3WY4A

Crystal structure of alpha-glucosidase mutant e271q in complex with maltose
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
535
structure length
535
Chain Sequence
b'NMMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLDNMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSRPENLDFLKDLRALMDEYPGTTTVGQIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEVASDLPVAHFTATRDGSTLTLPAYQAAFMQVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-glucosidase
molecule tags Hydrolase
source organism Halomonas sp. h11
publication title Structural analysis of the alpha-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism
pubmed doi rcsb
total genus 185
structure length 535
sequence length 535
chains with identical sequence B
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3wy4A03
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3wy4A02
2ZXAA 1E3ZA 1KBBA 1UH3A 1CGUA 1KCLA 3BVXA 1KGWA 3GXFA 4GQRA 3D51A 3TTSA 1VFOA 5BRQA 1UKSA 3GXTA 1BVZA 3BAKA 2E0PA 2NT1A 2G3NA 1CLVA 1V3JA 1J0JA 2F7QA 2YKKA 4PEEA 3H54A 3L4TA 4OGZA 4J3TA 3DHPA 4GI6A 2EO7A 4AW7A 3A23A 2VNCA 3A22A 3LRLA 5E0FA 3ZSSA 3S2CA 3LPPA 1QPKA 3K8MA 2ZUSA 1GJWA 1AQMA 1PIGA 3BLPX 3EDEA 2VRQA 4U2YA 1KCKA 1WPCA 4WSKA 2WVSA 4MAZA 3L4XA 4CVWA 1LWHA 3IJ9A 2YJQA 4HA1A 3EJRA 1UASA 1J0HA 2XVGA 3ZT6A 1HTYA 3A5VA 1M7XA 1KGUA 1Q4NX 2F7PA 1SMAA 2D3NA 2WVVB 1R7AA 1D3CA 3HJEA 3IJ7A 1O7DC 2WCSA 4FNUA 5A6LA 2Y24A 3VM7A 3HG5A 1WZLA 1TQSA 2E8ZA 2CHNA 2FH8A 3KL3A 3CZEA 2BHZA 3AMLA 1GVIA 1NOFA 2V3DA 3WMSA 2NSXA 1CGVA 1UD5A 2ZWYA 5E9AA 2DIJA 3WNOA 4DO6A 1JL8A 2G3MA 1CDGA 2ZX9A 3DHUA 3LXCA 4UZUA 5I5RA 1OT2A 2D0FA 3DC0A 2QPUA 3GXDA 2ZUTA 4J3UA 1EH9A 2FGZA 1XD0A 1KBKA 1JDCA 3EDDA 5C8BB 1C8QA 2E8YA 2WVUA 2YFOA 3WY3A 1D7FA 3EJSA 2ZX7A 3BLBA 3LRKA 3LX9A 1KGXA 2ALWA 1P6WA 3ZR5A 4J3VA 1JGIA 2WPGA 7TAAA 1XD1A 3L4WA 3CGTA 1ZJBA 1UA3A 5F7UA 4GKLA 2XWDA 1QWUA 1R75A 4FLSA 3KL5A 1CXHA 3BVWA 3CZSA 2BXZA 3H53A 1IZKA 2XN0A 4B9ZA 2QV4A 1UKTA 1H3GA 1JXKA 3ZT7A 4PCSA 4U31A 3BLKA 3BUDA 1KTBA 3VM5A 2C8NA 1G5AA 2F1BA 3CZGA 2EACA 1AVAA 3DX1A 4X0NA 1LWJA 2YFNA 1AMYA 3A24A 2AAAA 3BUIA 5A2BA 4LPCA 1CIUA 2QMKA 1Z32X 3BAWA 5BRPA 2GDVA 3UG4A 3WNMA 1G94A 3CZLA 1HX0A 1PEZA 1KWGA 2PWEA 4NXSA 2YA1A 2BY1A 3M07A 4BA0A 5A2AA 1JDDA 2FH6A 1PPIA 4OKDA 1CGXA 2OW6A 2VUYA 2XWEA 1KB3A 1HL8A 1HNYA 4FNQA 3EDKA 2FYVA 3LXBA 3LPOA 3TONA 5E6YA 5HXMA 2PWHA 2EQDA 2PWDA 2XIIA 3BAYA 4H8UA 3UERA 1UD2A 1XGZA 2VR5A 3QGVA 4AMXA 4H8VA 2BHUA 1CPUA 2Z1KA 4HP5A 4JFWA 3II1A 1G9HA 1PZ3A 1UH2A 3UG3A 3DDGA 3WFZA 1XH1A 2VRKA 4JCMA 1QW8A 4LXFA 1CGTA 3VGGA 1TQWA 2Y4SA 3BAIA 4FNPA 2ZE0A 3BUPA 4LQ1A 3IJ8A 1R33A 3EDFA 4UCFA 1B0IA 4FLRA 2WSPA 2WVTA 5CGMA 5CGTA 2DIEA 3HZ3A 1HXKA 1JD9A 3CPUA 5CLWA 1UKQA 1BG9A 1PZ2A 3FW6A 3BAJA 1EHAA 1UA7A 2Y2WA 2FHCA 1XSIA 2C7FA 6CGTA 2BXYA 3WNPA 3RILA 1ZJAA 3WY4A 1TMQA 2EADA 3BC9A 2DH3A 1CXFA 3WNKA 1CXLA 3L4ZA 3VGFA 2ZX8A 1IV8A 3DX2A 1R46A 4PSRA 1CYGA 2QLYA 3GXNA 1BPLB 1CXEA 5A2CA 2PWGA 4NXKA 4UQAA 1VIWA 3BSHA 3BMVA 1J0KA 2OSYA 3BSGA 2IGTA 1V3KA 2BY3A 1MXGA 3L4YA 1OSEA 2NT0A 2D73A 2FE0A 1JF6A 4XB3A 3WN6A 4AYGA 2TAAA 2BY2A 3H55A 1VB9A 4M8UA 4CN4A 4CN1A 3BH4A 4J27A 1BAGA 1QHOA 2BHYA 1KXVA 4JFUA 3VMPA 4NZJA 3VMNA 3K8LA 1RP9A 4UNIA 2OYLA 3VMOA 3WEOA 1TQTA 1QWNA 7CGTA 1B2YA 1TQVA 1UD4A 1WP6A 2FHBA 2F2HA 3BVVA 3WNNA 2WKGA 2XVKA 3DX4A 2WANA 3AJ7A 1VAHA 6TAAA 3VGDA 3WDJA 2GDUA 3VU2A 3OLIA 4JFVA 1V3LA 2F7RA 1NM9A 2XIBA 2E9BA 2OYMA 3EJUA 1JG9A 2AMGA 1MW0A 3WDIA 3W38A 2ZXQA 3WDHA 3BCFA 2DH2A 2X2IA 4AMWA 1XCXA 3EDJA 1R34A 2CXGA 1KWKA 1MFUA 1DEDA 3BCDA 4E2OA 2WNWA 2D0HA 1J0IA 3UEQA 1T0OA 4W93A 3AMKA 3CV5A 1JAEA 3MI6A 2WC7A 3KWXA 4JFSA 1MFVA 1TCMA 1E40A 1HL9A 5A6MA 5HDRA 2XVLA 3L4VA 3GTNA 2CPUA 2F1AA 4OJYA 3K8KA 1HVXA 4UQ9A 5E6ZA 1I75A 1RPKA 1JIBA 3HG3A 3LXAA 1HWWA 1JDAA 2VT0A 3GXIA 1L0PA 3CZNA 4H2CA 3ZOAA 1BLIA 3D50A 4BZYA 1XSJA 4FMVA 1JI1A 3HG4A 1E43A 3EJTA 3VNZA 4MB1A 3BUBA 5DFAA 2D0GA 2ZUVA 3DDFA 4J3SA 2BY0A 3D4YA 3ECQA 1M53A 1CXIA 4NZFA 3S5YA 1QI4A 1E3XA 1EO5A 4PCTA 1Y7VA 1MW3A 5E70A 3D52A 2EEXA 3WY1A 2WCGA 2ZWZA 2ZICA 4H7VA 1CGYA 2ZXBA 4TVUA 3WENA 3WNLA 4FNSA 1UH4A 3OLDA 1QI3A 3DX0A 1MW2A 2F61A 4JL1A 3WELA 4J3WA 2X2JA 5I24A 3VGBA 3WEMA 1QW9A 2QPSA 3BAXA 1V3MA 4NX0A 2X2HA 3VX1A 4JL2A 4WLCA 3HG2A 1CXKA 2V3FA 1MXDA 1UOKA 2Y5EA 1DTUA 3KLLA 4J7RA 1HT6A 4GI9A 2OW7A 5CLTA 5E1QA 3EJPA 4J3XA 3A21A 3BVTA 4UQCA 2GJRA 4GIAA 2GJPA 4H8HA 3A47A 3EJQA 3BVUA 3BUQA 2EAEA 3KEHA 3CZKA 3VSVA 1XSKA 4HPHA 4PSPA 4AIEA 4U33A 1ODUA 5I23A 3WY2A 3S5ZA 5CXPA 2WSKA 2WVVA 2OYKA 1U2YA 2ZX5A 4FLQA 4GQQA 1VJSA 3CC1A 4UOQA 1BF2A 1UD3A 1VFUA 4U2ZA 5DO8A 1QI5A 1PAMA 4GO9A 1OT1A 1XCWA 1ZS2A 1SZNA 3OLGA 3TV8A 4X9YA 3L2MA 3BMWA 5I0DA 1JXJA 3K1DA 1MWOA 4KWUA 3VSUA 3D4ZA 2F18A 1R47A 1PJ9A 4QAWA 1U33A 2XN1A 1MVYA 2QMJA 3VX0A 1W9XA 3ZR6A 1EO7A 3CTTA 2YA0A 3ZO9A 4JCLA 1EA9C 1U30A 1GJUA 2ZUWA 4M56A 3FAWA 4B9YA 4AIOA 8CGTA 3AXHA 3DX3A 4FLOA 1KXTA 3IGUA 3IK2A 1QHPA 4CKQA 1KXHA 1PS3A 3LRMA 1WZMA 1WZKA 4U3CA 3GBDA 3GXMA 3VGHA 3VO0A 4DO4A 4WF7A 3FAXA 1RP8A 2ZXDA 4CGTA 4GO8A 1MW1A 2XN2A 3UCQA 2EJ1A 2ZIDA 1G1YA 2WKLA 1A47A 1PIFA 3GXPA 1QX1A 3ZT5A 4NI3A 4GINA 1BVNP 4WSJA 3L2LA 2D2OA 2GUYA 3ZQ9A 1KXQA 3UG5A 2YIHA 5KEZA 3VNYA 4ATWA 3OLEA 4UOZA 2GVYA 2ZX6A 2EABA 1UD8A 4FNRA 2OSWA 9CGTA 4HOXA 1S46A 4FNTA 3VGEA 4AEFA 3KE0A 5EMYA 4CN6A 1IZJA 2YA2A 1CGWA 1XH2A 2F7OA 4UZSA 1JD7A 4UQDA 1UD6A 3ZSTA 3CLWA 4HOWA 3KL0A 4AYSA 1TQUA 3VSTA 4UQBA 4DO5A 1XV8A 1OGSA 1WO2A 2J25A 3L4UA 3KLKA 1GCYA 1KTCA 1SMDA 4KMQA 5TD4A 3TOPA 1JFHA 2D3LA 1DHKA 2E4TA 1WZAA 3W37A 1BSIA 2YOCA 4J28A 1OB0A 2OSXA 4AEEA 2PWFA 3GBEA 1AQHA 1WE5A 2ZUUA 4UQEA 2FHFA 3A4AA 3TTYA 3RIKA 1VFMA 3A6OA 4JFTA 2V3EA 5HPOA 4OIFA 1JF5A 3AXIA 1XH0A 4GI8A 4HOZA 1JI2A
