3WY8A

Crystal structure of protease anisep from arthrobacter nicotinovorans
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
219
structure length
219
Chain Sequence
VNQSETPVKHIGKIFFTLGGSNYVCSGNSVTAANKSTVSTAGHCLNEGPGAYATNFIFVPAYLNGAAPYGKWTAKALYAPTQWASNGNMQYDTAFAVMNTLNGQKLADVVGSSGVQFNAARGLSYKSFGYPAASPFNGESLKSCSGTATNDPYNPQFATQGIPCNMTGGSSGGPWFIGNSSSGYQNSVNSYGYGSNSSTMYGPYWGTVIQSTYNTAAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease
publication title Structural characterization reveals the keratinolytic activity of an arthrobacter nicotinovorans protease
pubmed rcsb
source organism Arthrobacter nicotinovorans
molecule tags Hydrolase
total genus 65
structure length 219
sequence length 219
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2014-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3wy8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3wy8A02
4ABGA 1HB0B 3SHCH 3MTYA 1MTNB 4JK6A 1F0UA 3GY8A 1V2VT 3KF2A 3L3TA 1S0RA 4B2BA 2M5TA 1SG8B 4Z6AH 3M5MA 3M35A 2ZDAH 4Q80A 1EAIA 4JZDH 1P01A 5JBBS 3UFAA 1NROH 2TGAA 4E7NA 1DXWA 2CHAC 5GCHF 2B8OH 3VGCB 2GVFA 3EA9A 1Y5AT 4X0WU 1OSSA 1DLKB 3E0NB 3SU4A 4YOGA 2BYAX 2AYWA 1HYLA 1XMNB 3PMAB 2FIRH 3SNCA 1DS2E 4BANB 1D3PB 1F5KU 1G2MA 1B0FA 2C4FH 3H7TA 3LIWA 5E2OA 3KHVA 3S9AA 2QC2A 3MH5A 4A5TS 1J14A 5EXNA 3M7UA 3T29A 1GJ6A 1PPEE 4I8LA 3S9BA 1L0ZA 2AMPA 1GBKA 4UEHH 1CVWH 1PFXC 3P70B 4ZKNU 1ZTJA 4FXGH 1LVBA 2G5NA 3SW2B 1RRKA 2BY8X 2UWLA 3QZQA 2XRCA 1EX3A 1O2HA 3I78A 3GY6A 2V3HH 1BUIA 2Y7XA 4TWYA 2FMJA 4YESB 2CF9H 3KGPA 3RU4T 1CSOE 1IQKA 5A8XA 3STJA 1O2LA 4ISIH 1AUJA 1DFPA 1UK3A 3ATWA 4MPWA 2AIQA 3HK3B 5FX5A 2EI6A 3U69H 3UNSA 1CQQA 1HIAB 3CP7A 1DLEA 1S85A 1KYNA 3HATH 1C5NH 4GCHG 4WH6A 2ZHFH 2H9TH 4ABHA 1AB9B 4AFQA 5JB9S 1W7GH 1ARCA 2F9BH 2J34A 2DUCA 3BTWE 4Q7XA 3TJNA 3K65B 1PPFE 2XC5A 4KTSA 2HWLB 1SGFG 2EC9H 3BEUA 5LH8A 3Q3YA 2P94A 2SGQE 1O2OA 2BZ6H 1P3EA 1HGTH 1GBEA 2J9NA 2BDCA 1DITH 1ABIH 2OC1A 4H42U 2ZKSA 4WXVA 1EAXA 1EXFA 1HJAC 3ODDA 3ELAH 4AG2A 1TX8A 5FPSA 4O97A 1HCGA 1A1RA 1GBLA 1O3FA 3P17H 3SOSA 2ZPSA 3KQBA 4INLA 3K9XB 2VWOA 2PKSC 1JOUB 2FM2A 3PO1C 4ZAEA 4TWWA 2ZCHP 1SHHB 4YM9A 1NY22 1S81A 1WU1A 3UWIA 2YNBA 3UR6A 1AZ8A 1GBJA 5JB8S 1U6QA 2PKAB 1XM1A 3QDZB 4X8TH 3GCHC 1NM6A 3OY5U 2WV5A 1ZTLA 3AW0A 1HXEH 1O5EH 3GYMA 1QJ6B 1C5VA 1NU7B 4K1EA 4CHAC 1GJ5H 4YT6H 1UCYK 1XUJA 3N7OA 5GXPA 1CBWC 3R0FA 3MHWU 1TBRH 2OQ5A 1TNJA 1KSNA 1WTHD 1W2KH 4ABFA 3A7YA 3E0PB 4AYYB 3KL6A 1O3PB 2C3SA 2PV9B 4NSVA 1Y3VA 1GI1A 2B9LA 1GI5A 3OYPA 2O8UA 4XDEA 2FESH 4Q2KA 3OSYA 3OTJE 1DXPA 5EU8A 2XWAA 1ESAA 1W11U 5A8ZA 4KELA 1C9TA 2TPIZ 2NU4E 1YPHE 1P04A 2EEKA 3E91A 1SSXA 9LPRA 1GDNA 1OPHB 3ZVAA 2VU8E 1SGFA 1O5AB 1MCVA 3E3TA 1M9UA 1AMHA 1A5HA 2A1DB 3PM3A 4ABEA 5DP9A 1BOQA 1MTNC 2WPIS 2ZHQH 3EDXB 3MO9A 4CH8B 3EYDA 1P02A 1KXAA 1TMBH 1C5PA 1GI3A 5EW2H 1TNLA 3ZYEA 1G30B 3BIVH 3VGCC 1AN1E 1E35B 1AD8H 4XFQA 4KKDA 3ITIA 1ANDA 3T27A 4E05H 4ZHAA 1QB9A 3FP8E 2I6QA 5BPEA 3RXIA 2TRMA 2HOBA 4UFDH 2A4QA 3A80A 1AE5A 2G52A 1DM4B 2P3FH 2J2UA 4MNXA 1BTPA 2H9HA 4BXWA 3LONA 1GBIA 3ZZDA 1AIXH 1VGCC 4X6MA 3BTDE 1SOZA 4NZLA 1ELAA 2BD7A 3BSQA 4ZXXH 1EUFA 4FUJA 4NZQA 4JCNA 3KCGH 1N6XA 1KLTA 1THSH 5HM9A 5C5OA 3PROA 2SNVA 3MMGA 4ZKOU 3ATMA 2ZI2H 1DOJA 1ZTKA 2V0BA 4Y6DA 3A8AA 1JIRA 4K8YA 3ZVEA 1HAXB 5AVDA 5LPFA 1BTZA 3SGAE 1HAPH 1MTUA 5FHTA 3M7TA 2GCHF 3MH7A 5EXMA 5E0JA 1C1SA 3DFJA 3GCTG 2H5DA 5FX6A 4DIHH 1EQ9A 1TA6A 1AUTC 1LHFH 2BLQA 1AB9C 3LH3A 1HNEE 1CE5A 1NPMA 4O9VA 3PLPA 3T62A 4A92A 3R3GB 1FJSA 1ELVA 4WF8A 5HYOA 2BMGB 2XBVA 3A8CA 3UOPA 1V2PT 1MTVA 2G00A 1UTMA 1BCUH 1IQGA 1TIOA 1UK2A 3QTVH 2AEIH 1QB1A 2GCHG 3ZZ7A 1A61H 2Z9KA 3RC5A 1K9OE 1XXFA 1G32B 2QF0A 1OWIA 1C2HA 3M7QA 1UCYE 1ZHRA 2BDHA 1GVLA 3TGIE 3S9CA 1L2EA 3UR9A 1WUNH 1PQAA 1GL0E 2PGBB 4WY3A 1BT7A 3URCA 2XCFA 3SO3A 1GBFA 2THFB 5DPAA 1SQTA 1MCTA 3HPTB 2G81E 1P2IA 2IPHA 4RKJB 2SFAA 2Z94A 1EPTB 3A86A 4MPVA 4DVAU 1P2NA 1HDTH 5F6MA 1OWEA 1QQUA 1GGDB 4LZ4B 4CRCA 3ZZCA 5I46H 3S7HB 1TA2A 1O2RA 3SU6A 3ZZ6A 3PMHB 2A7JA 4X1SU 1J17T 2ZDLA 4MVNA 