3WY8A

Crystal structure of protease anisep from arthrobacter nicotinovorans
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
219
structure length
219
Chain Sequence
VNQSETPVKHIGKIFFTLGGSNYVCSGNSVTAANKSTVSTAGHCLNEGPGAYATNFIFVPAYLNGAAPYGKWTAKALYAPTQWASNGNMQYDTAFAVMNTLNGQKLADVVGSSGVQFNAARGLSYKSFGYPAASPFNGESLKSCSGTATNDPYNPQFATQGIPCNMTGGSSGGPWFIGNSSSGYQNSVNSYGYGSNSSTMYGPYWGTVIQSTYNTAAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease
publication title Structural characterization reveals the keratinolytic activity of an arthrobacter nicotinovorans protease
pubmed rcsb
source organism Arthrobacter nicotinovorans
molecule tags Hydrolase
total genus 65
structure length 219
sequence length 219
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2014-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3wy8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3wy8A02
3BN9A 2ZTZA 1OWIA 3AAVA 4GHTA 4IW4E 1DLKB 3CS0A 1NFWA 4YTAA 1FN8A 1CE5A 3Q3YA 1B7XB 3SUEA 4Y8ZA 2ODYB 3AW1A 3KHVA 3OY5U 2FTMA 4DIIH 4GVUA 3R0FA 2ZU5A 1Y5AT 2C3SA 3RLYH 2VIQA 1GHZA 3GCNA 1MKXK 4BAQB 2G4TA 1ZGIA 2ZFSA 1ZYOA 4Z0KA 4NIXA 2VB0A 2SGEE 1OSSA 1QA0A 1TALA 1WCZA 2BLQA 1SFIA 1BZXE 1NRPH 1GBBA 1QFKH 4FUIA 1F5LA 1FV9A 2ANYA 3TNSA 1MCVA 5ESTE 1G2MA 2D1JA 1ID5H 1N1LA 1AVXA 2AGEX 2ZGBH 1A5IA 1MTNC 3TK5A 2ZHQH 2TGTA 3M5NA 1GDQA 2OBQA 3MNCA 1ZPCA 2SGFE 3VB4A 1C5TA 1ELBA 1O3GA 3BF6H 2P3UB 1O2NA 2QF0A 3ZZ6A 4DY7B 1C9TA 3GDVA 1S0RA 4AFUA 1FLEE 2A5AA 3BV9B 1QR3E 1XKBC 1VCWA 4X8UH 3BEFB 3SI4H 2BY6X 2A4RA 2P3FH 1O2XA 3D49H 3GDUA 4DVAU 2R3UA 1ABIH 3PMHB 4HGCA 3NKKA 1TPAE 4ISHH 1OP8A 3RXAA 3SQEE 1AKSB 4Y10E 3SJKA 1PPGE 1QRZA 5JBBS 4ABDA 3ZVBA 1O5DH 1ZHPA 4ZKRU 1HFDA 1RGQA 3DUXH 7ESTE 5LGOA 2R0KA 4ESTE 4CHAC 1DY8A 2RG3A 2ZC9H 5L30H 2YNAA 2VVCA 3RC6A 5EQQA 1RS0A 1IQIA 1G2LA 1TX8A 4CR9A 1AVGH 2HOBA 1RXPA 3URCA 1JXPA 1C5LH 1GCDA 5EGMA 4NFFA 1VGCC 1GG6B 3GCHB 1YKTA 1DT2A 1BRUP 3QUMP 1DWBH 2Z9IA 4MNXA 1HAVB 1HLTH 1O36A 5C2ZA 3GY3A 4NCYA 3ZZ8A 1DLEA 2GZ8A 5JBCS 1HIAB 1ZMNA 1YLCA 1NRRH 8LPRA 3ATKA 4YLQH 1P2JA 7GCHG 2FOEA 1Q31A 2H6MA 4JYTA 4MPXA 4CRFA 1WTGH 2Z3EA 2WUBA 3ZVGA 2CMYA 1INCA 1GJ5H 1GI9B 4ABJA 3BTEE 4HZHA 5T6FA 3PO1C 3V12A 3ZZ7A 1GWAA 1GBHA 2ANKH 3P8FA 1HJAC 4JZFH 3DD2H 1DUAA 1AI8H 1GI3A 2XXLA 3A80A 1TBZH 2V3OH 2G5NA 2ANMH 1DUEA 2FOCA 4XFQA 1UVPA 5GWZA 1P12E 1YPEH 2GKVE 1ELVA 4K8YA 2ZTXA 1OOKB 2O9QA 1W8BH 4JCNA 1Z1IA 1GBDA 1BOQA 5CMXH 1D3PB 4DGJA 1HAIH 2YNBA 2ZP0H 3PM3A 1XUFA 1O3JA 1T8NA 5DJ7A 1HYLA 4X6NA 1IQHA 5FCRA 2XNIA 1O2HA 4XSKU 5DP9A 1TBQH 1UK3A 3S0NA 3GYLB 1GJ4H 3V7TA 8GCHG 1QL9A 2Z94A 5K7RA 1ZHRA 1TX7A 4XDEA 4X8TH 3EE0B 3VGCC 3RXRA 2ZPRA 4BAKB 2QY0B 1YC0A 2RA3A 1EZSC 1LQEA 3T29A 1GHVH 1CA0C 1L0ZA 1MAXA 1GI8B 2ZDAH 1PQAA 1NU7B 3E0PB 2FS9A 1AKSA 1GVZA 1Z7KA 2C8WB 5C3NA 4O9VA 2VIWA 4MPUA 5FAHA 3S7KB 1AFEH 1F0UA 2BX3A 3E91A 3VB5A 5E8EH 6CHAB 8ESTE 2VINA 4TWYA 3Q76A 5L2YH 2GDDA 5E2PA 1KSNA 1SQOA 1Z1JA 2GZ9A 1LPGB 1O34A 2O8MA 2FESH 1S84A 3EA9A 2FZZA 1IQJA 2SGDE 4X1QU 1OWHA 3SNDA 1J8AA 4MQAA 4ZKNU 3ELAH 2F9UA 3AVZA 2DE9A 2PUXB 4XBBA 1A5GH 2C90B 1QBOA 1UCYH 3A84A 2FOBA 2ZCKP 4B2AA 1KXBA 1SGIB 1RTLA 1A0HB 2BXTH 1HAVA 9ESTA 1O2IA 4X2XA 1IQFA 3D62A 1HIAA 4WMFA 2ZO3H 2HNTC 1UK2A 3UOPA 3BTKE 3M7UA 4MPWA 2A7JA 3TH2H 4DT7B 1EJAA 1C1PA 1EZQA 2ZHFH 3PTBA 3NPSA 1O2OA 3F9GA 2QAAA 4ZHLU 1D9IA 3RU4T 2QXHA 2A1DB 3RUOA 4ABEA 4I8JA 4UFEH 5HGGA 1J14A 2Q6DA 4WH8A 3U69H 2HVXA 2R0LA 1IQLA 1FY1A 2OC0A 1AQ7A 3MO6A 1CT2E 4MDSA 2ZI2H 2G00A 4FU8A 1UJ1A 2JH6D 2ZECA 3JZ1B 1O5GH 2WV5A 4Q7YA 3E1XB 1F0RA 1ESTA 1K22H 3DFLA 3QN7A 2BX4A 1C2JA 5JB9S 1SR5C 1P2KA 1O5FH 5GIBA 4JZIA 3FANA 1O2PA 2W7UA 4XBCA 2ZGJA 3MNSA 4DOQA 1O2QA 1QB9A 2OBOA 3SJ8A 2BDHA 1WV7H 1O2ZA 3ZZBA 1D3DB 1S83A 2EC9H 3BIVH 1TMBH 1CSOE 2BOKA 1T32A 1WQSA 2FWWA 1KLIH 4FUHA 4AG1A 1XXDA 2BMGB 3SU5A 2OQUA 1GI5A 1DM4B 4VGCC 1SHYA 1AGJA 1FMGA 2PUQH 3FAOA 3NCLA 2XWBI 2I6SA 2BD9A 1CHGA 3BG4C 1G9IE 3PLBA 1MU6B 1O0DH 4CREA 2BDBA 2CHAB 2QA9E 8GCHF 7KMEH 1XM1A 2J95A 2CN0H 2PLXA 1VITH 2GDEH 1ZTKA 2BDCA 3LH3A 1C5XB 4HFPB 4NIWA 2BY8X 3KEEA 3UOUA 2BLWA 4ZAEA 2AEIH 1ARCA 3PLKA 3TJOA 3E0NB 3QO6A 3KQEA 5BRRE 1O2SA 3HATH 3V3MA 1FJSA 4YT7H 4KELA 2W26A 2F83A 4U30A 3M7TA 2J2UA 4FVBA 1MQ6A 1ETRH 1ZOMA 5TCCA 1T31A 5DG6A 5I25A 4BAHB 3M7QA 1C5SA 3DFJA 3SJOA 3LGVA 4F4OC 2GVFA 1Y3YA 1WAYB 1RD3B 1FAKH 2STBE 1EATA 3SGQE 3ZZ5A 2V6NA 4JZEH 2WINI 4Z6AH 5DP7A 3LJJA 1DPOA 2VWMA 4IS5A 1CBWC 2ZEBA 3BTHE 1C5MD 2HNTE 2QN5T 1BMMH 2TPIZ 1DXWA 1VZQH 1L2EA 5F8TA 5A8YA 2IOTA 1ZGVA 1OKXA 2A0QB 4Y7BA 2DE8A 1O3PB 2BDAA 3LGUA 4BTUB 3P8GA 1O30A 2FO9A 1P9SA 3V0XA 1V2QT 1TBRH 2QC2A 5A2MH 1C5RA 4BANB 2AMQA 1GJ8B 1IQKA 1KLTA 2BD8A 4AYVB 1AB9B 3T5FH 4JYUH 4CRGA 1QGFA 4YOJA 4U2WA 1ZMJA 2JH5D 1HAXB 3LDXH 3SNBA 3T26A 6ESTA 2BY9X 1WTHD 2BY5X 1ACBE 3K65B 4B71A 1WU1A 2UUJB 4I32A 4ABBA 1AE8H 1S81A 1NFXA 1CO7E 2H5CA 1P9UA 2XBYA 1P05A 4X6PA 3L6PA 1LVOA 2UWLA 1O35A 5HM2A 1TONA 1K1JA 2HNTF 2A2QH 3BTQE 1K1IA 3P95A 1CT4E 1G3EA 1OYQA 2H5DA 2ZCHP 1SQAA 1P3CA 3D23A 1XUKA 5ABWA 4WMDA 4Y8YA 4BOHA 5ETXA 4AGJA 1DITH 1SGTA 1UTNA 3SJ9A 2JETB 1C5WB 2ZGHA 4IC5A 