chains in the Genus database with same CATH superfamily
3MO1A 1E3ZA 1IEBB 1LEGB 2EDHA 2PKDA 1NFDF 4AM0Q 3DYPA 4UILH 1HL4A 4TTGA 1VFOA 3GXTA 2XY2A 4CMMB 2E0PA 3AY2A 2DQEL 1C5BH 5IK3A 1CF8L 2VH5L 5GGTH 3RGVD 4GI6A 5JXEA 3A23A 3ROOB 1NFIA 4BK4A 4GKSA 1AD9B 1ZGLB 4WHYH 3SBQA 3Q1EA 4RBPK 3UC2A 4MNQA 4WI9A 4YBQD 3FTGA 1ZIAA 1TSRA 3O0RH 3OKDB 3SDYL 1P1VA 1I3GH 1JZGA 1U8PB 3VWKB 4B9PA 3FUHA 3BGMB 5AAWA 4Z8FL 1BWWA 2P9RA 3N2JA 2QKIB 3TJHC 3JWNE 1ZLUK 4UM8B 5DUBB 3GPEA 3ZE1F 1NEZA 4XVSL 5DQJA 1AGFB 5CN1A 4K7PH 4L5FL 4ALAH 4Y2NA 1PSKL 3SGKC 3D0LB 1SMAA 5F97E 3FCTB 4YIQB 3JQOB 4JQXA 3C6SB 2JJTA 5JO5B 43CAA 5LCVA 3C60B 1KGJA 4M1CD 4MMZB 4AENA 2MCMA 1TVHA 1U2CA 1WISA 3TYGH 1G9NL 1XZ0B 4LCVA 4I9WE 1BDYA 2CHNA 2FH8A 5DT1H 4CUCA 2GI0A 2QVTA 5KYNA 1GVIA 3CFQA 3H9SA 2BIQA 3F05A 2PPEA 4L8BA 2WLNA 4B27A 3LZRA 2GTWB 4KZDH 3MRFB 2CLVA 3DGGB 1KN4H 2J43A 5T1MB 4TQHA 5D7JD 3LV3B 4ODWA 3N85L 5TPWH 3LKQA 4P9HL 2AKRA 2P28B 3MNVB 2NX5A 2ZUTA 1WICA 2IANE 1BEXA 4X5PA 4B53A 4P46B 4HCFA 1T0MB 3AQXA 3FSVA 1CD0A 4N6RA 2BIMA 1JV2A 4S1SL 1E5AA 2YD3A 1CJYA 1H3PL 4HF5H 3CZJA 5F7UA 4NB7A 4PYHA 2DLFH 2MH4A 4M6MH 3MV9D 3DGCR 4FLSA 4MMZA 4N2GA 3VXOA 3K2UL 4MA8L 4DAGL 2UX6A 3MOAL 3ARFD 3C60A 3C8KA 1DBKL 3EOTL 3E9UA 3OL2A 4GP4B 1IAKA 3H9SE 3F5WB 3IU4H 1IAOB 2A9NH 4L9DA 4H0LC 3NFPB 5F8QC 2Z9TA 4B9ZA 3LQMA 1JGLH 3VVVA 5A7EA 1OAYL 3MYJB 3QUZA 4K9EH 2BVOB 5KSAA 2P8MB 4LEOB 2RMNA 1NEZB 3T65A 2CMRH 5FGSA 5C0AD 3BUDA 5TPWL 3T6XA 1R5WB 2C8NA 5EULV 5GRUL 3ZYIA 1NM4A 4PREA 4MD4A 2IANA 4PPTA 2YD1A 3K3QA 4ZPTA 5KWYC 4A68A 5T1KA 1N64L 5D5MB 5C0DA 3K4AA 4G5AA 3CAFA 2XJKA 2DM3A 1S9XA 5DJAB 4F91B 3OF6A 1Z32X 1GR7A 1AQ8A 3CNKA 3PIQA 4PJIA 4AVIA 2GT9A 4HT1L 2ZSWA 4A37A 1BD2E 2BY1A 2CDGB 4JCWA 4XPBH 3S34H 1P69B 4URTB 3AXLB 3D18B 3QW9A 5I1AB 1ZLDA 4V1DB 3VWJC 1G43A 4PRIB 2Q8AH 5IKCB 4OCSH 3NCFB 2N1KA 3JZYA 3ARDB 4RQQB 3DYMA 1UURA 3TA3C 2CCVA 3LQAL 5E2JA 3KD4A 2C4FU 1E8YA 5ID1B 1U8NB 2LU5A 3BT2L 3MOBH 1Z7JA 5E94A 1ORSB 5BW7A 1MQ8A 2O5XL 3DGGA 4ZOEA 4HZLB 3GMRB 4UBDD 3BO8B 4OJEH 1S5IL 4P9HC 4I13B 2NSQA 4M6NH 5IB5B 5K9KB 4ALAC 1KXVC 4ZTOL 2WBJD 4XN5A 5HJ3B 3LNHA 3I85A 1HH6A 3R7QA 1CDJA 1O0VA 5LAXB 5IOPA 1EV2E 4EN3D 1R33A 1U93A 1ACZA 3LYRA 1A3RL 1Q9WB 5HHXH 4LLQA 3Q6GL 4BHUA 4S0SD 3WIIH 4MAUH 1R7AA 3IFOA 3MV8B 3TBYA 3Q8CA 4JVPA 4PGJA 4A04A 3NFSH 1WA2X 3FB6B 3QWOA 2COVD 4TSAH 4RNRB 3WFDH 4PY8I 4OJCA 1U8IB 2A0LD 4MNHA 5DJ0A 4OUUA 2QVMA 3U4BH 5EUKB 1AZUA 4KRPC 4RFNB 2DLEA 4HMCA 1KJMA 1YJDL 3BH9A 3GIZL 3IETA 3MRGA 3RI5F 5I1CL 3CBRA 2IGTA 3IMTA 5EU5B 4XAWL 4YUEH 3IDJA 2FE0A 3D06A 1AHWA 3BP5A 4G42B 5HHVH 1K2DA 1LEGA 4M8UA 3R1GL 4CN1A 2F19H 4J27A 1T1XA 4WUUA 2VOTA 3L3JB 1KPUB 2LV4A 4LSQH 5KVGE 1M2VA 2WD0A 3QI9A 2ZKXA 4Z77B 4Y7OC 4WQOA 1R1CA 4ZX4A 4HWNA 1JXDA 4LCWB 5IQ7L 1QWNA 4O4YH 3ZE2E 4HF5L 3HBZA 1HZKA 2IGFH 3B3BA 3S37L 2W92A 1NGYA 3C09B 2WKGA 2XVKA 3H0TB 2J1ZA 2ZXEB 1DQML 1HK6A 3RVVD 3N1GC 1P53A 4JO4L 2X0UA 4NZUH 5HI3C 3N0PB 4ZMVA 3FQ2A 3G08B 3QCVH 3U1SL 3QIUA 4XI5D 3R18A 1QEWB 2HRHA 4ZQTA 4IRSC 3H3PH 3RVWC 5AAMC 1KELH 2MHAB 1R34A 1BBJB 4YSEA 4DKEL 3ILPA 4YE4L 2HZHA 5DJ6B 1CTOA 3BCDA 2P49B 4KNQA 1TFHA 2VABB 4WO0A 3VXNA 2YC1B 4K7FB 1BZOA 3AG2B 4J4PD 3IWVA 1UUSA 4FQ2H 3BPOB 4ONFH 4BINA 3L6FA 1RAMA 5MP6L 2J20A 4XCFH 2Y23A 1FO0L 1HL9A 3FO2A 1IFHL 1OM9A 2RH0A 3H2PA 3OKKB 1A25A 2LW3A 4N8CH 5EBWB 1AGBA 5ESQB 5C2UB 1QFWM 2YD5A 2HKHH 4JZJA 3D9AH 2DKUA 3LXAA 1Z3GL 1E9QA 1FYHB 4FA6A 2AF2A 1KF9B 2MNUA 4H2CA 3HZKB 1TZIA 1QHQA 2VDOL 1A6AB 1BIIB 3OR6A 5IEKA 5EEXA 4FQXA 3VNZA 5DYFA 4MB1A 1MIMH 3U46B 5KVFH 3GSNL 3ZKXB 2PMZA 2DOCA 1QVOA 3REWA 1VEOA 1EO5A 4HWBH 4B5EA 1AO7D 4AGQA 3KPOB 1IB5A 2ENPA 2V9UA 2Q7YB 2DEXX 3D52A 1ZLWH 4N0RA 1NGWB 3SDXA 2ZWZA 3B7SA 2WLLB 4NQCD 4QHLA 4WV1B 3MJ7A 4UNUA 5FM8A 5I30H 1ITBB 1SYVB 4QIRA 2LAAA 3OLDA 1P9MC 5AD0B 2KZWA 1A4JB 3GJFK 4Y19A 5FUOH 1WDAA 1FZJB 4Q56A 3KPNA 3F6LA 1QTSA 3VI3B 2W9LA 4W9FC 4IJ3C 2EYSB 3AB0C 1S6NA 1ZVNA 2HTKD 3QHFH 4ENZA 4BFIB 3F04A 1L6ZA 4M43L 2D3JA 2QGBA 4X6DB 4RISL 1KG0A 1TTFA 4AM0A 4AJWA 4IBYA 1C5CH 3AB0B 2BIHA 3CHOA 4MXWL 2VXQH 5JMOC 3HNTH 5I1KL 5IFAH 2W1NA 5JTWA 4NQDD 2IFFL 5T3ZE 3QIBA 4W9JC 5GPRA 4ODXB 5J6GB 5F7KC 3NZSA 5H2BA 1NQBA 3GMOA 3VRJB 3A6BH 3I84A 1FAKT 4ZW8A 4FA8A 5D70H 5GRJH 4O58L 5CD5C 3QRFM 1NBQA 2K0RA 1G7LA 1RIUL 3LIZA 3TF7C 4MJ6A 4P23A 2Z0BA 4BH7B 4JNXA 1JPSL 4P5KA 4NQEA 3CFJA 3AREA 1VFUA 1Q9KB 1TZ8A 4XN8A 1PNDA 1WLHA 1GJIA 1PAMA 4XO5A 1YAZA 1ZS2A 1KCWA 1SZNA 4AGNA 4X9YA 1UXSA 1S9VB 3E2HB 3ZKSD 5H37A 5I0DA 