5DGJA 1SHYA 1ELTA 3Q3KA 3F9EA 4TY6A 3RMMH 2CXVA 2GV7A 2FEQH 1AKSA 4Y0YE 1GHYH 5JPMH 2W5EA 3KQCA 1XUGA 2Z3EA 4AORA 2FOHA 2XBXA 1XXDA 1O3NA 2ODPA 1NN6A 3AW1A 6GCHF 3NZIA 1J8AA 2ZFTA 2R0KA 2A31A 3SGQE 1ANBA 3UIRA 3FANA 1T4VH 4MNVA 4H4FA 1HFDA 1ZHPA 3MI4A 1DICA 1C5SA 8LPRA 1SLWB 1V2TT 4FUEA 1DANH 1RIWB 3UWJH 1BTYA 4ZXYH 5IYTA 1JMOH 1O2UA 1YP9A 6LPRA 2HRVA 3S69A 1KXFA 1RJXB 3OY6U 1YLCA 2YNAA 6GCHG 4KTUA 1VCWA 2G4TA 2ZCKP 1ZR0A 3A8DA 1WBGB 1ETRH 4Y10E 1V2UT 2WINI 1BMAA 1SR5C 2O8WA 3E8LA 1DE7H 1W13U 3HGPA 2ZP0H 2FS9A 1EPTA 1TRYA 2ZPQA 3RU4D 3TJUA 2FI4E 1MAXA 1KIGH 4O03A 1Y59T 2Y6TA 1JRTA 1L4ZA 4CR9A 1SMFE 2ZHWH 3BTTE 1OS8A 1TPOA 2VVUA 1QRXA 4Y0ZE 4PROA 4UDWH 2RA0A 1A3EH 1NZQH 2GZ8A 1O34A 1W12U 1O3DA 3T5FH 1AVXA 1GMDF 3FAOA 1UHBB 5GIBA 2BXUH 1XUIA 1UJ1A 1A46H 1B5GH 1EKBB 1MBMA 3VB3A 4A1XA 4MG3A 3T25A 2DE9A 5TCCA 1LHGH 4DJZB 2R3UA 4NIYA 3V7TA 2ZECA 1D4PB 3Q76A 1RTKA 5EXLA 5DO4H 3MU8A 4HTCH 2UUYA 3MO3A 2OBQA 1LHCH 2IJOB 2XBYA 5A2MH 4FUIA 1GMDG 5CHAB 1BRCE 2STBE 4K69A 3TNTA 2P3TB 1AI8H 1CHGA 1C5ZB 2Y82A 1C1QA 2VH6A 3KIDU 3V13A 4ZH8A 1FQ3A 1GBHA 3SV8A 4HFPB 4AB8A 2G5VA 1YCPK 2AGIX 4JYVH 1N1LA 4I32A 1O39A 2ZFFH 4AFZA 4X6PA 2ODYB 3P8NA 3F9GA 1Y5UT 1GHBF 1O2XA 4X1NU 1ELEE 1OP2A 1G3BA 3PLBA 1TMTH 1YCPM 2OLGA 1OWDA 3MYWA 1EJAA 1GJDB 1QL9A 2ZDMA 1NRQH 4XBBA 1MU6B 3O8CA 1ZMNA 1C1NA 1T8NA 2ILNA 2FP7B 2R0LA 1PPCE 1TNGA 2UUJB 5F03A 1YPGH 1F92A 4ZROA 4BAOB 1ORFA 1JIMA 3SJOA 1K21H 1UHBA 4JZEH 1EZSC 1EPTC 1C1WH 4U32A 1IQEA 5DP4A 3SV2H 5AFZH 3U8TH 1IQNA 1GGDC 5K0HA 1O2QA 3ESTA 4B71A 5ABWA 1F0TA 5DP7A 4CRFA 5GDSH 1PYTD 1A4WH 1A0LA 3ZZ9A 2ZC9H 2WYGA 4ISLA 1PPHE 4IMZA 4BAHB 4ISOA 1P2QA 3M36A 1PPZA 3GCOA 1MAYA 2GCTB 4XE4A 8GCHG 3O8DA 3TLOA 1QA7A 2ZPRA 4CR5A 1BJUA 2ALVA 1SC8U 3SV9A 3MNBA 1SLVB 3GY3A 1G2LA 3TK9A 1QURH 4BOHA 5ETXA 5PTPA 1N6YA 2HPQH 1MQ5A 1V2QT 1AE8H 2ZGXH 4J1YA 1O3KA 3U9AH 1BJVA 1VJAU 1O30A 3AVZA 1C4V2 4JZIA 5DK1A 1TGSZ 3P8GA 3SJIA 2Q6FA 1HLTH 5DP5A 3ATIA 1ARBA 1LDTT 2HNTC 4A1VA 1RIWC 2BLWA 1FY3A 3RXLA 1TPPA 1G3DA 3LH1A 1NT1A 1TOCB 4SGBE 1LHDH 4CREA 4NWLA 1CU1A 2FXRA 4A1TA 1C4Y2 1SGCA 2ZU1A 1L1GA 3EE0B 1BITA 1TAWA 1V2KT 2GV6A 2H2ZA 1FPHH 2GMTB 3SUGA 2ZDNA 2Y5HA 3DUXH 2ASUB 4AYVB 3G01A 1K1IA 3URDA 4Y8ZA 3RU4E 2BLVA 1DX5M 1V2LT 1SGTA 1NESE 1SGIB 3B23B 3ZZAA 1EJMA 4GCHF 1T8MA 3SU5A 1IQHA 1BTXA 4X2YA 4ZKRU 5J4SA 5FXLA 2WPJS 3VXEH 1NFYA 2OTVA 1O33A 4RSPA 5DP3A 1ELCA 1SFIA 4AZ2B 4WXIA 2CJIA 1SQAA 4INKA 3BTHE 1V2JT 1K1PA 2AGGX 2LPRA 4DG4A 3NKKA 4I8HA 1MKWH 1SGPE 1GJ9B 3CS0A 1C5TA 1N8OB 2ZQ2A 2I6SA 1YPKH 5E0HA 2LNCA 2WV4A 4YOIA 2BQ7B 1DDJA 4XBCA 2XNIA 5L6NH 3BTGE 1GBBA 4Y7BA 5EQQA 1S6FA 3ATLA 4NIXA 1OYQA 4MNWA 4B2CA 3LT3A 1TGNA 1EJNA 4R8TB 3M5NA 4YTAA 3NWUA 2AIPA 2BHGA 2PSXA 2WPMS 3MH4A 1IQIA 2ZDVH 4I7YH 1MUEB 4AG1A 9ESTA 2V3OH 1TBQH 2Q6DA 2CF8H 1HPGA 2ZZUH 2A5IA 4OGXA 1Z1JA 3TH4H 1FV9A 1FY4A 1FI8A 4BXSA 2C8ZB 1H8DH 3QGJA 1F5RA 2G51A 4IN1A 1SL3A 1KXBA 1HAOH 4ZHMU 1B0EA 4CRBA 2BQ6B 1O5CB 2G55A 4WJG2 2VIVA 2TGPZ 3P8FA 1TBZH 4JMYA 5JBTA 4KP0A 4AFSA 3SORA 2QXIA 1KTTB 3OU0A 6CHAB 1FY8E 2ZQ1A 3P92A 1PJPA 1BIOA 2FPZA 5EQRA 3S0NA 3RXFA 1C2LA 2XXLA 3RXBA 2WUCA 1G9IE 3BTKE 3BEFB 1DUEA 1FONA 3ZV9A 5FPYA 5EODA 2BY5X 1S82A 4IBLH 4U30A 2R2MB 1JBUH 3A82A 5A0CA 1BTUA 1DPOA 1EZQA 2ESTE 5FBIA 3QX5H 5AF9H 5EPNA 5JBAS 3MNCA 3RXGA 3ZVCA 1ZLRA 3KEEA 2F9VA 3PLKA 2JH6D 4ABIA 2AMQA 1HIAA 2ZA5A 3VB4A 3RXSA 1V2RT 2FOGA 2BDGA 1Z7KA 1GCTB 2A7HA 4MPUA 3SGBE 3HKJB 1CGIE 2A2QH 1HRTH 2BDBA 1P9SA 2ZFQH 4H6SB 2V6NA 4X1QU 2Z9GA 3RXOA 3KQEA 2OCVB 1NTPA 4RKOB 6ESTA 3RXUA 1GDUA 1YPLH 1D9IA 1QIXB 4I8GA 1UTJA 2GCTC 3EA7A 4UD9H 5EGMA 5E2PA 3FFGA 1W14U 1NRPH 2ZFPH 1ZJKA 4BAKB 3H7OA 2ZHDA 1P9UA 2AH4X 2PHBA 5EPYA 2F91A 3JZ1B 3Q77A 1Z8GA 1IOEA 1C1UH 1T8OA 3C27B 1GBTA 4ESTE 2J94A 3P8OA 3L33A 2WYJA 4X2XA 4Y79A 1AVWA 3P95A 1Y3YA 1DT2A 2VIWA 2GP9B 3PV4A 3LJOA 1O2IA 1Z8IB 5A8YA 1GG6B 1KDQB 3F68H 3MU0A 8KME2 3PMBB 1K1LA 1CHOF 3EGKH 5B6OA 4FVDA 1BBRH 2UWOA 3UOUA 3QK1A 5E0GA 2PKAA 1K22H 2GMTC 2YOLA 4ASHA 5C1UA 2J38A 4Y11E 1THPB 3FZZA 1DVAH 2BOKA 1QRZA 3BN9A 3T28A 