2B8OH 2Z9KA 3PROA 4Q80A 3MU4A 3VFEA 3IG6B 1HJ8A 3BIUH 3SV7A 1W2KH 1QCPA 2P8OC 1PQ8A 5JDUB 2JH0D 1XUJA 1PPFE 4K1EA 1ZSJA 1KXEA 3N7OA 2BHGA 1C4V2 1D4PB 3QTVH 4I8LA 3RXHA 3GCOA 3SNAA 1TGBA 1O3OA 3LOXA 1AZ8A 5FCKA 1O32A 1GGDB 3M36A 1FQ3A 2PR3A 2PW8H 2EEKA 1GBKA 2WYJA 2FX6A 1PJPA 1BA8B 4O03A 3LC5A 1CU1A 4NIYA 1TNGA 1NESE 2Y7XA 1HRTH 1K9OE 1TGTA 3A7WA 5IYTA 4OS6A 5GCHG 3OYPA 2ZFFH 2PKSB 3TJVA 1A0JA 5TCAA 1UVOA 2K1QA 3HGPA 1A1RA 3A87A 4HTCH 1PFXC 2XWAA 1S6HA 1GJBB 4R8TB 4OS7A 3SN8A 1H9HE 5AFZH 2FP7B 3CENA 3TJNA 2R2MB 4XOJA 1YGCH 2VIVA 2CF9H 1GG6C 1QB6A 3GCHC 4A1XA 2HRVA 5EPNA 2D26C 2BM2A 3RMNH 1G3CA 1SLVB 1TQ7B 2J34A 1RTKA 5CE1A 2BY7X 2G51A 1D3TB 1SOTA 3BTDE 4B73A 2ZA5A 1BHXB 3A88A 3LGWA 1L1JA 3ATWA 4UFFH 5EG4A 1PPBH 1O3DA 4ASHA 2OTVA 2EI6A 2ZPSA 1O5EH 1EAWA 2HALA 4AG2A 1O2JA 1EPTC 4KP0A 1TIOA 1ELAA 1BHXF 1J17T 1O2WA 2FXRA 3HKIB 3MYWA 1GDUA 3RXDA 3ZVAA 5SGAE 2VWNA 1X7AC 1C1RA 5LPRA 2ZHWH 1BTHH 3ITIA 4A7IB 1TX6A 2V0BA 1DWEH 3AAUA 1SLXB 1YCPM 2FS8A 2C8YB 1E38B 3PWBA 1Y8TA 1QNJA 1QBNA 1OS8A 3H5CB 4BAMB 3RU4D 3HK3B 4RSPA 3MNXA 3RU4E 3K6YA 3UNQA 2DUCA 1HAGE 2FDAA 3KQDA 4ABFA 2A5KA 1BRCE 1KLJH 4NZLA 4BAOB 2RA0A 1FXYA 4I8KA 3C27B 3RXLA 1UVTH 2H9HA 3P92A 2Y80A 1EJNA 5EW1H 1NN6A 2J92A 2BLOA 2P59A 1C4Y2 2AFQB 1V2NT 2VU8E 1ELDE 1S82A 3A81A 1P2QA 1NROH 2ZDKA 1G32B 1TOMH 1KYNA 4K60A 5JPMH 1O39A 1TNIA 2XCFA 1O3AA 4TY6A 1MBQA 3SORA 1BQYA 2Z3CA 1P57B 2EA3A 1EASA 1YPGH 1SGEE 3A82A 1FPCH 1V3XA 5CHAC 1W3CA 3LGIA 2W3KA 3FZDA 3A7TA 1ANCA 4FUCA 3SV6A 3TJUA 3U1IB 1QURH 3F1SB 1TNJA 4JYVH 4CR5A 2O8TA 1K1NA 1GHXH 1O5AB 4INLA 1HJ9A 1UCYK 1DVAH 1Y3WA 2J94A 1FNIA 3RXSA 3UNRA 2ODQA 1OWEA 2ZQ2A 1DY9A 1GMDG 1SG8B 2GMTC 1DFPA 1F5KU 1BB0B 2BQ6B 4Y8XA 1HAOH 1QHRB 4MPVA 1WBGB 4D9QA 4UFDH 4E05H 2FI4E 1ZLRA 1ZRKA 5GCHF 3V13A 3PMAB 1EOJA 2UUFB 4ISOA 1TYNA 1ANBA 1VCQA 2OUAA 5L6NH 1RIWB 3SU4A 1ESBA 2GX4A 2TGAA 1BMNH 1CHOG 2SNVA 3TH3H 1GBFA 2Y5HA 4UFGH 4JZ1A 2C4FH 1GPZA 3OX7U 3RXOA 1BMLA 4DW2U 1F2SE 1DX5M 5EQSA 4UDWH 2AIQA 4NGAH 3SHAH 2PTNA 3R3GB 4OS1A 1ZPZA 1P10A 1TABE 2ZHEH 1O2VA 2GV7A 2H9EH 4YESB 1W13U 1Z71A 1JRTA 1ZSLA 5E0GA 1FZZA 4BNRA 1XVOA 2BD2A 2QV1A 1MTWA 3KQBA 1TFXA 4DCDA 5FBEA 1EP5A 4SGAE 5BPEA 2GGVB 4D7FA 1UCYE 2SGAA 3SU0A 4ZHMU 4UONA 3EGKH 1CGIE 1EQ9A 3KNXA 4MVNA 1TA2A 5AFYH 1NC6A 1W10U 3TH4H 1BT7A 1K21H 1KDQB 5LH8A 1J9CH 1QL8A 2ZIQH 3ATLA 3ZVEA 2WPJS 8KME2 5LPEA 1UTMA 2I6QA 1MBMA 1O3BA 2W5EA 1TB6H 3TVJB 1Z8RA 3L3TA 1P3EA 3LPRA 2F91A 1EZXC 2ASUB 1MCTA 3H7TA 4K2YA 4XE4A 1H9LB 2C8XB 5JBAS 5I46H 3UUZA 2UUKB 3LONA 4IC6A 1D6WA 2CJIA 3LT3A 1O5CB 2CHAC 4MNWA 1BBRE 3VXEH 2ULLA 1KXDA 1TNKA 3BTGE 1JRSA 3S69A 1MH0A 1U6QA 2UWPA 2F9NA 5FXLA 1Q2WA 2F9VA 3WY8A 3ZVDA 3FP8E 4K5ZA 2FYRA 2SFAA 1K1PA 2BD7A 4F49A 2ESTE 1ZJKA 1BJUA 1BTWA 1OP0A 1H9IE 2AIPA 5L2ZH 4Y6DA 4IMQA 5DP8A 4FUBA 1N6XA 2FOGA 3KF2A 4WH6A 3ODFA 1HAPH 1C2HA 1MTNB 2PTCE 1V2OT 2G4UA 4NZQA 1H4WA 3ENSB 3RXQA 3A8DA 1G30B 1MAYA 1HUTH 2O8WA 3UWJH 1XKAC 1C2MA 2Z9JA 2BD3A 2BZ6H 4NWLA 2NU1E 1JBUH 1GMHG 2GCTC 3MWIU 5EOKA 3OU0A 2A5IA 1EP6A 3TU7H 1UTLM 1SBWA 1YLDA 1A2CH 4K69A 1GMDF 1UVSH 1A46H 4Y7AA 2P93A 4CRBA 3U8RH 1EKBB 1DOJA 3SHCH 4IN2A 3U8OH 1UMAH 2H2ZA 1YPHC 3AASA 1IQNA 1QQ4A 1C5YB 1OWKA 1V2ST 2F9OA 4TYDA 1S6FA 4UE7H 1FN6A 1CHOF 4NSVA 1UTJA 1L1NA 2W3IA 4M7GA 4FUJA 4AGKA 5EXNA 4GLYA 1WOFA 2OC8A 4CHAB 3HKJB 4NA8A 1O3MA 2XBVA 5FPTA 1T7CA 1C2FA 3ZYEA 1BBRH 2IPHA 3PB1E 3MO3A 3RXUA 2IN2A 3P17H 4AFQA 1ELEE 4WF8A 3VB3A 4A1TA 4WVPE 4H6TA 1AO5A 5EODA 1O33A 2XC0A 1KDQA 4Y76A 5DP5A 1OP2A 1DICA 1AFQC 1Z8IB 3BEUA 1BTPA 4GSOA 4X1NU 1LO6A 1O3KA 2NU4E 4YT6H 4A1VA 3MHWU 5DP4A 3FFGA 1D6RA 2CXVA 3A86A 4CRDA 4R0IA 3TGJE 1YCPH 4X2YA 1S0QA 3K2UA 4CBOA 3F68H 3LJOA 4ZROA 4B75A 3M61U 4D8NA 1AY6H 2F9PA 5FBIA 3M5MA 2BQWB 1GJDB 1F0TA 1XX9A 5AF9H 2VGCB 1Y5BT 1GL0E 3W94A 1P01A 1ELFA 1V2RT 1H8IH 1TLDA 1C5QA 2BZAA 2FOHA 1SI5H 1VITF 3HPTB 4XBDA 5DGJA 2HWLB 3LGTA 5DP3A 3ESTA 1RRKA 1OX1A 1V2VT 1J15A 3VPKA 4WY3A 4H42U 1N6YA 2QXJA 4IGDA 3S9BA 1O3HA 4IBLH 1HJAB 1QY6A 3QLPH 2ALPA 4IN1A 1L1GA 1GGDC 1E0FD 3F9EA 1GL1A 1JIMA 2Q6GA 2UUYA 1FY4A 4O3TA 2Z6BD 1ESAA 1E35B 4D9RA 1EJMA 1FUJA 1Y3XA 4MLFB 2QYIA 3GY4A 5PTPA 3MH6A 4B2BA 4K8BA 3BTTE 2TGDA 1IQEA 1M9UA 3RXCA 1QL7A 1C1WH 2XBWA 1Z6JH 1N8OC 3Q00A 2G8TA 1G37A 4GHQA 1TWXB 3GISB 4NA9H 3ZV9A 4MNVA 2ZDMA 2BDYA 1GMCF 4CRAA 3HK6B 1KY9A 3RXEA 2HLCA 1CA0B 2OP9A 4UD9H 5AVDA 1SGQE 3E3TA 2VWOA 1G36A 1H8DH 3CS7A 3TIUA 2WPLS 1LHGH 2ZPQA 1GMHF 1YPHE 1C2KA 1C1OA 4TPYA 1AVWA 1TA6A 2ZDLA 1EB2A 1PPHE 2R2WU 5E2OA 1S85A 1SGYE 3MU0A 3NXPA 3RXMA 4ZKOU 3RXBA 3GY7A 3TLOA 2EI7A 4OS2A 1FI8A 1SGFG 3GY2A 1TGSZ 1NZQH 1G3BA 3C1KA 3E8LA 1CQQA 4KKDA 1AUTC 5J4SA 1P06A 3SW2B 3ZZCA 3UR6A 1C5UA 5JB8S 1HNEE 1GI4A 1E37B 3LIWA 1EXFA 1IAUA 3MH7A 4TWWA 4A5TS 1BCUH 2GCHG 3A7VA 3URDA 2D2DA 2G5VA 4K1SA 1P02A 1NRNH 3SUDA 1BTUA 2B7DH 2FODA 4I8GA 3TITA 1TPPA 4NFEA 1O2LA 5JYIA 1P0SH 3I78A 4J1YA 1YM0A 1ZRBA 4TPIZ 2IJOB 1E34B 4YZUA 1ELTA 4O3UA 2GP9B 1QRXA 6GCHG 2FPZA 1QRWA 3KGPA 4FVDA 5E0HA 1EX3A 2VH0A 2AH4X 2FI5E 4E7NA 3UREA 5C5OA 3SI3H 3M37A 3FP7E 1OPHB 2Y7ZA 2ODPA 2Y81A 4RN6A 1SVPA 3UPEA 3QWCH 4Q7XA 1C1UH 2BQ7B 1ORFA 