3K1DA 1JGDA 2A74C 1C9SA 1C1EH 3JTSA 4JRWA 4WVRA 4QUOA 1E4WH 4BZ2H 4CRPA 4MWFA 2EDRA 4X98A 4AKQA 1W9XA 2FYYB 3CC5B 2MTPA 3SPVB 5AZEH 3ZO9A 3U48A 1EA9C 1SVZA 3MXWL 1YEIH 3GBLA 5CP7A 5DWPA 3I50H 1IKNC 3PQYD 4G9FD 5DEZA 1I8KB 4QRTB 4HIEA 4UT6A 3Q06A 4G5ZL 2W8CA 2IC2A 4DCQB 3H9YA 1E30A 1RIUH 4PJAF 3B9VA 3OTTA 5B39B 1FFNB 1H8NA 2YPLD 4NC0B 1KV7A 4NZRH 1CFSB 4QRRB 1OGTB 3MLRL 5MEQA 4NKMB 4Q8BA 4KGJA 4XO4A 4RFOL 2ZIDA 1G1YA 3C60D 4KQ3L 1ZA3A 5FCUH 2GJZB 2BWQA 4I3SH 3L2LA 3KPSB 1FNGA 4PGBB 1LEIB 3D07A 3STZA 1RZKL 3UJJL 2VAAB 3FU7B 3CFEB 4XCCH 3TVMC 3TYFA 4H20L 2X3BA 1YPZF 3N9GL 3C75A 4PGCA 1A66A 4X6EA 1CLCA 4NQSA 2VISB 2HVJA 1O6VA 4G7RB 1CR9L 4TNGA 4M93B 4XN9A 4OIBA 1MCQA 1Q1JL 4L37B 4UZSA 4JZNB 4DOHB 5IQ9B 4P2RA 4JKPL 3PREA 3CLWA 3Q3GA 1F3JB 3KL0A 2PNDA 4LEXH 3QNZB 4XHQA 4LPXA 3LNIA 3V5HB 5I15H 4YHML 1VEPA 3S35L 3VXSB 4DO5A 1HIMH 4UU9B 5EFIA 4YEEA 1CD8A 4P07A 3NIDF 1EEQA 4I3SL 4NKMA 4LARH 2VTFA 5A43C 4IRZA 2AGJL 2R59A 4OR1A 5AW6B 1MELA 4WWKA 4MQXD 1JZIA 4MNGB 4U3HA 4PI2A 2JCCA 3GBEA 5JXED 4QTIH 2ZNXA 1BVLA 5IMOB 2JJTC 3BPCB 2WBJA 1H0DB 1JV5A 2IQAA 5D7LA 5AB1A 5C0ND 4ZO6A 1BZ8A 2AJYH 4GI8A 2QKIC 2FL5A 3V6ZB 1WT5A 2J1KA 2AJXL 1IM3A 1B0RB 2AQQA 4KFMA 5LXGL 1UH3A 2J12B 2WQXA 4NUQA 4Z78B 1XL4A 5AB2A 1D7CA 1UKSA 5IQNA 3SCMD 2GI7A 1F4HA 1UXSB 3BDYL 4GEJA 2AXJA 1X5AA 4JZNA 2FEJA 4N3UA 3ZSSA 5JOPD 2CR0A 4ZFOB 5C7XH 1GMEA 4FXGB 3EO9L 4AQZA 2G60L 1UATA 1TYEB 4XMPH 4NPJA 1QLRA 3SPJA 4A2EA 1UM4L 2DL2A 3FQXA 3LHPL 4KNUA 2I9TA 4XXWA 2B59A 3BVNB 3STZB 2J8OA 4U6HB 1EWHA 5C0AB 3QIBB 3ARBA 3O9WD 3QYCA 1EUUA 4G9DA 4LSVL 1HJCA 1X5KA 5DVNA 1YEFH 2CM5A 4F93B 1M7XA 4OAWB 3DIVA 3IMUA 1IIKA 4WIQA 4WI5A 3ZTCC 3LDBC 1GGTA 4YPGA 4IM8A 4QOKE 1JWUB 4HMDA 5EU3A 5E5UB 1O9ZA 3QUZC 3DURA 5DRXA 5F7YC 1O9WA 4LVOC 4LLMA 1NCOA 2EC9U 5JQ6L 3AMLA 4X80L 1UWYA 1D5BA 4U1GC 4G8GB 5CP7B 1RPUA 2MPAH 1A4JA 3B2XA 2R27A 3QEHA 5C2BL 4TTDC 5IJVB 2VC2H 3F7LA 1LQSR 1NJ9A 4PD4K 4XMVA 3LH2L 3W82A 4ZX3A 1MDTA 3MJ7B 5DWUL 2CKBB 3NVQA 4Q52A 4L8DB 4BA8A 2WLLA 3QA3B 1WVZA 1RH8A 3WUWG 4HULB 4GXUN 4KJWD 4KY1L 3VTAA 1R3IH 2V5RA 4NFDA 4QRSB 3IJHB 4Q4IA 4BKLB 5L2KA 3CVBA 3WFHA 1EJ6A 4FQXB 1QNZL 3MUGA 2CUIA 5T3ZH 3UAEA 4NP4H 1T3FA 1R3LA 4WHTA 4CNIB 3II2A 5E8EA 3GPSA 4PJCB 1E4XH 3CSBA 4Q7DA 3AGVA 4S1QL 4BFJA 1A6ZB 1EEZB 4WTZA 2XN0A 1XIWD 1NMCC 1MHEA 2COQA 2PR4H 2DJSA 3VFPB 3JVGC 4NQCE 3V4PB 4GAJL 4KKAC 4LCCC 2X89D 5L88H 5AVWB 1P5VB 2F53D 1KTBA 4XBGA 1EVUA 4UYPA 1CE1L 2LLGA 2MCPH 5DUJA 3OPZH 5E2WH 2EDLA 1LWJA 1OP5K 4PS3A 3RWFB 4W81A 5FDWB 1FO0H 4OQ1A 5CZXD 1CVRA 2YC1A 3QDHA 5F1NB 2BM3A 1FHGA 3BUIA 3SN6N 4PJFE 5KJRL 2N3JA 1XH3A 4WSGA 3MV9B 4EI0A 1F2QA 3WNMA 1UA6L 1ND0A 2A9CA 3MDJA 4PWJA 4DN4L 5L2KE 1BBJA 5IFJA 4I1PA 3QZWB 1BHGA 5JQIB 5HYFA 1XSOA 3V7AE 2EDYA 2FH6A 3GB7B 4KDVA 3FN3A 4AGPA 2XWEA 3BD3A 5DLML 5DQ9B 1T2XA 1D2PA 1IU1A 3QHZL 4FTVE 3ZDYE 4HPOH 1UEMA 5CKGA 4Z3EA 3QRBA 3SDXB 3NGBB 3LN5B 1JZFA 4JG5A 3FQ1A 1P4LA 2R29A 4GAJH 1RK0A 2XDHA 4FEIA 3T8MA 3QGVA 4UDTA 3S36H 1VHPA 1IGTB 1CPUA 4FQQB 2BMKA 4PW3A 4N0UA 5D7IE 4I4WB 3DDGA 3IVKA 3WIHL 1XH1A 4UQ2B 4Z7UE 4JCMA 4UOJA 2V5SA 2H2PD 1OK8A 4J6IA 1TQWA 3ETBF 2QFPA 4WJKB 2ZE0A 1OM3L 3D3VD 2GSIA 2VZ3A 5HYSB 3PYCA 4QXGH 1Z5LA 1B0IA 4OLUL 3C08H 1BJMA 5CGMA 4L2LA 5EEWA 4G7VH 2X4QB 1X4ZA 2E9IA 4AGLA 2XTJB 2YZ1A 2VDQB 5F1SA 4L29A 5KTEL 4N2KA 4OVVA 4LMQI 3X3FH 4CJ0A 5JW5A 1R3JA 2A5UA 2NZ9D 4LSSH 4IU3A 1QFOA 1P7KA 3GIVB 2XJLA 2WXPA 4O58H 4FE9A 4ZX6A 3STLB 4MA1C 1ZV2A 3SYOA 1BPLB 1UEYA 1KCSH 2VL5B 3HG1D 3V0GA 5B38B 5AWNH 2GG1A 4Y4FB 1NL0L 1MFBH 1SXAA 4DKFH 3DETC 5CP3A 2BMKB 4TYUA 1E9OA 4PAZA 4MGXA 4B41A 1OAZH 3V6OA 3K6SA 4AV5A 1CDHA 1QHOA 1S7SB 4G8GE 3GMLA 1I1YA 4RAVA 5I66A 5F7EH 3Q8BA 3HHSA 1NLDL 4G8EA 3ULUH 3UEZA 5DVLA 1DBAL 2NY1C 5IW6A 3E8VA 1OGAB 4HJUA 3TCTA 1X5HA 4PBDA 2R29H 3EYUL 3DMMA 3M1CA 5ANME 1OPGH 5F7FA 5H4ZA 5DQDL 1D5IH 4XPTL 2B1AH 3QCTH 1Z9MA 1IM9B 3GMQB 1J5OH 2APVA 5JIIA 4GUOA 1WBXB 2IF7A 3NCCB 4JO5A 4F33A 1DDHB 1UACL 3WE1A 4P5TA 5I1JH 4JFVA 3FMGH 5FDWA 3IDJB 3P9MA 4ANXA 1OL0A 3EJUA 3NA4A 4V1DA 2DLIA 4GG6B 4NCC1 4A7UA 1SHMA 3AXLA 4E41D 2OAAA 2D2CC 2Y07L 2EDFA 2VLKD 3HUJF 3NP4A 4D7PA 1XGYL 1TTAA 5SWSD 3IWUA 4TNWF 1JSYA 2L7QA 4KZ0A 2RJMA 1ET8A 4L0YA 2R7EB 1A6ZA 4W68A 5EU6A 3NZHH 1S9XB 4JRXE 4Q6KA 4UB0L 5DJAA 2X6AA 3T3PF 4WTZG 5GGRA 2B39A 1AQKL 1QWHA 1RSYA 5IB3B 2EC8A 4NKOB 4ZW6A 3O3EB 1B4RA 3HRZB 3CK0L 1ZA6A 4PREB 3L3DA 4YE0A 4JM2F 3RA7L 5CFHA 1KXTB 4ZUUA 5KZCD 1KPRB 1F0LA 1E40A 3SDCD 1X5LA 4HCRL 1INQA 3ZE1E 4YGVA 2WO4A 3O3DB 4WI0B 1LO3L 2VSCA 3CSYB 2HCZX 3B5GA 3G6DH 4O2FB 5DDHA 5KSBA 1RPKA 5J12B 1D5RA 1E8ZA 4Z5RA 1ECZA 4OF7A 5CP3H 4NQUA 3A4DA 1LK2B 4H26B 2EH8H 5HJ3A 3HLAA 3PGCB 4HD9A 4AJYV 3DHJA 3PCYA 4PB0H 5K9KA 1I8IB 4BQ6A 4AYDC 2F8VA 2HG0A 5CHNA 2B1HH 3VD9A 5IBTL 5D72L 4JRXA 4L1DA 4P46A 3WLBB 2H6UA 1KTJA 4LLMB 4NBYB 2EEXA 1W8NA 2P46B 4GAAA 4ELMB 4DVRL 3Q8EA 3TZVA 1ZHNA 4POUB 4R4ND 4G8GD 2MTAA 1I9IL 2AKRB 4FJ6A 2MCG1 2NNRA 1QR4A 3X11B 3LIUA 4FNSA 5C09D 1BMGA 4A2GA 5DC0A 1QFWL 3M17A 1R3HA 1SY6H 3O8XD 1EZUA 3KS0J 4GRMA 4OBSA 2G75B 3VGBA 5IMKB 1MJUL 1UWGH 4NX0A 3ZZ1A 2K9FB 4P2OA 2BSTA 4Q9RH 3GI8H 