2B0FA 1A0HB 1DUAA 1B7XB 2QA9E 3GCTF 4GAWA 5EOKA 3SU1A 2Z3CA 1PQ7A 5G4BA 1OOKB 3ZZ4A 1JWTA 3GICB 3ZZ3A 1O3MA 1QTFA 3RXKA 1F7ZA 1OP8A 1CHOG 1TNKA 2P8OB 5K7RA 3FVFB 1CT4E 1UTQA 2C90B 5A0AE 1TABE 1BDAA 1FIWA 4SGAE 1MTWA 3SZNA 2VINA 1ZJDA 4X2WA 7ESTE 2BM2A 3BV9B 4XBDA 1T8LA 1VITH 3BEIB 4Y71A 3ZYDA 1SB1H 2BD9A 2HNTE 3M3TA 1INCA 2RA3A 2R2WU 1ZPZA 1CO7E 2ZFRH 1N8OC 4YO9A 3UY9A 1PPBH 1XUKA 1ZOMA 3TVJB 3KQDA 3RXDA 1ELGA 1TWXB 4D8NA 2R9PA 3ZVDA 1O3AA 1O2WA 2TBSA 4O3UA 1ZSJA 4FUBA 2TIOA 3E90B 1P03A 5CE1A 1O2PA 1AWHB 1HAHH 4TY7A 2FOEA 3VFEA 4U2WA 1UVOA 2J4IA 4K60A 5FCKA 1C5QA 1GJAB 1QGFA 2OP9A 3HKIB 1E38B 3OX7U 5F8XA 3MU4A 2BVRH 5F8TA 3DT0H 2O8TA 2A45B 3QUMP 1HAVB 1GJBB 1KY9A 2OC8A 3W95A 2FTLE 1TYNA 5C2ZA 1HUTH 2A5AA 2H6MA 2ULLA 1GHAG 2ZCLP 4D7FA 1EP5A 1W8BH 1A0JA 2A2XH 3ZZ5A 1WAYB 3RM0H 3FZDA 4THNH 1BB0B 2PFEA 3SV6A 4WVPE 2HNTF 1MQ6A 1C5YB 4CH2B 1FY5A 3QWCH 1H8IH 3QN7A 2P3UB 4YLQH 1RGQA 1BRBE 1FZZA 2HALA 3M61U 4GLYA 3H5CB 4K2YA 2GT8A 2PLXA 2FS8A 1SGYE 1L1NA 1ETTH 2QN5T 4ZMAH 2D8WA 2Y80A 5JDUB 3U1JB 3SU2A 1P3CA 1SOTA 3GDUA 1O32A 1GCTC 4H6TA 3PTNA 4I8KA 1C1OA 5C67A 5I25A 3SN8A 2SGFE 3T26A 2ZGJA 4YT7H 5JBCS 1TE0A 3RXMA 4CRAA 1HAYB 1O2KA 1O2JA 1QNJA 5IDKA 2GZ7A 1AU8A 1BZXE 8ESTE 1Z8RA 3ZZ8A 1ESBA 2V35A 1UVSH 4FUGA 2J92A 2CMYA 1IQFA 1UTKA 1DWCH 2F83A 4RN6A 1EAUA 1BHXB 1MH0A 1SVPA 1Z1IA 3SJKA 2PUXB 2QAAA 1FXYA 2AS9A 3MH6A 1EZXC 2FOAA 4OS1A 1GMHF 4Z0KA 1GHXH 4ZKSU 1IQMA 4CRGA 4FU9A 1HAVA 1Z6JH 1G37A 1HJ8A 1O3JA 4NFFA 4R0IA 3VEQB 4IS5A 5HM2A 2HLCA 1KTSB 1C1PA 2SGEE 1AFQB 2F3CE 2AGEX 1SBWA 1V2NT 1YPEH 2FDAA 4Y7AA 5CMXH 1SQOA 2KAIB 4I33A 1O5BB 1GG6C 1TOMH 2H9EH 3A7ZA 2FO9A 2WUBA 3LGTA 3I29A 2QXHA 1ZMLA 1P05A 3QZRA 2FI3E 1V3XA 1W0ZU 1O31A 1F0SA 3DD2H 4X8UH 1GMHG 2ZGBH 3EA8A 1EAWA 4DW2U 1A5IA 5FPTA 1QQ4A 2BD2A 3W94A 2IN2A 3B8JA 1E34B 1MMJN 4GVUA 2VB0A 3PB1E 1KXDA 7GCHG 1WQSA 2JETB 4NSYA 3D62A 1QRWA 1C5LH 3BF6H 3SNEA 2ZDKA 4TYDA 2C8XB 4BAMB 4MDSA 1W3CA 5AHGH 1UTNA 4ABBA 1AGJA 2P8OC 1IQLA 1O3EA 2BD3A 3GYLB 3TPIZ 1DSTA 3GDSA 1PQ8A 4Q7ZA 1FAKH 4UFFH 2G4UA 2Y5FA 3TGKE 2BDYA 1QL8A 2ZEBA 1C4U2 4WMDA 1PPGE 3BG4B 2ANKH 1PYTC 1AZZA 2NU2E 1FLEE 2ZO3H 1O5GH 1BA8B 3RXTA 4NCYA 2QGRA 1TRNA 2FX4A 5E8EH 2GT7A 2W3IA 3Q3XA 4B73A 3TK6A 3AAUA 1VR1H 3D49H 2ZU2A 5L30H 1EASA 4TPYA 5DP8A 1RTLA 2P59A 2AFQB 1V2WT 2KAIA 1WOFA 2ANYA 1ESTA 1D3DB 1S83A 1W10U 3SQEE 4YZUA 1OXGA 3UNQA 1Z6EA 4KGAA 1AO5A 4TPIZ 1OWKA 2CGAA 1ZPBA 1C2IA 1FNIA 1O3LA 1H9LB 2BD4A 8GCHF 1Q2WA 4NFEA 1LPGB 3CENA 3SU0A 2QCYA 3SI3H 1S84A 3E16B 1O2ZA 2VJ1A 1HAIH 4OS2A 1J15A 2OQUA 1V2ST 3LKWA 4ZUHA 1F0RA 4NGAH 3GY5A 1OP0A 3KNXA 4HGCA 1BQYA 1TQ7B 1YYY1 1AWFH 1G3EA 1VCPA 1GWAA 1VITF 5C1XA 3VXFH 3TH3H 1CBWB 1NRRH 4Q7YA 3RMLH 1WQVH 1NFWA 1P06A 3LGVA 4CRDA 1EOLA 1DY9A 2XW9A 1TGTA 2ZF0H 5F8ZA 1ZHMA 1QBVH 5HGGA 1K28D 1TGCA 1QY6A 2BD5A 2JKHA 1GJ8B 1O37A 3U1IB 2BD8A 1P2OA 1P57B 2Z7FE 1NS3A 2FTMA 1UTLM 5H4IB 3TGJE 3A7TA 1GHVH 3UPEA 2QXGA 2BTCE 3A85A 1C2DA 1UTOA 5TJXA 5LGOA 2K1QA 1NRSH 1QBNA 1VITG 4O3TA 3MNXA 2VVVA 3L6PA 3S7KB 1GJCB 1SGRE 3EQ0H 4ISNA 4XSKU 1GI0A 2H1UA 5A09A 1C2MA 3RC6A 5DKMA 2OD3B 2QF3A 3M3VA 3GCNA 3V3MA 1T4UH 2Z9JA 4K1TA 2Y5GA 3ATKA 3SUEA 3D65E 1AFQC 1TX6A 1O2SA 2NU3E 2Q6GA 4DIIH 1WYKA 3BIUH 3BTFE 3RMOH 1VCQA 2CV3A 4NA8A 1C1MA 1QFKH 1C2GA 4GHTA 1A2CH 1JRSA 1FUJA 2PSYA 2VNTA 2D26C 2SGAA 3VB5A 1SPJA 2P16A 5C5NA 1THRH 1SI5H 1O2YA 2BZAA 1P10A 1VGCB 1OWHA 4X8VH 1TGBA 4VGCB 1C5MD 4E06H 1TX7A 3TNSA 4X2VA 5GJ4B 1C2JA 1RS0A 1GL1A 5GWZA 4M7GA 2FLBH 1P8VC 3GY4A 1EB1H 5GCHG 3A8BA 3TH2H 2C93B 2JETC 1GBMA 2GDDA 4MQAA 1UMAH 1SGNE 1BMLA 1EOJA 3RXCA 4B76A 3K2UA 4FUDA 2OC0A 4D9QA 3TIUA 1RXPA 1XUFA 3RXJA 2BDAA 3MU5A 3BTEE 2GD4B 1UVPA 1F2SE 1RTFB 3RM2H 4FUFA 3A89A 1YLDA 1P11E 1TQ0B 5LPRA 3M3SA 3NUMA 3KN2A 3BTQE 1LPZB 1NO9H 4UFEH 5FBEA 3LGYA 1HBTH 1XVMA 2ZTYA 4WH8A 3SUFA 1BTWA 5CHAC 3ZZBA 2GTBA 4ISHH 3BG4C 4JYTA 1UVUH 1UCYH 2VWMA 4NA9H 3TK5A 5T6FA 4BTIB 3NCLA 1Y3WA 3LJJA 1H1BA 3MOCA 4GUXA 1C5OH 1T31A 4K8BA 1D6WA 4AGJA 3F9FA 3EAJA 2RG3A 2JH5D 1S0QA 3QO6A 1D3TB 2GGVB 3PYHA 1AVGH 2O9QA 2Q1JA 