1NU9A 4LXBH 2QF3A 1IHTH 1MD7A 4H6SB 3ZYDA 1FY8E 1AU8A 1ELGA 3EYDA 1O3EA 1MKWH 3GCTG 7LPRA 2QGRA 3STIA 1ANEA 1XXFA 2V35A 1AZZA 2ZU1A 1P2MA 3ZZDA 1AE5A 2XW9A 2ZFQH 4LK4A 2A31A 2SGQE 2P16A 1Q3XA 3KCGH 1SPJA 2ZZUH 2AMDA 2VH6A 1GHAG 3BEIB 1AWFH 4SGBE 1GHYH 5G4BA 1ZMLA 2HPPH 2J4IA 1O2UA 2FLBH 3RM0H 2FI3E 1GCTB 3QX5H 2H1UA 2ZNKH 1WQVH 2AS9A 4FXGH 1V2TT 2NWNA 3MU5A 3SV2H 1DXPA 3O8DA 3LGYA 1MU8B 4AZ2B 2M5TA 1ANDA 1YYY1 1LCYA 1T8LA 2WPIS 1RIWC 2A2XH 1O5BB 3B23B 1WSSH 5EXMA 1DANH 1PQ7A 4JMYA 1GHBG 1TPSA 1O37A 2HGTH 1HBTH 1BTZA 1SC8U 1JMOH 4NSYA 2GTBA 1H1BA 1V2PT 2ZFPH 3MU8A 3RXFA 1RJXB 1C5OH 2ZHDA 4A6LA 1O3FA 3BSQA 3U9AH 1MQ5A 3M3VA 4NA7A 1LPZB 2BXUH 2VNTA 1DSTA 1LDTT 3U8TH 3S9AA 2B5TB 1O3IA 1XMNB 1QQUA 1ABJH 3SV9A 1V2KT 2ZGXH 3A8CA 3SGAE 4DURA 3A89A 2BOHB 5FX5A 1SFQB 1ARBA 1Y3UA 3TGKE 2UWOA 1NS3A 1HGTH 5T3HA 2Q1JA 3RM2H 2Q6FA 4BTTB 3PWCA 4ZKSU 2BLVA 1O3NA 2BYAX 4UEHH 2R9PA 2OCVB 1IHSH 1O2RA 2PFEA 1K1OA 2GCHF 4ZUHA 4LZ4B 3LKWA 1EAUA 3F6UH 3MH4A 3Q77A 2J9NA 2VVUA 4FU9A 1SGDE 3SUFA 3IWMA 1YPMH 3T25A 5J4QA 2AERH 2GT8A 2ZU4A 3T28A 1LTOA 1EB1H 2ZKSA 4GCHF 3FVFB 5A0BA 3P6ZB 3PTNA 3D65E 1O2YA 2YOLA 4OGXA 1GBIA 1J16A 6GCHF 3GY8A 2V3HH 3RXJA 4ABAA 4JZDH 2P3TB 1G3DA 4YM9A 3PMBB 2C8ZB 1C4U2 3EAJA 6CHAC 1LPKB 1HB0B 5F03A 1C5PA 1NY22 2AGIX 2QCYA 1AN1E 3M5OA 4B2CA 1V2WT 4MG3A 5C1XA 2STAE 5HMAA 3GOVB 2LNCA 1SB1H 1PYTC 4X0WU 5A0CA 3P70B 3MU1A 2XC4A 3UNSA 3QZQA 1A61H 3GCTF 2WPKS 4AB8A 1HAZB 1XUHA 3O8BA 5C20A 5EU8A 1ZPBA 3VXFH 1OYTH 1NO9H 1P8VC 1GHAF 3VB6A 1TOCB 3L33A 3RC4A 4DIHH 1GHWH 1V2LT 1JWTA 3SO3A 3UY9A 2ZGCA 2THFB 1ETTH 2P8OB 1C1QA 1THPB 3NK8A 2FMJA 4H4FA 1CGJE 4ABIA 4AFSA 1SGFA 3TK9A 1FAXA 2PGQB 3QZRA 6LPRA 2CGAA 1TPOA 3A7ZA 1C2IA 3RLWH 3LH1A 1LVYA 3PV4A 2PHBA 1DWCH 4TY7A 1UTQA 3IITA 2QXIA 1GHBF 3G01A 2WV4A 1AD8H 4ZXYH 4RKOB 1F7ZA 2B9LA 1BBRK 3A83A 4B74A 4QT8C 4HI3A 5C67A 4I7YH 1AWHB 3M35A 1PQ5A 3DT0H 4YO9A 3TGIE 1VCPA 3E90B 1ELCA 4E7RG 2GZ7A 3B9FH 1GJ6A 4ISLA 1A7SA 2AGGX 1O31A 1W0ZU 3SOSA 4OS5A 5HM9A 4ABGA 1LKBA 1QA7A 2Y5FA 3FZZA 1JOUB 2B0FA 2FTLE 1Z8JB 2TIOA 2FOFA 4NWKA 4X2VA 1GBAA 2FOAA 1YCPK 4ABHA 1ZHMA 1WUNH 5GDSH 1LVMA 5DPAA 3SU1A 3SU6A 5GXPA 1HDTH 1K28D 2XCNA 2VGCC 4PROA 1EUFA 2BVRH 1BRBE 3MI4A 2XBXA 2ZDNA 1VITG 1FIWA 3BTME 1EPTB 4Y0YE 1LHEH 2A4QA 1ZZZA 1THSH 2BVSH 1UTPA 2XRCA 1AUJA 4BXWA 2NU2E 1YBWA 5A8ZA 5HYOA 2OC1A 2SNWA 3F9FA 5A8XA 2R3YA 1C1TA 2ZTYA 1TE0A 1D3QB 1A5HA 5LPFA 2A7CA 3KQCA 1GI7B 3RMLH 1MKXH 1BTYA 3SNCA 3A85A 5EW2H 3ATMA 1QB1A 3A7YA 1O2KA 1P03A 1UHBB 1F5RA 1KXFA 1P2IA 1GBEA 3B8JA 1FDPA 1W11U 4U01A 2PKAB 2BB4A 1LHFH 1W7GH 2A45B 4AN7A 3BTFE 1PYTD 5F6MA 5F8XA 3UFAA 3UWIA 1HAHH 1UTKA 1BUIA 2ALVA 4FUGA 4JK6A 2FX4A 1SLWB 2HPQH 3LU9B 2OLGA 1LVBA 3EA7A 1C5NH 4ISNA 2VIOA 3SUGA 2P94A 2XTTB 1GMCG 4X1RU 4AX9H 4CBNA 1V2MT 3GICB 1GJ9B 1K1LA 4I33A 1C2GA 1MD8A 2Z9LA 1LKAA 2Z7FE 1YPLH 2FLRH 5DP6A 5GJ4B 2BD4A 4Y71A 4AOQA 1YPJH 5C5NA 2A32A 3PMJA 2RCEA 4GUXA 4X1SU 5A09A 5HXFA 2C93B 1PPCE 4MNYA 2BTCE 2WPHS 2FM2A 5B6OA 1UO6A 3I29A 3M3TA 4K1TA 1IQMA 1FY3A 1PPZA 2RDLA 5CHAB 1ZR0A 2VWLA 3SQHE 1SSXA 1GVLA 1KIGH 1Y3VA 3UR9A 3M5LA 3TK6A 3S9CA 4B76A 4JK5A 1JIRA 1NT1A 2TGPZ 1UVUH 1WYKA 4GPGA 3M3SA 3QK1A 1EZUC 3MOCA 5EQRA 3SU3A 1GJ7B 1A3EH 2AYWA 3CP7A 3SBKA 1SLUB 2A7HA 4Y0ZE 1EAXA 2A4GA 3Q3XA 1TQ0B 4ISIH 1AB9C 1CT0E 2G81E 1FIZA 1OWJA 1Z6EA 4BTIB 2GMTB 3QGJA 4ZMAH 4FUFA 5F8ZA 1HCGA 1MTSA 2ZDVH 3EA8A 4YLUA 1W14U 3KN2A 3EDXB 1GJAB 1XVMA 5EPYA 9LPRA 3W95A 3F9HA 2NU0E 1A4WH 3E6PH 1TRYA 2KAIB 2QIQA 1PPEE 4I31A 1MZAA 1EOLA 1ZTJA 1NTPA 3A7XA 1MZDA 1Z8GA 2BDIA 3T2NA 2Y6TA 3U98H 5GPIB 1EPTA 1VGCB 3I77A 4D76A 1GBJA 1V6DA 3U1JB 2J38A 1QBVH 1NPMA 1C9PA 3RP2A 3OTJE 1GDNA 3ZZAA 4GAWA 4ZXXH 1T8MA 3PYHA 5FPYA 2VIDA 1A0LA 2Y5GA 3OY6U 4Y79A 3RC5A 3RXKA 7GCHF 1IOEA 5FHTA 2ZU2A 2JETC 1BIOA 3P8OA 1BMAA 3TPIZ 1UHBA 1GJCB 4B1TA 4ZHAA 4KTSA 1K1MA 2PKAA 4CRCA 1HV7A 1QTFA 1C1SA 1B0FA 3PO1B 4KTCA 1VJAU 1TRNA 1LQDB 3MH5A 3K6ZA 3KIDU 3PLPA 5H4IB 3RXGA 1C2DA 1MKWK 1P2OA 1W12U 1BRAA 1BJVA 5DK1A 1K2I1 1GBLA 4YOGA 4THNH 1SGRE 4I8HA 2BVXH 3RXVA 5DO4H 1MTUA 1GBMA 1DS2E 1FONA 1GCTC 3ZZ4A 4OS4A 4RKJB 3NWUA 2PSYA 1CGHA 4NIVA 3SZNA 5JBTA 1C5VA 1KXAA 5C1UA 1BTXA 4FU7A 2PKSC 3DHKH 2OXSA 3SU2A 4X8VH 5ESBA 4U32A 1AMHA 5E0JA 3NUMA 2TBSA 1TAWA 2EI8A 4X1PU 2Y82A 3VGCB 1SHHB 1GI1A 1L4DA 2TRMA 3SNEA 1EAIA 4AB9A 1TNLA 2SGPE 1HXFH 1O3LA 1YF4A 2PSXA 3AW0A 3ZVCA 2CV3A 3LC3A 1P2NA 3GYMA 3VB7A 1P11E 1QIXB 1GI2A 1VJ9U 1KTSB 2NU3E 1DWDH 5T6DA 1P04A 1HXEH 1W0YH 4Y11E 1SGPE 1O38A 1CA8B 2VJ1A 3VEQB 5AHGH 1YPKH 4AFZA 3GDSA 1ZSKA 2F9BH 2XYAA 1THRH 1SQTA 4FUEA 3ZZ3A 4O97A 1O2GH 3QTOH 4IMZA 4CH8B 4E06H 2KAIA 2BDGA 4FUDA 2ZFTA 4K3JA 4LZ1H 2GCTB 1C1MA 3MNBA 1UK4A 3ZZ9A 2ZFRH 2JKHA 4YOIA 2D8WA 3MFJA 3ODDA 5TJXA 1E36B 2FOMB 3Q3KA 1MMJN 1SGNE 3GY5A 4Q7ZA 1GI6A 3FP6E 1QJ6B 4X2WA 4Q2KA 1DE7H 1LMWB 1NFUA 1UTOA 2QXGA 2WYGA 1FPHH 4GCHG 5EXLA 3MO9A 3S7HB 1S5SA 1OXGA 1O2TA 4AYYB 3BG8A 4BXSA 1A3BH 1LHDH 1NFYA 4A92A 4CH2B 3RXPA 1O3CA 3KL6A 3T27A 3UQOA 3TNTA 2ZCLP 1W7XH 2A4OA 2VIPA 3MMGA 1AHTH 4WJG2 3RMMH 2PV9B 4WXVA 4DJZB 1QJ7B 1AFQB 3SV8A 3STJA 3GY6A 3NZIA 1MTVA 2O8LA 1QJ1B 3RMOH 