA 1R34A 4UQ2B 2EDNA 1ZHBA 4IKLA 4S0SD 1RFDH 3EO9H 2HG0A 4MSWA 1ZGLB 2IAMB 2VITB 2X40A 3PGDA 2AK4E 2G60H 5D1QE 5FECA 3C60B 3KWWA 3INUH 5KBDA 5C0GA 2MTPA 4KX8A 4IBUA 1IGMH 4HH8A 1F3JB 3DX9B 1DVZA 4CN4A 3DTXB 5DMGC 3KLLA 5IVNA 3NIGE 2ZICA 3FRPG 5EFIA 2DMBA 3QRFM 5IESL 1AXSB 4MDIB 1RZ7H 1OP4A 3FZUD 4GIOA 4QUOA 3QUGA 1P5VB 4WDIB 3NSXA 3QS3A 1AXTL 4WW1A 2ZOLA 3IFLL 1KIRB 2VSDA 3MTXA 2JQMA 1T4WA 2Q3XA 4HT1L 1F3RB 1YEEL 1HESA 3FHAA 4OQTH 4LEXL 4ZUVA 2P24A 4ODXA 4ZMWA 4PGDB 5MENE 4BFEA 3L7EB 2O6DA 4L9LC 5FHBH 3BQUD 4FQXC 4KNTA 1GKOA 5EIIB 4OLUL 4BFNA 4CDHA 1JG9A 1GH7A 4KZEH 3K5RA 4ABVA 5IQOA 1HL8A 3ARFC 2DZEA 1IKOP 4LHUD 4MJ4A 2QQNL 4FA7B 2BVPB 2AI0H 4JQXA 1P53A 4RGOH 3O11B 5F3HB 4F2MB 1KEML 3OWRA 1JZ7A 1H6EA 2EVFA 3G9AB 2OMBA 3DRQB 1KB5A 1OSPH 4XVJH 4GQZA 1DQKA 1QLEB 3PE9A 4X99B 1NEZB 1Z9SB 4P3CL 1UM4L 4UYQA 2DQIL 4P3WA 1MHCA 1NFDF 1UATA 2D7PA 2OV0A 1R6VA 2VLMD 4XVSL 3QQDB 5I0VA 3RGHA 2KQNA 4BWUA 1JZ5A 3EAKA 3OKNA 2X2JA 2P1YA 1ZLVK 1GY1A 5JA9A 4OZGF 1Z6JT 5AVXB 1A25A 5IROC 4HBQA 1I8MA 1QFWM 4U6HB 1OZUA 4F33B 1Q1JH 1JDDA 5JHLA 3BWAB 3D07A 4N2EA 4WUKH 5JPMC 2V2TB 2O5ZH 4AG4L 3WGVB 1KNOA 4XBGB 2WTRA 4LCWD 3QO1A 3L9EA 4MNGB 4R6UA 3HMWL 4GW1B 5K9QG 3ZHKA 3K2MC 1EXGA 2CO7B 4NO0B 3GTTA 3S5LA 4K7FA 4NXSA 4BA8A 3V52L 3VXRB 5TF0A 3B5TA 1XR9A 2QL1A 3QHTC 4TUOB 1DQQB 4HG4K 5BV7L 3RB7A 5HHMB 5D7JB 1VEOA 4ZOCA 3LS5H 1I3RB 4I3GA 1QRNE 5DD6A 5ALCL 3NABH 3LDBB 1MJ7H 2CHNA 2D3JA 1CLYL 2EH7L 3GXMA 4PJXB 4ZMPA 1ULVA 4XC3H 3ZE1B 3PL6D 3MRRA 5CLZA 1SJHA 1ZHKA 5FB8B 5JMOC 1N0LA 4NC1E 1UTDA 1A5FH 3ASWA 2DLFL 1HEJC 3PHSA 3SYAA 5I15H 4LSPL 3SBWA 2CH8A 1AS7A 4ZXBD 3QEGL 2G2PA 4K4KA 4GBXB 3DGCR 4AJ0A 1BQKA 1OCZB 1OL0A 2QBWA 3O3AA 5ERWA 1LHZA 3BD5A 4Z76A 1ASOA 1D7FA 4QXUH 1I1RA 1PG7L 2HFEB 5KYYA 2YPVH 3QIWC 2ZX9A 3QFJD 1TZIA 4L9DA 1KIPB 4U1GC 5CEZD 3D48R 3WHXA 4JKPL 1BXAA 5I5IA 3HG2A 2H45A 2LAGB 1ZSDA 1I31A 1H15A 2J6EA 1IM3A 1H19A 4HEPG 2VDPL 4JG0H 