1GI2A 4NG9H 3RXAA 2A4RA 3A7VA 2AMDA 3RDZA 3F1SB 4I31A 1YGCH 1LO6A 1P2MA 1QBOA 4CBNA 1TRMA 3RXQA 3E6PH 1HAZB 1MKWK 2TGTA 4XOJA 5SGAE 5AFYH 1O3BA 1Z8JB 1GHZA 3TU7H 1K1JA 4B1TA 1O35A 1FY1A 4UFGH 1GBCA 1ZRBA 1BMNH 1YM0A 2PTCE 1MKXH 3MNSA 4IGDA 1TPAE 3GISB 4FU7A 1K2I1 1MTSA 2R3YA 3HGNA 1GI6A 1FMGA 2B5TB 3TJVA 1P2KA 1YF4A 1OWJA 4X6OA 2PWXA 2OXSA 1O3OA 2ZU4A 2FOFA 1TONA 3AASA 2CN0H 4IW4E 4AN7A 1O5DH 1GVKB 5EW1H 2EA3A 2VIDA 1ZGIA 1C5UA 1HJ9A 1NC6A 1AQ7A 1GI4A 1MZDA 2BXTH 1YPJH 1S6HA 3UTUH 3QLPH 2PR3A 2VVCA 1KXEA 1Y5BT 1CA0B 2SGPE 1NU9A 1O3CA 1CA8B 4WWYA 1GBDA 7KMEH 4GPGA 4BTTB 2ZTXA 1VJ9U 3A88A 1LKAA 4LXBH 1TMUH 3MFJA 2VGCB 1HV7A 1YBWA 1O2VA 3SNBA 1W7XH 2O8LA 1H4WA 2ZTZA 3A87A 3CS7A 2EI7A 1OX1A 3PMJA 1XKBC 3IITA 2O8MA 5L2ZH 1QJ7B 1ELDE 1W0YH 1QA0A 2FYRA 1ELBA 1TNIA 1WCZA 3A83A 1O2NA 2A0QB 4DY7B 4ABDA 1GMCF 3NPSA 1O3IA 1ZZZA 3LDXH 2ZU3A 2NWNA 4LOYH 1MKXK 4OS5A 3SU3A 1C2KA 1H9IE 4AOQA 3P6ZB 1MD8A 3T2NA 1G36A 2Y81A 4NWKA 2WPLS 1C1RA 2JH0D 3STIA 4F49A 1FDPA 4Y8XA 1O36A 2BOHB 2BVXH 3ZVFA 3SJ8A 3GY2A 1C1VH 3A7WA 1ELFA 2WPKS 3AAVA 1E36B 2XC4A 3UREA 1GI7B 4ABJA 1K1OA 1DWDH 4NIVA 3A84A 3SI4H 3RXVA 1KLIH 1ANEA 4Y76A 2DE8A 4AGKA 1GMCG 4NA7A 1HAGE 1V2MT 1MD7A 1O38A 2XTTB 1P2JA 3MWIU 4WMEA 2PGQB 4FUCA 3LOXA 1Q3XA 4VGCC 3RLYH 1P09A 1QL7A 2QIQA 1V2OT 3NK8A 1TALA 1C9PA 2ODQA 1Y8TA 1MZAA 5L2YH 3WY8A 1H9HE 3RXHA 1OKXA 1XUHA 2QXJA 1XVOA 1Z71A 3U8OH 1LMWB 1AKSB 3E1XB 1QB6A 2FOBA 4JZFH 2BDIA 4WMFA 1L1JA 1FPCH 1WSSH 1GHAF 1ETSH 1CGJE 1AY6H 1ZSKA 2W7UA 2SGDE 1D6RA 1PQ5A 4OS6A 1BBRK 1C2FA 1X7AC 4DURA 1KXCA 1LQEA 2P95A 1KDQA 2A4GA 1T7CA 1LVMA 3RP2A 1FIZA 2BX4A 2Z9IA 5BRRE 2A7CA 1V6DA 1TPSA 4X1PU 3GDVA 1YKTA 3SJ9A 1NRNH 1VZQH 2SNWA 2FI5E 1AFEH 1UVTH 4F4OC 4OS4A 1P12E 3DFLA 3A7XA 3O8BA 2J95A 1OYTH 1ABJH 6CHAC 2D1JA 3PTBA 1ACBE 1IHSH 1GI9B 4ZHLU 2UWPA 1GBAA 1HXFH 4JYUH 1A7SA 3ZV8A 1C5RA 5J4QA 3RUOA 3JZ2B 2ZGHA 4X1RU 4DT7B 3LGWA 3U8RH 2FOMB 1DSUA 5FAHA 1L4DA 1P0SH 2P93A 4DOQA 4Y8YA 4X6NA 2PUQH 4K3JA 1NFXA 1EZUC 2VIPA 1J9CH 1BHXF 5EQSA 1S5SA 2UUFB 1IQJA 2OBOA 2F9PA 3UQVA 3GOVB 3VB7A 1MU8B 2EI8A 5C1YA 3UUZA 1BMMH 3LGIA 5EG4A 2QV1A 2BQWB 1KLJH 2PTNA 5ESBA 1O2GH 3M5LA 4MNYA 1GJ7B 2FYQA 4UE7H 4K5ZA 1GHWH 1TFXA 2F9OA 5ESTE 4U01A 4INHA 1GCDA 1C2EA 2AERH 1SLXB 5JYIA 2W26A 2F9NA 2FX6A 1GJ4H 3K6ZA 2Y7ZA 1CGHA 1E37B 1NFUA 2ZIQH 1DY8A 2GKVE 4I8JA 1K1NA 1ZSLA 1LKBA 2ZGCA 2IOTA 4JZ1A 3C1KA 3BTME 1CA0C 3LU9B 3SNDA 1T32A 5C3NA 1GPZA 1D3QB 1XKAC 3RMNH 4OGYA 1GDQA 4NIWA 3SQHE 1O3HA 3I77A 2STAE 2VGCC 3F9HA 2CHAB 1O2TA 3QGNB 1CT0E 3ZVGA 7GCHF 4D9RA 1AHTH 5GPIB 2ZHEH 1YPMH 2BY6X 4YLUA 2PW8H 3TJOA 3A81A 3RC4A 3VB6A 2W7SA 4B75A 1IAUA 2BLOA 3SNAA 1FN6A 1E0FD 3BG8A 3LC5A 4KTCA 3Q00A 3LGUA 1QCPA 2XYAA 1SLUB 2XBWA 1RD3B 4YOJA 3DA9B 3QTOH 1EB2A 4B74A 4J2YB 2Z9LA 2TGDA 3FP6E 3PWCA 2FOCA 2F9UA 1YCPH 1BBRE 3FP7E 4FUHA 1ANCA 3GY7A 1UK4A 2WPHS 1LVYA 3RXPA 1J16A 3F6UH 1O0DH 1BRAA 2G8TA 1C1TA 4HZHA 1QJ1B 4BAQB 4JK5A 2BY9X 2C8WB 2FLRH 1ZYOA 1ZGVA 4E7RG 4A7IB 5A0BA 2FZZA 1O2MA 2VWLA 1O5FH 3D23A 1SGEE 1ZPCA 2BB4A 4GHQA 3VPKA 3V0XA 1UO6A 2VH0A 4IC5A 2VWNA 1IHTH 2HPPH 1CT2E 3M5OA 1YC0A 2Z6BD 1TLDA 1EP6A 1SGDE 2XC0A 3SHAH 3UQOA 1LVOA 2GZ9A 1G3CA 2HVXA 2XCNA 2ZFSA 5T6DA 3RLWH 2RCEA 1LHEH 1ZRKA 2FWWA 4IC6A 4IMQA 3M37A 1BTHH 7LPRA 4ABAA 1Y3UA 1SGQE 2FODA 1C5XB 4DGJA 3RXEA 1Q31A 2GX4A 1RFNA 2ALPA 1GI8B 4FU8A 4BNRA 1MBQA 1C5WB 4MTBA 2BVSH 1WV7H 4AB9A 1HJAB 1TB6H 3SV7A 3UNRA 2ZG0H 1FN8A 4DCDA 2VIOA 4LZ1H 3IG6B 1A5GH 3SBKA 2OINA 2BY7X 2QYIA 3B9FH 5DJ7A 1F5LA 1FAXA 2HGTH 3HK6B 2PKSB 1LQDB 1DWBH 1YPHC 5HMAA 2GDEH 3PO1B 5T3HA 1WTGH 3U98H 5LPEA 4A6LA 5C20A 4AFUA 3K6YA 4QT8C 2VIQA 4BTUB 1XX9A 2OUAA 4OS7A 2NU1E 2H5CA 1LCYA 2BX3A 2ZU5A 4MLFB 4HI3A 5DP6A 1O3GA 1QR3E 2Z3DA 4LK4A 4GSOA 1K1MA 4K1SA 1DWEH 3RXRA 2ANMH 3GCHB 3PWBA 2ANWA 3ZVBA 3DHKH 1SFQB 1QHRB 1LPKB 1EATA 3NXPA 4MPXA 4CHAB 5FCRA 3LC3A 1ZMJA 5T6GA 1GHBG 1GVZA 4UONA 2UUKB 3MU1A 3MO6A 4FVBA 3O8RA 2D2DA 3IWMA 1ID5H 1Y3XA 3ODFA 2ZWLH 2OC7A 2A32A 1JXPA 1BRUP 2XWBI 1UTPA 1A3BH 4B2AA 4IN2A 3ENSB 4X8SH 3TITA 2W3KA 5TCAA 1TNHA 2A5KA 2B7DH 2NU0E 2RDLA 5DG6A 4D7GA 4AX9H 4D76A 3V12A 2A4OA 1LTOA 2ZNKH 3LPRA 3SUDA 2C8YB 5HXFA 2QY0B 4CBOA