1YNLL 2BP8B 1I9JH 3X13A 5C71A 4B3VA 5T1KB 1HHIA 1WEJL 3KLLA 4FXGA 3UPAA 4A39A 1R5WA 1S7TA 2DTSA 4XTRD 4GIAA 4LEOA 1NIBA 3T65B 1YYMH 3WO4B 4QXUH 3QEQB 1A6VL 2CA4A 4XO9A 2GIYA 1MCSA 6PAZA 4OV5B 3I6LE 2BSCA 3GI9H 2MIZA 5I6KA 1S7WB 4JGMA 2FT7A 3ME0B 2VM4A 3AWFA 1QA9A 2O6PA 4U6XA 1XGTB 3SE9H 2YMTA 4UTAH 3ARXA 5GJSH 1AD9A 1G7IB 2J88H 4G3YH 1AXSB 1BZEA 2FZ3B 1ZGLA 5LGHL 3CUPA 5A7BA 4F57L 4FQIL 5MEPA 4HCRA 4WAFA 5BRZB 4GMTH 3FUIA 4FQLH 1OTUC 3OLGA 3SPIA 3UDWC 4Y5XA 2PW2B 4M61B 5EO0B 3V4LA 3NN8B 2N0MA 2KMWA 4HUWB 5DMKB 1KC5L 3NH7L 4G7QB 1U92A 5DJZA 2XWJA 2CRZA 3ZQWA 3REVA 1E42A 4B3EA 3DROA 2FQEA 2Z91B 2OMZA 1ZLVH 4O9HL 1F41A 4RDBA 3VXSA 1GJUA 2P5ED 4EUPB 3QJVB 3V5HA 2MWCA 3ERXA 1S9YB 4ZK8A 1I85A 4JAMB 2FJUB 1ZV9A 3MV7D 1AC6A 1JNLH 1SLXA 1XZ0A 3LRMA 1WZMA 1I1AB 2AMUA 5TH2B 5L4JA 3ELQA 1F4YH 3NCXA 4FQIH 4X8JA 2C3XA 1KN2H 4K8RD 1T7ZA 2MOQA 1MHPH 3GRGA 4I8DA 2WB7A 4YSTA 1U36A 1YG9A 4IRJC 1AQDB 5C09E 5D7EA 4NZ8A 3U1PA 4U1IA 2XV6B 4OCXH 1XGRA 4EDWL 1AJ7H 3TN0A 3SDXE 3MR9A 3PDDA 4PLKC 3WIHA 4MMXB 4JQVA 4LOFA 2XXMB 3W9EB 3VXSE 4DGUA 2QEJA 4YK4B 1YMHA 3VG0L 2OSWA 1JGEA 1NCCL 2AK1L 3W0WE 3IF1B 1QUPA 3AS2A 1P4IH 1YHPA 1GZPA 1B9KA 3KPMB 4K73A 5KJRH 3LEVH 4D3CH 2QELA 3BW9A 1AIZA 3ZKND 3ZYJA 4DN4H 3ZSTA 2VDMH 2X41A 4ZQKA 3WEXA 3E6FB 4PJBE 1LO0L 4UIKL 5IHWA 5EPMB 3UL4A 1U91A 12E8L 4LVHC 3VW3H 5ERWB 3VSTA 1DANT 3BP7B 4KV5F 1E5UI 1M1XB 1S7XB 3U6XS 1I9IH 1IGCL 4DGYL 1IC0A 4DP7X 4XXWC 4KJQD 2HFEA 3ARFB 3CHXA 5EN2A 4FJYA 4LSRH 1F3RB 1W0YT 3A6CL 3NIDB 1FG2A 2N4IA 4MBRA 5TD4A 3RJDA 3UAAA 4F8PA 5L4FA 4J28A 2HKFL 2ITDA 5I15L 2QSVA 1LNUA 5C08D 2EDWA 2R2BB 1ZLSL 1F6LL 4JDEA 4IBVA 1S5HA 3GI8L 3L5WA 5KG9A 4HUNB 2E7HA 1NCCH 2ILLA 3L3GA 2HFTA 2NCEA 4TM9A 1P5UC 5FGBA 2JB5H 2Z31A 4JUSA 3DX6A 5SWZE 1W72A 3FNKA 1CGUA 3EO1B 3LNEA 2YSTA 4G80B 3EBHA 3GXUB 1OM3H 2F74A 4TSBL 4RWYL 1T1ZA 5FB8A 5H2BB 2X88A 4WEUD 1F4XH 2A9DA 3IPEA 2ICEC 1A6WL 3GHEH 1NDTA 2R1XB 1G9ML 3MOAH 3RHWF 4IMKA 1QTPA 1FNHA 1RSFA 2FWSA 3CFDA 2O5NA 4KJPC 2EDTA 4HFUL 3DHMA 3TS8A 1WPCA 1TT6A 3H9ZA 5B39G 4PWFA 2VIRA 1BX2A 3A0OA 4WSKA 4Q14A 2FUTA 4WO4A 1UCBH 3N41B 3BWZA 5DJ8B 3BZEB 1ORQB 3ZY7A 1A6TB 1Q4NX 4MRBA 3JUYA 1F4WH 4IU2B 2GJ6E 1U8HB 2A6DA 1GYWA 2WTPA 3UPCA 3NPSB 5I6LA 5MEOA 1WFUA 1CFVH 3CZEA 1VFBB 5CEZE 2K4AA 3UP6A 1TVDA 3B8YA 4KTEL 4L8SB 1NOFA 2V3DA 4KKCD 3BH8A 3UX9B 1W6LA 1A6AA 3HW7A 2I27N 3MRPA 2Y25A 4RGMB 1UB5B 1IC4L 1XD0A 1JP5A 3RWDB 1DVQA 2JKRM 4IU2A 4KROD 1T1WA 3H9SD 3WIIL 3IFPB 1NFAA 4KC3B 4D2NA 2I24N 5KUKA 4NEHB 5C2BH 3TF4A 2YBRB 3N3EA 5AW7B 2KZ1B 1FLRL 2B3RA 2IFFH 1EERB 1M7DA 3FRPB 1TIUA 1IEAB 1R75A 5IEHB 1XGUB 4QWWC 1DQLL 5B1BB 2DQFB 5LG1A 4FADA 1MHCB 2VABA 3FH5A 3P4LA 3LEVL 4H5SB 5D4QA 4D3CL 4PJAE 2QV4A 2QLVB 3FCSA 3TNNA 1JPST 2BVUA 5KYYA 2XTJD 1DZ0A 5C86A 3DBXA 3C5JA 3E6HB 4MAYD 4NCC2 3GLZA 4K3JL 2HMIC 3AT0A 4DGYH 1B4LA 2BVPA 3OJ2C 7PAZA 1QAWA 1PG7L 4MDIB 4NM8L 3TC9A 2K1MA 3BAWA 3CFTA 3UG4A 1UOWA 3CZFA 3FU0A 1KWGA 5JIKA 4NXSA 3HPJB 3U36B 2N7SA 2CO2A 3NYKA 1S78C 3ULVE 3UBXA 2EE9A 1TQCB 4Z0XA 5JHDB 2ZKYA 3L45A 1JF1B 1X6LA 4OZFG 4LCWA 5CILH 1H8SA 3QE5A 1KB3A 4J12A 4MLIA 1EXHA 3PUUA 1J8HD 5JYMA 4F80A 2FYVA 2D7PA 3ARTA 1J8RA 4YJZL 4P2QD 1J0ZA 1HXMB 1NMAL 1CK0H 2DV6A 1OAKL 4NI6A 5IZ7A 1DQVA 1O75A 3L5JA 5F44A 1FBIL 5E4AA 2BHUA 3KNBA 4WFFD 5DFVC 2H1LM 1IEHA 1G9MH 3IU3B 3FCGA 1A7QH 4O51B 5CEZD 4HXAL 4L3CB 5EU5A 4FA7B 4PJHE 2NYKA 4TQIA 3V6OC 1R24B 3MRGB 5KVDL 2HT3C 4QRRE 1QW8A 2O6EA 1DO6A 1INEL 5I9QB 1ZT1A 3VGGA 1J1XH 4KI1A 2Y4SA 4M6OL 2N7AA 3FFCB 1OSZB 5F2FA 3PWJB 4Y1SA 1ZVHA 5I16A 4PVLA 2TSAA 1A7PL 1MNNA 4DK6A 4IS6A 2MOGA 5AVSB 5F9JB 3WTTA 4MMXA 1PQZA 3ZPDA 4LU5L 4X7SL 5C0BD 3IB4A 4LCWE 5JIMA 4LP5A 4MYWB 3WL9B 1JPGA 3B2DC 1W72L 2H7WA 3TCLB 3RUGB 4M7KL 3L95B 3VH8B 2AZAA 2QGDA 3WE6A 2Y6TE 1I1AC 4GUPA 3LZFH 1PCSA 2PR9A 3FTYA 5EC1B 2B9AA 3FN0L 4JHZA 4FQ2L 1PFOA 5IOPB 3WNKA 1AAJA 4K94H 4FN0A 1V10A 5GS0H 1RY7B 5LCVL 4GQ9L 5FM4A 1H6UA 1XDTT 2H45A 2QLYA 4BYHA 4G11A 5HDQH 1E6JH 5DHMC 3OSVA 3O9WB 3OSKA 3ECBA 5IVZB 3SZKC 5HDLA 3BSHA 5KVDH 5D4IA 1NCAL 3Q6FB 2AJUH 4TV3A 4MS6A 1IO4C 1N59B 2QPFA 1MCFA 5FYJD 4DZ8B 1MLCB 5E00A 1OOAA 1ORSA 2FT6A 2F54E 4GIOA 4KI5F 3QQ4B 4BK5A 2V33A 2EVIA 3C5ZD 5FO8A 4FZ8H 4M93C 1EEYB 1RJLA 5DJZB 2Z4TA 2BPBA 4JFDA 4AV4A 3VFOB 2F58L 4MS8D 3PWVA 2PW2A 3FUFA 43C9B 4N5EC 3MA7B 1JPEA 4WI2A 4JFZH 4Z7OF 2EUXA 3SKMA 4JPQA 3IFLL 1HHJA 2FHBA 3R06A 5BRZA 1Q0EA 3CUPB 5DR5L 3FULA 2B0SL 1FNSH 3NSXA 4K55A 2Y7NA 4PJIB 3AJ7A 3ULUL 3VI3F 4P4RB 5C70A 5JPNB 3WDJA 5ETUA 1SJVA 4YEFA 1IE5A 1BJ1J 3LRSB 4M7LH 4HV8A 4ZPTB 4GYBA 4ZMAT 5BVJA 3ULVH 5DZLA 4HWUA 4RX4D 2G9HA 3A6BL 3GSWB 5C0JA 4FTVA 4U7KA 4N25A 3FH8A 1IJ9A 2BVOA 5DHXB 2GK0A 2CXGA 1H6TA 2D8KA 3NFSL 1IAOA 2FR4A 3WEAA 1GGUA 5C0CB 3EO0B 5BVJB 2NNAA 3SBRA 3ARZA 4MZ2A 4IW4C 3ZRSA 1ID2A 1WWAX 4MCNA 3V5DA 1M6OB 1NC4B 1NICA 5DXWA 4Y1AB 3PHQA 2VQTA 1R3HB 2VLKE 3SQOH 3SOTA 2GITB 2V9QA 2CPUA 5I8KL 1T0MA 1DVFD 2E4FA 5D6CB 2BIPA 2EUVA 2KZBA 1MJ7L 3T6QC 4OZIF 3IN0A 5CLXA 4ZPVA 5DD0H 4ELMA 2WLMA 3OKMB 5TQ0H 3K6OA 3LV3A 1DSWA 4F3FA 3QIUD 3EJTA 4Y16D 5CBAB 4KO6A 5EB9A 5LLIC 1TCRB 3SZ6A 3KBEA 3RL2A 3MRFA 5IW1A 