3WY4A

Crystal structure of alpha-glucosidase mutant e271q in complex with maltose
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
535
structure length
535
Chain Sequence
NMMWWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYDVSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKADWFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLDNMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSRPENLDFLKDLRALMDEYPGTTTVGQIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSASYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVCLYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPWTDGEQGGFSPVEPWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTRQKGDETLLCVFNLTGQEQQTTLPVEVASDLPVAHFTATRDGSTLTLPAYQAAFMQVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-glucosidase
publication title Structural analysis of the alpha-glucosidase HaG provides new insights into substrate specificity and catalytic mechanism
pubmed doi rcsb
source organism Halomonas sp. h11
molecule tags Hydrolase
total genus 185
structure length 535
sequence length 535
chains with identical sequence B
ec nomenclature ec 3.2.1.20: Alpha-glucosidase.
pdb deposition date 2014-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF11941 DUF3459 Domain of unknown function (DUF3459)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3wy4A03
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3wy4A02
2F7OA 3WY3A 1SMAA 1B0IA 1HXKA 1UH2A 3KEHA 2BXZA 1JF5A 1ODUA 3TTYA 2EJ1A 2FGZA 3UCQA 1PIFA 1JD9A 3BUDA 1QX1A 1AQMA 1W9XA 1UKQA 1CXKA 4JFTA 4MB1A 4OJYA 1UH3A 1MW2A 1KCLA 5E9AA 4CGTA 2E8YA 1ZJAA 2OYKA 4FMVA 4H7VA 2CHNA 4JFSA 3RIKA 4GI6A 1WPCA 2XN1A 3EDDA 1DHKA 5EMYA 3GTNA 2YJQA 1SZNA 4PEEA 1HTYA 5A6LA 3D4ZA 3II1A 3WDHA 4CN6A 2ZUWA 3K1DA 2NSXA 4LXFA 2EACA 3BMVA 3IJ7A 3CLWA 4PCTA 2GJRA 4U3CA 1QW8A 2F7RA 4AIEA 2PWHA 3CGTA 1KTCA 1V3LA 5E6ZA 3TTSA 6CGTA 4QAWA 1IZKA 1QI5A 1JIBA 2Y4SA 4U2YA 2OYMA 4FLOA 4E2OA 2DH3A 2XN0A 3UG4A 1KXVA 1KBBA 3IK2A 1GJWA 3VNZA 3CZSA 4GO9A 1UASA 3WNKA 2GVYA 3LRMA 2D2OA 1CGTA 2IGTA 1P6WA 1VFUA 4DO6A 4GKLA 1EHAA 3BVVA 3WEOA 3AXHA 4NXKA 3LX9A 1QI4A 1AMYA 1JL8A 4NZJA 1Z32X 2DH2A 4OKDA 5E1QA 1UD3A 2F1BA 2ZWZA 1HNYA 5HPOA 1BPLB 1CGUA 1KGXA 3HG2A 2ZIDA 2EABA 2F61A 3BMWA 2J25A 1XD0A 3K8LA 2DIJA 3BCDA 1RP9A 2EQDA 4H2CA 4ATWA 2GDVA 2XWEA 2ZUUA 3LPOA 1J0JA 2E9BA 1RPKA 2PWGA 4AEEA 3D51A 1KB3A 1XH0A 3H54A 4B9ZA 3DX1A 3A22A 3CZKA 1KCKA 1NM9A 3CV5A 3EDJA 3A47A 3KWXA 4PSRA 1EA9C 1TQWA 2WVVB 1XGZA 3CZNA 1OB0A 8CGTA 2WC7A 1QHPA 1XSIA 1WZAA 3BC9A 3DHPA 3GXFA 3VGFA 1BF2A 2Y5EA 3VSTA 3ZT6A 1PEZA 1R46A 1TMQA 4FLQA 5CGTA 1MFUA 1IZJA 1J0HA 2DIEA 2WCGA 4UQDA 2FH8A 2XIIA 1TQUA 3WELA 1UD2A 3AMKA 2CXGA 1AQHA 4JFUA 2OSWA 9CGTA 4DO5A 1KXTA 1G9HA 1MWOA 1UD8A 2YA1A 3GBDA 2GDUA 5DO8A 3OLDA 1XSJA 2C7FA 3CZEA 3FAXA 4JFVA 4UQEA 2AAAA 4W93A 1VAHA 2PWFA 4WF7A 5CGMA 3GXPA 3LPPA 5BRPA 2VUYA 4KMQA 4OIFA 1IV8A 2F7PA 4CN1A 3VU2A 1UD5A 5CLTA 3GBEA 2QPUA 4J3TA 3WDIA 1KXHA 4GQQA 2ZXQA 1KBKA 5CXPA 3L4VA 2V3DA 1VFMA 3UG5A 4UQCA 1CXIA 3BLBA 1PJ9A 3HG4A 5KEZA 1UD4A 1Q4NX 2XVKA 2D0GA 4J3VA 1R34A 2ZXBA 1JG9A 1XH1A 5E70A 4UOQA 1GJUA 3KE0A 1E43A 5HXMA 4GINA 3BAXA 1MW1A 2OSXA 3LXBA 4PSPA 1CXLA 3VSVA 1OT1A 1PPIA 2XVGA 3DDGA 3EDEA 3L4XA 1E40A 3CZGA 1JI2A 3DX0A 2OSYA 4FNUA 3ZT5A 1NOFA 4JL2A 3ZR5A 2ZX5A 1ZS2A 1JD7A 2QV4A 1M53A 2EADA 2ZUTA 1KWKA 3ZT7A 1JF6A 1QW9A 3S5YA 5A6MA 3WNMA 4GI9A 3WEMA 1SMDA 2WNWA 3GXDA 3TONA 1U30A 2D73A 5I5RA 1QPKA 1HVXA 4JCMA 1BVZA 1R75A 1U2YA 2GJPA 4JFWA 3WDJA 3S5ZA 2BHYA 4FLRA 2BHUA 3FAWA 3KLLA 3H53A 1KTBA 1UKTA 3ZO9A 2BY2A 5I0DA 2D0HA 2FH6A 2EO7A 1V3JA 1V3MA 2WVUA 1EO7A 1XCWA 2VRQA 5A2AA 2ZE0A 4M8UA 1JXJA 1PS3A 1E3ZA 2WKLA 2V3FA 2Z1KA 3VMOA 1CGXA 1PIGA 3A24A 2VT0A 4UQBA 1VIWA 4X0NA 1OSEA 1AVAA 2BY0A 3KL5A 3A21A 3BVWA 4M56A 3AJ7A 4AMXA 1CXEA 4FNSA 3VGBA 3WNPA 3RILA 7CGTA 3WY1A 4J3SA 3VGHA 1BVNP 4J3WA 4AYGA 3TOPA 2VR5A 2QPSA 1CGWA 1KGWA 1WE5A 4XB3A 4FNQA 1TQVA 1LWHA 2FE0A 4GI8A 3TV8A 1CXHA 3D52A 2C8NA 3GXMA 5TD4A 3CTTA 2F18A 1S46A 2EAEA 2ZX9A 3A23A 3AMLA 4AIOA 1MW0A 2ZICA 3VX1A 1EH9A 3D50A 2ZX8A 3BSHA 3ZQ9A 1PAMA 1UOKA 2QMJA 1HX0A 2WCSA 5E0FA 1O7DC 3IJ8A 4GO8A 3A5VA 1XD1A 2F2HA 3W38A 2XWDA 3ECQA 3VGEA 1VJSA 1JI1A 3ZSTA 1XCXA 1MVYA 3ZR6A 3BLKA 4UCFA 2OYLA 2YIHA 3WMSA 2BXYA 3EJRA 1T0OA 2WVSA 4AMWA 1XV8A 3BCFA 3UERA 3CPUA 2WVTA 3L2MA 3M07A 4B9YA 1HL9A 4LPCA 4TVUA 4HOXA 3BLPX 3GXNA 3VM5A 3WNLA 4BZYA 1LWJA 1RP8A 2AMGA 2FHBA 1C8QA 3BAWA 2FYVA 1JFHA 2F1AA 2ZUVA 3BH4A 1D7FA 3WENA 1CXFA 4UZSA 3VX0A 4AEFA 4GQRA 3CC1A 4UZUA 3HG5A 4HPHA 1EO5A 3DDFA 1A47A 2BHZA 1KGUA 1D3CA 4X9YA 3KLKA 1GCYA 3OLIA 1JGIA 2X2HA 4WLCA 1UA3A 3BVUA 1OGSA 3BAJA 3L4YA 5I24A 2WKGA 1XSKA 3L2LA 1BG9A 4J7RA 2QLYA 1TQSA 1VB9A 4H8VA 1CYGA 2F7QA 2ZUSA 5I23A 2YOCA 5A2BA 2BY1A 3DX2A 2YA0A 3IGUA 2E0PA 1UD6A 2D3LA 4CKQA 1MXGA 3BUIA 2VRKA 5A2CA 3OLGA 5BRQA 1QI3A 2QMKA 3WNOA 6TAAA 2NT1A 2YKKA 1CPUA 3BSGA 4JCLA 5CLWA 1OT2A 1JDCA 3LXCA 2G3MA 1V3KA 1KWGA 1CGVA 3GXTA 1PZ2A 4GIAA 1WZLA 2ZX6A 3L4UA 3AXIA 4CVWA 3BAIA 3WNNA 4FNTA 4KWUA 3D4YA 4NXSA 1WZKA 3FW6A 4UQAA 4HOZA 4AYSA 2NT0A 4UQ9A 4OGZA 2FHFA 5C8BB 3VMNA 1QHOA 1UA7A 1XH2A 4CN4A 