chains in the Genus database with same CATH superfamily
4ABGA 1HB0B 3SHCH 3MTYA 1MTNB 4JK6A 1F0UA 3GY8A 3WW7A 1V2VT 3KF2A 3L3TA 1S0RA 4B2BA 2M5TA 1SG8B 4Z6AH 3M5MA 3M35A 2ZDAH 4Q80A 1EAIA 4JZDH 1P01A 5JBBS 3UFAA 1NROH 2TGAA 3KYFA 4E7NA 1DXWA 2CHAC 5GCHF 2B8OH 3VGCB 2GVFA 3EA9A 5F53A 1Y5AT 4X0WU 1OSSA 1DLKB 3E0NB 3SU4A 2XOKD 4YOGA 2BYAX 2AYWA 1HYLA 1XMNB 3PMAB 2FIRH 3SNCA 1DS2E 4BANB 1D3PB 1F5KU 1G2MA 1B0FA 2C4FH 3H7TA 3LIWA 5E2OA 1E79D 3KHVA 3S9AA 2QC2A 3MH5A 4A5TS 1J14A 5EXNA 3M7UA 3T29A 1GJ6A 1PPEE 4I8LA 3S9BA 3OTPA 4F48B 1L0ZA 2AMPA 1GBKA 4UEHH 1CVWH 1PFXC 3P70B 4ZKNU 1ZTJA 4FXGH 1LVBA 2G5NA 3SW2B 1RRKA 2BY8X 2V3MA 5DSFA 2UWLA 3QZQA 2XRCA 1EX3A 1O2HA 3I78A 3GY6A 3DSGA 2KX4A 2V3HH 1BUIA 2Y7XA 4TWYA 2FMJA 4YESB 2CF9H 4FETA 3KGPA 3RU4T 1CSOE 1IQKA 5A8XA 3STJA 1O2LA 4ISIH 1AUJA 1DFPA 1UK3A 3ATWA 4MPWA 2AIQA 3HK3B 5FX5A 2EI6A 2LELA 3U69H 3UNSA 1CQQA 1HIAB 3CP7A 1DLEA 1S85A 1KYNA 3HATH 1C5NH 4GCHG 4WH6A 2ZHFH 2H9TH 4ABHA 1AB9B 4AFQA 5JB9S 1W7GH 1ARCA 2F9BH 2J34A 2DUCA 3BTWE 4Q7XA 3TJNA 3K65B 1PPFE 2XC5A 4KTSA 2HWLB 2L6OA 1SGFG 2EC9H 3BEUA 5LH8A 3Q3YA 2P94A 2SGQE 1O2OA 2BZ6H 1P3EA 1HGTH 4Z1MD 1GBEA 2J9NA 2BDCA 1DITH 1ABIH 2OC1A 4H42U 2ZKSA 4WXVA 1EAXA 1EXFA 1HJAC 3ODDA 3ELAH 4AG2A 1TX8A 5FPSA 4O97A 1HCGA 1A1RA 1GBLA 1O3FA 3P17H 3SOSA 2ZPSA 3KQBA 4INLA 3K9XB 2VWOA 2PKSC 1JOUB 2FM2A 3PO1C 4ZAEA 4TWWA 2ZCHP 1SHHB 4YM9A 1NY22 1S81A 1WU1A 3UWIA 2YNBA 3UR6A 1AZ8A 1GBJA 5JB8S 1U6QA 2PKAB 2KZ4A 1XM1A 3QDZB 4X8TH 3GCHC 1NM6A 3OY5U 2WV5A 1ZTLA 3AW0A 1HXEH 1O5EH 3GYMA 1QJ6B 1WXRA 1C5VA 1NU7B 4K1EA 4CHAC 1GJ5H 4YT6H 1UCYK 1XUJA 3N7OA 5GXPA 1CBWC 3R0FA 3MHWU 1TBRH 2OQ5A 1TNJA 5C0UA 1KSNA 1WTHD 1W2KH 4ABFA 3A7YA 3E0PB 4AYYB 3KL6A 5HKKD 1O3PB 2C3SA 2PV9B 4NSVA 1Y3VA 3VG8A 1GI1A 2B9LA 1GI5A 3OYPA 2O8UA 4XDEA 2J98B 3ZIAD 2FESH 4Q2KA 4Q63A 3OSYA 3OTJE 1DXPA 5EU8A 2XWAA 1ESAA 1W11U 5A8ZA 4KELA 1C9TA 2TPIZ 2NU4E 1YPHE 1P04A 2EEKA 3E91A 1SSXA 9LPRA 1GDNA 1OPHB 3ZVAA 2VU8E 1SGFA 1O5AB 1MCVA 3E3TA 1M9UA 2W6JD 1AMHA 2KCYA 1A5HA 2A1DB 3PM3A 4ABEA 5DP9A 1BOQA 1MTNC 2WPIS 1YLNA 2ZHQH 3EDXB 3MO9A 4CH8B 3EYDA 1P02A 1KXAA 1TMBH 1C5PA 1GI3A 5EW2H 1TNLA 3ZYEA 1G30B 3BIVH 3VGCC 1AN1E 1E35B 1AD8H 4XFQA 4KKDA 3ITIA 4FOUC 1ANDA 3T27A 4E05H 4ZHAA 1QB9A 3FP8E 2I6QA 5BPEA 3RXIA 3FO8D 2TRMA 2HOBA 4UFDH 2A4QA 3A80A 1AE5A 2G52A 1DM4B 2P3FH 2J2UA 4MNXA 1BTPA 2H9HA 4BXWA 3LONA 1GBIA 3ZZDA 5CHBA 1AIXH 1VGCC 4X6MA 3BTDE 1SOZA 4NZLA 1ELAA 2BD7A 3BSQA 4ZXXH 1EUFA 4FUJA 4NZQA 4JCNA 3KCGH 1N6XA 1KLTA 1THSH 5HM9A 5C5OA 3PROA 2SNVA 3MMGA 4ZKOU 3ATMA 2ZI2H 1DOJA 1ZTKA 2V0BA 4Y6DA 2IPQX 3A8AA 3MQKC 1JIRA 4K8YA 3ZVEA 2J98A 1HAXB 3GS9A 5AVDA 5LPFA 1BTZA 3SGAE 1HAPH 1MTUA 5FHTA 3M7TA 2GCHF 3MH7A 3WWFA 5EXMA 5E0JA 4B6FA 1C1SA 3DFJA 3GCTG 2H5DA 2W6ID 5FX6A 2KCPA 4DIHH 1EQ9A 1TA6A 1AUTC 1LHFH 2BLQA 1AB9C 3LH3A 1HNEE 2F4LA 1CE5A 1NPMA 4O9VA 3PLPA 3T62A 4A92A 3R3GB 1FJSA 1ELVA 4WF8A 5HYOA 2BMGB 5HIYA 2XBVA 3A8CA 3UOPA 1V2PT 1MTVA 2G00A 1UTMA 3PV2A 1BCUH 1IQGA 1TIOA 1UK2A 3QTVH 3WWBA 2AEIH 1QB1A 2GCHG 3ZZ7A 1A61H 2Z9KA 3RC5A 1K9OE 1XXFA 1G32B 2QF0A 1OWIA 1C2HA 3M7QA 1UCYE 1ZHRA 2BDHA 1GVLA 3TGIE 3S9CA 1L2EA 3UR9A 1WUNH 1PQAA 1GL0E 2PGBB 4WY3A 1BT7A 3URCA 2XCFA 3SO3A 1GBFA 2THFB 5DPAA 1SQTA 1MCTA 3HPTB 2G81E 1P2IA 2IPHA 4RKJB 2SFAA 2Z94A 1EPTB 3A86A 4MPVA 4DVAU 1P2NA 1HDTH 5F6MA 1OWEA 1QQUA 1GGDB 4LZ4B 4CRCA 3ZZCA 5I46H 3S7HB 1TA2A 1O2RA 3SU6A 3ZZ6A 3PMHB 2A7JA 4X1SU 1J17T 2ZDLA 4MVNA 5DGJA 1SHYA 3W1EA 1ELTA 3Q3KA 3F9EA 4TY6A 3RMMH 2CXVA 2GV7A 1W0KD 2FEQH 1AKSA 4Y0YE 2YMSB 1GHYH 5JPMH 2W5EA 3KQCA 1FX0B 1XUGA 2Z3EA 4AORA 2FOHA 2XBXA 1XXDA 1O3NA 2ODPA 1NN6A 3AW1A 6GCHF 3NZIA 1J8AA 2ZFTA 2R0KA 2A31A 3SGQE 1ANBA 3UIRA 3FANA 1T4VH 4MNVA 4H4FA 1HFDA 1ZHPA 3MI4A 1DICA 1C5SA 4XD7D 8LPRA 1SLWB 1V2TT 4FUEA 1DANH 1RIWB 3UWJH 1BTYA 4ZXYH 5IYTA 2OK5A 1JMOH 1O2UA 1YP9A 6LPRA 2HRVA 3S69A 1KXFA 5HIZA 1RJXB 3OY6U 1YLCA 2YNAA 6GCHG 4KTUA 1VCWA 2G4TA 2ZCKP 1ZR0A 3DCLA 