4U1KA 4EOWH 1RIVH 3H9SB 4L8BB 1QYGH 4ZUTB 5LUMA 1F90H 3S8WA 4YHLL 5E70A 4KVNL 3W2DL 4ZUWB 2WZ5A 4XP6H 1N26A 4G8IA 2XPGA 4MD5A 1DQMH 1FORL 4IDLA 3WIFA 3GSRB 4L2YA 4ZAKB 3U6RB 4Y5XC 3O3DA 4WI0A 1JK8A 2CHXA 4I9XA 1MCWW 3LKRB 2CWRA 2ZCKH 1W91A 3LZLA 3OB0K 4FL4C 3QCVL 4QO1B 1KPVB 3F7YB 1GYUA 4PJXF 4EN2A 2D31B 4AIZA 5BS0B 4F8QA 1P7QD 3KLSA 3RZCD 3QB7C 2YUZA 1KIUA 3T08A 4N8UA 1XCQB 1SDDB 4GG8B 4KKLC 4JFEB 1NFIB 3ZU8A 3LJ3A 1UA6H 1JWSA 4HFUH 4HIHB 2NY2C 3KWTA 1H3PH 4NO0D 2OK0H 1BJ1H 3KPQA 1ZT7B 2HUEA 4XMUA 1D9KD 3EUDA 2EAEA 5KBPA 3JV5A 5GIRA 4ZZFA 1JUFA 1DDHA 1FH5H 1NC2D 3I6SA 2DMCA 1HSBA 3FSZA 4QRBA 4ZO7A 3TEUA 2ADIB 2CD0A 2CJ3A 3QUYB 5DO8A 2OZ4L 3B7YA 1BD2B 3OJMB 4AT6A 3NJXA 1PZAA 4BFNA 1HH9A 5DZVA 3VSUA 2F18A 4J1UB 5MENA 1ITCA 5IGXL 3NZUA 2JSFA 3CG8A 4G8EB 4RAVB 4X4ZA 4C54A 4UAHA 25C8H 3NJGA 1JRHI 2K3HA 3SKOB 5LGJB 5E99H 3DX8B 1GY1A 1DFBH 1FN4B 3FPXA 3IGUA 4I2XA 4MJIA 1B0GB 3EJZD 2ZOKA 3CXFA 3BPNB 3F01A 4FKKA 3LS4L 3PLYA 4MZIA 5GGRY 2XHNA 2OL3B 1OV8A 5FLUA 5CLZA 1USQA 5DURD 3GMPB 1DCLA 3QDAA 1ETZB 5KW9H 4ZO9A 4XNYL 3VFWB 3B9KB 1YEWA 2OV0A 3K72B 4P2QE 3ZQ9A 5BXFA 3PABB 2Y5QA 4PJIF 4LEEA 4NBXB 4LSVH 4HUXA 4ZMQA 2DWDB 3HI6L 3IDYC 3CHQA 3OLEA 1DJYA 3BD5A 3IGKA 3U9UB 2EDDA 5T1LA 2H41A 2QTVA 3P0YL 3SJVB 1OPGL 1Z5LB 1W0VB 5G4NA 3QJZA 2OX5A 3M1BB 4H8QA 4QY8B 2NOYA 3B5TA 2JLPA 1TQCC 2NZIA 3GBMH 4K5NA 3TO4C 1DE4B 1OOWA 1C5CL 2FNWA 5IHLB 1NLDH 4N2HA 1IL1B 2EVFA 3JV6A 3C5XA 5ELIA 3ULVF 5B22A 3VVWA 4EVNB 2EXTA 4QJ3B 5G2NA 3NCEB 1K8IB 4I77L 3W0WB 1J9CT 3VXMD 2J25A 4H1LG 3ZHLA 5JMRA 3L4UA 4P2QA 1RUML 2BO0A 2R23A 3FHQA 4KY1H 4CADA 3HEIB 4P05A 2FBJL 3VFRB 4IDJH 4UNVA 4LLVA 1DHKA 5DK2B 1OAKH 1XR9A 4Z23A 2ZOWA 4TSAL 3FB8B 2FX7L 2Q9OA 2XC8A 3DVGB 4OY9A 1T0NA 3MLYH 3QIWB 2CXKA 3UROR 3MRIB 2VZ1A 3FCUB 3MV9A 2WUCL 4X42A 1BQHA 5IBUB 3W81A 4TLSA 3ORJA 3L3IB 3LKPB 4HJJH 4OLVL 4X6FB 3RB5A 2BSRA 2EKJA 5I8OL 5D2LB 4HPYL 5FYKU 4MNGE 4XPFL 2F7QA 5EOTA 3K5RA 4PTTA 3RDTA 5D7LD 2WBJC 2EO7A 1ES0B 1NA8A 1ZKAA 1YDPB 1MREL 2BHFA 1NGXB 1RUMH 2DDQL 4MDJB 2BCKA 1YSOA 4IBSA 4KRLB 2ATAA 4P3CL 4GRLA 4HEPG 4HGWA 3TBTA 1HL5A 3PXLA 4LLWB 3W3BA 1RZJH 1GA2A 4WHTB 3FRUB 4WRLA 1DP0A 1Y18B 3O4LA 1YEJL 3B2VL 2WVSA 1A8ZA 3DSFL 1KELL 2LE9A 3DX9B 3HE6D 3OXRA 4UMSA 3H6JA 5F7LB 4BKLA 1D7DA 4XCEA 1DUYA 4JJ5A 5CR1A 3AACA 3UJJH 1EAJA 1WS8A 1A3ZA 4FFZA 3O6ML 4FNUA 3ZE1B 2O72A 4P4KA 3MJ9A 4C83A 1WZLA 3KHQA 1U41A 1QBBA 3WD5L 3QORC 2VE6A 2DYPA 4OD2A 1DLHB 5F72S 5CUSL 1XF2B 4X4XA 4PJEF 3L8QA 2KPNA 3QHZH 1OB1B 2W88A 4EXPX 4KK9D 5E1IA 4LLDB 1N5AB 3UFIA 3NAAL 3UTTB 2X4TB 4KKAD 1E3FA 5I5JA 2OMYA 4YHMH 1CFMA 4NERA 4YAQB 4H4NA 4J3UA 1JWUA 3IEAA 3B2VH 3FT9A 4XAKD 5DZOA 3I74A 5EU3B 3VXME 3BSZH 3W11D 5T3ZD 4YPGB 2BNQA 1QLEH 2XV2A 3Q9QA 2YLKA 5GGSY 3WY3A 4NNYA 4N2FA 2NNXA 1OCOB 4GJTB 4F8OA 2XRAH 1C8PA 4FFWC 4RX4A 4QHPA 1KEGL 4GXVL 3ARBB 4J3VA 2APXA 3CFMA 3CQPA 3C87A 5CCHE 3L9RA 4FZEH 4WW2B 1QWUA 4E42A 3EG9B 4PWKA 2ODHA 4Z7UB 1WFTA 2QTEA 2R1WB 3QFJB 2G3XA 5DGRA 3NJKA 4PMFA 3WFCH 2VLRD 2DJMA 2G0LA 1MFBL 4PHXA 2XA8L 5JOPE 5FECB 1JK9A 2NY4B 4ZXBA 5HP5A 3KYNB 5JIDA 1U4EA 5DVPA 5SV3A 4IRZH 1I1FA 1RK1B 3P30H 6FABH 3QEGH 4Y2DB 2E7BA 5ACZB 3BUTA 1YEKH 1NANI 1CN4A 2M8XA 4J4PC 5KVDE 1HX0A 1HI6A 1PEZA 1T5XA 1F2XK 1KY7A 2H2PC 1F4YL 2PWEA 3MTXA 4G7YH 4UOW0 4WUUD 3TH2T 3VQLA 4CVZB 3SY0A 3D12B 1KN2L 2JF1A 1BVLB 3FU8A 3MFFB 5DQDH 1UWFA 2BSSA 3L3KA 4QOKD 1KLFB 4MB4A 5D1QA 3EFOB 3UZVB 3VFTB 3VCLB 1JNLL 3ARPA 4UT6H 3FU5A 2OI9B 3DI3B 1T5KA 4L3EA 4GAGH 2QSCL 3MOQA 2CGYA 3VG0H 3PL6A 4AG4H 4MKTA 4LRNL 1NC4D 1UH2A 3QUXA 4X4MA 4I0PC 1RQ5A 2IQ9L 1NDMA 3PHOA 4JFPB 5BO1L 4QGTA 2GUOA 4KMLB 4XXCC 1N2RA 2X28A 4L4TB 4LL9A 1MHHB 4FFVC 4JG1L 3V6FA 1OQXA 1ZXKA 4PGCB 4W9ZA 4O02A 4P57B 4R0LC 4PJ7F 3PWLA 5T1JA 4ODSH 5IVNA 3SDDA 5E8NB 4S0TD 4NO0A 5E8OA 5D2NB 4NO5A 5CD3B 1E4WL 1YRKA 3GO1H 3N43F 2LR4A 3C12A 5IROC 5EZLB 1ZJAA 3G6JB 3BC9A 4HKZA 4XR8C 1H3XA 4EE2A 1HHHA 1TG8A 1HJBC 1OSYA 4JB9L 4LOUD 3LZNA 3R7RA 4GAYA 3GDCA 4BWTA 3CSFA 1X7QB 1WWCA 2W07A 3CFKB 2W65B 4H1LH 2VR7A 4Y1AE 1FUNA 5KSUB 1IFRA 2WCPA 5GSRB 3D08A 2PPFA 1EGJA 1A1NB 2A83B 5DVKA 1P7HL 5BS0D 4YHKL 2DKMA 3VFVB 2EECA 3WO3B 1M71B 3IJSB 1JPTL 1MI5E 1FA4A 4JO4H 5D55A 1KN4L 1K4DA 1TQTA 4KRNA 4PI0A 3J8F7 3ZTEA 2J3SA 3S35H 2FWUA 4JPSA 4P9HH 1Q9KA 3FXIC 3CFJB 3MJ6A 4X0KB 5MI0B 4WWOA 3RTQD 5KSVB 2QQLH 3MLSH 1Q72H 4XWGL 4GBXC 5BUAA 4G1EB 2I85A 4XCYA 3BZFA 1ED3B 3QXDB 3NK3A 1FYTB 2GQHA 4TOYH 4XNYH 1MW0A 1UM6H 5IJDC 5H37G 3U82B 2QVKA 4GSUA 5E2TL 2JKTM 1PZ5A 4ZODA 3GKWH 3F65A 4QJ5B 1KWKA 3UH8A 1N0LB 1DEDA 5FO9A 1DBML 5IHZA 3T1FA 4ZFZA 4P5TC 1T0OA 2YKLH 4W93A 1H6FA 4EUPH 2ZYSA 1JAEA 5IT2L 4FQLL 4F2MB 1SEQL 2EYSA 3JYCA 4NQED 2GTZB 2R9HC 2AJ3B 2PW1B 4JDZB 1T1YA 2OXGA 4TSCH 5A6MA 3EYSL 3IMBA 3QVAA 1IX2A 5FEBA 4K9EC 3D7PA 2Y6SC 3L4VA 1ZD6A 3ILQD 1I7TB 4POYA 4UTAL 5HI5C 4HHAA 2NW3B 3U25A 4UQ9A 4BZ1A 1SYVA 5E6ZA 3BPLB 1U0QA 2YD2A 2CCLA 3MLWL 1GL4B 4Z7QF 2ZTBA 2EH7H 1XCTA 3N6YA 1G6RL 2X2YA 1NGWA 1UWXK 1EGJH 2DQDH 4H88H 2XFXA 3EFDL 4KBPA 1DANU 1F00I 4JG9A 5CJOH 1UM6L 1Y1DA 2ZSVA 4QTFA 2OMUA 3D34A 4YDKL 4R7DA 4TQPA 5F3HB 4ZYKA 5TDOB 1NOAA 4PCTA 3MV7A 