1DTUA 1H3GA 3MI6A 1G94A 3HZ3A 3EJPA 3LRLA 1G1YA 1QWNA 1ZJBA 3VMPA 1WP6A 1M7XA 1BSIA 2XN2A 4HP5A 2WVVA 2PWEA 3BVXA 2YA2A 3GXIA 2ZWYA 3S2CA 1R33A 1HT6A 1WO2A 1B2YA 1KXQA 1HL8A 1U33A 2XIBA 3BAYA 2E4TA 3VGDA 3VM7A 1R47A 3BVTA 1BAGA 3L4TA 2Y2WA 7TAAA 4J28A 4DO4A 3DC0A 3LXAA 1HWWA 2ZXDA 1CLVA 3DX3A 2WPGA 1J0IA 4H8HA 3ZSSA 2OW7A 3EJQA 2E8ZA 2WSPA 1JAEA 3VSUA 4NX0A 3BUPA 1UH4A 4JL1A 1CIUA 1MFVA 3L4WA 3WY2A 1CGYA 2BY3A 1I75A 2YFOA 5DFAA 3KL0A 2X2IA 5E6YA 1J0KA 3W37A 3BUBA 1L0PA 3CZLA 3OLEA 3IJ9A 2V3EA 2ZXAA 4FNRA 4H8UA 1DEDA 1CDGA 2VNCA 4WSKA 1MXDA 3ZOAA 3DX4A 3BAKA 4LQ1A 2WSKA 4FNPA 2OW6A 2FHCA 2EEXA 4UNIA 2D3NA 2ZX7A 1GVIA 2WANA 5HDRA 2YFNA 4J3XA 1JDDA 2CPUA 1G5AA 4NZFA 1QWUA 4UOZA 4MAZA 4PCSA 2D0FA 3UEQA 3WY4A 1WZMA 3EDFA 1MW3A 3DHUA 2TAAA 1VFOA 3HJEA 4J3UA 3EJSA 1BLIA 3K8KA 4U2ZA 3UG3A 4BA0A 3HG3A 3VGGA 3VO0A 3WN6A 4FLSA 3EDKA 4WSJA 3VNYA 2X2JA 1R7AA 3EJUA 1TQTA 2ALWA 3A4AA 2Y24A 2G3NA 3A6OA 3KL3A 3LRKA 1UKSA 4AW7A 5F7UA 3WFZA 2XVLA 3H55A 2GUYA 3L4ZA 1E3XA 4J27A 1Y7VA 2PWDA 4HOWA 4U31A 4U33A 1JDAA 1JXKA 3EJTA 3K8MA 4NI3A 3QGVA 3BUQA 4HA1A 1TCMA 1PZ3A
chains in the Genus database with same CATH superfamily
2G5RA 4UV4H 4Y1AA 2LFEA 3ARVA 1B0IA 3CXHK 3KEHA 4FXGB 43C9B 3O9WA 1R0AL 2LTQB 3ZGHA 5AB1A 4PIBA 4HU2A 2WW8A 4WV1B 2P43B 3BFQG 1I9IH 5I0ZA 4GJTB 2GITA 3G9AB 1VGKB 3VFOA 3GKZA 3SDDC 5LN4A 4JFTA 3PREA 2WXKA 5KYWB 2AQQA 5H37H 4E5XB 4V2CB 1G7PB 3GRWL 4PJ9A 4LSPL 4JFSA 3UGUA 3O41B 1NKGA 1HAWA 4V1DB 3B9AA 4M1GH 4XPGL 3WLWD 2UZXA 3DYOA 1CLYH 1KLUB 3W9EB 1HTYA 3RHWK 5A6LA 3ZE1E 1TVBA 3C75A 1MVFA 3LS4H 2D31A 4FULA 1A6VH 3SCMA 2AERT 4KK6C 4AYDC 3ASNB 3QXDA 3MCKA 4U6YA 5ID0A 5BO1L 2HFFB 3HUJA 3MRRB 1DQQA 1T2XA 2AABL 1QW8A 1NCIA 3MJ9L 5HJGA 3LKQA 5K59E 1BQUA 3CLFH 2PWHA 1VEPA 3CGTA 4JY6B 1ZLSH 4FCHA 3O2VL 4FP8L 4L8SB 5JXEC 2EO9A 5EZIH 4QTIH 4RZCB 4A55A 1RJYA 3QDGA 3C8DA 2Y36H 4ELMF 3UMTA 3DECA 3FTGB 1S9XA 3F04A 4G11A 3TO4C 3VFGH 4J39A 3LRMA 2CIIA 1QRNE 5C08A 2WQ8A 4NYLA 3VFTA 2Q5BA 4JHBA 5F9DC 4OF6A 5IQNA 1IGML 5EULV 1KN2H 3D0LB 1JXDA 2NY4D 2XXMB 3LX9A 4OKDA 1M6OB 2OL3L 3HFML 1MN4A 5DDHA 4EMZA 5CBEB 1L6PA 4NAMA 3DGGA 4N8PA 3HLAB 2W60B 1E2ZA 2B16A 4M9OA 4PS4L 4YO0B 1YQVH 4ZS6C 1LE9A 2ZIDA 2J56A 1YG9A 5E8PB 1U8LB 3FFCD 1C12B 1M7DB 1M3IA 4OLVL 5KSAC 5D2NA 2VDQL 3GRBA 4RGMC 4P5MA 4CGUB 5HDWA 1J5OH 4ANWA 1IGTA 5CSBA 1YNLH 5E2VH 3HG1B 2YOAA 3NJNA 4DK3A 1XH0A 2Y07H 4HK3J 3DX1A 4GG6F 1G6VK 5AYUL 1KELH 3F64A 5ACMA 4DP0X 1NUNB 3CZNA 3IFOA 4P2YA 2Q0ZX 4DEPB 1QHPA 5IQOA 1EO8H 2WQSA 3GIVB 1ZA3B 1Q1JL 1QSFA 4N2CA 3RJQB 2KQNA 1LO5B 2R4SL 1FC1A 2VXQA 3SZKC 3MVSA 1B88A 1NMAH 4Y4KC 2BVUA 3PWUB 3GMPB 4JFFD 1SN5A 2A74A 3AC0A 3S37L 4WEUD 5DVMA 3QIWA 2QHRL 2GSIA 4D9LL 1GPOH 2YPLB 4OFKA 5EEXA 4MA1C 4RMTA 5FA3A 4L4TD 1G9MC 1MG2C 4JGMA 4EI6B 1FZKB 4F2FA 3VW3L 3LTVA 4PRNB 3EBHA 2DWTA 3L3OC 4UQEA 1T1WB 4D0BB 1XGQB 5ADPH 3HAEB 3WUWA 2JELH 1IV8A 1P53A 2F7PA 1NJ9A 4LCWD 1SJXA 4DCQB 4KV5E 3WDIA 5H2BA 1ZHLB 1FO0L 3S8WA 3GS4A 1MAMH 4PRPB 5DVLA 5IGXL 1MHHA 5DHYB 1KG0A 4IK7A 4KQ0A 4DAGH 4RA3A 1Q4NX 5GS1A 1MQKL 1TQCC 2DYPB 2PYEE 2DQJL 3IVKB 5D1QC 2HRLA 1MW1A 2XG5A 3JVFC 4RRPG 3UYRL 3MXWH 3MLPA 3BVNA 3U25A 1KLFB 3MRDA 4C54A 2CNZA 2BVPB 3BGFB 2BSED 3P9MA 2NZ9D 4L48A 1BMGA 2ICWI 1T0PB 1KY6A 2J8UA 3GJFH 2RHEA 2D8KA 4FERA 5F7EL 4LL4A 2AKRB 3CLEL 1ZS2A 1D5ZB 2QTEA 4F37F 4QEGA 4BWUA 5C09A 1N10A 2Q3AA 4U1GC 5HVGB 3BDYH 3OKDA 2JJUA 4RISL 2WP3O 1I3VA 3ECBB 5J57B 4QAMB 3QCVH 2JJVA 2QSCH 3EO0B 2TRHA 4FLRA 3UTSE 1INEL 5C0BE 5C0RH 5DRWA 1T4KB 3LEVL 3WL9A 3BYYA 5EIQA 5ISZD 3GKWH 2MCPH 4UOJA 1HYRC 1HILA 2VXTH 2YXFA 3QUZC 3VDAA 4DQOL 4FFZA 4IQHA 5IWLC 2V3FA 4JVWA 5ALCH 4EUPG 1A6AA 4P46D 3QUYA 4NHUB 2O6CA 4UQBA 2D7PA 3OJDA 4MLSA 2JMRA 2ZCHL 1NA8A 1FG9C 2BY0A 5KVEH 3ZE2B 1MELA 4X99A 3NCCB 3FO9A 2F5AH 4LSVL 2ZCLL 4PJAA 1DSWA 2APXA 3NPZB 2VDMH 5GGQL 3QVAA 4FQ1L 1EANA 4Z7WB 4MXVE 3E8UH 1NBQA 4A7GF 5DFVD 1F4WL 4NGHL 3GZPA 3P0GB 1F90L 2P8PA 3UH8A 4J4PA 3RGVC 3KXFB 1MFBH 4X6DE 1UM4L 1L0YA 4ZW8A 1I9RH 5GIRB 4OLZH 5A2FA 3CXFA 2C8NA 1IL1B 1DQLL 2JI1A 5LQBL 4F5CE 2ED7A 2ZG2A 1JF1A 2DL9A 2NW2B 2O6FA 3JWOL 4F7MB 3G08B 1JPFA 4HWBL 3TEXA 1VADA 3PJSA 4BFRA 2BC4B 5DJYA 5LB1A 2WBWB 2CMRL 2L04A 3C5XA 5D7LB 1TUPA 1A2YB 3K0WA 2ICWA 2QKIC 5C9JB 4Z3TA 5KSBB 4N2MA 3DXAD 2CLRB 2OMBA 2VL4A 3GZKA 3V6ZB 3VFSA 4RDQG 4M5YL 5C0AE 4I87A 4R96A 1O7VA 2XZCH 2JKNA 3VXRB 5LXGH 3QJRB 4LDOB 4JKNA 4P49A 3Q5TA 1TZIB 3R18A 5ALBL 4IOSD 5I1KH 3ULVC 2ITCB 1GGBH 1C5DB 2DQCH 4HK0A 4G8IB 8FABA 1S7XB 1BLNA 2NLJB 4L18A 1ZK9A 4AVHA 5E7BA 3VD1A 1X5ZA 3T6QC 1QR4A 1SMOA 1YUHB 1Z5LA 4XGZA 3O6KL 3A6BL 1NGXB 4KY1L 3NCJH 4V1DD 3ZKQD 2VISB 5J5EA 1LWJA 3T4YB 2D3JA 2GAZA 2XKNA 3MV9E 4U0RB 1HYSC 4WHYG 3ESMA 5AW5B 3ZE1B 4GKZB 5B3SB 5JW4Q 2IAMB 1UJTA 4GQRA 2IAAC 5DCCA 1CDUA 1ZCRA 2QVFB 4BYHA 4KJQD 4YHOL 4ENEC 1MVUA 3ULUF 4YDVA 4LB8A 1L6XA 4YSPA 4TVSa 2P3YA 1NLBH 2XTJC 4PJ8B 4U1IA 3TYFB 1U3YA 4BFFA 3NCWA 3MMEB 4DP1X 4F7CA 1AGFB 1FN4A 4ICWA 4IHOB 4ODUB 2J2ZA 5J11C 2C7UB 1QSZA 1WEJH 2YOCA 4LCCC 4ODHH 2J5LB 3O3EA 5I18H 1T5WA 4Z95L 4GG8A 4LSTL 1ZTXL 2YQ2A 1RUML 1PEWA 2JKXA 1A6ZA 2D3LA 1IC5H 3CQFA 3Q0HA 4YOKA 5K9QI 1DVXA 4R8WH 5CAYB 3QEUB 5IBLC 1J18A 4F58L 1NH6A 2Z8WC 3V0WH 