1AIXH 1C1NA 1TMUH 1C2LA 3HGNA 3UIRA 3ZVFA 1SMFE 3EQ0H 1IQGA 2Z9GA 1GI0A 4INKA 3ZV8A 1LHCH 3UQVA 1F92A 1C2EA 3E16B 4DG4A 4J2YB 4AORA 2BD5A 1TMTH 1ETSH 3SGBE 2ZU3A 2FIRH 2ZQ1A 3RXIA 5FX6A 2Z3DA 2G52A 1HAYB 1YP9A 2ZWLH 1DDJA 4VGCB 1CVWH 3MTYA 3BG4B 4KTUA 2GV6A 1SGCA 5A0AE 3ATIA 2F3CE 2CF8H 1KXCA 1RTFB 2ILNA 4LOYH 5T6GA 2WPMS 1P09A 1ZTLA 1GBCA 1O2MA 2GD4B 4WWYA 2ANWA 5DKMA 4OGYA 1TNHA 2W7SA 2FYQA 1XUIA 4INHA 2O8UA 1VR1H 2H9TH 3SJIA 3P8NA 3O8CA 4NG9H 3OSYA 3K9XB 3O8RA 2G55A 1OWDA 1NRQH 1ZJDA 3RXTA 1TRMA 3DA9B 1B0EA 3QDZB 1N8OB 2PGBB 4ZH8A 2GT7A 2XC5A 4X8SH 1SL3A 1HPGA 1MUEB 1Y59T 3A8AA 4X6OA 1V2JT 5K0HA 3UTUH 1B5GH 1TGNA 2ZG0H 2LPRA 2OC7A 1GVKB 1NM6A 3BTWE 5IDKA 1L4ZA 4WMEA 3T62A 3A8BA 1KTTB 1T4UH 2VVVA 1NRSH 2OD3B 1F0SA 2P95A 1V2UT 1C5ZB 1C1VH 1CBWB 1TGCA 4WXIA 1GBTA 3QGNB 5C1YA 3RDZA 2FEQH 1FY5A 2OQ5A 4MTBA 1Y5UT 2AMPA 3JZ2B 1RFNA 1SOZA 1XUGA 2OINA 1T8OA 2WUCA 5FPSA 2ZF0H 2PWXA 1BITA 3H7OA 1BDAA 1T4VH 4X6MA 1DSUA 4KGAA 4D7GA
chains in the Genus database with same CATH superfamily
3BN9A 2PP6A 1OWIA 2ZTZA 3AAVA 4GHTA 4IW4E 1DLKB 3CS0A 1NFWA 4YTAA 1FN8A 1CE5A 3Q3YA 1B7XB 3SUEA 4Y8ZA 2ODYB 3AW1A 3KHVA 3OY5U 2FTMA 4DIIH 4GVUA 3R0FA 2ZU5A 1Y5AT 3N7DA 2J97A 2C3SA 3RLYH 2VIQA 1GHZA 3GCNA 1MKXK 4BAQB 2G4TA 1ZGIA 2ZFSA 1ZYOA 4Z0KA 4NIXA 2VB0A 2SGEE 1OSSA 1QA0A 1TALA 1WCZA 2BLQA 1SFIA 1BZXE 1NRPH 1GBBA 1QFKH 4FUIA 1F5LA 1FV9A 2ANYA 3TNSA 1MCVA 5ESTE 1G2MA 2D1JA 1ID5H 1N1LA 1AVXA 2AGEX 2ZGBH 1A5IA 1MTNC 3TK5A 2ZHQH 2TGTA 3M5NA 1GDQA 2OBQA 3MNCA 1ZPCA 2SGFE 3VB4A 1W0KD 1C5TA 1ELBA 1O3GA 3BF6H 2P3UB 1O2NA 2QF0A 3ZZ6A 4DY7B 1C9TA 2KCAA 3GDVA 1S0RA 4AFUA 1FLEE 2A5AA 3BV9B 1QR3E 1XKBC 1VCWA 4X8UH 3F2GA 3BEFB 3SI4H 2BY6X 2A4RA 2P3FH 1O2XA 3D49H 3GDUA 4DVAU 2R3UA 1ABIH 3PMHB 4HGCA 3NKKA 1TPAE 4ISHH 1OP8A 3RXAA 3SQEE 1AKSB 4Y10E 3SJKA 1PPGE 2KCYA 1QRZA 5JBBS 4ABDA 3ZVBA 1O5DH 1ZHPA 4ZKRU 1HFDA 1RGQA 3DUXH 7ESTE 5LGOA 2R0KA 4ESTE 4CHAC 1DY8A 2RG3A 2ZC9H 5L30H 2YNAA 2VVCA 3RC6A 5EQQA 1RS0A 1IQIA 1G2LA 1TX8A 4CR9A 1AVGH 2HOBA 1RXPA 3URCA 1JXPA 1C5LH 1GCDA 5EGMA 4NFFA 3GS9A 1VGCC 1GG6B 3GCHB 4RT1A 1YKTA 1DT2A 1BRUP 3QUMP 1DWBH 2Z9IA 4MNXA 1HAVB 1HLTH 1O36A 5C2ZA 3GY3A 4NCYA 3ZZ8A 1DLEA 2GZ8A 5JBCS 1HIAB 1ZMNA 1YLCA 1NRRH 8LPRA 3ATKA 4YLQH 1P2JA 7GCHG 2FOEA 3OAAD 1Q31A 2H6MA 4JYTA 4MPXA 4CRFA 1WTGH 2Z3EA 2WUBA 3ZVGA 2CMYA 1INCA 1GJ5H 1GI9B 4ABJA 3BTEE 4HZHA 5T6FA 3PO1C 3V12A 3ZZ7A 1GWAA 1GBHA 2ANKH 3P8FA 1HJAC 4JZFH 3DD2H 1DUAA 1AI8H 1GI3A 2XXLA 3A80A 1TBZH 2V3OH 1E1QD 2G5NA 2ANMH 1DUEA 2FOCA 2IJD1 4XFQA 1UVPA 5GWZA 1P12E 1YPEH 2GKVE 1ELVA 2QF4A 4K8YA 2ZTXA 1OOKB 2O9QA 1W8BH 4JCNA 1Z1IA 1GBDA 1BOQA 5CMXH 1D3PB 4DGJA 1HAIH 2YNBA 2ZP0H 3PM3A 1XUFA 1O3JA 1T8NA 5DJ7A 1HYLA 4X6NA 1IQHA 5FCRA 4XRNA 2XNIA 3VG8A 1O2HA 4XSKU 5DP9A 1TBQH 1UK3A 3S0NA 3GYLB 1GJ4H 3V7TA 8GCHG 1QL9A 2Z94A 5K7RA 1ZHRA 1TX7A 4XDEA 4X8TH 3EE0B 3VGCC 3RXRA 2ZPRA 4BAKB 2QY0B 1YC0A 2RA3A 1EZSC 1LQEA 3T29A 1GHVH 1CA0C 1L0ZA 1MAXA 1GI8B 2ZDAH 5FL7D 1PQAA 1NU7B 3E0PB 2FS9A 1AKSA 1GVZA 1Z7KA 2C8WB 5C3NA 4O9VA 2VIWA 4MPUA 5FAHA 4ZCNA 3S7KB 1AFEH 1F0UA 2BX3A 3E91A 3VB5A 5E8EH 6CHAB 8ESTE 1UW7A 2VINA 4TWYA 3Q76A 5L2YH 2GDDA 5E2PA 1KSNA 1SQOA 1Z1JA 2GZ9A 1LPGB 1O34A 2O8MA 2FESH 1S84A 3EA9A 2FZZA 1IQJA 2SGDE 4X1QU 1OWHA 3SNDA 1J8AA 4MQAA 4ZKNU 3ELAH 4Q4LA 2F9UA 3AVZA 2DE9A 2PUXB 4XBBA 1A5GH 2C90B 1QBOA 1UCYH 3A84A 2FOBA 2ZCKP 3WWBA 4B2AA 1KXBA 1SGIB 1RTLA 1A0HB 2WSSD 2BXTH 2WHXA 1HAVA 9ESTA 1O2IA 4X2XA 1IQFA 3D62A 1HIAA 4WMFA 2ZO3H 2HNTC 1UK2A 3UOPA 3BTKE 3M7UA 4MPWA 2A7JA 3TH2H 4DT7B 1EJAA 1C1PA 1EZQA 2ZHFH 3PTBA 3NPSA 1NBMD 1O2OA 3KQ5A 3F9GA 2QAAA 4ZHLU 1D9IA 1NBME 3RU4T 2QXHA 2A1DB 3RUOA 4ABEA 4I8JA 4UFEH 5HGGA 1J14A 2Q6DA 4WH8A 3U69H 2HVXA 2R0LA 1IQLA 1FY1A 2OC0A 1AQ7A 3MO6A 1CT2E 4MDSA 2ZI2H 2G00A 4FU8A 1UJ1A 2JH6D 3OFND 2ZECA 3JZ1B 1O5GH 2WV5A 4Q7YA 3E1XB 1F0RA 1ESTA 1K22H 3DFLA 3QN7A 2BX4A 1C2JA 5JB9S 1SR5C 1P2KA 1O5FH 5GIBA 4JZIA 3FANA 1O2PA 2W7UA 4XBCA 2ZGJA 3MNSA 2WPDD 4DOQA 1O2QA 1QB9A 2OBOA 3SJ8A 2BDHA 1WV7H 1O2ZA 3ZZBA 1D3DB 1S83A 2EC9H 3BIVH 1TMBH 1CSOE 2BOKA 1T32A 2K8IA 1WQSA 2FWWA 1KLIH 4FUHA 4AG1A 2HLDD 1XXDA 2BMGB 3SU5A 2OQUA 1GI5A 1DM4B 4VGCC 1SHYA 1AGJA 1FMGA 2PUQH 3FAOA 3NCLA 2XWBI 2I6SA 2BD9A 1CHGA 3BG4C 1G9IE 3PLBA 1MU6B 3KYFA 1O0DH 4CREA 2BDBA 2CHAB 2QA9E 8GCHF 7KMEH 1XM1A 2J95A 2CN0H 2VBCA 2PLXA 1VITH 2GDEH 1ZTKA 2BDCA 3LH3A 1C5XB 4HFPB 4NIWA 2BY8X 3KEEA 3UOUA 2BLWA 4ZAEA 2AEIH 1ARCA 3PLKA 3TJOA 3E0NB 3QO6A 3KQEA 5BRRE 1O2SA 3HATH 3V3MA 1FJSA 4YT7H 4KELA 2W26A 2F83A 4U30A 3M7TA 2J2UA 4FVBA 1MQ6A 1ETRH 1ZOMA 5TCCA 1T31A 5DG6A 5I25A 4BAHB 3M7QA 1C5SA 3DFJA 3SJOA 3LGVA 4F4OC 2GVFA 1Y3YA 1WAYB 1RD3B 1FAKH 2STBE 1EATA 3SGQE 3ZZ5A 2V6NA 4JZEH 2WINI 4Z6AH 5DP7A 3LJJA 1DPOA 2VWMA 4IS5A 1CBWC 2ZEBA 3BTHE 1C5MD 2HNTE 2QN5T 1BMMH 2TPIZ 1DXWA 1VZQH 1L2EA 5F8TA 5A8YA 2IOTA 1ZGVA 2M2AA 1OKXA 2A0QB 4Y7BA 2DE8A 1O3PB 2BDAA 2JIZD 3LGUA 4BTUB 3F3BA 3P8GA 1O30A 3WW7A 2FO9A 1P9SA 3V0XA 1V2QT 1TBRH 2QC2A 5A2MH 1C5RA 4BANB 2AMQA 1GJ8B 1IQKA 1KLTA 2BD8A 4AYVB 1AB9B 3T5FH 4JYUH 4CRGA 1BMFD 1QGFA 3SZEA 4YOJA 4U2WA 3FKSD 1ZMJA 2JH5D 1E79D 1HAXB 3LDXH 3SNBA 