4IDLA 2H7WA 2WV3A 4G42A 4PVLA 3LKRB 3P3TA 3LRSB 3ULVH 1N6QL 3VI3F 1L4IA 1PZUB 1ZT7B 5LG1A 2BNUB 3RX9A 3OKLB 2QGDA 4G8AC 3ES6A 2AK1H 4EE2A 2WSKA 2X2YA 1X5MA 4TVPD 1QABA 3U1SL 2AQNA 4OV6F 1HWHB 4NQXA 1IARB 1YY8A 1ZPLA 1EO5A 5INDA 3LXUX 4HUMB 1BPVA 4WENB 2G9KA 2DYPB 4EZLA 2B5IB 4JFWA 4RZCA 1JZ6A 3FN0H 2WWKT 3BW9A 2IXQB 4PGCA 4NO3A 1TVDA 3FQWB 2R4RL 4JDZA 4YL4A 1GIGH 4TUKL 3D6GA 5E0QA 1W16A 5FO7B 2G5UA 5CZXD 3VU1A 5F1IB 4E42B 1BBDH 1J0YA 3ATEA 4FA8A 1UHVA 1QLEH 4GSDL 1NBZB 3QG6A 3T77B 1RUKH 3QZOA 4PJ5A 4G5ZL 5C0FB 1QO3B 2JLLA 1A6UH 1IGYB 3GBML 4JZJA 4KK6D 4OV5A 1AC0A 2DI7A 3EGSA 4O00A 4GAAA 3OKYA 3U7YH 1AR2A 1JV2A 1MI5D 3SBRA 4GAGH 4DUWA 1NTDA 2V37A 5A1AA 3VE0A 4QRSA 3RU8H 3GMMA 4JN2A 4JLRB 4I13B 3LEXA 4U7MA 2QKSA 5CEXB 4L3EE 1ZXKA 3MQIA 3NAAH 4X5PA 3GO1L 1AKJB 3KYMB 5EZIH 1OQXA 1E2VA 2ZXBA 3MAWA 2ZUQB 2W0LA 4DP1X 3R1GL 1RZGB 5JPNA 1M4KA 2BOBA 1BZQK 2ED9A 4TTDC 4Y4HA 5A6MA 2Y7QA 1B9ZA 4XNYH 2X9WA 5FM5O 1NGWA 1RZ7L 2AXHA 2DQHH 4N6QA 4QRFA 1EEQA 5HDRA 2PXYB 3SGKA 4WNJA 3BSGA 5SWZA 4GUQA 5IP4A 4LSQL 3CN0A 3JTTA 3DO3A 4AYBA 4DKFH 2O5NA 3UTSE 1UGNA 2C1PB 5DLLA 4GP4B 1INQA 1CDIA 3PWJB 3MJ9L 1OSEA 5H2BA 1HHJA 4OCXL 5DLMH 3PWUB 4XNXH 4AGQA 4NT6B 5AFAA 5JYMA 3Q06A 4NQCA 1F11B 1JZEA 1OW0C 5GRJH 2IDUA 4WEEA 1INDH 1KGCE 5I19L 1IBGH 4NUMA 4YVNA 2AI0L 4RGOL 4N20A 1MNNA 3PAVA 1YN7B 2XZZA 5DURB 4NXKA 3VFNA 4Z1PA 3GSOA 2AP2A 3N1PC 5E23A 4XVJL 2XETA 4BEIA 5AOJA 1C9SA 2W59A 1UOVA 3NGBB 5KYWB 1NGYA 2FL5A 2DB8A 3MI6A 4J3OD 2EILB 1U41A 3ABGA 3JQOB 1WITA 2IAND 3KYKH 3GC3A 2A74A 4OJDH 4W9HC 1C5CL 3ESVF 3K46A 3MNZA 2R7EB 4QHUA 1MWAL 5AD0B 4NNYA 1SBSL 2VRKA 1P4LB 4OR1A 1Q1JL 2HVKA 3DO4A 3E6HA 2CD0A 3B9DA 3UGXA 4H20L 2O5ZL 1OHZA 1GGTA 1FIGH 1U30A 1GMIA 2A7BA 4U1LB 1HFUA 2PF6A 2XN0A 3RFZC 2IFGA 5E8OA 1A6VH 1JK8B 3KPNA 1B0GA 1NMBH 2V0AA 1KCBA 1GOHA 5GGRY 3RL2B 3DROB 3MGOA 3D4GA 1I82A 1YSOA 4ZO6A 5I1LB 2F74A 3V0AC 1L6XA 3GBNL 2X4RA 1TXKA 3GUFA 