1MJJA 1OW0A 3VCLB 4M6OL 4FEMA 4N1HB 1QRNB 5DYOA 1QFWH 3FB8B 4YPGB 2X3AA 1YECH 3BSGA 4Y4HB 4PCKA 5DMJB 1OT2A 1XR8B 1OAJA 4YSDA 2DZEA 1KNOB 2NY6B 5C7XL 4IBVA 3WIFB 4GRWE 3VWKA 1FYTD 4Z8FH 5T33L 3EH2A 4XXWA 3MZTA 3DYPA 1L7TH 3T2NL 2MOGA 2XC8A 1NDTA 3IJSB 4NZDA 4XNMB 1W72L 4EF3A 4Z7VA 3E6FB 1KEGH 3LKOB 3Q01A 4GP5B 1GW6A 1NEZA 2JCCF 2F74A 4D7BA 5C0NC 3T0XA 2CIKA 3HG1D 4DN4L 3MOQA 4E9LA 4JO1H 1E9PB 2R23A 2ZWYA 3OSKA 2Q3XA 2ADJB 3GEFA 4XO5A 3LPFA 4N2OA 1CK0L 5JUEL 2ZOUA 4MZRA 1DVTA 4PREB 2KZKA 2QVMA 4JY4A 5DZLA 5T5NG 5D7IA 4Z7UF 3MRCA 3NSFA 5EEVA 4M62H 4WFED 3WEAA 5K1JA 3QXAA 2IO5A 1J1PH 4FFYL 3X17A 4G8FB 3GGWB 4DKDC 3HZMB 1ERNA 1EZSA 2OW7A 15C8H 2BS9A 2NTSP 4PJGA 4K7FB 2BHFA 2YPLD 3JT0A 1YNKL 5DJXB 5GGTL 4UNTA 2YC1A 1IAKA 4OCYH 1H6UA 1N4XL 2MQCA 4QRFA 5LXVA 2ARJQ 2H1PH 2PKDA 2EZ0D 3RB7A 1LL1A 2VLLA 4TSAL 3EFFA 3T77A 4J6RH 5E6YA 1J0KA 2QHLA 5IK3A 2OTUA 2NYYD 4BK4A 2EE0A 2WWKO 3QJFB 1EBPA 1MCLA 4N0YL 1GY2A 2LE9A 3QYNA 3NCBB 4FYSA 4PRPD 2QGDA 3TP4A 3KCWA 3AG1B 4FABH 3KPSE 3EGDB 3RWEA 4XOCA 3UJJH 3E3QC 1XF4A 2VLRA 3VQLA 2PYEB 2DYPD 1A4KB 2D3NA 1X4YA 1GMIA 3RDTB 1TTBA 3MTXA 4CU7A 3HNTH 5DHEA 5EIVA 4DKFL 1G5AA 5LNEA 2YAOA 1H8SA 2G2NA 2OI9B 5BCAA 4L23A 1YYLH 4HUKB 4Q14A 4I3GA 3WCYA 3PHOB 4DTGH 2TAAA 1EK3A 1YPZF 2BZCA 4FCAA 3B2XA 1PYWA 3I3DA 4WY7L 4P2CG 3B9KB 4FG6C 5E8DL 1LEKB 4CUCA 4XNZB 4FXLA 3Q2LA 4G80B 4LLUB 5HJBA 1R7AA 4N9GA 2G0KA 3K91A 4QXUL 4BCXA 5CP7A 5KG9B 2XZZA 4HKXA 1MLCB 2A4ZA 3MGTA 1I7ZA 3L7EB 3LRHA 2MQ0A 4K3EH 5HHQA 5K1VA 3GI8L 2R29A 4FQLH 3OAUL 3RX9A 3WNIA 2VIRB 3UTSB 4YXKH 4EAEA 5C0BB 1LO3L 3I6KA 1BFOB 4MJ5B 5JO5A 1S4IA 2JXMA 3FCTA 2V2XA 2M2DA 4ZI8A 1PZ3A 4JDEA 4WWKD 4Z7OE 1A1NA 5E6ID 4F7KA 2HTLC 3INUL 4R3SB 2PO6A 1IC1A 2EJ1A 4N4YB 4A63A 1IAIH 1MHEA 4QXTB 2HFEA 1AGDA 5KN5A 1FE8L 5IMOA 3H2QA 4P59H 3SDXA 2J7LA 3KYOB 2GCYA 5HI4D 3WKQA 3UZQB 3B7SA 32C2B 1A14L 3S3BB 2DQFB 4TTDD 2AXJA 5FYJL 4CGTA 3EYUL 3KVDD 4RFNB 3UTPE 3CVDA 4EIZC 2IGFH 4ZDHA 2Q86A 1SPDA 3GMMA 4PRIE 5HTSA 4R7DB 2B9AA 4W9EC 5LCVA 2A6JB 5JPNC 1DJIA 3WFBL 1TCRA 2ZUWA 3HBZA 1DVQA 4X6DB 3CX2A 2NSXA 4AJWA 3QUXB 1U42A 3EGSA 5JQIB 5DZPA 1Q9OB 4M7ZB 2XFXB 5D8JH 1WFIA 2CJSA 3O4LA 2YZ8A 4LIQL 4H13C 5CZVL 5I1GH 1FBIL 4ERSH 3JV4B 5T1LA 5E2JA 4MKMA 1YAIA 5FHBL 1SY6H 4KTEH 1NICA 5D6DC 3GMOB 4BQ6A 1T1ZB 4NN5B 1AS8A 3IDXL 5K33A 2AJ3A 5AZ2L 3TA4D 3N42F 4AOFA 3EBIA 3RUGF 4EOWL 2VDLH 4WGWB 2E75C 3GSNB 4OLXL 4GIPD 4OVVA 3CMOL 4BCZA 4TUUA 3NZ8B 4MS8D 6PAZA 1UASA 3S36H 4WW1B 3HN3A 5IVNA 4XPHL 1JYWA 3QQ9D 5C0AB 2C34A 3BP4B 3EYVB 3FO2A 3CVIH 4QF1B 1FCGA 3VXRD 2I7OA 5JOFB 1Y0LA 3GSXA 3H3PL 5J9PB 5CZKA 2PCFB 1SJEB 3QZLA 3OXSB 4K0OA 3ZHFA 5FECA 4QRUA 5F7AA 3LZQA 4WW2F 3X14A 5EUOA 1G6RH 4HMCA 4HULB 3FU3A 2QQKL 2R1XA 4M29A 5BMFH 2Y3NA 25C8L 1F5WA 4N2FA 2EABA 3OPZH 2NMSA 5E8NA 5EU5B 1DP0A 1FRGL 1PG7H 2J25A 4R4BA 5KVFE 1XD0A 1X9RA 2HN7B 1REIA 3U0TB 1ZVNA 4M43L 3LN5A 3FT2B 1S78C 3FO1B 4HG4J 1KIRB 2BRRH 2GFBB 3MV9B 3VDBA 1OVZA 3KS0H 3GS0A 4XAWL 1VZHA 3R4RA 2Y72A 4OTXL 4KZEH 1QATA 3KPTA 4LL1A 2IAMD 4Y9FA 4YQXH 5I8CA 4H26B 2VDKH 5DEFA 1ZY9A 4RSYA 4DGVL 3D05A 4MNQE 5EOQH 3WFEH 3BC9A 4WWOA 3Q6FB 1A1OA 3VSTA 3W9DB 4HDIB 1BBDH 4PJ8D 4RQQB 1E5BA 2WBJB 3BZEA 2YD1A 2ARJB 1QFUL 2NY2C 4NZRL 4XTRD 1WIUA 5IB3A 3ILDA 2ZF9A 2EVHA 4NRXB 9CGTA 4DO5A 4WU7A 3M7FB 2XWTB 2ROYA 2OMTA 3R06B 4A6YB 2NYZA 3BN3B 1HZHL 2NXYC 1EEUA 3F84A 3OLDA 1MCOL 1QRND 3WKPA 4Y4HD 2ENQA 4JDZA 1RUKH 3V9CA 2GQHA 1S7RB 1IARB 3ZMRA 5IKCA 3LNHA 2NY6D 4GRWB 2ZYIA 3H9ZA 3L3JB 5LO7A 3SGKA 4OF8A 3V6OC 1JZGA 3VTAA 4HFUL 2P46B 5KAQG 3QRFM 5DR5L 5EO1B 1VFMA 1GTNA 2EYRB 3QQ3A 1G7JA 3UBHA 1R34A 2Z7UA 1MNNA 1RU9L 3TBWA 3MRQA 2Q7AA 1CTMA 1TJIH 4I4WA 1HSAB 1NGPL 4K55A 4BE5A 4WVRA 1V7NH 5LNGA 1AGCA 5M94B 2DLIA 2G60H 5TGBA 5I76B 4GBXA 2EYSB 3DX0A 5TH2B 5ES4B 1OGTA 2G4GA 2BZ7A 1FLRL 1Q38A 2W0KA 3CDGB 2GY7B 1HEZB 2VL5B 2QV4A 3NIDE 1KWKA 3OHXC 4XXCC 2JB6A 4AL8L 3QWNA 1QW9A 3IFLL 3WNMA 2ZYSA 3SBWA 3BUYA 4A38A 3ML8A 5GGSA 3GO1L 4FFWD 4DGWC 1KTKE 2PXYC 2WMPA 1MAJA 1BZ8A 4P4KC 2BDNL 1CYWA 3JWDC 4PWJA 5CSGA 3V4PB 2F15A 1T04A 3OBAA 2PETA 3F7PC 3ZO9A 1BGXH 3SE9H 2LAAA 3NMEA 1T6WA 3MV01 5ITBL 3NTCH 1NCAL 2IDTA 2J8HA 5BRZE 1S5IL 3MLXH 2E9IA 5IQ7H 4QYOB 2OJZL 3K72B 1CGXA 3QJXA 4OB5L 1FFNA 2G9HA 4PY7B 4JHZA 5MEQA 1AXTL 2SODB 3WKNA 4P5KB 3B2VH 4EI5B 4XO4A 5IB1A 3GJFA 5EZLA 1INQB 4DFHA 1IRAY 1NBCA 2YGVA 3KPPA 4ZUUA 1R9FA 5MEOA 2EEBA 3KPSB 1NFIA 4Z77A 3MLRL 1WDAA 2WNKA 4ALAC 3MJGX 3VD0A 2P5WA 4Y2OB 1KYAA 1A1MA 1Z9PA 3C6LA 2JB5H 4NC1E 1UURA 4O2FA 2I60H 2WXIA 4XPAH 3RDTD 3HE6A 2KH2B 1A7QL 3W81A 5E8OA 4B5EA 2O61A 3M46A 4ONFH 5GRYA 1DZ0A 2JQAA 2NUTA 5KWYC 1RZ7H 3B9KD 3K71B 3CVHB 2EDTA 2BOCB 2VDNB 4EUPH 1EXHA 3ALPA 2H9GB 3HZVA 4OF7A 4PJEA 4G1EB 2Y9RT 1YEEH 5HHVL 1H5BA 1LEGA 3TVMC 5IUCA 5L4MA 5I6PA 2BP8A 5AVUB 4ELME 1MY7A 3HUJF 3DUUB 3FT4B 4K9EH 1N8OE 1YEFL 3QEQE 3L17A 4N24A 4U3SB 1M42A 2ZNWA 2AS5M 5E8EA 3OKOA 4NO5B 3CK0H 4Z3IA 3UTSD 2MJWA 5C0BD 1UOLA 5BQ7A 2YUVA 3ARBC 4FYRA 3GRWH 2WXJA 4QHNB 4Z7OB 4BK8A 2OYLA 1GZPA 4DZ8B 2NY5C 4XPGH 1PY4A 5KVDL 2WVSA 1XV8A 1MOEA 4V2BA 2EDNA 3JV6B 3AAZA 1KCUH 4KPHL 1EWHA 2IPTL 4F93B 5BVJA 2WP3T 5HI5C 1Q0EA 2EIMB 2XZAL 3BKML 1MPAH 4HBCH 1BCIA 1H3PH 5E6SB 