3T26A 6ESTA 2BY9X 1WTHD 2BY5X 1ACBE 3K65B 4B71A 1WU1A 1KMHB 2UUJB 4I32A 5EJLA 4ABBA 1AE8H 1S81A 1NFXA 1CO7E 2H5CA 1P9UA 1FX0B 2XBYA 1P05A 4X6PA 3L6PA 1LVOA 2UWLA 1O35A 5HM2A 5C17A 1TONA 1K1JA 2HNTF 2A2QH 3BTQE 1K1IA 3P95A 1CT4E 1G3EA 1OYQA 2H5DA 2ZCHP 1SQAA 1P3CA 3D23A 1XUKA 5ABWA 4WMDA 4Y8YA 4BOHA 5ETXA 4AGJA 1DITH 1SGTA 1UTNA 3SJ9A 2JETB 1C5WB 2ZGHA 4IC5A 2B8OH 3MQKC 2Z9KA 3PROA 4Q80A 3MU4A 2JDID 3VFEA 3IG6B 1HJ8A 3BIUH 3SV7A 1W2KH 1QCPA 2P8OC 1PQ8A 5JDUB 2JH0D 1XUJA 1PPFE 4B6EA 4K1EA 1ZSJA 1KXEA 3N7OA 2BHGA 1C4V2 1D4PB 3QTVH 4I8LA 3RXHA 3GCOA 3SNAA 1TGBA 1O3OA 3LOXA 1AZ8A 5FCKA 1O32A 1GGDB 3M36A 1FQ3A 2PR3A 2PW8H 2EEKA 1GBKA 2WYJA 2FX6A 1PJPA 1BA8B 4O03A 3LC5A 1CU1A 4NIYA 1TNGA 1NESE 2Y7XA 1HRTH 1K9OE 1TGTA 3A7WA 5IYTA 4OS6A 5GCHG 3OYPA 2ZFFH 3DSPA 2PKSB 3TJVA 1A0JA 5TCAA 1UVOA 2K1QA 3HGPA 1A1RA 3A87A 4HTCH 1PFXC 2XWAA 1S6HA 1GJBB 4R8TB 4OS7A 3SN8A 1H9HE 5AFZH 2FP7B 3CENA 3TJNA 2R2MB 4XOJA 1YGCH 2VIVA 2CF9H 1GG6C 1QB6A 3GCHC 4A1XA 2HRVA 5EPNA 2D26C 2BM2A 3RMNH 1G3CA 1SLVB 1TQ7B 2J34A 1RTKA 5CE1A 2BY7X 2G51A 1D3TB 1SOTA 3BTDE 4B73A 2ZA5A 1BHXB 3A88A 3LGWA 1L1JA 3ATWA 4UFFH 5DSFA 5EG4A 1PPBH 1O3DA 4ASHA 2OTVA 2J98B 2EI6A 2ZPSA 1O5EH 1EAWA 2HALA 5T1VA 4AG2A 1O2JA 1EPTC 4KP0A 5DN6D 1TIOA 1ELAA 1BHXF 1J17T 1O2WA 2FXRA 3HKIB 3MYWA 1GDUA 3RXDA 3ZVAA 5SGAE 2VWNA 1X7AC 1C1RA 5LPRA 2ZHWH 1BTHH 3ITIA 4A7IB 1TX6A 2V0BA 1DWEH 3F0PA 5KEDA 5KGOA 3AAUA 1SLXB 1YCPM 2FS8A 2C8YB 1E38B 3PWBA 1Y8TA 1QNJA 1QBNA 1OS8A 2W6ID 3H5CB 4BAMB 3RU4D 3HK3B 4RSPA 3MNXA 3RU4E 3K6YA 3UNQA 2DUCA 1HAGE 2FDAA 3KQDA 4ABFA 2A5KA 1BRCE 1KLJH 4NZLA 4BAOB 2RA0A 1FXYA 4I8KA 3C27B 3RXLA 1UVTH 2H9HA 3P92A 2Y80A 1EJNA 5EW1H 1NN6A 2J92A 2BLOA 1YLNA 2P59A 1C4Y2 2AFQB 1V2NT 2VU8E 1ELDE 1S82A 3A81A 1P2QA 1NROH 2ZDKA 1G32B 1TOMH 1COWD 1KYNA 4K60A 5JPMH 1O39A 1TNIA 2XCFA 1O3AA 4TY6A 1MBQA 3SORA 1BQYA 2Z3CA 1P57B 2EA3A 1EASA 1YPGH 1SGEE 3A82A 1FPCH 1V3XA 5CHAC 1W3CA 3LGIA 2W3KA 3FZDA 3A7TA 1ANCA 4FUCA 3F2FA 3SV6A 3TJUA 3U1IB 1QURH 3F1SB 1TNJA 4JYVH 4CR5A 2O8TA 1K1NA 1GHXH 1O5AB 4INLA 1HJ9A 1UCYK 1DVAH 1Y3WA 2J94A 1FNIA 3RXSA 3UNRA 1SKYE 2ODQA 1OWEA 2ZQ2A 1DY9A 1GMDG 1SG8B 2GMTC 1DFPA 1F5KU 1BB0B 2BQ6B 4Y8XA 1HAOH 1QHRB 4MPVA 1WBGB 4D9QA 4UFDH 4E05H 2FI4E 1ZLRA 1ZRKA 5GCHF 3V13A 3PMAB 1EOJA 2UUFB 4ISOA 1TYNA 1ANBA 1VCQA 2OUAA 5L6NH 3UAIC 1RIWB 3SU4A 1ESBA 2GX4A 2TGAA 1BMNH 1CHOG 2SNVA 3TH3H 1GBFA 2Y5HA 4UFGH 4JZ1A 2C4FH 1GPZA 3OX7U 3RXOA 1BMLA 4DW2U 1F2SE 1DX5M 5EQSA 4UDWH 3U28C 2AIQA 4NGAH 3SHAH 2PTNA 3R3GB 4OS1A 1ZPZA 1P10A 1TABE 2ZHEH 5HKKD 1O2VA 2GV7A 2L74A 2H9EH 4YESB 1W13U 1Z71A 1JRTA 5KECA 1ZSLA 5E0GA 1FZZA 4BNRA 1XVOA 2BD2A 3CNRA 2QV1A 1MTWA 2KM0A 3KQBA 1TFXA 4AC9A 4DCDA 5FBEA 1EP5A 4SGAE 5BPEA 2GGVB 4D7FA 1UCYE 2SGAA 3SU0A 4P02A 4ZHMU 1VKYA 4UONA 3EGKH 1CGIE 1EQ9A 3KNXA 4MVNA 1TA2A 5AFYH 1NC6A 1W10U 3TH4H 1BT7A 1K21H 1KDQB 5LH8A 1J9CH 1QL8A 2ZIQH 3ATLA 3ZVEA 2XOKD 4ASUD 2WPJS 8KME2 5LPEA 1UTMA 2I6QA 1MBMA 1O3BA 2W5EA 1TB6H 3TVJB 1Z8RA 3L3TA 1P3EA 3LPRA 2F91A 1EZXC 2ASUB 1MCTA 3H7TA 4K2YA 4XE4A 1H9LB 2C8XB 5JBAS 5I46H 3UUZA 2UUKB 3LONA 4IC6A 1D6WA 2CJIA 3LT3A 1O5CB 2CHAC 4MNWA 1BBRE 2QF5A 3VXEH 2ULLA 1KXDA 1TNKA 3BTGE 1JRSA 3S69A 1MH0A 1U6QA 2UWPA 5EIYA 2F9NA 5FXLA 1Q2WA 2F9VA 4FOUC 3WY8A 3ZVDA 2XNDD 3FP8E 4K5ZA 2FYRA 2SFAA 1K1PA 2BD7A 4F49A 2ESTE 1ZJKA 1BJUA 1BTWA 1OP0A 1H9IE 2AIPA 5L2ZH 4Y6DA 4IMQA 5DP8A 5CHBA 4FUBA 1N6XA 2FOGA 3KF2A 4WH6A 3ODFA 2CK3D 1HAPH 1C2HA 1MTNB 2PTCE 1WXRA 1V2OT 2G4UA 4NZQA 1H4WA 3ENSB 3RXQA 3A8DA 1G30B 1MAYA 1HUTH 2O8WA 3UWJH 1XKAC 1C2MA 2Z9JA 2BD3A 2BZ6H 4NWLA 2NU1E 1JBUH 1GMHG 2GCTC 3MWIU 5EOKA 3OU0A 2A5IA 1EP6A 3TU7H 1UTLM 1SBWA 1YLDA 4HG6A 1A2CH 4K69A 1GMDF 1UVSH 1A46H 3W1EA 4Y7AA 2P93A 4CRBA 3U8RH 1EKBB 1DOJA 3SHCH 4IN2A 3U8OH 1UMAH 2H2ZA 1H8HD 1YPHC 3AASA 1IQNA 1QQ4A 1C5YB 1OWKA 5B6LA 1V2ST 2F9OA 4TYDA 1S6FA 4UE7H 1FN6A 1CHOF 4NSVA 1UTJA 1L1NA 2W3IA 4M7GA 4FUJA 4AGKA 5EXNA 4GLYA 1WOFA 2OC8A 4CHAB 3HKJB 4NA8A 1O3MA 2XBVA 5FPTA 1T7CA 1C2FA 3ZYEA 1BBRH 2IPHA 3PB1E 3MO3A 3RXUA 2IN2A 3P17H 4AFQA 1ELEE 4WF8A 3VB3A 4A1TA 4WVPE 4H6TA 1AO5A 5EODA 1O33A 2XC0A 1KDQA 4Y76A 5DP5A 1OP2A 1DICA 1AFQC 1Z8IB 3BEUA 1BTPA 4GSOA 4X1NU 1LO6A 1O3KA 2NU4E 4YT6H 4A1VA 3MHWU 5DP4A 3FFGA 1D6RA 2CXVA 3A86A 4CRDA 4R0IA 3TGJE 1YCPH 4X2YA 1S0QA 3PV2A 3K2UA 4CBOA 3F68H 3LJOA 4ZROA 4B75A 3M61U 4D8NA 1AY6H 2F9PA 5FBIA 3M5MA 2BQWB 3F2HA 1GJDB 1F0TA 1XX9A 5AF9H 2VGCB 1Y5BT 1GL0E 3W94A 1P01A 1ELFA 1V2RT 1H8IH 1TLDA 1C5QA 2BZAA 2FOHA 1SI5H 1VITF 3HPTB 4XBDA 5DGJA 2HWLB 3LGTA 5DP3A 3ESTA 1RRKA 1OX1A 1V2VT 1J15A 2QE7D 3VPKA 4WY3A 4H42U 1N6YA 2QXJA 4IGDA 3S9BA 1O3HA 4IBLH 1HJAB 1QY6A 3QLPH 2ALPA 4IN1A 2LELA 1L1GA 1GGDC 1E0FD 3F9EA 1GL1A 1JIMA 2Q6GA 2UUYA 2YMSC 1FY4A 4O3TA 2Z6BD 1ESAA 1E35B 4D9RA 1EJMA 1FUJA 1Y3XA 4MLFB 2QYIA 3GY4A 5PTPA 3MH6A 4B2BA 4K8BA 3BTTE 2TGDA 1IQEA 1M9UA 3RXCA 1QL7A 1C1WH 2XBWA 1Z6JH 1N8OC 3Q00A 2G8TA 1G37A 4GHQA 1TWXB 3GISB 2RFKC 4NA9H 3ZV9A 4MNVA 2ZDMA 2BDYA 1GMCF 4CRAA 3HK6B 1KY9A 3RXEA 2HLCA 1CA0B 3WWFA 2IPQX 2OP9A 4UD9H 5AVDA 1SGQE 3E3TA 4RI0A 2VWOA 1G36A 1H8DH 3CS7A 3TIUA 2WPLS 1LHGH 2ZPQA 1GMHF 