3A8DA 1WBGB 1ETRH 4Y10E 1V2UT 2WINI 1BMAA 1SR5C 2O8WA 3E8LA 1DE7H 1W13U 2KCOA 3HGPA 2ZP0H 2FS9A 1EPTA 1TRYA 2ZPQA 3RU4D 3TJUA 2FI4E 1MAXA 1KIGH 4O03A 1Y59T 2Y6TA 1NBME 1JRTA 1L4ZA 4CR9A 1SMFE 2ZHWH 3BTTE 1OS8A 1TPOA 2VVUA 1QRXA 4Y0ZE 4PROA 4UDWH 2RA0A 1A3EH 1NZQH 2GZ8A 1O34A 1W12U 1O3DA 2L74A 3T5FH 1AVXA 1GMDF 3FAOA 1UHBB 5GIBA 2BXUH 1XUIA 1UJ1A 1A46H 1B5GH 1EKBB 1MBMA 3VB3A 4A1XA 4MG3A 3T25A 2DE9A 5TCCA 1LHGH 4DJZB 2R3UA 4NIYA 3V7TA 2ZECA 1D4PB 3Q76A 1RTKA 5EXLA 5DO4H 3OFND 3MU8A 5B6LA 4TSFD 4HTCH 2UUYA 3MO3A 1YWUA 2OBQA 1LHCH 2IJOB 2XBYA 5A2MH 4FUIA 1GMDG 5CHAB 1BRCE 2STBE 4K69A 3TNTA 2P3TB 1AI8H 1CHGA 1C5ZB 2Y82A 1C1QA 2VH6A 3KIDU 3V13A 4ZH8A 1FQ3A 1GBHA 3SV8A 3KYGA 4HFPB 4AB8A 2G5VA 1YCPK 2AGIX 4JYVH 1N1LA 4I32A 3UAIC 1O39A 2ZFFH 4AFZA 2JJ1D 4X6PA 2ODYB 3P8NA 3F9GA 3FN8A 1Y5UT 1GHBF 1O2XA 4X1NU 1ELEE 1OP2A 1G3BA 3PLBA 1TMTH 1YCPM 2OLGA 1OWDA 3MYWA 1EJAA 1GJDB 1QL9A 2ZDMA 1NRQH 4XBBA 1MU6B 3O8CA 1ZMNA 1C1NA 1T8NA 2ILNA 2FP7B 2R0LA 1PPCE 1TNGA 2UUJB 5F03A 1YPGH 1F92A 4ZROA 4BAOB 1ORFA 1JIMA 3SJOA 1K21H 1UHBA 4JZEH 1EZSC 1EPTC 1C1WH 4U32A 1IQEA 5DP4A 3SV2H 5AFZH 3U8TH 1IQNA 1GGDC 5K0HA 1O2QA 3ESTA 4B71A 5ABWA 1F0TA 5DP7A 4CRFA 5GDSH 1PYTD 1A4WH 1A0LA 3ZZ9A 2ZC9H 2WYGA 4ISLA 1PPHE 4IMZA 4BAHB 4ISOA 3N99A 1P2QA 3M36A 1PPZA 3GCOA 1MAYA 5FL7D 2GCTB 4XE4A 2YMSC 8GCHG 2EY4C 3O8DA 3TLOA 1QA7A 1UW7A 2ZPRA 4CR5A 1BJUA 2ALVA 1SC8U 3SV9A 3MNBA 1SLVB 3GY3A 1G2LA 4Q4LA 3TK9A 1QURH 4BOHA 5ETXA 5PTPA 1N6YA 2HPQH 1MQ5A 1V2QT 1AE8H 2ZGXH 4J1YA 1O3KA 3U9AH 1BJVA 1VJAU 1O30A 3AVZA 1C4V2 4JZIA 5DK1A 1TGSZ 3P8GA 3SJIA 2Q6FA 1HLTH 5DP5A 3ATIA 1ARBA 1LDTT 2HNTC 4A1VA 1RIWC 2BLWA 1FY3A 3RXLA 1TPPA 1G3DA 3LH1A 1NT1A 1TOCB 4SGBE 1LHDH 4CREA 4NWLA 1CU1A 2FXRA 4A1TA 3PV5A 1C4Y2 1SGCA 2ZU1A 3CNRA 5EJ1A 1L1GA 3EE0B 1BITA 1TAWA 1V2KT 2GV6A 2H2ZA 1FPHH 2GMTB 3SUGA 2ZDNA 2Y5HA 3DUXH 2ASUB 4AYVB 3G01A 1K1IA 3URDA 2KR7A 4Y8ZA 5GNDA 2YMSD 3RU4E 2BLVA 1DX5M 1V2LT 1SGTA 1NESE 1SGIB 3B23B 3ZZAA 1EJMA 4GCHF 1T8MA 3SU5A 1IQHA 1BTXA 4X2YA 4ZKRU 5J4SA 5FXLA 2WPJS 3VXEH 1NFYA 2OTVA 1O33A 4RSPA 5DP3A 1ELCA 1SFIA 4AZ2B 4WXIA 2CJIA 1SQAA 4INKA 3BTHE 1V2JT 2LP6A 1K1PA 2AGGX 2LPRA 4DG4A 3NKKA 4I8HA 1MKWH 1SGPE 1GJ9B 3CS0A 1C5TA 1N8OB 2ZQ2A 2I6SA 1YPKH 1VKYA 5E0HA 2LNCA 2WV4A 4YOIA 2BQ7B 1DDJA 4XBCA 2XNIA 5L6NH 3BTGE 3H09A 1GBBA 4Y7BA 5EQQA 1S6FA 3ATLA 4NIXA 1OYQA 4MNWA 4B2CA 3LT3A 1TGNA 1EJNA 2QE7D 4R8TB 4RT0A 4RT1A 3M5NA 4YTAA 3NWUA 2AIPA 2BHGA 2PSXA 2WPMS 3MH4A 1IQIA 2ZDVH 4I7YH 1MUEB 4AG1A 9ESTA 2V3OH 1TBQH 2Q6DA 2CF8H 5KEDA 1HPGA 2ZZUH 2A5IA 4OGXA 1Z1JA 3OE7D 3TH4H 1FV9A 1FY4A 1FI8A 4BXSA 2C8ZB 1H8DH 1S6LA 3QGJA 1F5RA 2G51A 4IN1A 1SL3A 1KXBA 1HAOH 4ZHMU 1B0EA 4CRBA 2BQ6B 1O5CB 2G55A 4WJG2 4XRNA 2VIVA 2TGPZ 3P8FA 1TBZH 4JMYA 5EIYA 5JBTA 5KECA 4KP0A 4AFSA 3SORA 2QXIA 1KTTB 3OU0A 6CHAB 1FY8E 2ZQ1A 3P92A 1PJPA 1BIOA 2FPZA 5EQRA 3S0NA 3RXFA 1C2LA 3FOAA 2XXLA 3RXBA 2WUCA 1G9IE 3BTKE 3BEFB 4ACBA 1DUEA 1FONA 3ZV9A 5FPYA 5EODA 2BY5X 1S82A 4IBLH 4U30A 2R2MB 1JBUH 3A82A 5A0CA 1BTUA 1DPOA 1EZQA 2ESTE 5FBIA 3QX5H 5AF9H 5EPNA 5JBAS 3MNCA 3RXGA 3ZVCA 1ZLRA 3KEEA 2F9VA 3PLKA 2JH6D 4ABIA 2AMQA 1HIAA 2ZA5A 3VB4A 3RXSA 1V2RT 2FOGA 2BDGA 1Z7KA 1GCTB 2A7HA 4MPUA 3SGBE 3HKJB 1CGIE 2A2QH 3F3BA 1HRTH 2BDBA 1P9SA 2ZFQH 4H6SB 2V6NA 4X1QU 2Z9GA 3RXOA 3KQEA 2OCVB 1NTPA 4RKOB 6ESTA 3RXUA 1GDUA 1YPLH 2HLDD 1D9IA 1QIXB 4I8GA 1UTJA 2GCTC 3EA7A 4UD9H 5EGMA 5E2PA 3FFGA 1W14U 1NRPH 2ZFPH 1ZJKA 4BAKB 3H7OA 2ZHDA 1P9UA 2AH4X 2V7QD 2PHBA 5EPYA 2F91A 3JZ1B 3Q77A 1Z8GA 1IOEA 1C1UH 1T8OA 3C27B 1GBTA 4ESTE 2J94A 3P8OA 3L33A 2WYJA 4X2XA 4Y79A 1AVWA 3P95A 1Y3YA 1DT2A 2VIWA 2GP9B 3PV4A 3LJOA 1O2IA 1Z8IB 5A8YA 1GG6B 1KDQB 2KCAA 3F68H 3MU0A 2WHXA 8KME2 3PMBB 3F2HA 1K1LA 1CHOF 3EGKH 5B6OA 4FVDA 1BBRH 2UWOA 3UOUA 3QK1A 5E0GA 2PKAA 5C94A 1K22H 2GMTC 2YOLA 4ASHA 5C1UA 2J38A 4Y11E 1THPB 3FZZA 1DVAH 2BOKA 2AHME 1QRZA 3BN9A 3T28A 2B0FA 1A0HB 1DUAA 1B7XB 2QA9E 3GCTF 4GAWA 5EOKA 3SU1A 2Z3CA 1PQ7A 5G4BA 1OOKB 3ZZ4A 1JWTA 3GICB 3ZZ3A 1O3MA 1QTFA 3RXKA 1F7ZA 1OP8A 1CHOG 1TNKA 2VBCA 2P8OB 