4XTRC 2CSPA 2VMJA 1Q9OA 3T3PE 5KAQG 1ZVYA 2ZICA 2PTTB 4H7VA 2A74A 1W80A 5BS0E 5DC2A 2VITA 5B7FA 3FB5B 3ULUD 4MQTB 2I26N 4P9ML 2F61A 3GNMH 5HYQB 5CZRA 5EBWA 3H7LA 5B4MC 2X2JA 5ESQA 3D09A 3HFML 1W15A 4I0PB 1V3MA 4ICWA 5HGBA 3MRQB 1ZLWK 5ISZA 3CN1A 3I6LD 4APXA 4HAGA 4K7FA 1E0OB 3RFZA 2WLIB 4Y1TA 1UJ3B 3U0TA 3FSWA 1MVUA 4C4KT 5CMAB 5ABAA 1HT6A 4GI9A 3QPQC 5C3IA 5DJCA 4KH2A 1KXQE 4HSCX 3WFDL 3SCMB 4CMHC 4HEMA 3S5LB 3EJQA 4JDTL 2VN5A 4JRXD 3Q2WA 1HCYA 4EIZC 1KYDA 3GUTB 3RPIA 2WYZA 3VSVA 1XSKA 2ZOLB 5GGTA 3S8GB 2NY3B 5ID0B 3TVMA 4X99A 3VI4F 3WY2A 1M7IB 4S1RH 4WFGD 1U58B 5KVMC 4FG6C 1SNRA 3ZKQD 2BOLA 1CLZH 5L8JB 2WV3A 2BSDA 2IALB 4GQQA 4OI8A 4MA1B 3S48A 3BUYB 3ZZLA 2NQDA 3O9WC 2AEQL 4FABH 1TDQA 4NAQA 2CJUH 4BZ1L 1MH5A 1SXCA 2NY4C 3FOLA 1SYSA 1SHXA 2W94A 3KGTA 5ITFA 1MRFH 3QFGA 4IRJD 2KT6A 4F20A 5KVEH 3RP1A 2E9WA 4BV1A 4DF9A 1EAPB 1AP2B 3NABH 1H3UA 4PJ9A 3L3JA 4PRAA 3IDYB 3QR0A 3UTQB 4GRWF 2WBXA 4F27A 5FOBB 5DYOB 2OTUA 5DO2D 5DTFA 4YHOL 15C8L 3JYBA 4HUCA 3X2QB 2P8PB 3QP3A 4FLOA 4L05A 1JGVL 1AACA 3QZLA 3MCG1 1G7JB 3WXWH 3HAEG 1AO7A 1SXBA 3IK2A 1SN0A 4I1RA 4HPOL 5KYWA 3VXPA 1R4XA 4XNAA 2CJSA 3X1NA 2B1HL 3FAXA 4N0YL 1SOKA 5D71H 1ZEAL 2ETWA 1DJGA 3OX8B 4PJ7A 3FTUA 4B95C 1X5GA 1X5FA 2EJ1A 2Y7QB 3FN0H 1QSEB 1BVNP 2WXOA 4K2UL 3LB6D 4OLZH 5E2UH 5DMYA 1HINH 3GD1C 5FWRA 2DS4A 3V0DA 1Q9WA 4XMLH 1BM3L 3ZE0B 5HHQA 5IWLA 3IT8D 1D7BA 1FIGL 1DJZA 2H3NA 5LN4A 3UABA 5ADOH 1UCBL 1QFPA 1HH6B 1IZJA 2IMMA 4P99A 2CGRH 3P73B 3L5HA 1AD0A 3SBWA 3DPDA 4Y5VA 1ZEAH 4RFEA 4HW6A 1C5BL 1ONQB 1FZOB 4FMKA 4RZCB 2GY5A 2Q3ZA 2OMBA 3AABA 1CBVH 3G5XB 4Z9KB 3MCYA 1WO2A 3AS3A 4JFFA 1GCYA 3UYRH 1F6FB 1J1PH 1RMFH 2FLRT 4GSXA 3W9DA 4AYID 4RQQA 2DY2A 5AVVB 3TOPA 3J27A 2FJFB 1YEGH 1K5NA 2AC0A 4KJPD 3PQYB 2ZF9A 3D18A 4UT7H 5IB1B 4OZ4A 2ALAA 3PWUA 1WBYB 2AV7A 1JFQL 4XPGL 1A8JH 4UDUB 3N1MC 1KFAL 4YGAB 1Q0XL 2O61A 1KLUA 2JTYA 1JI2A 2R83A 4S1DC 5HHOD 2A73B 4ONHB 3NJVA 4HOZA 1MAKA 4PRBB 3MODH 3VXMB 2YQ2A 5ECJE 4G9FA 5BRQA 1UM4H 4PMEA 3QIWC 3QIBD 1J9SA 4LRIC 2NT1A 2RIKA 1IC1A 3WAJA 5DS8A 3F58L 4RLDA 3Q2CA 5FM5M 4GKZA 1BLNB 3GSOB 3T8XA 3KZ8A 4XP1L 2OL3H 4WUKH 3ZMEA 2Z92A 2DPKA 2UWEA 2VNCA 3I6KA 4MJJA 4NM8H 3PGFL 3T0EB 1QPKA 3QRGH 3MQIA 3GZKA 1AJ7L 1QYGL 2CAKA 1U6AL 3ARGA 3BKYL 1Z0MA 1AH1A 3L48A 4U2YA 4MKMA 1LO5A 4PTUB 5IY5B 3U7YH 4LF3B 2BWIA 3MUHL 3QZPA 1HCZA 2VZVA 4I0KA 2QQKH 1MHPL 1GYVA 1P4IL 3VTMA 2QHLA 3FONA 4XRCB 4DP0X 1TF4A 1HTYA 1WZ1L 1GAFH 3RL1A 4QF1B 3DPBA 1E8XA 2F7PA 3LPFA 4GKNA 3FT3B 1ZLEA 3ESUF 1T04A 4Q6IA 4OZGE 4YHPA 3BJLA 1SXNA 5A6LA 4NUJA 3SYQA 4NQXB 3VB9A 2AQ2A 1OEZW 2OR7A 4X5WB 4R4FH 5FA3B 1D5MA 3KL3A 2ZOTA 5BJTA 5IJBC 1N68A 1I1RA 1L7IL 1UZ8A 1H9VA 2JNZA 2ATPA 2XV0A 4BXVA 4K9EL 5I8EA 1FO0B 2CCWA 3QPXH 4CL7A 1I9RH 3JZ7A 1X5IA 4DO6A 2ZJSH 3KVQA 2NY0B 1CDGA 4JO1L 3TJHD 4UZUA 3GMMA 4JM4H 3DC0A 1EAOA 2K78A 1AR1C 1URZA 1TETH 1TTGA 1PVHA 3QQ3B 4NRZA 1O6SB 1GH7A 3D3VA 5C0RH 4HGKC 2V6HA 2H4EA 1WTLA 3S96A 1HDMA 2J8HA 2JQMA 1AGFA 4JKMA 4O2EB 2VDOB 1TJHL 3EYVB 2WPGA 4KXBA 3ARRA 4FRWA 3T9WA 1WC7B 1U3JA 1NWPA 1U8PA 1RZQA 3VWKA 3V0EA 2FB4L 2VJXA 1BQKA 3Q7JA 4UMGA 2HPTA 1YPZB 3MUZ1 4JFYA 1IC5H 4RA3A 3SDAD 1KDIA 3BHBA 3IGFA 4XVJL 4JM2B 4R4BA 1J9RA 4YDVA 3BLKA 4XN1A 3MREB 2O5XH 1YN6A 3LZFL 1WAAA 3DRQB 2WXNA 5D1QD 2F1BA 3VRIA 2YFNA 1UWEL 2R2EB 2I9LB 1QSED 5FGRA 3ZDWA 5I6NA 2QMKA 2OM5A 3BOVA 1S8DA 4WENB 3L1GA 3MO1B 4U1HA 5IVXE 3RX9A 1QFWH 1B4JL 1KIQA 2PP7A 1ROWA 3VG9B 4GG6F 1YO4A 4AYBA 2VDLH 3M86A 4KKZA 2WN2A 3P77A 2D7TH 2OQJB 4LKXB 3JWNG 3BIKB 3HC2A 1FL6A 4OKDA 3HKZA 4RETB 1CQKA 1AZVA 3IDGA 1QQDA 1TSHA 1WBZB 5EHFA 2IADA 2VMDA 3LXBA 3DTXB 4CSSA 5CBEB 4LBEA 5GGQL 3RBGA 2PWDA 3BAYA 3CXHJ 1UOLA 4MCMA 1KGYE 4AH2B 2WY3B 1J05B 2WXJA 2GC7C 1QSZA 4IRJB 2CDEA 4WJ5B 4HP5A 5I9QC 1QPXA 5CIPH 3MMEA 1KB5L 1IRAY 1WH0A 4XNXH 5BW7C 3WFZA 1JZEA 2C1OA 5IR1A 1CGTA 5DC4B 3ZYZA 4V33A 5SV4A 5IMLB 3FQRA 5B1AB 3ZTDC 1II4E 2VKXA 5DUPH 2WXMA 1XF4B 3FHEA 3ARDD 2WK2A 2OMXB 4ZDHB 3UZQB 5EU6D 2WNXA 3ZHFA 2DM7A 2W60B 3VWJD 4EDXB 2AXHA 1OCRB 5CGTA 4QHKJ 3S36X 3F3HA 3BWUF 3QXAB 2ADJA 4WKZA 1I3RB 2XWCA 1BFTA 4MJ2A 3VD1A 4M7JL 3IXTB 1X44A 3QJFA 1FZKB 3ULVC 4JDTH 4PY7B 1DDTA 5EIIA 3MLUL 1HHGA 4G59C 1U8KA 1E2ZA 3MRMB 5HGAB 3X12B 1Q90A 3VXRB 1NIFA 3ZE0E 3GK8L 3WTSA 4W9IC 1CXEA 5L8LB 5A2CA 4UQAA 1VIWA 1YY8B 1J0KA 4HJJL 4YSDA 3N42B 2V7HB 2BVQB 1I9RL 3QUYD 3U30B 4EZJA 2X4RB 1MWAA 2F53E 5HHOB 2G2RA 1CO1A 4PRNB 4FABL 2VRAA 3SYAA 1OTTD 1D5IL 2E7MA 3DXAA 4XPTH 5GGSA 1J5IA 1QSEE 2EXSA 4KDTA 3RQ3A 1CFQB 4M03A 4XP5H 4G6KH 4MVBC 5CNHA 1LE5A 4IGBA 4YHIA 1EO8L 3WHE1 3UAJA 1FRGL 2R4SL 5HHPA 1OCZB 4Y4HA 5L2KD 3MTRA 2CK0H 4MCYB 3U2JA 4JFQA 4KVNH 4MHHG 3W2DH 4CDGC 1OF2A 2HSIA 2LLLA 5CEXB 4YHNA 3CX5K 5D5MF 2QPEB 3KMDA 4XP6L 5F3BB 1KTDB 4BK5C 3T6ZA 1TZGH 5K39A 1FPTH 4KPHL 5L2JB 1XGPB 4BCXA 4QRPB 4HIJA 2XN9B 5T5FA 3AU0A 1H3TA 3I6GB 2DJUA 2F53A 1CFBA 2A9ML 2WLHA 2XIBA 3KLAB 4N0CD 1RJCA 1HCFX 3MXWH 3ATBA 5G5DB 4PGEA 1KCRL 1E2VA 4EZKA 1FVEA 4YSAA 5F88A 2A7BA 3QIUC 4C57C 4OCYH 1RD6A 2Q3XA 4NJAH 3D8MA 2R2CA 1MSPA 2D0HA 3ULSA 5D9SB 2ADFH 3ASOB 4JZOB 4AXWA 4OM0H 4YXHL 2WC7A 4JFDD 5GRVL 4X4ME 1JS4A 