1YPHE 1C2KA 2V3MA 1C1OA 4TPYA 1AVWA 1TA6A 2ZDLA 1EB2A 1PPHE 2R2WU 3PRBA 5E2OA 1S85A 1SGYE 3MU0A 3NXPA 3RXMA 4ZKOU 3RXBA 3GY7A 3TLOA 2EI7A 4OS2A 2KX4A 1FI8A 1SGFG 3GY2A 1TGSZ 1NZQH 1G3BA 3C1KA 3E8LA 1CQQA 4KKDA 1AUTC 5J4SA 1P06A 3SW2B 3ZZCA 3UR6A 1C5UA 5JB8S 1HNEE 1GI4A 1E37B 3LIWA 1EXFA 3OEHD 1IAUA 3MH7A 4TWWA 4A5TS 1BCUH 2GCHG 3A7VA 3URDA 2D2DA 2G5VA 4K1SA 1P02A 1NRNH 3SUDA 1BTUA 2B7DH 2FODA 4I8GA 1K0HA 3TITA 1TPPA 4NFEA 5C0TA 1O2LA 5JYIA 1P0SH 3I78A 4J1YA 1YM0A 1ZRBA 4TPIZ 2IJOB 1E34B 3AK5A 4YZUA 1ELTA 4FETA 4O3UA 4B6FA 2GP9B 1QRXA 1YWUA 6GCHG 2FPZA 1QRWA 1E1RD 2JJ1D 3KGPA 4FVDA 5E0HA 3F0OA 1EX3A 2VH0A 2AH4X 2FI5E 4E7NA 3UREA 5C5OA 3SI3H 3M37A 3FP7E 1OPHB 2Y7ZA 2ODPA 2Y81A 4RN6A 1SVPA 3UPEA 3QWCH 4Q7XA 1C1UH 2BQ7B 1ORFA 2YMSD 1NU9A 4LXBH 2QF3A 1IHTH 1MD7A 4H6SB 3ZYDA 1FY8E 1AU8A 1ELGA 3EYDA 1O3EA 1MKWH 3GCTG 7LPRA 2QGRA 3STIA 1ANEA 1XXFA 2V35A 1AZZA 2ZU1A 1P2MA 3ZZDA 1AE5A 2XW9A 2ZFQH 4LK4A 2A31A 2SGQE 2P16A 1Q3XA 3KCGH 1SPJA 2KR7A 2ZZUH 2AMDA 2VH6A 1GHAG 3BEIB 1AWFH 4SGBE 1GHYH 1SQRA 5G4BA 1ZMLA 2HPPH 2J4IA 1O2UA 2FLBH 3RM0H 2FI3E 1GCTB 3QX5H 2H1UA 2ZNKH 1WQVH 2AS9A 4FXGH 1V2TT 2NWNA 3MU5A 3SV2H 1DXPA 3O8DA 3LGYA 1MU8B 4AZ2B 2M5TA 1ANDA 1YYY1 1LCYA 1T8LA 2WPIS 1RIWC 2A2XH 1O5BB 3B23B 1WSSH 5EXMA 1DANH 1PQ7A 4JMYA 1GHBG 1TPSA 1O37A 2HGTH 4RT0A 1HBTH 1BTZA 1SC8U 1JMOH 3FN8A 4NSYA 2GTBA 1H1BA 1V2PT 2ZFPH 3MU8A 3RXFA 1RJXB 1C5OH 2ZHDA 4A6LA 2OK5A 1O3FA 3BSQA 3U9AH 1MQ5A 3M3VA 4NA7A 1LPZB 2BXUH 2VNTA 1DSTA 1LDTT 3U8TH 3S9AA 2B5TB 1O3IA 1XMNB 1QQUA 1ABJH 3SV9A 1V2KT 2ZGXH 3A8CA 3SGAE 4DURA 3A89A 2BOHB 5FX5A 1SFQB 1ARBA 1Y3UA 3TGKE 2UWOA 1NS3A 1HGTH 5T3HA 2Q1JA 3RM2H 2Q6FA 4BTTB 3PWCA 4ZKSU 2BLVA 1O3NA 2BYAX 4UEHH 2R9PA 2OCVB 1IHSH 1O2RA 2PFEA 3N99A 1K1OA 2GCHF 4ZUHA 4LZ4B 3LKWA 1EAUA 3F6UH 3MH4A 3Q77A 2J9NA 2VVUA 4FU9A 1SGDE 3SUFA 3IWMA 1YPMH 3T25A 5J4QA 2AERH 2GT8A 2ZU4A 3T28A 1LTOA 1EB1H 3SYJA 2ZKSA 4GCHF 4TT3D 3FVFB 5A0BA 3P6ZB 3PTNA 3ZIAD 4YXWD 3D65E 1O2YA 2YOLA 4OGXA 1GBIA 1J16A 6GCHF 4I86A 3GY8A 2V3HH 3RXJA 4ABAA 4JZDH 2P3TB 1G3DA 4YM9A 3PMBB 2C8ZB 1C4U2 3EAJA 6CHAC 1LPKB 2EY4C 1HB0B 5F03A 1C5PA 1NY22 2AGIX 2QCYA 1AN1E 3M5OA 4B2CA 1V2WT 4MG3A 5C1XA 2STAE 2KZ4A 4TSFD 5HMAA 3GOVB 3OE7D 2LNCA 1SB1H 1PYTC 4X0WU 5A0CA 3P70B 3MU1A 2XC4A 3UNSA 2KCOA 3QZQA 1A61H 3GCTF 2WPKS 4AB8A 3FOAA 1HAZB 1XUHA 3O8BA 5C20A 5EU8A 1ZPBA 3VXFH 1OYTH 1NO9H 1P8VC 1GHAF 3VB6A 1TOCB 3L33A 3RC4A 4DIHH 1GHWH 1V2LT 1JWTA 3SO3A 3UY9A 2ZGCA 2THFB 1ETTH 2P8OB 1C1QA 1THPB 3NK8A 2FMJA 1EFRD 4H4FA 1CGJE 4ABIA 4AFSA 1SGFA 3TK9A 1FAXA 2PGQB 3QZRA 6LPRA 2CGAA 2WV9A 1TPOA 3A7ZA 1C2IA 3RLWH 3LH1A 4DT4A 4Z1MD 1LVYA 2J98A 3PV4A 2PHBA 1DWCH 4TY7A 1UTQA 3IITA 2QXIA 1GHBF 3G01A 2WV4A 1AD8H 4ZXYH 4RKOB 1F7ZA 2B9LA 1BBRK 3A83A 4B74A 4QT8C 2HVYB 4HI3A 5C67A 4I7YH 1AWHB 3M35A 1PQ5A 3DT0H 4YO9A 3TGIE 1VCPA 3E90B 1ELCA 4E7RG 2GZ7A 3B9FH 1GJ6A 4ISLA 1A7SA 2AGGX 1O31A 5C94A 1W0ZU 3SOSA 4OS5A 5HM9A 2RDEA 4ABGA 1LKBA 1QA7A 2Y5FA 3FZZA 1JOUB 2B0FA 2FTLE 1Z8JB 2TIOA 2FOFA 4NWKA 4X2VA 1GBAA 2FOAA 1YCPK 4ABHA 1ZHMA 3N7EA 1WUNH 5GDSH 1LVMA 5DPAA 3SU1A 3SU6A 5GXPA 1HDTH 1K28D 2XCNA 2VGCC 4PROA 1EUFA 2BVRH 1BRBE 3MI4A 5IK2D 2XBXA 2ZDNA 1VITG 1FIWA 3BTME 1EPTB 4Y0YE 1LHEH 2A4QA 1ZZZA 1THSH 2BVSH 1UTPA 2XRCA 1AUJA 4BXWA 2NU2E 1S6LA 1YBWA 5A8ZA 5HYOA 2OC1A 2SNWA 3F9FA 5A8XA 2R3YA 1C1TA 2ZTYA 1TE0A 1D3QB 1A5HA 5LPFA 2A7CA 3KQCA 1GI7B 3RMLH 1MKXH 1BTYA 3SNCA 3A85A 5EW2H 3ATMA 1QB1A 3A7YA 1O2KA 1P03A 1UHBB 1F5RA 1KXFA 1P2IA 1GBEA 3B8JA 1FDPA 1W11U 4U01A 2PKAB 2BB4A 1LHFH 1W7GH 2A45B 4AN7A 3BTFE 1PYTD 5F6MA 5F8XA 3UFAA 3UWIA 1HAHH 1UTKA 1BUIA 2ALVA 4FUGA 4JK6A 2FX4A 1SLWB 2HPQH 3LU9B 2OLGA 1LVBA 3EA7A 1C5NH 4ISNA 2VIOA 3EE7A 3SUGA 2P94A 2XTTB 1GMCG 4X1RU 4AX9H 4CBNA 1V2MT 3GICB 1GJ9B 1K1LA 4I33A 1C2GA 1MD8A 2Z9LA 1LKAA 2Z7FE 1YPLH 2FLRH 5DP6A 5GJ4B 2BD4A 4Y71A 4AOQA 1YPJH 5C5NA 2A32A 3PMJA 2RCEA 4GUXA 4X1SU 5A09A 5HXFA 2C93B 4ACBA 1PPCE 4MNYA 2F43B 2BTCE 2WPHS 4Q63A 2FM2A 5B6OA 1UO6A 3I29A 3M3TA 4K1TA 1IQMA 1FY3A 1PPZA 2RDLA 5CHAB 1ZR0A 2VWLA 3SQHE 1SSXA 1GVLA 1KIGH 1OHHD 1Y3VA 3UR9A 3M5LA 3TK6A 3S9CA 4B76A 4JK5A 1JIRA 1NT1A 2TGPZ 1UVUH 1WYKA 4GPGA 3M3SA 3QK1A 1EZUC 3MOCA 5EQRA 2AHME 3SU3A 1GJ7B 1A3EH 2AYWA 3CP7A 3SBKA 1SLUB 2A7HA 4Y0ZE 1EAXA 2A4GA 3Q3XA 1TQ0B 4ISIH 1AB9C 1CT0E 2G81E 1FIZA 1OWJA 1Z6EA 4BTIB 2GMTB 3QGJA 4ZMAH 4FUFA 5F8ZA 1HCGA 1MTSA 2ZDVH 2GJGA 3EA8A 4YLUA 1W14U 3KN2A 3EDXB 1GJAB 1XVMA 5EPYA 9LPRA 3W95A 3F9HA 2NU0E 1A4WH 3E6PH 1TRYA 2KAIB 1WDIA 2KFWA 2QIQA 1PPEE 4I31A 1MZAA 1EOLA 1ZTJA 1NTPA 3A7XA 1MZDA 1Z8GA 2BDIA 3T2NA 2Y6TA 3U98H 5GPIB 1EPTA 1VGCB 3I77A 4D76A 1GBJA 1V6DA 3U1JB 2J38A 3OEED 1QBVH 1NPMA 2LP6A 1C9PA 3RP2A 3OTJE 1GDNA 3ZZAA 4GAWA 4ZXXH 2K0QA 1W0JD 1T8MA 3PYHA 5FPYA 2VIDA 1A0LA 2Y5GA 3OY6U 4Y79A 3RC5A 3RXKA 2EQNA 7GCHF 1IOEA 5FHTA 2ZU2A 2JETC 1BIOA 3P8OA 4F55A 1BMAA 3TPIZ 1UHBA 1GJCB 4B1TA 5EJZA 4ZHAA 4KTSA 1K1MA 2PKAA 4CRCA 5CDFE 1HV7A 1QTFA 1C1SA 1B0FA 5C0UA 3PO1B 4KTCA 1VJAU 1TRNA 1LQDB 3MH5A 3K6ZA 3KIDU 3PLPA 5H4IB 3RXGA 1C2DA 1MKWK 1P2OA 1W12U 1BRAA 1BJVA 5DK1A 1K2I1 1GBLA 4YOGA 4THNH 1SGRE 3KYGA 4I8HA 2BVXH 3RXVA 