4X98B 1OAUL 2XQYK 1JGEA 1E9OB 5DI8B 2AABH 5ERWB 1YMME 3SPGA 4TRPH 4PRIB 3QRBA 2B77A 4FP8H 4P9HL 3RKDC 4LCUB 2DKSA 2VXSL 5AOZA 4N6RB 4Y19A 3QUXD 2HB0A 3ARWA 3C09B 5C0DB 2PCPA 1G4RA 3PWLA 4OAWA 3KLAB 4FAAB 3T09A 5I1DA 1UA3A 3CBKB 3FBQA 3I74A 1OGSA 4I3RH 1XBRA 2CSPA 3MRHA 1KTJA 2G2RA 3BEVA 3Q9PA 5DD5H 1BQ5A 2J1XA 4H5SA 3S35X 3O6FB 1LO2L 2ZUSA 5GSVB 5A2JH 5FHAH 3DX2A 4P46C 1A6WL 1BIIB 2IXQA 2VLKA 4OIIL 3IDNA 4LLVB 4QYAA 1QI3A 3T2QA 4OT1L 3RL2A 1P7HL 2N0KA 4XBEH 3TC9A 1G9ML 3V0VA 5C0AD 3RE0A 5LGYA 4ATTA 5CLWA 2ATPB 1OAZL 1V3KA 4P04A 4WHYH 5K9JH 3RIFK 2EDXA 1L0QA 1WWAX 4R97C 3NFNB 1L9MA 4XVJH 5DFVC 5HVWA 3DIDA 1E5YA 3DKHA 3JWNE 3QI9A 2OKMA 2DEWX 3IMVA 4KKLD 5AYUH 2CA3A 3U4KA 4MXWL 3KWWA 5AB9A 4OGZA 1CFQB 2ZAIA 2V9UA 1NIEA 4WHCA 2R2EB 4NQSA 4HUCA 3FB7B 4HS6A 4APQA 3JYCA 4WWID 1IC0A 3WIHA 1XEDA 3KAAA 3MV9D 4HEPA 2ATKA 3AM8A 3S37H 4JQXA 1IGCH 3A67H 4S0TD 1F8TH 4JPIB 5DO2D 3KJ6H 2N59A 2RALA 2XIBA 5BZDB 3GSUA 3MV8E 1JZ5A 1C7SA 5F7LB 3WE6A 2V8LA 4PV8B 5C86A 1RY7B 4NDMB 3VW3H 2WBJD 5E56A 4TOYL 2Y2WA 3ARGA 3HKFA 4ODSL 3KNBB 7TAAA 2J4WL 2J8UF 4JK0D 4F33B 4FXGC 4DO4A 2YLHA 1OCOB 2LTQC 1CLVA 3NFSL 3QZNA 4QRQA 5LDUA 1XGYL 1FO0H 1Y1DA 3BUPA 2VLJE 3O3BB 4KO5A 4WO4B 3ATBA 1KT2B 1GH7A 4A7UA 3WFDH 2CBTA 5CJQH 3KLQA 4JRLA 1J9CT 3MXVL 3ZL2A 4OUOA 4GXFA 2NX5E 4ZFOB 3H9SE 4FHKA 1DQDL 4ETQB 3LDBB 3MCLL 4I1PA 3DMMB 1CE1H 3MACL 2ICEC 4JMXA 5D55A 4L1DA 4ZAKA 4DPRA 5EF1A 2BSBA 1MH5A 1OGAA 2HWZL 4IJTA 5IREA 4N2BA 4IBLT 1CDJA 3X13A 3ZOAA 4FQXB 4O5LL 5E0QA 3RWIA 4JHVA 4JR9H 2YN3A 3ZGIA 3Q43A 2BSRB 3CLEH 3LQZA 5KJRL 3O3AA 2OW6A 2EEXA 1ZWIB 5F89B 2ZQKA 4HW6A 4UNIA 1BM7A 2R69H 3HMWH 4PJAF 2HG0A 1MEXL 3VXPA 4N2EA 1CFVH 2ZPKH 4IRSC 3MRKA 4L8SC 1XF3A 1ED3A 1SYSB 2APSA 3L5XH 1CZ8L 1RZFL 2X6BA 2ZXWB 3HJEA 4G6KL 3K8KA 4I18A 4BA0A 1INEH 1T80A 2XZQL 3LEVH 3NIDB 3ZW3A 4UU9A 1PZAA 4NSKB 4CVXB 4YLBA 4QOKE 3LRKA 5DJZA 5CD5D 1P1ZA 4OD2A 1WQVT 3CVCA 2COVD 3ZO0A 1Y7VA 1B3IA 2KLRA 1SLXA 4RNRA 5E4EC 5ICUA 3NPSC 3Q44A 4BDVB 2N4IA 1L9PA 4G7VL 2VXUL 1GW0A 2VN3A 3ULSA 4Y9EA 1ODUA 2E3VA 3QG7L 5F0LB 5G5DB 2W65B 4XB8A 2X6MA 1KUMA 3B9EA 2JLPA 4NGHH 5GGRA 3BUDA 3ULVL 2X9ZA 4G9FD 1F90H 3GHEL 4DEUA 4TYUA 5MI0B 3G3LA 2OMYA 3P2BA 2VITB 4N2HA 4Y0GA 1HL4A 1UH3A 2UZYA 3V4UH 3V5HB 4HC1L 2CQVA 5EIIA 4L29B 1DQLH 4F9LC 2AK1L 2W88A 1N64H 3KPSD 3HC2A 5C0IB 3EDDA 4JG9A 4UT9H 1I4FB 3DSFH 3GQFA 3CDZA 5KOVC 1EV2E 2MHAB 3ULUE 1N7MH 2G2PA 3RYMA 3GMRA 3SGJC 1HJCA 1TJGL 3QR2A 4YE0A 3FHQA 2CMRH 3D7PA 2DBLL 3KPQA 5A3ID 3QC6X 4P23B 1HH9B 5D7JA 1AYRA 1CFMA 1KBVA 1L9QA 1AQ8A 4MJ4A 1OM3L 2WWKT 3RWJA 2VDRB 1WFUA 1MREL 3N1GC 3WNJA 1FI8C 3OR6A 4M5YH 4J3BA 4BH7A 4HH9B 1SN2A 4W9HC 3TTSA 3VXSB 4LCYB 3HRZA 4ELMB 5JA9A 4KXBA 4XC3L 1QFHA 1N5YL 3QEQB 1E6OL 3VRJA 1PDKA 2NYYC 2WLJA 1W16A 1FSKC 1F6FB 1HCZA 4O02H 4UV7L 4OZ4A 3S35L 1AHWC 2QR0A 1ZVHA 1BXAA 4MAYA 3KCPA 3WEOA 1PLCA 3GBNH 3KWTA 5HYQA 2DJ4A 4K23L 5AL8A 1AMYA 3BGMA 3MKKA 5EO9B 1NINA 2JVUA 5I1EL 5BJTA 3A6CH 4HUVB 5F9OL 4RSVA 5DS2A 2EEDA 3DWTA 2JCCE 4YHOH 4B96A 3ZHDA 3UBFA 4Z7NF 3UTPD 4GG6B 3QPKA 4PI2A 2XWBB 1FZOB 3PP4L 1J0JA 1YMMB 3E1ZA 5A43C 4PRID 4W9ZA 3KH3A 1WHPA 3H9HA 4NKOA 1KCKA 4LSTH 1HK6A 3PL6C 4ZFGH 4KX7A 4WDIA 3AXLB 4Z7VF 2YGPA 3V8CA 1CBVL 1CD8A 4Z7UE 2Q3ZA 2JIXA 2BWDA 3RL1A 3QC5X 2QSQA 4UIMB 3NRQA 1MAKA 3ZHKA 1SJVA 4ZOEA 3NOIA 2COQA 1C08B 4FLQA 1HHHB 2VYRE 1F1GA 3GZOA 4PRHE 3O6FD 3U9UA 4E41A 4E9YA 4PV9B 4X80L 5EU7E 2FWUA 2E59A 2XIIA 3P3SA 1G6RA 1IGYA 1TQUA 4LL9A 1XQ4A 3QEGL 4JFUA 3G5ZA 2DQDH 2CM5A 5D7IF 5E4IA 3T0DA 3MRIA 5EA0H 2KC0A 4DKEH 3W39A 2D7TH 1IC7H 3DIFA 4NO0B 2R0LH 2UY6B 5JHDE 1UT1A 5B39B 1YMHA 5HHOE 2W80C 3H3KA 1DO5A 2AZAA 3MBXL 4ONOA 4WGVB 5CGMA 4PJGF 5FF6B 1R3JB 2P28B 5DJAA 4D8PB 3RZCA 2NY0B 1FLTX 3HNVH 5F6IB 4UTBL 2OCJA 5D6CB 2ZOKB 2VMCA 4Q4EA 1P5UA 2HH0H 4KDWA 3NZUA 3T8VA 3TU6A 4I0KA 3DUSB 3BFOA 5DQ9A 4NHCH 5JUEH 1FUNA 5CEXA 1ZHKB 3U46A 1GJUA 2FEDD 4JRYE 1DUYA 3REWA 2XJLA 3SHSA 4LDCA 3QORB 4NAJA 2I26N 35C8L 1YPZE 4HEME 3FUMA 1L9OA 1X7QB 3QIUC 2XRAH 3DVGB 3EDEA 1Q9LA 4N8VB 1UXWB 2Q6WB 3RI5F 3B2UC 2DLGA 4XP9H 4B60A 2OSYA 1IM9B 3BW9B 4HIEB 1OCRB 4M3HA 4MNQD 5LWYH 4RIRB 1G9NC 3VUAA 1WCBB 3MV8B 1ZGLM 1BW8A 4OKVB 3L48A 3ASWA 5AYQA 5B3JF 3A0OA 3BQUA 1NAKL 1ORSB 1SMDA 1QUNA 3M45A 4TSAH 4EXPX 2ADFL 5FR3A 5D5MA 1QPKA 2DOCA 3U1SH 2C9PA 3WDJA 2BERA 3BP7A 3LIZL 1JHLL 1TF4A 1SLUA 2H2PD 2VLJB 1NOLA 4WO4D 3AT0A 2P44B 1F11B 4JO3L 4UM9B 1D5BA 2WCPA 1VEOA 2ARWA 2O5ZL 5GQBA 1D2OA 5JDSB 5F7DB 2X2UA 3AU1B 3VMOA 3N6YA 3EW3B 5CU5A 2NX5B 3OKEA 3H9SB 4YWGH 4PTTB 3MLWH 1OSEA 2YD3A 3ME0A 4DKFH 5AD0A 5KVMC 3IB4A 1WAAA 3T8XB 3NSXA 2FUTA 1WA2X 2I5YL 1E4XL 2AI0H 3QT2A 5E8DH 2B1HH 4FQXD 2BMKB 5JMRA 2OQJA 3SDXF 1S5HB 3RVWD 5MEPB 2MRYA 1INDL 4ZX3A 2YUXA 2M83A 3VXRE 4XO8A 4H20L 2YBRA 1TZ8A 4KNUA 3L6FB 1WC7B 4XTRC 5EF3A 1TMCB 1KV7A 2ERJC 3MNDA 1CXHA 1MWAL 5E00B 5BOPA 4UDTB 1TTAA 2YD6A 3TNMB 2YQBA 4MJ6A 1J9SA 3FK3A 2ENYA 4L0PB 4M5SA 1UWXH 2UWEA 4F15C 4PR5B 2CUIA 3VQ2C 4FEIA 4AIOA 1JPGA 2B3RA 2CUHA 3L9RA 3RUGE 4RRPA 4Z78B 5LN8A 2L7QA 2IADB 3D50A 4QOKB 4ZMOA 5ICZB 4IMKC 3VFWB 4P2OC 2X3BA 4JHWL 2FJFB 2PCXA 4Q89A 3TIDB 1KPVB 4O2EB 3ZZSA 4IIQA 1JWMB 1S9VB 1S2EA 4NJAH 4UANA 1T66C 2JH2A 1NWOA 1MFMA 