5K7RA 3FVFB 1CT4E 2K8IA 1UTQA 2C90B 5A0AE 1TABE 1BDAA 1FIWA 4SGAE 1MTWA 3SZNA 2VINA 1ZJDA 4X2WA 7ESTE 2BM2A 3BV9B 4XBDA 1T8LA 1VITH 3BEIB 4Y71A 1SQRA 3ZYDA 1SB1H 2BD9A 2HNTE 3M3TA 1INCA 2RA3A 2R2WU 1ZPZA 1CO7E 2ZFRH 1N8OC 4YO9A 3UY9A 1PPBH 1XUKA 1ZOMA 3TVJB 3KQDA 3RXDA 1ELGA 1TWXB 4D8NA 2R9PA 3ZVDA 1O3AA 1O2WA 2TBSA 4O3UA 1ZSJA 4FUBA 2TIOA 3UB0A 3E90B 1P03A 2KM0A 5CE1A 1O2PA 1AWHB 1HAHH 4TY7A 2FOEA 3VFEA 4U2WA 1UVOA 2J4IA 4K60A 5FCKA 1C5QA 1GJAB 1QGFA 2OP9A 3HKIB 1E38B 3OX7U 4ZCNA 5F8XA 3MU4A 2BVRH 5KGOA 2JIZD 3DT0H 5F8TA 2O8TA 2A45B 3QUMP 1HAVB 1GJBB 3PRBA 1KY9A 2OC8A 3W95A 3SZEA 2FTLE 1TYNA 5C2ZA 1HUTH 2A5AA 2H6MA 2ULLA 1GHAG 2ZCLP 4D7FA 4ACAA 1EP5A 1W8BH 5DN6D 1A0JA 2A2XH 3ZZ5A 1WAYB 3RM0H 3FZDA 4THNH 1BB0B 2PFEA 2QF5A 3SV6A 4WVPE 2HNTF 1MQ6A 1C5YB 4CH2B 1FY5A 3QWCH 1H8IH 3QN7A 2P3UB 4YLQH 1RGQA 1BRBE 1FZZA 2HALA 3M61U 4GLYA 3H5CB 4K2YA 3DSPA 2GT8A 2PLXA 3FKSD 2FS8A 1SGYE 1L1NA 1ETTH 2QN5T 4ZMAH 2D8WA 2Y80A 5JDUB 3U1JB 1E1RD 3SU2A 1P3CA 1SOTA 2WV9A 3GDUA 5CDFE 1O32A 1GCTC 4H6TA 3PTNA 4I8KA 1C1OA 5C67A 5I25A 3SN8A 2SGFE 3T26A 2ZGJA 3N7EA 4YT7H 5JBCS 1TE0A 3RXMA 4CRAA 1HAYB 1O2KA 1O2JA 1QNJA 5IDKA 2GZ7A 1AU8A 1BZXE 8ESTE 1Z8RA 3ZZ8A 1ESBA 2V35A 1UVSH 4FUGA 2J92A 2CMYA 1IQFA 1UTKA 1DWCH 2F83A 4RN6A 1EAUA 1BHXB 1KMHB 1MH0A 1SVPA 1Z1IA 3SJKA 2PUXB 2QAAA 1FXYA 2AS9A 3MH6A 1EZXC 2FOAA 4OS1A 1GMHF 4Z0KA 1GHXH 4ZKSU 1IQMA 4CRGA 4FU9A 1HAVA 1Z6JH 1G37A 1HJ8A 1O3JA 4NFFA 4R0IA 3VEQB 4IS5A 5HM2A 2HLCA 1KTSB 1C1PA 2SGEE 1AFQB 2F3CE 2AGEX 1SBWA 1V2NT 1YPEH 2FDAA 4Y7AA 5CMXH 1SQOA 2KAIB 4I33A 1O5BB 1GG6C 1TOMH 2H9EH 3A7ZA 2FO9A 2WUBA 3LGTA 3I29A 2QXHA 1ZMLA 3KQ5A 1P05A 3QZRA 4M9FA 2FI3E 1V3XA 1W0ZU 1O31A 1F0SA 3DD2H 4X8UH 1GMHG 2ZGBH 3EA8A 1EAWA 4DW2U 1A5IA 5FPTA 1QQ4A 2BD2A 3W94A 2IN2A 3B8JA 3F0PA 1E34B 1MMJN 4GVUA 2VB0A 3PB1E 1KXDA 7GCHG 1WQSA 2JETB 4NSYA 3D62A 1QRWA 2K0QA 1C5LH 3BF6H 3SNEA 2ZDKA 4TYDA 2C8XB 4BAMB 4MDSA 1W3CA 5AHGH 1UTNA 4ABBA 1AGJA 2P8OC 1IQLA 1O3EA 2BD3A 3GYLB 3TPIZ 3DSOA 1DSTA 3GDSA 1PQ8A 4Q7ZA 1FAKH 4UFFH 2G4UA 2Y5FA 3TGKE 2BDYA 1QL8A 2ZEBA 1C4U2 4WMDA 1PPGE 3BG4B 2ANKH 1PYTC 1AZZA 1H8ED 2NU2E 1FLEE 2ZO3H 1O5GH 1BA8B 3RXTA 4NCYA 2QGRA 1TRNA 2FX4A 5E8EH 2GT7A 2W3IA 3Q3XA 4B73A 3TK6A 3AAUA 1VR1H 4RI0A 3D49H 2ZU2A 5L30H 1EASA 4TPYA 5DP8A 1RTLA 2P59A 2AFQB 1V2WT 2KAIA 1WOFA 3OEHD 2ANYA 1ESTA 1D3DB 1S83A 1W10U 3SQEE 4YZUA 1OXGA 3UNQA 1Z6EA 4KGAA 1AO5A 5EJLA 4TPIZ 2WPDD 1OWKA 2CGAA 1ZPBA 1C2IA 1FNIA 1O3LA 1H9LB 2BD4A 8GCHF 1Q2WA 4NFEA 1LPGB 3F2GA 3CENA 3SU0A 2QCYA 3SI3H 1S84A 4TT3D 3E16B 1O2ZA 2VJ1A 1HAIH 4OS2A 1J15A 2OQUA 1V2ST 2HVYB 3LKWA 4ZUHA 1F0RA 4NGAH 3GY5A 1OP0A 3KNXA 4HGCA 1BQYA 1TQ7B 1YYY1 1AWFH 1G3EA 1VCPA 1K0HA 1GWAA 1VITF 5C1XA 3VXFH 3TH3H 1CBWB 1NRRH 4Q7YA 3RMLH 1WQVH 1NFWA 1P06A 3LGVA 4CRDA 1EOLA 1DY9A 2XW9A 1TGTA 2ZF0H 3OAAD 5F8ZA 1ZHMA 1QBVH 5HGGA 1K28D 1TGCA 1QY6A 2BD5A 2PP6A 2JKHA 1GJ8B 1O37A 3U1IB 2BD8A 1P2OA 1P57B 2Z7FE 1NS3A 2FTMA 1UTLM 5H4IB 4HG6A 3TGJE 3A7TA 1GHVH 3UPEA 2QXGA 2BTCE 3A85A 1C2DA 1UTOA 4ASUD 5TJXA 3F2FA 5LGOA 2K1QA 1NRSH 2WSSD 1QBNA 1VITG 4O3TA 3MNXA 2VVVA 3L6PA 3S7KB 1GJCB 1SGRE 3EQ0H 4ISNA 4XSKU 1GI0A 2H1UA 5A09A 1C2MA 3RC6A 5DKMA 2OD3B 2QF3A 3M3VA 3GCNA 3V3MA 1T4UH 2Z9JA 4K1TA 2Y5GA 3ATKA 3SUEA 3D65E 1AFQC 1TX6A 1O2SA 2NU3E 2Q6GA 4DIIH 1WYKA 3BIUH 3BTFE 3RMOH 1VCQA 1YY3A 2CV3A 4NA8A 1C1MA 1QFKH 1C2GA 4GHTA 1A2CH 1JRSA 1FUJA 2PSYA 2VNTA 2D26C 2SGAA 3VB5A 1SPJA 5C17A 2P16A 5C5NA 1THRH 1SI5H 1O2YA 2BZAA 1P10A 1VGCB 1OWHA 4X8VH 1TGBA 4VGCB 1C5MD 4E06H 1TX7A 3TNSA 4X2VA 5GJ4B 1C2JA 1RS0A 1GL1A 5GWZA 4M7GA 2FLBH 1P8VC 3GY4A 1EB1H 5GCHG 3A8BA 3TH2H 2C93B 2JETC 1GBMA 4YXWD 2GDDA 4MQAA 1UMAH 1SGNE 1BMLA 1EOJA 3RXCA 4B76A 5C0TA 3K2UA 4FUDA 2OC0A 4I86A 4D9QA 3TIUA 1RXPA 1XUFA 3RXJA 2BDAA 3MU5A 3BTEE 2GD4B 1UVPA 1F2SE 1RTFB 3RM2H 4FUFA 3A89A 1YLDA 1P11E 1TQ0B 5LPRA 3M3SA 3NUMA 3KN2A 3BTQE 1LPZB 1NO9H 4UFEH 5FBEA 3LGYA 1HBTH 1XVMA 2ZTYA 4WH8A 3SUFA 1BTWA 5CHAC 3ZZBA 2GTBA 4ISHH 3BG4C 2J97A 4JYTA 1UVUH 1UCYH 2VWMA 4NA9H 3TK5A 5T6FA 4BTIB 3NCLA 1Y3WA 3LJJA 