1QZ8A 5DO4H 1MTUA 1GBMA 1DS2E 1FONA 1GCTC 3ZZ4A 4OS4A 4RKJB 3NWUA 2PSYA 1CGHA 4NIVA 3SZNA 5JBTA 1C5VA 1KXAA 5C1UA 1BTXA 4FU7A 2PKSC 3DHKH 2OXSA 3SU2A 4X8VH 5ESBA 4U32A 1AMHA 4OM9A 5E0JA 3NUMA 2TBSA 1TAWA 2EI8A 4X1PU 2Y82A 3VGCB 1SHHB 1GI1A 1L4DA 2TRMA 3SNEA 5GNDA 1EAIA 4AB9A 1TNLA 2SGPE 1HXFH 1O3LA 1YF4A 2PSXA 3AW0A 2KCPA 2WZQA 3ZVCA 3FO8D 2CV3A 3LC3A 1P2NA 3GYMA 3VB7A 1P11E 1QIXB 1GI2A 1VJ9U 1KTSB 2NU3E 1DWDH 5T6DA 1P04A 1HXEH 1W0YH 3OTPA 4Y11E 1SGPE 1O38A 1CA8B 2VJ1A 3VEQB 5AHGH 1YPKH 4AFZA 3GDSA 1ZSKA 2F9BH 2XYAA 1THRH 1H8ED 3NRLA 4M9FA 1SQTA 4FUEA 3ZZ3A 4O97A 5EJ1A 1O2GH 3QTOH 4IMZA 4CH8B 4E06H 2KAIA 2BDGA 1YY3A 3PRDA 3PV5A 4FUDA 2ZFTA 4K3JA 4LZ1H 2GCTB 1C1MA 3MNBA 1UK4A 3ZZ9A 2ZFRH 2JKHA 4YOIA 2D8WA 3MFJA 3ODDA 5TJXA 2V7QD 2J5UA 1E36B 2FOMB 3Q3KA 1MMJN 1SGNE 3GY5A 4Q7ZA 1GI6A 3FP6E 1QJ6B 4X2WA 4Q2KA 1DE7H 4XD7D 1LMWB 1NFUA 1UTOA 2QXGA 2WYGA 1FPHH 4GCHG 2F4LA 5EXLA 2JJ2D 3MO9A 3S7HB 1S5SA 1OXGA 1O2TA 4AYYB 3BG8A 4BXSA 1A3BH 1LHDH 1NFYA 4A92A 4CH2B 3DSGA 3RXPA 5HIYA 1O3CA 3KL6A 3T27A 3UQOA 3TNTA 2ZCLP 1W7XH 2A4OA 2VIPA 3MMGA 1AHTH 4WJG2 3RMMH 2PV9B 4WXVA 4DJZB 1QJ7B 1AFQB 3SV8A 3STJA 3GY6A 3NZIA 1MTVA 2O8LA 1QJ1B 3RMOH 1AIXH 1C1NA 1TMUH 1C2LA 3HGNA 3UIRA 4ACAA 3ZVFA 1SMFE 3EQ0H 1IQGA 2Z9GA 1GI0A 4INKA 3ZV8A 1LHCH 3H09A 3UQVA 1F92A 1C2EA 3E16B 4DG4A 4J2YB 4AORA 2BD5A 1TMTH 1ETSH 5F53A 3SGBE 2W6JD 2ZU3A 2FIRH 2ZQ1A 3RXIA 5FX6A 2Z3DA 2G52A 1HAYB 1YP9A 2ZWLH 1DDJA 4VGCB 1CVWH 3MTYA 3BG4B 4KTUA 2GV6A 1SGCA 5A0AE 3ATIA 2F3CE 2CF8H 1KXCA 1RTFB 2ILNA 4LOYH 5T6GA 2WPMS 1P09A 1ZTLA 1GBCA 1O2MA 2GD4B 4WWYA 2ANWA 5DKMA 2YMSB 4OGYA 1TNHA 3UB0A 2W7SA 2FYQA 1XUIA 4INHA 2O8UA 1VR1H 2H9TH 3SJIA 3P8NA 3O8CA 4NG9H 3OSYA 3K9XB 3O8RA 2G55A 1OWDA 1NRQH 1ZJDA 3RXTA 1TRMA 3DA9B 1B0EA 3QDZB 1N8OB 2PGBB 4ZH8A 2GT7A 2XC5A 4X8SH 1SL3A 1HPGA 1MUEB 4P00A 1Y59T 3A8AA 4X6OA 1V2JT 5K0HA 3UTUH 1B5GH 1TGNA 2ZG0H 2LPRA 2OC7A 1GVKB 1NM6A 3BTWE 1MABB 1L4ZA 5IDKA 4WMEA 3T62A 3A8BA 1KTTB 1T4UH 3DSOA 5HIZA 2VVVA 1NRSH 2OD3B 1F0SA 2P95A 1V2UT 1C5ZB 1C1VH 1CBWB 1TGCA 4WXIA 1GBTA 4F48B 3QGNB 5C1YA 3RDZA 2FEQH 1FY5A 2OQ5A 4MTBA 1Y5UT 2AMPA 3JZ2B 1RFNA 1SOZA 1XUGA 2OINA 1T8OA 2WUCA 5FPSA 2ZF0H 2PWXA 1BITA 3H7OA 1BDAA 1T4VH 3DCLA 4X6MA 1DSUA 4KGAA 2L6OA 4D7GA
chains in the Genus database with same CATH topology
3BN9A 2ZTZA 1OWIA 3AAVA 4GHTA 4IW4E 1DLKB 3CS0A 1NFWA 4YTAA 1FN8A 1CE5A 3Q3YA 1B7XB 3SUEA 4Y8ZA 2ODYB 3AW1A 3KHVA 3OY5U 2FTMA 4DIIH 4GVUA 3R0FA 2ZU5A 1Y5AT 2C3SA 3RLYH 2VIQA 1GHZA 3GCNA 1MKXK 4BAQB 2G4TA 1ZGIA 2ZFSA 1ZYOA 4Z0KA 4NIXA 2VB0A 2SGEE 1OSSA 1QA0A 1TALA 1WCZA 2BLQA 1SFIA 1BZXE 1NRPH 1GBBA 1QFKH 4FUIA 1F5LA 1FV9A 2ANYA 3TNSA 1MCVA 5ESTE 1G2MA 2D1JA 1ID5H 1N1LA 1AVXA 2AGEX 2ZGBH 1A5IA 1MTNC 3TK5A 2ZHQH 2TGTA 3M5NA 1GDQA 2OBQA 3MNCA 1ZPCA 2SGFE 3VB4A 1C5TA 1ELBA 1O3GA 3BF6H 2P3UB 1O2NA 2QF0A 3ZZ6A 4DY7B 1C9TA 3GDVA 1S0RA 4AFUA 1FLEE 2A5AA 3BV9B 1QR3E 1XKBC 1VCWA 4X8UH 3BEFB 3SI4H 2BY6X 2A4RA 2P3FH 1O2XA 3D49H 3GDUA 4DVAU 2R3UA 1ABIH 3PMHB 4HGCA 3NKKA 1TPAE 4ISHH 1OP8A 3RXAA 3SQEE 1AKSB 4Y10E 3SJKA 1PPGE 1QRZA 5JBBS 4ABDA 3ZVBA 1O5DH 1ZHPA 4ZKRU 1HFDA 1RGQA 3DUXH 7ESTE 5LGOA 2R0KA 4ESTE 4CHAC 1DY8A 2RG3A 2ZC9H 5L30H 2YNAA 2VVCA 3RC6A 5EQQA 1RS0A 1IQIA 1G2LA 1TX8A 4CR9A 1AVGH 2HOBA 1RXPA 3URCA 1JXPA 1C5LH 1GCDA 5EGMA 4NFFA 1VGCC 1GG6B 3GCHB 1YKTA 1DT2A 1BRUP 3QUMP 1DWBH 2Z9IA 4MNXA 1HAVB 1HLTH 1O36A 5C2ZA 3GY3A 4NCYA 3ZZ8A 1DLEA 2GZ8A 5JBCS 1HIAB 1ZMNA 1YLCA 1NRRH 8LPRA 3ATKA 4YLQH 1P2JA 7GCHG 2FOEA 1Q31A 2H6MA 4JYTA 4MPXA 4CRFA 1WTGH 2Z3EA 2WUBA 3ZVGA 2CMYA 1INCA 1GJ5H 1GI9B 4ABJA 3BTEE 4HZHA 5T6FA 3PO1C 3V12A 3ZZ7A 1GWAA 1GBHA 2ANKH 3P8FA 1HJAC 4JZFH 3DD2H 1DUAA 1AI8H 1GI3A 2XXLA 3A80A 1TBZH 2V3OH 2G5NA 2ANMH 1DUEA 2FOCA 4XFQA 1UVPA 5GWZA 1P12E 1YPEH 2GKVE 1ELVA 4K8YA 2ZTXA 1OOKB 2O9QA 1W8BH 4JCNA 1Z1IA 1GBDA 1BOQA 5CMXH 1D3PB 4DGJA 1HAIH 2YNBA 2ZP0H 3PM3A 1XUFA 1O3JA 1T8NA 5DJ7A 1HYLA 4X6NA 1IQHA 5FCRA 2XNIA 1O2HA 4XSKU 5DP9A 1TBQH 1UK3A 3S0NA 3GYLB 1GJ4H 3V7TA 8GCHG 1QL9A 2Z94A 5K7RA 1ZHRA 1TX7A 4XDEA 4X8TH 3EE0B 3VGCC 3RXRA 2ZPRA 4BAKB 2QY0B 1YC0A 2RA3A 1EZSC 1LQEA 3T29A 1GHVH 1CA0C 1L0ZA 1MAXA 1GI8B 2ZDAH 1PQAA 1NU7B 3E0PB 2FS9A 1AKSA 1GVZA 1Z7KA 2C8WB 5C3NA 4O9VA 2VIWA 4MPUA 5FAHA 3S7KB 1AFEH 1F0UA 2BX3A 3E91A 3VB5A 5E8EH 6CHAB 8ESTE 2VINA 4TWYA 3Q76A 5L2YH 2GDDA 5E2PA 1KSNA 1SQOA 1Z1JA 2GZ9A 1LPGB 1O34A 2O8MA 2FESH 1S84A 3EA9A 2FZZA 1IQJA 2SGDE 4X1QU 1OWHA 3SNDA 1J8AA 4MQAA 4ZKNU 3ELAH 2F9UA 3AVZA 2DE9A 2PUXB 4XBBA 1A5GH 2C90B 1QBOA 1UCYH 3A84A 2FOBA 2ZCKP 4B2AA 1KXBA 1SGIB 1RTLA 1A0HB 2BXTH 1HAVA 9ESTA 1O2IA 4X2XA 1IQFA 3D62A 1HIAA 4WMFA 2ZO3H 2HNTC 1UK2A 3UOPA 3BTKE 3M7UA 4MPWA 2A7JA 3TH2H 4DT7B 1EJAA 1C1PA 1EZQA 2ZHFH 3PTBA 3NPSA 1O2OA 3F9GA 2QAAA 4ZHLU 1D9IA 3RU4T 2QXHA 2A1DB 3RUOA 4ABEA 4I8JA 4UFEH 5HGGA 1J14A 2Q6DA 4WH8A 3U69H 2HVXA 2R0LA 1IQLA 1FY1A 2OC0A 1AQ7A 3MO6A 1CT2E 4MDSA 2ZI2H 2G00A 4FU8A 1UJ1A 2JH6D 2ZECA 3JZ1B 1O5GH 2WV5A 4Q7YA 3E1XB 1F0RA 1ESTA 1K22H 3DFLA 3QN7A 2BX4A 1C2JA 5JB9S 1SR5C 1P2KA 1O5FH 5GIBA 4JZIA 3FANA 1O2PA 2W7UA 4XBCA 2ZGJA 3MNSA 4DOQA 1O2QA 1QB9A 2OBOA 3SJ8A 2BDHA 