7FABH 3SOBL 2K7QA 4M1DH 4JAMA 2F8IA 2I9LA 5BRZD 3ZR6A 1IIIA 3TFKD 4XVSH 4UF7C 1F0LA 2NY3B 4G8EB 1VPOH 3F7QA 4JANA 5GRJL 3WFBH 5IMKA 2OMZA 4B9FA 5IG7A 1J1OL 1FBIH 4CRPA 5EUOF 1WBXB 4EUPA 4Z76A 2Z92A 4PG9A 4XH2A 3LKNB 1NFAA 4HHGA 2BNQA 4NKDB 4XCFL 1A8ZA 4PJ7A 3PWPE 2EVIA 1P7QA 2X4QB 3ZKXC 5F9JB 2H26A 4M4RB 4LSDA 4XNDA 1OOAA 3OKLB 4FFWC 3VX0A 4EOWH 2XWXA 4OLXH 4WGKA 4HPHA 1J5IA 3H8NA 3CMOH 3PDDA 4PW4A 4S0SD 1FZMB 3QFDA 5JZ7C 3MJWA 4B6ZA 2CJUL 1KXQE 4YE4H 4JRXD 3V5DB 3GRWA 3IS1X 1XZ0B 5LNDA 5F0MB 1CQKA 3TIEB 3L2LA 5JLZA 4CC4A 5SWQA 1U2CA 4LMQE 1WBZA 4JJ5B 5DJDA 1BZ9B 5AUMA 2IPUK 3QDJE 3HC3L 2VC2B 1UD6A 1YEDA 1AQKH 1ZS8A 1Q94A 2DMBA 2IH1A 1GC1H 3QEQD 4HSQA 3SZ6A 4DERA 4LVNB 4GW1A 5DWUL 5IJBC 4AX3A 4HQQL 1DVUA 1RZQA 1S8DB 3GLZA 1E30A 3LS5L 3CFJA 3MJ9A 5K9OB 4JFZH 4CL7A 5EEYA 1ZXQA 3RFZC 4XCCH 4ZPTA 1PZ2A 4TUJA 2B4CC 5A7BA 5IHWA 5IY5B 5I5IA 4NRYB 1G7QA 3UTTE 1FFPA 4KRPC 4XAWH 1EAQA 1MJ8L 1HCVA 2NNAA 3SPVA 2OI9C 4MSWA 3DJZA 1N3NB 4DGVH 1BFSA 4LEEA 6FABL 1B6DA 1G7MB 3VMNA 5DLMH 2JCCB 5DT1H 1BX2A 1J8HB 3MI6A 3SE4C 1IKNA 4JFXA 2CUAA 3B9KC 1KJVA 3OX8B 4LARL 2J3SA 1YMMD 3MBWA 4EE2A 3DV6A 3VMPA 4XMLL 3RNQB 3WMPA 4GAAA 1TXKA 2O6PA 2OL3A 1OP4A 5J3HC 3SJVE 3MRGB 2L0DA 2EUXA 1U33A 2CG9X 4Z7UB 5B8CC 4W4OC 3FU9A 1PAZA 4GEJA 4NCC1 5CR8A 1HZHH 3I9GH 1U8QB 2EVJA 3BXNB 1O9WA 2APTA 1BYPA 3Q3GA 4FRWA 4PRHB 4YZWA 2JI3A 4YGAB 5ENWB 1UADC 2ZUYA 4ADGA 3DJ9A 3MLZL 3VE0B 1MIML 4X5WB 3OQRA 3BJ91 5HGAB 4EDXB 5C0EA 4HFUH 4JFOA 2BIIA 4HUWB 3FZUC 3JWDL 4MB4A 4Z1PA 4LCIH 5CMAB 5EZJB 1PZDA 5JHDB 2Y7QB 1UYWH 1MZZA 4NO0D 2QEJA 5HHOB 5I8KH 1C5CH 3FFCA 4XMPL 4N0RA 4Y1AE 3JT2A 4RFNC 3VD3A 4PLJD 2FX8L 3KJ4C 4X6BA 1FDLH 4W9DC 5JIQA 1X44A 3PWNB 2NY0D 4PW9A 2G5BB 3BUBA 2RCSL 5D1XA 2R7EB 4X50A 3QPXL 5AVQB 2PTTB 1ZLWH 4WSKA 2WQVA 2IDQA 1VZGA 2QJDA 4XCYB 1TO5A 4PB9L 4HXBL 3O8XA 4ZX4A 2WXQA 4JRYB 3HVDA 3SODB 3TN0A 2Q76A 4ALAL 4R4FL 3QORD 2CR3A 5AOMA 1GVIA 3IXTA 4J3XA 4HKBA 1YPZB 1DDTA 3UAFA 3JTBA 4M1CC 4UOZA 3PDOA 5HPMB 5DRXA 1JN6A 1T3FA 3AQYA 1FO0A 1NGQL 1IM9D 3T6WA 1ORQA 3SE8H 4YVUA 3MGOA 5D9SA 5D7SH 4X6CA 3HUJE 3MV8D 2ETWA 4YSUA 1NCAH 1DANT 2EUVA 3MUHL 1R24B 5C0JB 4GUQA 2H4EA 4CMMB 3FQUB 2WLIA 4HJSA 1NMBL 4PWEA 5EORL 4AW7A 2OJZH 5DVNA 2XPYA 1PGRB 1HKFA 4P57B 4IGBA 3QZWA 4HOWA 1OAKL 1R5VA 3K4DA 1YLBB 4PJEF 4Z5RA 2EE9A 3QDGE 3N06B 2AQSA 3MA7A 4JZOB 1WLHA 2F0CA 2VLJD 4KKLC 4F8LA 5CJ8A 2AXWA 1SXNA 4UM9D 1K8IB 5C08E 5FLVA 2PW2A 3W3BA 1IB5A 3TTYA 2FGZA 3PPEA 2NX5D 3H9SD 3GSQA 3QJOA 2NY5L 3WHE0 5FGBA 4NPYB 5HJ3B 4M7LT 2CO7B 4LEBA 1PU0A 1UCBL 3MJ7A 2Z31A 5I1LA 3V5KA 4F7PB 5LG1A 4KJWD 4WJKB 3L2NA 4PH8A 3FOLB 4R26L 5L7XH 4DP2X 1J11A 2ITEA 1F4XL 3QAZB 2DTML 4ONHB 5CZXD 1RJZB 3CSYA 3DX8A 3H3BC 4B97A 1FV1B 4HGWB 3ZPDA 3G5XA 5D2NE 1A9BB 2ZYRA 1U91A 3MBEA 3FUEA 2WBJC 2AV1A 2BM3A 4GXUM 4ZQKB 5FYKE 5CEYB 5TE6H 2X42A 1KXVC 3L3KA 1W80A 2X4NB 3HZYB 1TKWB 2PTVA 4GRMA 4PGEA 2W07B 1D7CA 4X7TB 5F9WC 1KGYE 4HZ1A 4D0CB 3N42B 3KLHD 3RUGB 4BFIA 1QSFE 1RUQL 2VSCA 2E56A 3ARQA 5CFAA 5D1ZI 4QOKD 1UXSB 2GBTA 3LQMA 4XOEA 1Z6JT 2QQLL 4Y9GA 2FTAA 4GQ9L 4ZPVB 4FLOA 4PGBB 5KVDH 2D4FA 4TUOA 5FKAB 3GC3A 4PRDA 2Z91B 4XN2A 4W6YB 5GISL 2IPTH 5HHXH 2F1EA 4OZFG 4I3SH 2DDQL 2IGTA 4D2NA 1LK2A 3TBBA 4PJIE 4H8WH 3FB5B 4KK5D 5HY9B 4CBPA 2O5XH 3L8QA 2OPCA 3PGCB 4FC3E 2UXFA 2E7BA 2AMUA 1BXXA 1ZKAA 3DX7A 4MJ2A 2C3VB 3FU7A 4P9HH 2NY3D 4WU5B 4Z0XA 1S9YB 1UD3A 2VXSH 1CVSC 3ML9A 2AXGA 5EFIA 3UYPA 3PGFL 1VFBB 4JB9L 2P8MA 5GS3A 1ZV5A 4HLEA 1E28B 1K2DA 1QSEA 4P5TC 1OPGL 4U4BA 1XGRB 1KC5H 1LO2H 3PWPB 3ULUD 3WIAA 2AHIA 3QQ4B 3KWXA 4PMFA 2ZG1A 4OIIH 2X4UA 4P9ML 2P45B 4MCMA 3WS3B 1BF2A 3DXAA 2A6IA 3DJTA 3GB7A 1CB4A 1W0WA 2MCMA 3UTOA 3V6FB 2BOBB 2XYCA 3SDYL 5C09E 4RAHA 4Y5XB 2DMCA 3QDJB 1S9WB 5C2BL 4IOSA 3NSDA 4OCWH 1UATA 5B4MD 4WV1A 3ELAT 4WWPA 1L9RA 1H8OA 2BVQB 2XBDA 3CC5A 3GSNH 1V05A 4YJZL 1MWOA 2R2BA 4IM8A 2YA1A 4MXWH 4EI5C 1WH0A 2NR6D 4U6HA 5FUZH 3KYAA 4R2GC 4WF7A 2MCAA 3G6AB 4BK5C 5D1ZA 3O41A 4X42A 4BKTC 4NUJA 4M5ZL 4NQQA 4HG4K 5GRUL 3IETB 3ARXA 1R5IA 4YHPA 5KBMA 4GQQA 1I1AB 4JO4L 4WCYL 2V3DA 2EEAA 4P07A 4F24A 4UQCA 5L0QB 1F58H 2HKFH 4K9JA 4OIAA 2DQUH 4ABQA 2B14A 2N56A 1UQSB 4PJAE 4WJ5B 2DLHA 1CG9B 3MRRA 2EKSB 5LBGA 1M7IA 2CDGB 5T3XE 4GB9A 5FO9B 1DVFB 3D9AH 4TOYH 4R7LA 4F3FB 2OSXA 3JUZA 2CRIA 2QL1A 2VSDA 5BUGA 2BCKB 4E9WA 2WOBA 3SJVB 3U48A 5EU3B 3ZT5A 2K7PA 3FCSB 1XGYH 3GEWB 3P40A 4P3DB 5AAMA 3ZR5A 1ICTA 2H6UA 3EOAA 5DLLA 4NLHA 1OL0A 4HWEH 1U93B 2EDHA 4PGCB 1W72A 4W9LC 1ITCA 4HKJB 5FM5O 4PRHD 5JW5B 1NDGB 4MBOA 2PMZA 2WJ7A 4S1QH 4KVPA 3NGBB 3TONA 1DQDH 5HYSG 3FTYA 2NTFB 3MCLH 4HVBA 1GKEA 1FYTA 2E7HA 2ITFA 3MACH 3UPRB 2HG5B 1T0MB 2Z7ZA 1YDPB 1XCTB 3PXJA 2JTYA 1KWGA 1I53A 4O5LH 4P0DA 2AV7A 1X5LA 4A6YH 5JHDD 2FR4B 5HHOD 5I1JL 4KVNH 1G7HA 4Y1AB 3ARDC 4Z0BH 3O9WB 3A24A 4GS7B 5E9DA 4X0NA 4FFYA 3KL5A 1TJHL 2HKHL 4GRWH 2GITB 3IGFA 1QFWM 3SE3C 2XSKA 3TT3L 3CHRA 3VFOB 3LRSA 1MCBA 3WY1A 5D93B 3S97C 1SEQH 4HS3A 5LGJA 1U36A 2C9AA 4LDEB 5GGTA 5IB5A 4BCYA 2XZQH 3ATDA 4KMLB 4JRYD 4K8RD 2Q8AH 2X4RA 1TQVA 3TCLA 4X6FA 2HX8A 2UZXB 1T20A 5SWZA 4LLMB 1TVBB 2FQFA 3OGCA 1RCYA 3C5ZA 5ACZA 3SCMB 3TBCA 4P3WA 4RMVA 3QXDB 3MCKB 4U6YB 5C3LD 3AB0B 3HUJB 1RVFL 3NUKA 2KI6A 