4UIMA 1AO7B 3SCMB 3D0VA 4JPKL 4UOJA 5GGVL 3SE8H 4AV5A 3EUDA 3EJTA 3P73A 4IRSC 4ODBD 4L4TD 1BQSA 5KSVB 3KPTA 1TIUA 4Z7NB 2WIIA 2ZT9C 4XC3L 1FUNA 3SOBH 1BIIB 5DVKA 3EXLA 4NKOB 4WWKC 2DQTH 1PZCA 3PWVB 1MZYA 4KJPC 2ADGB 2IDFA 1A5FL 3O3BA 4XAKE 5EBLA 5ENWA 4ANVA 1U3HB 2F8IA 1B0IA 2JJVA 1E67A 2L3BA 5D7IB 1AGDA 2L8AA 4PJIE 3CH8A 1OCRB 3ZDXB 2COQA 2D0HA 2ORBH 1RAMA 3QCTL 2NZIA 4CBPA 1XDTT 1EUUA 3I9IA 3T0AA 3CXDH 1PX8A 2AVGA 4QXUL 3AQZA 5B7MA 5GZOD 4QT5A 5ICYA 2IMMA 4FP8H 3U6RA 1QLRB 3BDYL 3WEMA 4BCZA 3SE9H 2X4SA 2NSMA 1NFDE 3CFUA 4Z5RA 3KGTA 3ECQA 4NC0B 1P2CB 2V9UA 2IDCA 2IPKB 4JG0L 2XVLA 5J89A 4HJSA 3ULVL 4ONOA 4OZGE 2YGPA 2J4WH 4ZTOH 3HTLX 5TDNA 3V55A 3VACA 1OAXH 5JZ7C 3CD4A 2EEFA 2BY0A 2AK1L 1TZGL 2AJSH 3TJPA 2C4FU 3S34L 2ROXA 2VZ3A 3DTUB 2WNWA 3Q2VA 3UC2A 2WW8A 4M8RA 5ICUA 5C6WH 4NKIH 4PTTA 4R2GD 1DQTA 4DFIA 5ACZA 1L9SA 3U0PA 3HUJA 2ISDA 2CDEA 3F6JA 5C08D 3FN0L 2W88A 5E6IA 1RL1A 2AGJH 2BVOA 2CR0A 2ICWI 1GIGL 4HK3J 5I8EB 3LB6D 3VJ6B 4LP5A 3RGVA 1LEKA 5K33A 3R0MA 1J9TA 1A3QA 1UKQA 1QLEL 3UIYA 3AXLA 4Z7UB 4FQJH 4YGAB 2VQ4A 1P7QD 3K72A 1RUKL 4PD4J 5DD0L 3LMJH 1E5AA 4PRNB 3F6IA 1A6UL 2QELA 2UZIH 1CVRA 4M7KH 5I18H 2BP8B 5BRZB 5DHDA 3U7YL 3FDWA 4ZZKA 1WCBA 4OGXH 1SMOA 3BSZA 2AQ3A 4XNBA 5JHAA 1V05A 5GJSH 1MCBA 3W0WE 3RU8L 2WHVA 1VADA 2J43A 2K6YA 2X2IA 4AY0A 1CFTB 4PV1C 3PWPA 1ZJBA 5A3ID 2EUZA 2NYZA 2OP4L 3NAAL 3NH7L 4MD5B 5EZIL 1P4UA 1JV5B 3ISYA 5L4FA 1ORQB 5K1JA 5D7LD 4L8CA 4XPBH 2VL5B 3RZCB 2XTJD 3GHBH 3O0RL 1CB4A 2XWCA 4JB9L 3VRIA 2FJGB 2BY2A 2NDFA 2NX5E 2X4OA 4PWKA 3EJJX 4E9VA 2OL3A 3SZ6A 2WKLA 1ZGLM 2BS71 5AVVB 1XGZA 1NCCH 4U4BA 3QJOA 4R7DA 1A0QH 1BZ9A 4KQ4H 4E0RA 3KM1A 2V9QA 1G7HB 2K78A 4DKFL 4ZYKB 3VI3E 5B7FA 4PY7B 2DLEA 4W4OA 3NDYE 5MEPB 4YSSA 3GSRB 5F8RC 1CTOA 2X4PB 3Q05A 3SBPA 3AMKA 4Q9QH 5DLML 3BMWA 5ECJE 5F7DA 2NY1D 3QIBD 4K7PH 4MAYB 2ICWB 2D0FA 4I8DA 1JPEA 4IKIA 2FR4A 2Z1PA 3OJDB 3RWIB 3U1QA 3WKPA 4FXGA 4H8QA 3O8XD 