2FTAA 3N42F 1CWVA 2J1WA 1IGMH 5HHOE 1SLVA 1BFOA 5HDRA 1X3DA 4NUGL 3HPLA 5C0EA 2BJMH 2R0LL 4LAQH 1YNTB 3FL7A 3D69B 3G04A 5M7QA 4PR5B 3HG3A 2AZUA 1MWAH 4JBSA 4FFYA 3GM0A 4QTHB 4V1DE 4YN3A 4EI6B 1FSKB 5LKNA 2YEQA 3QG6B 4NGHL 3O8XB 4H8WH 3BSZL 2BSED 1J48A 5G4MA 4ZMXA 4HKBA 3O6LL 4JY6A 4GSDH 3SE3A 1GOHA 2ZUVA 1A3LH 3MRDB 2C26A 1CFNA 4NZFA 3MPCA 3KLHC 2J73A 1NCAH 4LEXL 3WJMA 2HJKB 1NCDL 4HWZB 4JFZL 1AHMA 3GSNB 2AJSH 1TQBB 2VAJA 3MCLL 5DLLA 2DMKA 3JTTB 1YZZA 5I1HL 4Y16A 2P43B 2BS9A 4PQXA 1INDH 3EYFA 4LAQL 2F58H 4RMUA 3GEFA 4WW1A 3X12A 2QPSA 3MRMA 4AQOA 5J4MA 4RRPM 4UINH 1S9WA 3U30C 1I85C 1DVFA 5LAPA 1D2OA 1FZKA 1GPOH 4LCIL 2GSGA 2V3FA 3DJSA 2FGWL 4Z7OB 5JNYB 2QR0A 4F7MA 2AJYL 2XPZA 2LU4A 1PYWB 1WCBB 1NGQH 5D7IB 3UTTE 1URIA 2CUAA 5CLTA 4L4VB 3JWDC 4P23D 5CSGA 4A6YA 2XXCB 3MRNA 4OLXH 1MRCL 3HZMA 1NCDH 1GZQA 3L9YA 4GW1A 3ABGA 3KEHA 1P7QA 3RZCA 5MERB 4D0DB 5AZUA 1MUJA 4PS7A 3T77A 4ALAL 3ZDXE 5GXBB 3O2WL 3FQWA 2ZXGA 4UT9H 3IMWA 4UNTA 4UOQA 4RFNC 2ZKMX 3ZO0A 3U2IA 1P0SE 4N2IA 4OF3A 5FW6A 3WTVA 1OAZL 4EI5D 4PRHB 1C12A 1R17A 2JI1A 3RY6C 1VKXA 4KWUA 3MX0B 3DJ9A 2X1PA 3D4ZA 5DMIH 1YPZE 2N01B 1T7YA 4QRUA 1F90L 1QNIA 2BNRB 4V1DD 2IDSA 4WHCA 3ZR6A 3PJNA 4DT2A 3B6SB 1CDIA 5AYTA 8CGTA 1Q8MA 3CD4A 1MY5A 2IWKA 3DV4B 3O4OB 5E2VL 3MV11 2E6PA 4P5RA 3MLPA 4XPAH 1F56A 5DD3L 2YD6A 1XMEB 2C9AA 1FJ1A 4LKCB 3MBWA 1YJDC 1D5XB 1UC6A 2CBMA 1U8CB 1JHTB 2WWKO 3GO1L 2VC2L 5INDB 4A7GF 5C0IB 1SQMA 2HJLA 2HX7A 4HPYH 1A47A 5JW3H 4IBWA 2Z35B 3FTVA 4D9QE 2DIBA 3MCKB 4R3SB 5F1OB 4YZWA 4GINA 3I02A 1A4BA 3IGAA 3IS1X 5MHSE 3WXWL 2AI0H 3EGSB 3LNDA 4JM2A 3WJLC 5DC9B 4HD5A 3RGVB 1FIEA 4ATWA 1GOFA 5BMFL 1NCUA 3Q2NA 3D48R 2LU7A 2OZ4A 2AQTA 1QLFB 2K8MA 4IHOA 3ZGIA 3PAZA 4F7EB 4RAUA 1AZBA 3T2NH 2B5IC 5BZDB 3HAEB 3MNZB 3KE0A 1MCRA 4OJDH 3S96B 4E68A 4JHUA 1YC7A 2C7UB 3HCVB 1TQUA 2XKNA 1KENL 2ZKHL 5C0BB 3C60C 1TPXB 3KPPB 1KBWA 3HMXA 4WO4C 1XV8A 4M8VA 3RURA 1CTMA 5E6IA 5FGCE 4R96A 1V54B 2VDMB 3T0AA 4IQHA 4JKWA 3V0HA 3QAZB 3LQAC 4PJXE 1WZAA 4GQPH 1BSIA 5BMFH 1U8OA 1CD1B 1EXGA 2O1AA 5ALCL 4XT1C 2YAPA 4HQQH 1G1CA 5FKAB 2NR6D 4ZZKA 4TOYL 4TF4A 2RQEA 3KBHE 3O45A 3KPRD 4HKXB 5H4YA 5HDOA 2XNAB 3W39A 3HE6C 3VD4A 3EHBB 2WQSA 1T04B 5DLMH 5E2TH 2B08A 1J18A 2P8LB 3FYEB 1X7TA 1E6JL 2XQYK 1R9FA 1F1GA 1JNHB 2H8PB 4JKPH 5J1AB 2VM9A 1QFWI 1ZE3C 3D0VA 5DU7A 3D51A 4JRYB 5CJXC 2WQAA 1MRCH 5D6DC 2G3NA 1GXEA 4FZEL 5CSZB 3HHRB 3OKNA 3PP4H 1IC7L 3HJ0A 3TA3A 3DHPA 1RL1A 5AZ2H 2PABA 2VLMD 3MACL 3V9FA 2N59A 3F12B 1JXFA 2BP0B 5DJXB 1XO8A 3T0VA 2NTFB 4PJXA 2J8UB 2PYFB 3TBSA 1S4IA 3DLQR 5FPIA 2XA8H 3PHSA 4N8VB 2NYYD 5C3LD 2EIZB 2F08A 2M26A 2VLLB 1RXLA 1DUZB 4M02A 3RWGA 3W11C 1LO4H 3GJEA 5F1KC 5BZWB 3OJDB 4WWNA 2JKXA 1A4KA 3T6VA 1ASOA 3CCHA 3ARUA 3KXFE 3RU8H 1J8HA 3RGBA 2HT2C 4ONGH 4XX5A 1P1ZA 4HJGA 3N41F 1JERA 5F71A 1I53A 3SEPA 3MC0A 4HZAA 4O2CB 4AWJC 2VDRL 4OGYH 1IGIL 2IFGA 1FI8C 3PP4L 1TOXA 1FVCB 1QACA 4OD3L 5TE4L 5B7MA 4NQVB 1FDLH 5DVMA 1CG9A 3AS1A 3ROLA 3SODB 5AL0A 3A4FA 3FSAA 5KVGL 3GUFA 3KDMB 2GHZA 4KAQH 4OLWH 3V52L 4P4KC 3DHUA 4DZBB 3H1ZA 3QC5X 2GY7B 4PJCE 6PCYA 3QORA 3FQUA 1ML0A 4ELKA 4PG2A 4XPHL 4R5TA 3VI3E 1P5UB 1N8ZB 1TZGL 5DRNA 3F7PC 5C08A 1IQWL 3EJSA 3P73A 1HEJC 2L7EA 2ALWA 1U3HB 4KKQA 4KUZL 2IPKA 3SYCA 5J9PA 3KXFA 5F7WC 2R15A 4F7PB 1OP5H 4E0RA 4TVSa 3CJJA 1NBCA 3GJFA 2VDRH 3NMEA 4OGYL 5FYJU 3TIEA 2B3IA 5DHYA 5FWQA 5K9OB 2NQ3A 3AQDA 4G8AC 2X09A 2WWKT 1UKTA 2GBAA 5CJ8A 4KZEL 4OLVH 3LS5L 1BFSA 3CPLB 5I82A 4XP9L 3QZNA 1FHNA 4KXCA 1YNKL 3IDXL 3MUY1 2YN5A 1N4XL 1CL7L 1KYAA 2A38A 1V7NH 1WA0X 2P24B 4E9XA 5IB4A 1F6AA 1SBSH 4K3HA 2VMEA 2WN3A 3H4HA 3NJIA 1PZBA 5DEJA 2CLRA 4E9SA 1BYNA 2X6MA 4BFFA 3NCWA 3NFNB 1JDDA 2BSEA 4AZUA 4ZMZA 5ICZA 4YH6A 2YGQA 2IDFA 5D2NE 4I5BB 3WHXA 2KHAA 2DWEA 5FOBA 1EX0A 1ZVSB 2W95A 3O6KH 3WO4C 4OLZL 3OGOE 5C09B 1NPJA 3G6AA 3NCYP 1YEDB 4JLRB 3EDKA 35C8L 3U4KA 2QQLL 3MLSL 2P44B 5CGYD 5ICXB 3RNQB 5EDXA 1RI8A 1KBGL 2X87A 2JKIS 4FX5A 3FOMA 4JQXC 5FK9A 1N3NB 1PBYA 1MH5B 3FOLB 3U79A 3V5KB 3HI5L 1X9LA 5IROD 3QDJA 4XMWA 2IPTH 5C07A 2DQCH 4G8FB 4PN6A 4X9BA 3GMNA 3UG3A 1A5FH 2FWLB 5IGXH 5JPNC 2XRAL 1F6AB 4IKLA 1T6WA 3D85B 2P24A 1AS6A 2K8QA 4LXFA 1BZ7B 4HXBH 4FNPA 1O9VA 3S6CA 3NCJH 1CDYA 3QFDA 3FFDA 3H2WA 2HRPH 3L81A 4RWYH 3S5LG 3T3PB 1G4MA 1SJEA 3RY4A 1BM3H 4FLRA 3LH8A 4ES9A 4UAOC 1B3JA 1Q1PA 1ZT4B 5ADOL 2A2QT 4O00A 3WFCL 2YPVH 1S7QA 4N8VG 4M9PA 2HJFB 8FABA 2PO6B 3DXAD 1S7RB 4F92B 1A2YB 4DUXA 2H0PA 5ISZB 2Y69B 3QDJE 1SPDA 4KO9A 5EUOB 4L3ED 3WTXA 2XX1A 3LKOA 2XUWA 4WWKD 2J72A 4FHJA 4NKQB 1BA9A 1U3HA 1J1PL 1RMFL 2GHWB 3CFBA 4A2MA 4N1CA 4NXKA 1SVBA 5HYQA 2QQNH 4OGXH 1J12A 5E9DE 1FNEB 2CKNA 4YSCA 1J5CA 4W6XB 5ALBH 3D0AA 3MJ8A 4B60A 4FYRA 1RHHB 2ZAIA 3MRLB 4B9IA 3RWIA 4WUUE 1VB9A 3OKYA 1FVDB 5H8DA 4BFKA 4PJGA 2IAMC 4JN1H 4PWEA 3QFJE 3X3GH 5F6HI 4XGZB 1MNUL 3E9TA 4ZUSA 4KKBC 1KB9J 2OLDA 5M94B 1J8KA 1TTRA 5FR3A 2PCPB 1CG9B 4XO3A 3QQDA 3X3FL 2WTRA 1I3GL 2Q86B 3T6WA 1VZIA 4KO5A 1BBDL 1MJJA 3N1PC 5DD5H 1B9ZA 3ULVL 4HHGA 2ENYA 3KPSE 1E5ZA 2F19L 2HLFD 3TV3H 4BFOA 2CH8A 5IESH 4OIAA 3HC0B 4JRYE 4E41A 2R9HD 1XGQA 3AFLA 2D9CA 3LEYL 4NO2B 1YYLL 2HX9A 1N10A 