1MW0A 4LEXH 1J7VR 1DQQB 4MLIA 5LGKA 1K85A 1ETB1 4NO2A 4TS6A 3QG7H 1RK1B 4DWHA 4WNJA 5JR1L 2V7NA 2WO3B 4TNEA 3AROA 3UZEA 4Y4FA 3GHEH 1N6QL 3LRGA 1RAMA 4B7LA 1RJYB 1U92A 3K74B 3O4OB 3NSCA 3MFGB 3QDGB 5F7YC 3WMQA 3WN5C 1S9XB 4KRNA 4HC1H 3QK0A 1EFXA 1JK9A 2CIIB 4G6AC 1MRCH 4WEBH 5D72L 3TWYA 3V9EA 5C08B 1JZ4A 3UDWC 4NYLB 3IBEA 4Q52A 2FGWH 3VFTB 1HH6A 2P9RA 4GMSH 4HGKC 2K4AA 1EMTH 4LU5L 2CM6A 2QFRA 4NPKA 5FIEA 5DDHB 4HJTA 4Z7NE 1TJGH 2VSMB 1BZOA 2UUDK 2DLTA 3DGGB 3ARRA 4BKSC 4QRTA 1DQIA 3Q2WA 2FEEL 4QXGH 2UZPA 3RTQC 4W4NA 2ALAA 1KJ2L 5J56B 4I1NB 4IOFD 5D2NB 4Z7VE 1UWGL 4FG4A 5CR1A 5HHPA 4P5MB 3HNSL 4GLRH 5AL0A 4MTMA 1P6AB 1XF2A 1IGTB 1NBZA 4XC3H 4AEFA 3CC1A 3AVEA 1A6UH 2F8VA 2CLVA 1GCYA 3IFOB 1Z3GL 3AZUA 3K7UA 4XC1L 1G84A 5IMLA 5JQHC 4URKA 4UV7H 1QSFB 3CVHH 2QLYA 1VB9A 4WWKA 2D3VA 1MRFH 4N5EC 4LDLB 5E6IA 5D7IE 4Y16C 1F3DH 2E0PA 1U8JA 5SV4A 2A74B 4YVNA 5GJTH 3QIWB 3LDBC 5I1EH 3UBGA 3JUYA 12E8L 5DURB 3DMMC 3FRPA 4PJGE 3BRGC 1AZZC 4JHUA 5CILL 2VAJA 3BZDA 5ICXA 4JCLA 2G4EA 4YN3A 2X1WL 4PJIB 3QXUA 3LKSA 5I8OH 2SEBA 1KTRL 3ZMEA 3WUWB 4KOBA 3AXIA 1XCQB 2WTOA 3HE7A 3Q5OA 2B1OA 4CVWA 3ZRSA 1SJMA 2YLKA 1U6AL 4ZW3A 1NJ9B 2BVEA 4KWUA 2V5RA 2FO1A 1NIBA 2ED6A 3QWRD 5H2BB 4DP9X 3TH2T 1X5FA 2A77L 1BFTA 4M6AA 1DQJA 1MHHB 1KG0B 4MQTB 3W5NA 4U1SA 4WI2A 1IAIM 3T71A 5KW9L 3AREC 5E08H 5GS1B 1DDHA 2VLRE 5FM4A 3N0AA 2CO2A 2XG5B 4X80H 3PWPD 2WXMA 2E74C 3S2CA 1RQ5A 4DNLA 3MRDB 4H0HB 3FTUA 4N90E 3RY6A 5B38G 3QEGH 3NEOA 5J1AA 1OP3H 5B3JE 3P9MB 2VUOA 5KSBA 2NXZB 2YQGA 4Y5VB 5CJ5A 2FJUB 4HWZA 1R17A 5JPMA 3TT1H 3RPIA 4GMTL 5ADOH 1JPEA 4W70A 4AIZA 5C09B 2XETA 4D9RE 4HAFA 1IILE 3QDJD 3OKDB 2WXPA 5DD0H 1QLRA 3QISA 5J13C 4HWUA 1LQSR 3M1BB 1XR9B 2NLJA 5EDXA 1U8CA 1MFVA 5DRWB 3WL9B 5D5MF 1NGWA 3NABH 1SDDB 2YAHA 1HILB 4B95C 3CBJB 4FQCL 3KL0A 1KCRL 2B1AH 5DMKA 5ESQA 1FPTL 3PXHA 3TO2A 2VISA 1A6AB 5J89A 3QUYB 1VKXA 3BHBA 3OJDB 3UTTD 3ARZA 1K9TA 1ZK5A 4H25B 3SDXE 1DJGA 2OMNA 4X99B 3MV7A 3FO9B 4R4ND 1FA4A 4NC0B 1HWHB 5CN3A 3LH2L 4PJAB 1MFEL 4OD3L 4DGIL 4P23C 2GI0A 1BYNA 3LXUX 1WAAF 3QQNA 1MUJA 5CM1A 1DVFD 4PCYA 2EUWA 1KDIA 1IFHL 3SGDH 2BVYA 2Y6TE 2EXWC 2P8PB 3HC0A 2GI7A 5FUCC 3GSVA 4YHYB 4TVPL 1N6VA 1UACH 2BJMH 4L5FE 3H42H 3LIZH 1JHLH 3O4LE 1GOHA 1C5BL 1WICA 3VNYA 1V7MH 3FQ4A 1G0YR 3T0WA 2D03L 3GDBA 4PRBA 1JF1B 5CJXC 3FB8A 1K6QL 4JKPL 4Y4HA 2DMGA 1FWXA 2WTPA 1XR8A 1JPFB 1IIKA 1QVOA 1JV5A 2UWEF 1TQBB 3KYNA 1VADB 3PJSB 5I6MA 3MU3A 2KL6A 2WNGA 1U8MB 2GBUA 4GP8B 2P5EA 5G55A 1DO6A 3TFBA 4LPTA 2ICWB 3QHZH 3NJXA 1YNTA 5EBWA 4NLAA 4GRLA 1TCMA 1E4XH 1F18A 3VFSB 3VD5A 3FYEB 4N2DA 2GEQA 1UH2A 3FQTA 1YEHL 4MMXA 1ZV9A 1JF5A 1SOXA 2X2YA 3MUGB 4R96B 1M2VA 4J8RA 4Y1AD 3VXNA 3EHBD 4R7VA 3BKJH 3O9WD 4TSCH 5DK2A 4ZRGA 4H20H 3BD5A 3P54A 1XX9C 5DJ0A 3SQRA 3GIZL 4HK0B 5EUOE 4U7KA 8FABB 3OB0K 4LGRB 5DUBA 1BLNB 4NZUL 3T08A 4KTYA 3WO4B 1Z5LB 4L1LA 4XGZB 3RIKA 4GI6A 3ATFA 3X1GA 1JRHH 1UEMA 1V10A 1QAWA 5GZOD 3KHOA 5DC9B 5D70L 4X4YA 1M9WA 2GAZB 2XKNB 2ED8A 2K3HA 3I85A 2AQTA 1O6TA 5HHME 3HR5A 4G8FA 4JO2H 1M3JA 2WXFA 1WS8A 4PJ7F 5IBUB 3CHOA 1MVUB 5TE4H 4YDVB 2F7RA 2DM2A 2FJGA 2WKOA 2ZKXA 4U1IB 2V17L 1FC2D 2QADC 3TPKA 5I28A 2B20A 1DJSA 5AOIA 5CKGA 5DRNA 1FN4B 1RSFA 4RAVA 2J2ZB 5JOEA 4N6QA 3ZVVA 2UZIL 3O3EB 1NL0H 4XNYL 1T5WB 5T3ZL 4GG8B 3IK2A 1A6ZB 2EIEA 2B59A 3RY5A 3AT8A 3QDGD 1B4JL 3WNKA 4ES9A 2VDPL 4X4ZA 3JWNC 2ZP9A 4WFFE 3EXJA 1J1OH 1MJJB 2I69A 5B7FA 2VRAA 2DD8L 3FPYA 1C1EH 5DYOB 5C08D 2AANA 4OJFH 2DWDA 3EADA 4P4RA 2MTPA 1DBJL 3WI9A 3N55A 4KQ4L 3UO1L 1A4KA 2B4CL 4K3HA 4XCFH 1I8UA 3CUPA 1UT9A 3AFLA 3RDTA 4ZMTA 2DL2A 3WTUA 4XE5B 4Z7NB 1CGUA 3QCTL 2I9TA 5KVGL 4RRPM 3LN4A 4DKAA 1QFPA 3EJZD 2CJUH 2FT7A 4ODVL 1T03L 4BQCA 2VH5L 5DJCA 5E4OA 3TH4T 1L0XA 4UYQA 4RDQF 4NWTL 3GFUA 2OZNA 1OGPA 4I9WD 4FFVD 2OCCB 4Z7VB 3D51A 4P99A 3P4MA 3I50L 1NEZB 2F74B 5FYKD 4CSZA 3LMJH 2CIKB 2AQ1A 3L7EA 1R5WA 1TR7A 3DLQR 4OZFH 3U7YH 5KBLA 1XSIA 3FUDA 5I19L 2IIJA 5DWUH 1KIUA 4HQQH 3UTSA 4M03A 3BP5B 2WUCH 3LAFA 2FBJL 3LS5H 1KPUA 2JJSC 1QSFD 4JO5A 4JREC 5KSAA 4JY4B 1TU2A 4ZG1A 5D7IB 3MRCB 3MTRA 2B0SH 2R8SL 2WD0A 3FUNA 3QIWD 1KXTA 5TF0A 5E9NA 4PJGB 2OTWA 1ZANH 4ANUA 32C2A 2C3GA 3OL2A 3BEWA 3AY4C 1NCHA 4OCSL 3RTLA 4AEIH 1T7YA 3MGAA 1S7SA 2YC1B 1IAKB 4OGAD 1OP5K 1UUSA 4UMSA 3EBGA 2E4FA 1R6VA 4PD4J 1WCQA 4LARH 2VLLB 5CZXC 4BKLA 4NBYB 4Y2LA 4JFEA 3EFFB 4EZMA 3PFUA 3T77B 2WUBL 3LZFL 5IK3B 2OTUB 3NJKA 3ET9F 3HPJA 5KEZA 2HJKA 3CCHA 4KK8D 1N59A 5CHNA 3OJ2C 1NCWH 3FF8A 5FYLE 1XH1A 1T2JA 2Y0SA 4BQ9A 3CWGA 3RWEB 2VKWA 2YGOA 1XF4B 2VLRB 2P5WE 3IYLW 3L3OA 1X4ZA 1GGIH 3BGAA 1RSYA 5DVPA 4KXCA 1MIMH 2Y7SA 1MCEA 1NKOA 4O58H 2WXLA 4UTAL 4FNUA 1OF2A 3GSNA 3N41F 1PQZA 1GL4B 3A4EA 1RZ8A 1D5IH 2FQGA 1HKLL 3Q1SH 4W9CC 4PS7A 2NXZD 3J7HA 5B1CA 1P5VA 2R27A 2QVKA 3FT3A 2GSMB 5C0AA 2P49B 4N9GB 1VSCA 1JHKH 2VN7A 4PJEE 4QF1A 3IE4A 5CP7B 3V4VL 2A0LD 5C09D 3GXDA 4HKXB 3MGTB 3DVIA 2Z35A 4L1HA 4X6CF 4YC2C 1I7ZB 1R75A 1U2YA 3NIGF 4JFWA 5K9KA 1S7VA 4XI5D 4K7PY 3UACA 1IBFA 1Q0YL 5HHQB 2DV6A 3HR6A 1FNGB 4MGXA 5JW4R 4LASL 1V3MA 1P2CA 1V8HA 3I6KB 5JO5B 5I73C 2JXMB 4F2MA 3FCTB 2V2XB 3CN2A 4HXBH 4PB9H 5I6XB 5IHLB 1OTUC 4JDEB 4KI5F 3MA9H 4UAHA 1A1NB 4W81A 1TZGH 1AOHA 2PO6B 4DH2A 2VW4A 1KACB 