1IBGL 4CU8A 4M5TA 4BGLA 4QRPE 4FN0A 1EZLA 2WINB 4PJBF 5AB0A 4L5FH 2XPYA 3RY5A 2NMSA 4YS4A 3HN8A 1C12A 3Q8AA 3QUMB 5MEOA 3WSQL 5TE4H 2EEXA 4C56E 5E5RB 3DBXA 3AU0A 2CA3A 4ZZFA 4YDJA 2MKLC 4ODVL 3F7QA 2OR9H 2B08A 1E4XH 1OF2A 3KYKL 3IDUA 3HG0A 3TYFA 4C4UA 2ICEC 5HGBA 1JTOA 1G6RB 5JQIB 4NP9A 3KDMB 4QRTB 4LIQE 4Q74A 4R97B 5H37G 4JZOA 3HVDA 3D51A 2J1KA 2DWEA 4WHYG 1DQIA 4GB9A 1FIGL 2KYIA 3FQ1A 1S7TA 3NCEB 4JFYA 3SDDC 2EUVA 1MOEA 3LXCA 4FC3E 5HHVH 4PRBA 2Q6WA 1WE5A 1A6VL 1IM9B 1IGJA 1L7IL 3N04A 2IMNA 3PXHA 4ALAC 2CGRL 3V5KA 3OSVA 3PIQB 2DD8H 1GS6X 1NMBL 1QLFA 2JKSA 5E1AB 1NEUA 1PY4A 4QOKA 1EQWA 4OZFA 1MCHA 2ZXDA 2YXWA 2X9YA 1AD9B 2BP0B 5F9WB 2HFGH 1IBFA 2VT0A 3JWOC 4XNMB 3X14A 4EUPB 3KPQB 3MRDB 3F58L 4I85A 2BHZA 3PGFH 5E1IA 4P99A 4ZK8A 3SE8L 1K5WA 2IGLA 1MFNA 1VDGA 2ZXAA 4NZ8A 4GUPA 1WIUA 1AY1H 3O6FA 3H9SA 4PB0L 1UASA 3CXHJ 3CCHB 1SY6A 3WY2A 3CFJA 4NAJA 2YGVA 4KRPD 4WSGA 1NUDA 3Q6FA 2NY5C 1WH0A 2R15A 2HJFB 2UZXA 5TDOB 4HS8H 1RHHA 4W6XB 5I1CH 4TYUA 1PBYA 2ORBL 4QTFA 3RQ3A 5I1DA 1QWHA 3VFVB 4Q58C 1HZHH 4RISH 1N6VA 5D1XB 3FTYA 1KXTA 2RJMA 3V6OE 2N7SA 4G80A 2PWGA 3RIFK 2XC8A 3CVBA 1RP9A 2X5PA 5ISZD 1BVLB 3UTTA 3SE9L 4FXKC 4KY1L 4FFYA 5DXWA 5TF1H 2NTFA 3VFPA 1GC1H 1IAKB 3BH9A 1YRKA 5AYUH 2XJLA 2ZG3A 5J13B 3LQZA 1ES0B 1NCBL 1NJ9B 2YGOA 3VXUA 2PKDA 4N2HA 4ZTOL 2YA2A 3C6SB 1OAXL 3S4SA 5IBUG 4D7BA 3GSUA 4Q14A 2IGTA 4LP8A 2OSLB 2CPUA 5CIPB 4NBXB 3BN3B 4WWID 2VRAA 1P69B 4NKIL 4DO4A 3A5VA 3UTQA 1E28A 3OXRA 1T1ZB 3IJ8A 4DGYL 3UBXA 3BAXA 3QJRB 3O3EB 4FFTA 2DLGA 3TXAA 1LO0H 1MFEH 2DYRB 2AGJL 3HHRB 3QZWG 4EVNB 5KSAD 1OALA 5AEAA 1FGNL 4RAUA 2F9BT 1MRCH 5JXAH 1O6VA 3F6LA 4CSSA 2BVUA 3LZFH 1R3JA 3QUMH 4YGVB 4NJAH 2XZAL 4BWWA 2OMTA 4FQJL 4NZJA 3CZLA 5ADPH 4D3CH 2UZIL 4M7KL 4DVBA 2VN7A 3KPOA 4BK5A 3S9DB 1DVSA 2XQ0A 2DM4A 3D08A 3MTRA 1G6RH 2Y72A 2AQSA 1JF1A 1R4XA 3D3VA 5GJSL 3VFSA 1E9QB 4MA1B 3TZVA 2XQYK 2O6EA 2ZCLH 5E70A 4HOZA 1TTFA 2VABA 