3B7TA 5GHWL 4L5FE 4N2CA 2UXTA 3B34A 4TULL 4W1TA 2W59A 2XTSA 3SE3C 1GOGA 4F9LC 2A6KA 3QH3B 3ARBD 5JW4M 3HS8A 4ZFQA 4PYGA 4IEFB 3TPUA 1ZOXA 1Z9LA 3TBVA 2NLJB 3O6FA 2CZNA 3LSOB 4TUJB 2J8UA 2PYFA 5JPMC 5TFSL 3WTYA 2NY1D 4AYFB 2NTFA 2IQ9H 1CFTA 3AT9A 2H1PL 3F12A 2WNWA 4IBZA 1J0IA 2VXSL 2C3VA 3B3IB 4HLZG 3VE0B 3N85H 3ZDXB 1WUZA 2EEFA 1RZ7H 4YDIH 5LG6A 4N0UE 2JMRA 3V0WL 3SGEH 2X4OA 1LK3H 4JO3L 4W6WB 2YMXL 3IXAB 2A4CA 2XQYA 3NEXA 3QZWG 2B1AL 2CO4A 5PCYA 4JRYA 4E41E 1DBBH 3ABLB 4YBLB 3MJWA 1KV3A 1MZYA 1NMBH 1H3WM 3KH3A 3LN9A 3ULUC 1HNFA 3PDOB 4LCCB 4LSDA 1IMHC 5HHNA 4NJ9H 4YHLH 2OMTA 4XH2B 4QHMB 2FCBA 4Z0BL 2A9BA 4U0RC 1FL5A 5I19L 4XNQB 2FO4A 4FMVA 2HFGL 4K9JA 4LGPB 1AZNA 3ZZSA 4X7TA 4N8CL 1TYRA 4KXZI 3KPLB 3L16A 4BD4A 3BUBA 1FGVL 4U1LB 5HJDA 3BWAA 3L54A 4XVJH 5CEZL 3QPQD 2VXTH 5E6UB 5KYXB 3GLDA 1IGJB 3IMVA 4QXUL 4H40A 4P2OD 2WCGA 2JI3A 4RA0C 3N04A 4YS4A 1N6VA 5E1AA 4R7NB 3V4PH 1XIWA 2ESVB 2GFBB 2WQWA 5C0BA 2ED7A 1NIDA 4Z18A 4P04A 3SE9L 4LDCA 1G6RB 2I7OA 4UQ3A 4MXQD 5JIHA 4HFWA 3F62A 2KQNA 2EP6A 3RNKB 2NY6D 1WWBX 4NJ9L 3BAXA 2D7TL 4NRXA 4JFOA 4OZIA 4K23H 1HWGB 1RFDH 1UGKA 2AJZA 4JL2A 4TL5A 3K7UA 3WD5H 3US1A 1A1OB 4MMYB 4ZMTA 3G6JF 1W0WA 2VW4A 1QPPA 2EYTA 4ZMOA 2CIIA 4ZOAA 2DICA 4KX8A 5D72H 5ES4B 2GJRA 1PX8A 1NBZA 3V4UH 2P7TA 3WSQH 1EFXA 5DK0A 2EDQA 5F9DC 2H0EA 4YNYA 3QO0A 4TQ8A 1VENA 4ZS7H 3X3GL 3CZKA 1XIWB 2ESVA 2GFBA 1D5XA 2FSEB 4Z7VE 1KJ2B 1GIGL 1AMXA 1Y1UA 3EHBD 3N1QC 5I23A 1LGVA 5CXPA 1H5BC 1RZPA 1MFNA 5L8KB 5BOPA 3FT0A 4JM2C 1SOSA 3NDYE 5B8CB 4G6FB 1CUOA 1HQ4A 1KT2A 3AQZA 1BF2A 1VGEL 1UD3A 3FFOA 3OAUL 4OFKA 4ICXA 5KS9B 4K3EH 5EUOF 4MSWB 3IKCA 3VDCA 3I9AA 2I32A 4L3EB 3P30L 4HWEH 4WU7A 1C16A 4EN3B 4N68A 3VCLA 4QXVA 3LMJL 1PJ9A 2BP5M 1PFCA 5PAZA 1U33A 1RVFL 3GHBH 2Q2EB 4UI2A 4NS0A 1T0PB 1XAUA 1DVSA 2DF3A 2VDNL 2BSSB 3CTTA 3P9LA 4NT6B 5DK0B 5BO0D 1K3ZA 2CRYA 2HG5B 1NBZB 3OMAB 1Y6KR 2ZPKH 4I48B 4U1JA 1LEKA 2DMBA 2Y07H 1NSNL 4FQXC 4OGQC 1T5XB 4MAUL 4O02H 3BQVA 4WNQA 4U3CA 3CVCA 1EMTH 5BVPL 1MUJB 2C3VB 1OWWA 3MODL 1XB3A 3QDGB 3QISA 2XN2A 4Y5YA 1P7QB 3KG5A 2HP4A 3RZCB 3NGBC 5F9OL 2X3CA 5K69A 3KYNA 2YMOA 3VFGH 4NHCL 3O6FB 4RGNB 5F7DB 3HG1A 3HZMB 2EXYD 1KTLB 4FEMA 5HPMA 3UG5A 3O4LD 2LTQC 1SLUA 3HVDA 4LSRL 3VNYA 2ZYIA 3NTCL 4AJ0A 5CR8A 4A66A 3BQUB 3HE6A 3JV4B 1DQQA 3O2DH 1DQIA 3GINA 1WIPA 3ZE0F 4PLNC 5I6MA 3ARSA 2OXHA 3EG9A 4PRPA 5F1IA 3MXVL 1N5YH 2YQBA 2KC0A 4AG4L 5ESAA 4ELMF 1KB9K 4GRLC 4P2RE 4AEFA 5MHSD 2EYRA 2VLKB 4MCZA 4ZSOA 2YA2A 2O26U 4YSUA 1PZCA 1QRKA 3BZDA 3ASNB 2OMWA 4O02L 5F7HA 2FJSA 3VFSA 3JTTA 3UYPA 4K8RC 4Y8DC 1IAII 4D8PA 4QHMA 3D4CA 4E9VA 4PLJC 4JFEE 4YSPA 1BW8A 2FX7H 5D1ZC 3JWOC 4UZGA 3MRRB 4PV1C 1AIFB 4GBXB 3V9CA 1BFVL 1SMDA 1HWHB 4PP1C 3NIFF 4JFXB 5D1XC 3IPFA 5ICYB 3MRDA 4PH8A 4DUWA 3MRCB 4HKBB 4NKDA 3QDJD 4YOKA 4LESA 2IDCA 2DYPB 4OD2B 3CWGA 4XBPB 4HJ0C 5L4IA 3OMZA 1N5YL 1HZHL 4EO5A 2HPOA 3ECWA 4JFFD 4LOEA 5DD6A 2Z8WC 2ZG2A 4YHKH 1JGUL 2K4WA 5EORL 3QWNA 4JJ5B 1WG3A 3VA2C 4OCYL 1M05B 2WKOF 3BVXA 4TUJA 2VXVL 5TE6L 1ZXQA 1A7RL 4L1SA 4L4TD 2ROXA 4FG0A 1GGBL 3TBVB 3WI9A 4D7BA 2V5YA 4YXLH 4W9LC 3RWEB 2Z31C 1BV8A 2GIXA 3E38A 4I0PD 4QHUB 3AY4C 4PEEA 3O4LB 4TXVB 3VD2A 1N7MH 1X5MA 3EOAB 1KNOA 2JK5B 3G5YB 5J1TC 1KJ2H 1VPOL 1SJEB 3LRLA 3MGOB 4P59L 2QKSA 4PG2C 5LGHH 5HBBA 4KNSA 1MAMH 3ULAB 1DQJB 1Z3GH 1NIAA 5EOTB 1VFAA 3RDTB 1CCZA 2ZWNA 3P11H 5D2LA 5E8PA 2VW7A 1UWEH 4FQJL 3TO4B 5CWSB 1ZDSA 5E2UL 1QATA 4R90L 1FZMA 3LMJH 3A5VA 2JB6B 4QOKA 2IOIA 4MFHA 3MRIA 1ESOA 1OSPH 5ESVA 1O7DC 3H4FA 5EZOL 1G4RA 3UO1L 1FV1B 2ITCA 4XNMB 1OY3B 1RUKL 5F7NC 2H6PB 5AEAA 2Q87A 4DPAX 2NNFA 5KSAC 5D5ME 3EF7A 3U2SA 3G5VA 4F7TB 5JDJA 2FGWH 3G3LA 3DSNA 5LCVH 1VPOH 4PRHD 4Y4HB 1NGQL 2R1YA 4BFBD 5A40E 3WMSA 2NSXA 1NCTA 5I1KH 5DS2A 5GGQH 3NIGB 4BH8B 3RU8L 2AJUL 4M4PA 4ODTL 3DXAB 5HY9B 1ZPUA 4B9GA 4IOIB 1QRNE 2D0FA 3ARGD 2QPUA 2HUHA 1S7RA 5D1QC 2X4RA 3EDDA 4TMPA 1WIOA 4TQEL 4DP8X 3GSVB 3NZ8A 3EYSH 2G0KA 3ZUCA 1P2CA 1PZUB 1BXVA 5KN5A 3CXDL 1P6WA 5LBSL 2Z7WA 4WK4B 1FYTD 5HDBE 2DQEH 1JGIA 3MRBA 7TAAA 3HS0B 4QY8A 3RIAF 5IQLA 4GKLA 1OW0A 5I1EH 2VH5H 3LEXB 1IVTA 5AW4B 4XODA 5T1LB 4B50A 2DB8A 5A2KH 5AAPA 3RTQB 3TEYA 4YSRA 2XZQH 3APNA 5C0FB 1IE4A 2Z4QB 5FF6B 4FC3E 1A6UH 4R0LA 5TF1L 1P6AB 4B97A 2A6JB 1DSFH 2EACA 3MKGA 3QJHA 1TITA 1AMYA 2AK4E 3B2MA 2VDKH 2Q7NA 1NINA 2Z34A 1LO3H 2UYLA 3LNGA 2OCFD 3SDXF 2GDVA 1T66D 3MA9H 2UUDH 4HUUA 5IJCC 3OMNB 2NY2B 2F8IA 2YPKB 4JRFA 1UQSB 1Z66A 1BZ9B 1CGXA 4HDIA 1EJ8A 2VUYA 4QWWD 4PJ6A 2X5PA 3HNSH 1JGUH 4OKVB 2P5EB 4GS7C 3QJXA 5A16A 3D87B 4J8RA 3ZK0A 5AALA 4A7VA 2HWZL 2VN6A 3RIFF 3I75A 2R0KL 3FO9B 3QDMA 5DGQA 5F0PB 1FL6B 3ES6A 3GJEB 5BZWA 2Z1KA 3C6EA 4JFWA 3RWGB 3T3MB 3RAJH 3P2DA 1NCBL 4GG6E 1K85A 2PTVA 3TLRA 2IAMA 1FE8L 3ZW3A 2FAUA 4NBZB 1JN6B 3ABKB 3NACH 1IGFL 2DQHL 2BP0A 4ERSL 4FCAA 2CLZB 1LP9B 2WVTA 1RZGB 3AAZA 1UZ6F 4FXTA 1A5FL 3S4SA 5B4MD 1HXKA 1NCJA 1MRFL 3BXNB 3E8UH 1SDDA 4GG8A 1YEEH 5JHDE 4GH7B 5J5EA 1KB5B 1PD0A 3FQUB 6CGTA 3QDME 4ZFGL 2BW4A 3WNPA 1A6VH 1RV6X 3RILA 3IFLH 3WY4A 4XB8A 4DH2A 3L5XH 1GYCA 2EIDA 1T21B 1ZE3H 2WAQA 3KYAA 3L4ZA 2XV3A 3QXVA 3WUWA 3IU4L 3C5ZA 3QUMH 2CHDA