4N85A 3QUYD 3FO1A 3SDCC 5GRVK 1MHEB 3BVWA 4JQIH 1FCCA 2CCWA 2HFEB 1AGDB 3FU5A 4C55A 5IMOB 5KN5B 1HHIA 5AYTA 3SDXB 3ULUC 2GCYB 1GIGL 2E9WA 1A7RH 4H26A 2VABB 1CICC 5IUSA 5FX3A 1BVNP 4OCLC 2MMXA 3U30C 2EH7L 3W9DA 2QPSA 2AEQL 5T3XD 4ZDHB 4AKOA 2Q86B 5BUPA 5IWLA 1KGWA 2JKLA 8PAZA 3GMMB 3QJQB 2LVCA 3TV8A 4NZTL 4HCRL 1P0SE 2YXWA 4J4PD 1TFHA 1TCRB 5SX5H 3O0LA 4MDJA 4Y19E 2ZJSL 3EGSB 3B8SA 3VRLF 3EAKA 2ENSA 4ANVA 2LLLA 3O4LB 1JGDA 4AGMA 4POZD 4LVNC 5T1LB 4AG4L 1P7BA 2DQTL 2ZX8A 3Q9QA 2A4CA 3HB3C 4JCWA 2FAUA 4KKAC 4HU8A 4HIIA 3BAEL 3HCVA 2AJ3B 5TQ0L 3ESUF 1M71A 3QG6A 4GAYA 4KAQH 5B22A 4C8XA 5JYMA 2H0JA 3DO4A 4K94H 4X8XA 3RGVA 2VLKE 1UCBH 2Q7YA 3QRLA 5DK3A 3R0MA 5K5YA 1YY9D 1JI1A 2H8PA 4ZQTA 4R26H 4OM1L 4UCFA 3FO2B 2YIHA 4AGOA 3EJRA 5I75B 1H9DA 1Y0LB 3GSXB 4NN6C 2XN9D 4G82A 1FFRA 4XXDA 4QRUB 1V5JA 2MKWA 4PV1C 3X14B 5EUOB 4BWTA 3M07A 2R1XB 4OM0L 3U7WL 5AVWB 1RZKH 1L6ZA 2QKIA 3QIBC 5AENA 1F42A 5E8NB 3IDMA 4R4BB 4WQOA 1XBDA 3FHEA 3HMXH 3QO0A 4LSQL 5CFHA 4HF5L 2AMGA 2FHBA 3TYGH 1C8QA 2FYVA 3LN5B 5HHMB 4AEHH 3BRDA 3II2A 2YAMA 5I8CB 3AQZA 3NBNA 1QKZL 4WLCA 5DEFB 2NDFA 4HC1A 4KX8A 2DDQH 2VW6A 1A1OB 3V4PL 1QPPA 5C6TL 4MAUH 3Q5YA 4H8VA 2RTTA 1BEYH 3WOVA 3BZEB 2A73A 4I0PC 3IGUA 1S7TA 3WXVH 3ARYA 3EO9L 5IB3B 4HGMA 4G9FA 3KS0J 1BAFL 5ILTH 2F5BH 4WU7B 3RG1C 4JB9H 2OMTB 1INQA 2H2SD 2I7SA 3IPEA 1SF3A 2P4AB 4WUKH 3RZWA 5F2FA 2HUEA 4JDZB 1OPGH 1UB5A 4TLUA 1MF2H 4NS0A 3B3IA 3RWFA 5IKCB 1EHKB 1Z9SA 4FNTA 2OP4L 3WFCL 4F8TA 4Z3JA 3D4YA 2VN6A 5DS8A 5K69A 1OGAE 4Q8BA 2NY1B 2X38A 4PGJA 1P7KA 3QQ3B 4NQVB 3U6XS 3FJTA 1G7JB 2EDEA 1MFCL 3TXAA 1G94A 2LU4A 2EDQA 2X1OA 5ESAA 1G1YA 3MRLA 3TBWB 3MRQB 1XO8A 3SDYH 4AQEA 4G1EA 2VDNL 4Y8AA 1IM3D 4I4WB 5GHWL 3IKKA 3MRBA 3OJVC 1P4UA 2FD6L 1AGCB 2R56H 3CX5J 3IF1A 4L8CA 4GBXB 5BPPA 1OGTB 3MLVH 4NEHB 5LHDA 1BOGA 1X4XA 3PF2A 4Y1TA 1YEGL 2JB6B 1U3HD 4BGLA 1FFOA 1L7IL 3APMA 3BUYB 3SGDI 5A6IA 5GGSB 4S1SL 4DZ8A 3MLYL 5GRUH 5JIDA 5MHSD 1B4LA 3ZLQC 3DO7A 2WMPB 2ENPA 3IU4H 2VC2H 4WCYH 3O3UN 4M4PA 3VYNA 1T04B 3ASOB 1K8DA 1LJMA 4NM8L 4HKZA 5AWNH 4GFXA 4KFZC 4UOW0 4AI7A 4OLWL 4EI0A 3MLUH 2WQWA 3LHPL 4JZJC 3QAZC 1DFBL 4IOFC 3P4OA 1FFNB 1L0PA 4ZXBC 2G9HB 2EYTA 2UVFA 3V2AR 2VZVA 3B37A 4MJIA 3GJFB 5EZLB 4ZUUB 3KPPB 1E4XI 1JZIA 5MEOB 2GC4C 2FHCA 2W81C 3C8HA 1NFIB 1XL6A 4Z77B 1BFVL 4M02A 1A64A 2P5WB 1A1MB 2VZ3A 3C6LB 4CKVX 4G9DA 4O2FB 3U2JA 4RGOH 4F1SA 4FQIH 4OQTH 3HE6B 3S8FB 4S11A 5EF2A 4N90D 5E8OB 4XB7A 3GZQA 1CLCA 1QNZL 4L4JA 5IFHH 2ODHA 2O61B 3S0PA 1W91A 4NQUA 4ODBD 2NUTB 4NFBA 4PHXA 4XNXL 3VGGA 3WG7B 5KAQF 2QFPA 4WSJA 2WB1A 2ADYA 3T8MA 4FG0A 3CIAA 1E65A 4QGYA 1JRHI 5E1AA 4QNPF 3HZVB 5I1JH 4PJEB 4WW2C 2Q2LA 4UIKL 2XVLA 4Y2NA 1H5BB 1LEGB 1RIVL 1RZJH 2GUYA 3CHPA 3CVBA 3H55A 2BP8B 3MQIA 4FXKC 4UBDC 4C56A 4D9RD 4DVBA 4XP6L 5J6GA 1DSYA 4MA7H 3K8MA 4JG1L 4TKWA 2FUQA 3S88H 3FTVA 3MOBL 5E8EB 3OKOB 1F2QA 2HT4D 1U8PA 2VDMB 3DBSA 1SMAA 2ZWNA 3PG2A 2H1XA 3ZTNL 4DETA 4DW2L 5BQ7B 1MY5A 1GAFH 4LE8A 2PLTA 2C9VA 2VMJA 1GZPB 2VE6A 5KVFL 4A7VA 2PO6D 1CXKA 4JZNA 4UYPA 3WXWL 2GEEA 2YBGA 3AAZB 4OJYA 4Q2ZA 5L8LB 3LIZA 4AXWA 2E9JA 5BVJB 2OYKA 4X0KA 2FK9A 3ZRCC 3L9EA 1AO7E 4N1CA 3D0AA 4MNQA 5I2IA 2IH3A 1H3XA 1A9EA 4ZOAA 1JGEB 2V2WA 2J73A 3WHE1 3MODL 4K8RH 2AGJL 4KK9D 3O2WL 4F7TA 1QTYT 2AQNA 3EG9A 2W9DH 5EPMA 1H3UA 2XBTA 3N9GL 3NT0A 1E5UI 3QULA 4F33A 5JR1H 2EACA 4H1LA 3BWZA 3X1BA 4Y19B 2HKAA 5E24E 3L5HA 1FVDA 2PCPB 3PWLB 3O4LD 1WBYA 4OAWB 5I1DB 3O3BA 1WS7A 5T1LD 4AIEA 3LD8B 5D72H 1EDYA 2AJUH 2G2RB 3MRHB 2HLAB 2OJEA 1OHQA 3BEVB 2IGLA 4GAGH 5E6ZA 5IHHA 4FS0A 4H5SB 4BFBD 4APXA 4E41E 1IZKA 4UWQB 2Y4SA 1T7WA 1HZLA 4FZ8L 1FIGL 3PQYA 1GJWA 1MWAA 2IXQB 2VLKB 4QHPA 4ACTA 5I6NA 1CN4A 3IDNB 3I9AA 3FSAA 1FJ1A 1U0QA 3RL2B 1I1AC 3ETTA 5L0QC 3V0FA 3V0VB 5DUML 2DQHH 1A65A 2UXTA 5D6DA 5IBUG 1QBMH 1Z32X 2QQNL 1HL5A 5E51A 3KG5A 4S2SA 1DVFC 1E2WA 4ZW7A 5DQDH 1MCIA 5CEZL 4CSTA 3QI9B 2GB2A 2H41A 3KWWB 3BSZL 1Z3GH 4RVBA 4XZ4A 4XC1H 1RL1A 1RP9A 1CLZH 2JF1A 4GYBA 4NQSB 3ZY7A 2AXFA 4HS6B 4APQB 5BOZG 1W8NA 2CJ3A 1KB3A 1JVLA 4P2RA 4QR7A 1MFNA 4EQ3A 3F85A 3H54A 1YN6A 2YGQA 3O6MH 2J1WA 3CV5A 1FNLA 5HHMD 1QRKA 5C0GA 2ATKB 5FK9A 1OCZB 1QQDA 1SXBA 1J9RA 1F3JA 1X5AA 1BQLL 5AVXB 3GSUB 3WE6B 1K3IA 3L1FA 2L3BA 5INDA 2X3CA 5BRZA 3BD3A 4XX1G 3ARGB 5F93C 3MCYA 3KH4A 5KSBF 1UD2A 3G6DL 4TSBL 4HLZG 2I85A 5D5ME 2HMIC 1G9HA 4JY5H 1Y1UA 3OMZA 3GBDA 2VJ0A 3AQDA 1CJYA 4K5NA 4WFFD 1J05B 4YPJA 4ETYA 4XN4A 4TNWF 1SHMA 1SVZA 2YEQA 5D93C 3QDAA 1Z3RA 3H4FA 4NB7A 4N2NA 2WGXA 4PJ9C 1PSKL 5J12C 3EUDA 2R4RH 4MQ7A 1CI5A 5CLTA 2K70A 3CU1A 4HPYL 2VR8A 5DA4A 1KBKA 4OZFA 4ZAKB 4AQ8C 4TL4A 1R1CA 1WAAE 1OGAB 4YX2H 1UM5H 3M17A 2VJXA 3PP3K 2NY1D 3SKJH 2D0GA 2IPUG 4N20A 4LVHB 4XX5A 2R59A 3C6SB 4K71B 3VA2C 3X13B 5JXAL 3D30A 4JRXA 2LU5A 2PUQT 3RWIB 1QTPA 3IM1A 3IRCA 3LQZB 3SCMC 3O3AB 4B9IA 2ICCA 2VDRL 5GRXG 1AFVH 3VXPB 4IW4C 3DURA 1ACZA 1JGUL 4URTB 5C07A 4R5XA 1ZHNA 1XF3B 1ED3B 1OAQL 4JL2A 2Z1PA 5FO8B 3GM8A 3NRPA 3CU7A 4I18B 4LPVA 2UWEE 5AW0B 1KCSL 3T3PF 4UU9B 2WAHA 4NT6A 2NOYA 1D9KB 5E6UB 2WO2B 4GAJL 3RQ3A 2IH9A 4MMZC 1FPTH 3FUKA 5DJZB 3TBYA 1P1ZB 4OD2B 2FL5A 4PVNA 4IEFA 4RNRB 2XWZA 4MX7A 5HVHB 3ABZA 1N70A 3T4AA 3VFUA 1EJ8A 3KPMA 4BQ8A 1BQHG 