1WV7H 1O2ZA 3ZZBA 1D3DB 1S83A 2EC9H 3BIVH 1TMBH 1CSOE 2BOKA 1T32A 1WQSA 2FWWA 1KLIH 4FUHA 4AG1A 1XXDA 2BMGB 3SU5A 2OQUA 1GI5A 1DM4B 4VGCC 1SHYA 1AGJA 1FMGA 2PUQH 3FAOA 3NCLA 2XWBI 2I6SA 2BD9A 1CHGA 3BG4C 1G9IE 3PLBA 1MU6B 1O0DH 4CREA 2BDBA 2CHAB 2QA9E 8GCHF 7KMEH 1XM1A 2J95A 2CN0H 2PLXA 1VITH 2GDEH 1ZTKA 2BDCA 3LH3A 1C5XB 4HFPB 4NIWA 2BY8X 3KEEA 3UOUA 2BLWA 4ZAEA 2AEIH 1ARCA 3PLKA 3TJOA 3E0NB 3QO6A 3KQEA 5BRRE 1O2SA 3HATH 3V3MA 1FJSA 4YT7H 4KELA 2W26A 2F83A 4U30A 3M7TA 2J2UA 4FVBA 1MQ6A 1ETRH 1ZOMA 5TCCA 1T31A 5DG6A 5I25A 4BAHB 3M7QA 1C5SA 3DFJA 3SJOA 3LGVA 4F4OC 2GVFA 1Y3YA 1WAYB 1RD3B 1FAKH 2STBE 1EATA 3SGQE 3ZZ5A 2V6NA 4JZEH 2WINI 4Z6AH 5DP7A 3LJJA 1DPOA 2VWMA 4IS5A 1CBWC 2ZEBA 3BTHE 1C5MD 2HNTE 2QN5T 1BMMH 2TPIZ 1DXWA 1VZQH 1L2EA 5F8TA 5A8YA 2IOTA 1ZGVA 1OKXA 2A0QB 4Y7BA 2DE8A 1O3PB 2BDAA 3LGUA 4BTUB 3P8GA 1O30A 2FO9A 1P9SA 3V0XA 1V2QT 1TBRH 2QC2A 5A2MH 1C5RA 4BANB 2AMQA 1GJ8B 1IQKA 1KLTA 2BD8A 4AYVB 1AB9B 3T5FH 4JYUH 4CRGA 1QGFA 4YOJA 4U2WA 1ZMJA 2JH5D 1HAXB 3LDXH 3SNBA 3T26A 6ESTA 2BY9X 1WTHD 2BY5X 1ACBE 3K65B 4B71A 1WU1A 2UUJB 4I32A 4ABBA 1AE8H 1S81A 1NFXA 1CO7E 2H5CA 1P9UA 2XBYA 1P05A 4X6PA 3L6PA 1LVOA 2UWLA 1O35A 5HM2A 1TONA 1K1JA 2HNTF 2A2QH 3BTQE 1K1IA 3P95A 1CT4E 1G3EA 1OYQA 2H5DA 2ZCHP 1SQAA 1P3CA 3D23A 1XUKA 5ABWA 4WMDA 4Y8YA 4BOHA 5ETXA 4AGJA 1DITH 1SGTA 1UTNA 3SJ9A 2JETB 1C5WB 2ZGHA 4IC5A 2B8OH 2Z9KA 3PROA 4Q80A 3MU4A 3VFEA 3IG6B 1HJ8A 3BIUH 3SV7A 1W2KH 1QCPA 2P8OC 1PQ8A 5JDUB 2JH0D 1XUJA 1PPFE 4K1EA 1ZSJA 1KXEA 3N7OA 2BHGA 1C4V2 1D4PB 3QTVH 4I8LA 3RXHA 3GCOA 3SNAA 1TGBA 1O3OA 3LOXA 1AZ8A 5FCKA 1O32A 1GGDB 3M36A 1FQ3A 2PR3A 2PW8H 2EEKA 1GBKA 2WYJA 2FX6A 1PJPA 1BA8B 4O03A 3LC5A 1CU1A 4NIYA 1TNGA 1NESE 2Y7XA 1HRTH 1K9OE 1TGTA 3A7WA 5IYTA 4OS6A 5GCHG 3OYPA 2ZFFH 2PKSB 3TJVA 1A0JA 5TCAA 1UVOA 2K1QA 3HGPA 1A1RA 3A87A 4HTCH 1PFXC 2XWAA 1S6HA 1GJBB 4R8TB 4OS7A 3SN8A 1H9HE 5AFZH 2FP7B 3CENA 3TJNA 2R2MB 4XOJA 1YGCH 2VIVA 2CF9H 1GG6C 1QB6A 3GCHC 4A1XA 2HRVA 5EPNA 2D26C 2BM2A 3RMNH 1G3CA 1SLVB 1TQ7B 2J34A 1RTKA 5CE1A 2BY7X 2G51A 1D3TB 1SOTA 3BTDE 4B73A 2ZA5A 1BHXB 3A88A 3LGWA 1L1JA 3ATWA 4UFFH 5EG4A 1PPBH 1O3DA 4ASHA 2OTVA 2EI6A 2ZPSA 1O5EH 1EAWA 2HALA 4AG2A 1O2JA 1EPTC 4KP0A 1TIOA 1ELAA 1BHXF 1J17T 1O2WA 2FXRA 3HKIB 3MYWA 1GDUA 3RXDA 3ZVAA 5SGAE 2VWNA 1X7AC 1C1RA 5LPRA 2ZHWH 1BTHH 3ITIA 4A7IB 1TX6A 2V0BA 1DWEH 3AAUA 1SLXB 1YCPM 2FS8A 2C8YB 1E38B 3PWBA 1Y8TA 1QNJA 1QBNA 1OS8A 3H5CB 4BAMB 3RU4D 3HK3B 4RSPA 3MNXA 3RU4E 3K6YA 3UNQA 2DUCA 1HAGE 2FDAA 3KQDA 4ABFA 2A5KA 1BRCE 1KLJH 4NZLA 4BAOB 2RA0A 1FXYA 4I8KA 3C27B 3RXLA 1UVTH 2H9HA 3P92A 2Y80A 1EJNA 5EW1H 1NN6A 2J92A 2BLOA 2P59A 1C4Y2 2AFQB 1V2NT 2VU8E 1ELDE 1S82A 3A81A 1P2QA 1NROH 2ZDKA 1G32B 1TOMH 1KYNA 4K60A 5JPMH 1O39A 1TNIA 2XCFA 1O3AA 4TY6A 1MBQA 3SORA 1BQYA 2Z3CA 1P57B 2EA3A 1EASA 1YPGH 1SGEE 3A82A 1FPCH 1V3XA 5CHAC 1W3CA 3LGIA 2W3KA 3FZDA 3A7TA 1ANCA 4FUCA 3SV6A 3TJUA 3U1IB 1QURH 3F1SB 1TNJA 4JYVH 4CR5A 2O8TA 1K1NA 1GHXH 1O5AB 4INLA 1HJ9A 1UCYK 1DVAH 1Y3WA 2J94A 1FNIA 3RXSA 3UNRA 2ODQA 1OWEA 2ZQ2A 1DY9A 1GMDG 1SG8B 2GMTC 1DFPA 1F5KU 1BB0B 2BQ6B 4Y8XA 1HAOH 1QHRB 4MPVA 1WBGB 4D9QA 4UFDH 4E05H 2FI4E 1ZLRA 1ZRKA 5GCHF 3V13A 3PMAB 1EOJA 2UUFB 4ISOA 1TYNA 1ANBA 1VCQA 2OUAA 5L6NH 1RIWB 3SU4A 1ESBA 2GX4A 2TGAA 1BMNH 1CHOG 2SNVA 3TH3H 1GBFA 2Y5HA 4UFGH 4JZ1A 2C4FH 1GPZA 3OX7U 3RXOA 1BMLA 4DW2U 1F2SE 1DX5M 5EQSA 4UDWH 2AIQA 4NGAH 3SHAH 2PTNA 3R3GB 4OS1A 1ZPZA 1P10A 1TABE 2ZHEH 1O2VA 2GV7A 2H9EH 4YESB 1W13U 1Z71A 1JRTA 1ZSLA 5E0GA 1FZZA 4BNRA 1XVOA 2BD2A 2QV1A 1MTWA 3KQBA 1TFXA 4DCDA 5FBEA 1EP5A 4SGAE 5BPEA 2GGVB 4D7FA 1UCYE 2SGAA 3SU0A 4ZHMU 4UONA 3EGKH 1CGIE 1EQ9A 3KNXA 4MVNA 1TA2A 5AFYH 1NC6A 1W10U 3TH4H 1BT7A 1K21H 1KDQB 5LH8A 1J9CH 1QL8A 2ZIQH 3ATLA 3ZVEA 2WPJS 8KME2 5LPEA 1UTMA 2I6QA 1MBMA 1O3BA 2W5EA 1TB6H 3TVJB 1Z8RA 3L3TA 1P3EA 3LPRA 2F91A 1EZXC 2ASUB 1MCTA 3H7TA 4K2YA 4XE4A 1H9LB 2C8XB 5JBAS 5I46H 3UUZA 2UUKB 3LONA 4IC6A 1D6WA 2CJIA 3LT3A 1O5CB 2CHAC 4MNWA 1BBRE 3VXEH 2ULLA 1KXDA 1TNKA 3BTGE 1JRSA 3S69A 1MH0A 1U6QA 2UWPA 2F9NA 5FXLA 1Q2WA 2F9VA 3WY8A 3ZVDA 3FP8E 4K5ZA 2FYRA 2SFAA 1K1PA 2BD7A 4F49A 2ESTE 1ZJKA 1BJUA 1BTWA 1OP0A 1H9IE 2AIPA 5L2ZH 4Y6DA 4IMQA 5DP8A 4FUBA 1N6XA 2FOGA 3KF2A 4WH6A 3ODFA 1HAPH 1C2HA 1MTNB 2PTCE 1V2OT 2G4UA 4NZQA 1H4WA 3ENSB 3RXQA 3A8DA 1G30B 1MAYA 1HUTH 2O8WA 3UWJH 1XKAC 1C2MA 2Z9JA 2BD3A 2BZ6H 4NWLA 2NU1E 1JBUH 1GMHG 2GCTC 3MWIU 5EOKA 3OU0A 2A5IA 1EP6A 3TU7H 1UTLM 1SBWA 1YLDA 1A2CH 4K69A 1GMDF 1UVSH 1A46H 4Y7AA 2P93A 4CRBA 3U8RH 1EKBB 1DOJA 3SHCH 4IN2A 3U8OH 1UMAH 2H2ZA 1YPHC 3AASA 1IQNA 1QQ4A 1C5YB 1OWKA 1V2ST 2F9OA 4TYDA 1S6FA 4UE7H 1FN6A 1CHOF 4NSVA 1UTJA 1L1NA 2W3IA 4M7GA 4FUJA 4AGKA 5EXNA 4GLYA 1WOFA 2OC8A 4CHAB 3HKJB 4NA8A 1O3MA 2XBVA 5FPTA 1T7CA 1C2FA 3ZYEA 1BBRH 2IPHA 3PB1E 3MO3A 3RXUA 2IN2A 3P17H 4AFQA 1ELEE 4WF8A 3VB3A 4A1TA 4WVPE 4H6TA 1AO5A 5EODA 1O33A 2XC0A 1KDQA 4Y76A 5DP5A 1OP2A 1DICA 1AFQC 1Z8IB 3BEUA 1BTPA 4GSOA 4X1NU 1LO6A 1O3KA 2NU4E 4YT6H 4A1VA 3MHWU 5DP4A 3FFGA 1D6RA 2CXVA 3A86A 4CRDA 4R0IA 3TGJE 1YCPH 4X2YA 1S0QA 3K2UA 4CBOA 3F68H 3LJOA 4ZROA 4B75A 3M61U 4D8NA 1AY6H 2F9P