5I6MA 1CF1A 4OVVA 4OB5H 1FLRH 5DFAA 4XPBL 1CICD 4ZFGH 1A6TB 3GHBL 4UDTB 4PV9B 4WI0B 4AE0A 1GTFA 3QZLA 4MNQE 5E51A 5CD3B 4PRPE 1SQMA 4YFLI 2O61A 3HBZA 5FKPA 4JM2D 4CSPA 1ND0A 1P4IH 5KWYC 2VDMB 5F70A 2G5BB 5CZVL 1E43A 2ZKMX 3BLPX 4EUPH 2PCPB 3DXAA 3IBEA 4NRXA 1T2QL 1CR9H 2MNWA 2AXGB 3FJTA 3MLYL 3WJJC 3OJVC 2Y23A 2DKSA 1KFAL 1U8PA 4JKWA 4Q9QL 1GGUA 2HTKC 1UQSB 4K7PL 4PVMA 1PZDA 1HEHC 1MFBL 3CMOL 3FUIA 2G2RA 4NIKB 4P9ML 1CDYA 3JWOL 5EEVA 1H3GA 2CMRH 4L37B 2IQ9H 4MS6A 3CZKA 3AB0C 3BPOB 3FBQA 4ZUTA 3V7MA 2VWEC 4JFFD 3X2QB 1KLUB 1OP3K 2XBDA 1I8IA 4Y4FC 1DJIA 5JXED 5E9DE 4R97C 3SE6A 4L8BA 1J8HE 3WTUA 4YN3A 2WLIA 5TE4L 3CPLA 1DR9A 2H4EA 1F00I 5IMLA 2QVFB 1LO4H 4OLZH 4NS0A 4JY4B 2NY5L 3AFLA 1ZTMA 3A4FA 4J28A 1N59B 2A2QT 2OR9L 1E4XL 4I89A 4OCWH 2X09A 4M5YH 3RVWC 3ATBA 3CFEA 3ELAT 4GXUN 1WAEA 2VM9A 3TM6A 3W1ZA 4PJCA 3CN1A 4IM8A 3FQYA 2YPLE 4QHMA 3L9BA 1JXGA 2AFNA 3MROB 3ENEA 2OX5B 1LK2B 5T3ZH 1BXXA 3MNVB 5CIPH 4WW2C 1U58B 4KTYA 3EO0A 5EDXA 2FUQA 4Q4IA 3ZYZA 3CZUB 2QQQA 2DQJH 5GS0H 1T1YB 4QIRA 1KCVH 4U1JA 3QI9A 2OM5A 4QHKI 5EZJB 4G72B 3L3GB 4MXQC 3EYSH 2D3LA 2LU4A 4N2GA 3KXFB 5IV2A 4I2XE 1MCRA 1XT5A 4CW1B 4WI5A 4XP9H 4HMEA 3BP7B 2CU9A 3KGSA 4QKXB 4BDVB 4GAJL 1XZ0A 1TU2B 2D31A 4M3HA 4CMMB 1CQKA 1IGTB 2WXFA 4WSKA 3FSWA 1AY1L 3I6LE 4TNVK 3RZWA 5AAWA 3HI1A 3L3IA 1H6FA 5LBSL 4KDVA 5C0JB 5LB1A 2B9BA 2KLSA 4YHNA 1TEGA 2XA3A 3K8KA 4HLZG 4HLJA 4CA4A 2OSWA 1JCVA 2ENJA 1HSAA 2BK8A 3N1QC 2H2PD 3AT9A 4HS8L 3VXOA 2YUWA 5AG9A 3PDOB 2R56H 1IB5A 3STLB 1YEKH 4HP5A 2B2XH 5ESAA 2AJUL 1HZHL 1X5HA 5E5MA 3ARPA 4OW6A 2DL2A 4PJBE 4TNWK 2VLRE 4FX5A 2J8HA 1MSPA 1TEFA 3N2JA 2RACA 3QIUC 3QRBA 5I8CA 3KBPA 1IJ9A 2Z0UA 1P7BA 1PKQE 4L9LA 4JCWA 4FQXA 1J9QA 3R7QA 3VM5A 3TC9A 1D5ZA 5AYUL 2WUCH 5IMOB 3GJFA 4KUZH 4W70A 3BHBA 5DYOA 3FH5A 4RX4D 1KBPA 1B88A 2VDMH 3FBKA 3WE6A 4JRYB 4U2YA 1BX2B 3ARFA 2B4CC 4JDEB 3ZQXA 3QGVA 3D4ZA 3TFKD 2WCSA 2FX9H 3QC6X 4N0CD 4Y5VC 3TBS