3LH2H 4DGIH 1MFEH 4OD3H 2Z1KA 3TEYA 3OHXA 3ULSB 1BZDA 4EN3C 2VT0A 3BP6A 1KN4H 2WWMD 4ZTPH 2OJ1A 1YNTF 1W8EA 1BD2E 1TTCA 1IFHH 4NJ9L 4XVUD 3OKKA 2PXYA 5GGRB 4L3EA 2QPFA 3WNPA 3O2DL 3QA3A 1MQ8A 1AD0A 2UZYB 3PDGA 5CNHA 3S4SG 5FDWA 4KKNA 5FYLD 5EIIB 5DD1H 1NMCB 1S3KL 3WTWA 5MEND 2D03H 3P1VA 5DVKA 7PAZA 2VXVL 1K6QH 4FNQA 2BNQE 2FDBP 2P5WD 3DK2A 2AITA 3CHSA 3C6LD 3CDZB 4YUEL 4HIHA 2Y3AA 4PJ7E 2BIQA 3F58L 3HE6D 2YPVL 5EZPA 3GMRB 3NEXA 1T2QH 4LKCA 3T2OA 3QJUB 3KPQB 1LNUA 3CTTA 1AKPA 3T2LA 1MCHA 2A74C 5D7JB 4WI7A 1OANA 3RWJB 3VH8G 1JNJA 3BYTA 3II3A 3OR6B 5CZRA 3EYOA 4CA4A 5EBGA 4TUKH 4BH7B 1ID2A 1JP5A 3TWCL 4K7PH 3WKML 1F4YH 3HRZB 1J1XL 1S7WA 1I8AA 2WKOF 1KCVH 2HP4A 3OD3A 4QI3A 4L0YA 4LPUA 1LDPH 2F2HA 3F62A 3VRJB 3RIAF 1PDKB 3MNMA 4JS7A 2HCZX 4NZUH 4U1NA 1IX2A 4S1RH 1VJSA 3U82B 5F7FA 3ABGA 4OZ4B 2QELA 1ANUA 1J9QA 1F45A 5HYSA 2QR0B 1I8MA 5FKPB 5BV7B 3TVMA 3KCPB 4AMWA 1ROCA 5I5JA 5GS1C 1II4E 5HYQB 1AG6A 3BGMB 3C6EA 4AV0A 4KO6A 4UM8A 1HE8A 5BOJA 5BJTB 3ZX1A 1ILUA 3B8YA 4N0CD 4HOXA 5KYUA 1JNLL 1AO7B 1OTTD 5GSRA 2F8XC 1YYCA 3GK8H 3ARBA 5IW1B 4OKVA 5HYIA 3UAEA 1SXCA 2F1AA 2A1WL 3PE9A 1AS7A 2VDLB 3H9HB 3GUTA 2P48B 4NKOB 1I1YA 4XNYH 3KVQA 5C92A 4ZFFA 2BHZA 3PHAA 1CF8L 3FN3A 1ND0A 2FIKA 4WDIB 4FQQA 4O9HL 5I71C 2G9KA 1F1DA 2GYSA 3BVUA 4ZFZA 1LE5A 2ZSVA 2VDPH 2JIXB 2VR7A 2LHAA 1NCGA 4Z18A 3RL1B 3RVUC 4A67A 1KBGH 2WKGA 1TJMA 1N6UA 3PABA 1TQSA 5EC1A 4NQEA 3S5LA 3TJEL 4N8CH 3U9UB 5A2BA 4E41B 2BY1A 3NFPA 3UP6A 2HPTA 4KQ4H 3MOAL 2NX5A 3H9SA 3QHTC 1G6RB 3BUIA 5DMGD 3G5ZB 2VLKD 3I6GA 3QCTH 1MG3C 3M86A 3MRIB 5KVGH 4KU1A 1GXEA 1CPUA 3W39B 1DE4A 3IFPA 1T03H 3SPHA 2VH5H 1YMHB 4GIAA 5TTRA 3P0VH 1D7BA 5DJAB 3RZCB 1ESOA 3BO8A 3I50H 4KMTH 2DI8A 5IHZA 1ZEAL 2FB4L 5AW9B 3KM2A 7PCYA 2NT0A 4UQ9A 5D1XE 3QI9D 2VDKB 1P5UB 1QHOA 3F7KA 1IE4A 4YHYC 5I15H 3DBXA 1DTUA 1H3GA 3B56A 5DQ9B 1PLGL 2PNDA 5CEXB 3BZFA 3U46B 1GSMA 1DUYB 1OE2A 4PWKA 5LLIC 3ZZ1A 4APQD 3IE9A 3ZDYF 2X7LA 2CKBL 2J1ZA 2NY7L 1JZDC 4G3YL 4HP5A 4OCRH 4XPFL 1PFCA 3DPBB 2R8SH 5FYKH 1Q9LB 1B2YA 4YHLH 1YEWA 3KR3H 1ZE3C 4OCXL 4GQZA 4RMSA 3BVTA 4X6CE 4R6UA 4V11A 4OCSH 3NIGE 1AKJB 4NNYA 2R0WL 3FU8A 4EDWL 4F8QA 1JNNH 2X4PA 3BQUB 3ARGD 2VXQH 2NCEA 1QUNB 3N91A 2FWSA 3W57A 4XMTA 3APNA 1QEWA 2AQ2A 5D5MB 3R4DA 5E5MA 5E1HB 3UCRA 1CVRA 3BT0A 1TNNA 3Q2VA 4KI5E 3E2HC 1QZNA 2A7BA 3BP7B 5C8JA 2PW1A 4JPKH 4IBYA 1AZBA 4JDVA 1RJLA 1TETL 1D5BB 3HS9A 1LDSA 3BN9D 3BIKA 4ABVA 4OZIA 4WFGE 3MYJA 1CMOA 3NZHL 4E36A 5AW8B 3ME0B 1WSST 4UQ3A 3IJ9A 4ZAKD 5AD0B 3E1F1 3PY9A 4CNIA 1VGEL 4XVTL 1OGAD 1HNGA 4NZ8A 3DVFA 3LNFA 2V5TA 4OVUA 4U4IA 3RX5A 2OV0A 1HKLH 2NUPA 1RIHL 3ETBF 2OQJB 1XZ0A 2QLVB 2XDHA 4BUGA 3RVTC 2NW3A 2DB8A 5AAWC 2YFNA 4ABUA 4L05A 5B7MA 2CPUA 3FHAA 3IMWA 2MKLC 3UC0H 3VRLE 2YBRB 1TZAA 3I2CH 3FQ1A 2GK2A 2ICEA 2J44A 1ASPA 4DGUA 1RMFL 3CPLA 4KH2A 1USQA 1AC0A 4YGVA 1VACA 4MJ6B 2EO1A 1IQDA 1VDGA 2UWEB 5KBNC 1YSOA 2ALWA 2NR6A 3R7QA 3MNWA 4DOHE 1EJ6A 1JYNA 1JPGB 2LLGA 3J07A 3L9RB 4XPTH 1D9KD 1OW0C 4YHZL 2DICA 4G42A 3H0TA 5JHMA 5B38A 1B4RA 4B9CA 1JPTH 2Y1AA 4EPSA 1GTFA 4IRSA 1U3ZA 4IIQB 4PM1A 1MCWM 1U58A 3VWKC 4HA1A 4Q9QH 4HJJH 3AG3B 3V4LA 3NVQA 4WKXA 2BXZA 1TLMA 3SPJA 5EUKB 4XXWC 4JAMB 2ZAHA 4OJDH 2I9LB 2ZYHA 3VU1A 3QWOA 4KKBD 4YAQA 2WOYA 3KMDA 4OQTA 4AMKL 4CVUA 5BNXD 4LQFL 4HCRH 4JANB 5IMKB 4J12A 2OMZB 1MW2A 1NCNA 5IG7B 2VO8A 1UHVA 1ZJAA 5IROA 1I1FB 3EYSL 3SY6A 4MA8L 3IWUA 4U7SA 2ZWLT 1EAOA 3ZIMA 4IJ3B 3B2DC 2LW3A 4EUPB 3DSNA 4Z76B 1CDHA 2Z92B 1QSEE 4PG9B 3GTNA 2O5YH 4XH2B 4Z3HA 3MUJA 3SQOL 1AOZA 1G87A 2BNQB 4OLUL 5TDNB 1YEKL 5E99L 5T3XH 3V95A 1IE5A 3L3GA 4TTGA 3UTZA 3V0HA 2GJZA 2B5IB 3BAEH 4PJ7B 4PTUA 1P7QB 4CILA 4LXFA 2H26B 4NCDA 1G1OA 1KENH 3BOVA 4EDXA 3K80A 3IJ7A 5T8IA 4PN6A 3FTSA 5D7JD 3QFDB 3PXLA 4ZS7L 3ULVF 1OCWL 4KTDL 1DJWA 3DXAE 3I02A 1CR9L 5EZJA 3U1PA 1I8LA 3W2DL 5JLZB 5SWQB 1OWWA 4U2YA 5H35A 2CALA 3GJEA 1WBZB 5DJDB 1NTDA 1RZGA 5AUMB 4F7EA 2AJYL 4XMVA 3UG4A 3SGJA 1KBBA 4NBXB 1YEDB 1ZS8B 2LR4A 3KPNA 1AIZA 1Q94B 2IH1B 5HI3D 5F21B 1YVLA 2BCMA 4GW1B 1CGTA 1J9TA 1YJDH 3EYQC 4Q58C 3RBGA 4UB0H 1F6LL 5E2WL 1EHAA 3LQAC 3CFJB 3C12A 5LBSL 4XNUL 3KWVA 2CGRH 3L9BA 5G4OA 4ZPTB 2DH2A 4TUJB 3RWGA 5KTEL 1ACYH 3HN5A 1G7QB 3T0EA 1C9SA 4PGDA 5HJDA 1FFPB 1H3TA 4EZLA 4XZUA 4NNPH 4HH8A 2AJVH 4YL9A 1CC3A 2F61A 2NNAB 3SPVB 1LD9A 4MSWB 2XQBH 2V5MA 3EH3B 2ZAGA 1AO7D 2F9BT 1AY1L 2E9BA 2IFFH 3KDPB 2HT3C 2F8OA 4JFXB 4NUGL 4ESKA 1KJVB 1M56B 5IESL 3MBWB 3RPBA 4KZCA 3DV6B 2HT2D 1U41A 1NM9A 1PLAA 4F8NA 2OL3B 6PCYA 3OTTA 5F7NC 3DTDA 4JM4L 4X7CC 5F3HA 5ANMA 3UJIH 5FGSA 3OQ3B 3MJ6A 1R3IL 5J06A 3LH9A 1B0RA 1VERA 1KJ2A 2OMUA 3VD7A 1YC7A 1NLDL 3Q3GB 2VDQB 5SWSA 3FSVA 1AGBA 3WTXA 4U6TA 3BPLB 3LCYA 2F19H 1EZLA 2E9GA 2BNUA 2AEPL 3VI3A 3TA3D 3HI6H 3DX6A 2CPCA 1FYTE 4NPYA 1E7UA 2RQEA 5G4NA 1BOYA 3INOA 3LV3A 3PL6A 4MVBD 1UD8A 4JFOB 5DJ6A 4Z7OF 4KVCH 2R15A 3SPCA 2X6AA 4HEPG 4XP5H 1KIPA 4JN1H 1DN0A 2CLZA 4ZODA 1A3LL 4QRBA 5EH1A 3FN0H 5IOPA 4Q6IA 1AIFA 3NDZE 5E9DE 4X6BB 1MRDL 4XMKH 3RZCD 5DTFA 1BVLA 4KK9C 5CXPA 5GHWH 3LHAA 3WJLC 3ORJA 5D1XB 2Y6SC 4UT7L 1MJUL 5AW2B 4MMYA 1JMXA 5E70A 2F53A 2TSBA 4OY9A 3RP1A 3P3YA 2OZ4L 3O8XB 4GINA 5DSCA 1YEGH 5LGHL 3TN0B 1JZ7A 2Q76B 4R83A 4HLZH 3N41B