1H1BA 3MOCA 4GUXA 1C5OH 1T31A 4K8BA 1D6WA 4AGJA 1MABB 3F9FA 3EAJA 2RG3A 2JH5D 1S0QA 3QO6A 1D3TB 2GGVB 3PYHA 1AVGH 2O9QA 2Q1JA 1GI2A 5T1VA 4NG9H 3RXAA 2A4RA 3A7VA 2AMDA 3RDZA 3F1SB 4I31A 1YGCH 1LO6A 1P2MA 1QBOA 4CBNA 1TRMA 3RXQA 3E6PH 1HAZB 1MKWK 2TGTA 4XOJA 5SGAE 5AFYH 1O3BA 1Z8JB 1GHZA 3TU7H 1K1JA 4AC9A 4B1TA 1O35A 1FY1A 4UFGH 1GBCA 1ZRBA 1BMNH 1YM0A 2PTCE 1MKXH 1COWD 3MNSA 4IGDA 1TPAE 3GISB 4FU7A 1K2I1 1MTSA 2R3YA 3HGNA 4B6EA 1GI6A 1FMGA 2B5TB 3TJVA 1P2KA 1YF4A 1OWJA 4X6OA 2PWXA 2OXSA 1O3OA 2ZU4A 2FOFA 1TONA 3AASA 2CN0H 4IW4E 4AN7A 1O5DH 1GVKB 5EW1H 2EA3A 2VIDA 2M2AA 1ZGIA 1QZ8A 1C5UA 1HJ9A 1NC6A 1AQ7A 1GI4A 1MZDA 2BXTH 1YPJH 1S6HA 3UTUH 3QLPH 2PR3A 2VVCA 1KXEA 1Y5BT 1CA0B 2SGPE 1NU9A 1O3CA 1CA8B 2RFKC 4WWYA 1GBDA 7KMEH 4GPGA 4BTTB 2ZTXA 1VJ9U 3A88A 1LKAA 4LXBH 1TMUH 3MFJA 2VGCB 1HV7A 1YBWA 1O2VA 3SNBA 1W7XH 2O8LA 1H4WA 2ZTZA 3A87A 3CS7A 2EI7A 1OX1A 3PMJA 1XKBC 3IITA 2O8MA 5L2ZH 1QJ7B 1ELDE 1W0YH 1QA0A 2FYRA 1ELBA 1TNIA 1WCZA 3A83A 1O2NA 2A0QB 4DY7B 4ABDA 1GMCF 3NPSA 1O3IA 1ZZZA 3LDXH 1WDIA 2ZU3A 2NWNA 4LOYH 1MKXK 4OS5A 3SU3A 1C2KA 1H9IE 4AOQA 3P6ZB 1MD8A 3T2NA 1G36A 2Y81A 4NWKA 2WPLS 1C1RA 2JH0D 3STIA 4F49A 1FDPA 4Y8XA 1O36A 2BOHB 2BVXH 3ZVFA 3SJ8A 3GY2A 1C1VH 3A7WA 1ELFA 2WPKS 3AAVA 1E36B 1NBMD 2XC4A 1GI7B 3UREA 3OEED 4ABJA 1K1OA 1DWDH 4NIVA 3A84A 3SYJA 3SI4H 3RXVA 1KLIH 1ANEA 4Y76A 2DE8A 4AGKA 1GMCG 4NA7A 1HAGE 1V2MT 1MD7A 1O38A 2XTTB 1P2JA 3MWIU 4WMEA 2PGQB 4FUCA 3LOXA 1Q3XA 4VGCC 3RLYH 1P09A 1QL7A 2QIQA 1V2OT 3NK8A 1TALA 1C9PA 2ODQA 1Y8TA 1MZAA 5IK2D 3WY8A 5L2YH 1H9HE 3RXHA 1OKXA 1XUHA 2QXJA 1XVOA 3EE7A 1Z71A 3U8OH 1LMWB 1AKSB 3E1XB 2JJ2D 1QB6A 2FOBA 4JZFH 2BDIA 4WMFA 1L1JA 1FPCH 2EQNA 1WSSH 1GHAF 1ETSH 1CGJE 1AY6H 1ZSKA 2W7UA 2SGDE 1D6RA 1PQ5A 4OS6A 1BBRK 1C2FA 1X7AC 4DURA 1KXCA 1LQEA 2P95A 1KDQA 2A4GA 1T7CA 1LVMA 3RP2A 1FIZA 2BX4A 2Z9IA 5BRRE 2A7CA 1V6DA 1TPSA 4X1PU 3GDVA 1YKTA 3SJ9A 1NRNH 1VZQH 2SNWA 1H8HD 2FI5E 1AFEH 1UVTH 4F4OC 2JDID 4OS4A 1P12E 3DFLA 3A7XA 3O8BA 2J95A 1OYTH 1ABJH 6CHAC 2D1JA 3PTBA 1ACBE 1IHSH 1GI9B 4ZHLU 2UWPA 1GBAA 1HXFH 4JYUH 1A7SA 3AK5A 3ZV8A 1C5RA 5J4QA 3RUOA 3JZ2B 2ZGHA 4X1RU 4DT7B 3LGWA 3U8RH 2FOMB 1DSUA 5FAHA 1L4DA 1P0SH 2P93A 4DOQA 4Y8YA 4X6NA 2PUQH 4K3JA 1NFXA 1EZUC 2VIPA 1J9CH 1BHXF 5EQSA 1S5SA 2UUFB 1IQJA 2OBOA 2F9PA 3UQVA 3GOVB 3VB7A 1MU8B 2EI8A 5C1YA 3UUZA 1BMMH 3LGIA 5EG4A 2QV1A 3PRDA 2BQWB 1KLJH 2PTNA 5ESBA 3F0OA 1O2GH 3M5LA 2RDEA 2XNDD 4MNYA 1GJ7B 2FYQA 4UE7H 4K5ZA 1GHWH 1TFXA 2F9OA 5ESTE 4U01A 4INHA 1GCDA 1C2EA 2AERH 1SLXB 5JYIA 2WZQA 2IJD1 2W26A 2F9NA 2FX6A 1GJ4H 3K6ZA 2Y7ZA 1CGHA 1E37B 1NFUA 2ZIQH 1DY8A 2GKVE 4I8JA 1K1NA 1ZSLA 1LKBA 2ZGCA 2IOTA 4JZ1A 3C1KA 3BTME 1CA0C 3LU9B 3SNDA 1T32A 5C3NA 1GPZA 1D3QB 1XKAC 3NRLA 3RMNH 4OGYA 1GDQA 1E1QD 4NIWA 3SQHE 1O3HA 3I77A 2STAE 2VGCC 3F9HA 2CHAB 1O2TA 3QGNB 1CT0E 3ZVGA 7GCHF 4D9RA 1AHTH 5GPIB 2ZHEH 1YPMH 1BMFD 2BY6X 4YLUA 2PW8H 3TJOA 3A81A 3RC4A 3VB6A 2W7SA 4B75A 1IAUA 1OHHD 2BLOA 3SNAA 1FN6A 1E0FD 3N7DA 3BG8A 3LC5A 4KTCA 3Q00A 3LGUA 1QCPA 2XYAA 1SLUB 2XBWA 1RD3B 4YOJA 1SKYE 3DA9B 3QTOH 1EB2A 4B74A 4J2YB 2Z9LA 4OM9A 2TGDA 3FP6E 3PWCA 2FOCA 4DT4A 2F9UA 1YCPH 1BBRE 3FP7E 4FUHA 1ANCA 3GY7A 1UK4A 2WPHS 1LVYA 3RXPA 1J16A 3F6UH 1O0DH 1BRAA 2G8TA 1C1TA 4F55A 4HZHA 2QF4A 1QJ1B 4BAQB 4JK5A 2BY9X 5EJZA 2C8WB 2FLRH 1ZYOA 1ZGVA 4E7RG 4A7IB 5A0BA 2FZZA 1O2MA 2VWLA 1O5FH 3D23A 1SGEE 1ZPCA 2BB4A 4GHQA 3VPKA 3V0XA 1UO6A 2VH0A 4IC5A 2VWNA 1IHTH 2HPPH 1CT2E 3M5OA 1YC0A 2Z6BD 1TLDA 1EP6A 1SGDE 2XC0A 3SHAH 3UQOA 1LVOA 2GZ9A 1G3CA 2HVXA 2XCNA 2ZFSA 5T6DA 3RLWH 2RCEA 1LHEH 1ZRKA 2FWWA 4IC6A 4IMQA 3M37A 1BTHH 7LPRA 4ABAA 1Y3UA 1SGQE 2FODA 1C5XB 4DGJA 3RXEA 1Q31A 2GX4A 1RFNA 2ALPA 1GI8B 4FU8A 4BNRA 1MBQA 1C5WB 4MTBA 2BVSH 1WV7H 4AB9A 1HJAB 1TB6H 3SV7A 3UNRA 2ZG0H 1FN8A 4DCDA 2VIOA 4LZ1H 3IG6B 1A5GH 3SBKA 2OINA 2BY7X 2QYIA 3B9FH 5DJ7A 1F5LA 1FAXA 2F43B 2HGTH 3HK6B 2PKSB 1LQDB 1DWBH 1YPHC 5HMAA 2GDEH 3PO1B 4P02A 5T3HA 1WTGH 3U98H 5LPEA 4A6LA 5C20A 4AFUA 3K6YA 4QT8C 2VIQA 4BTUB 1XX9A 2KFWA 2OUAA 4OS7A 2NU1E 2H5CA 1LCYA 2BX3A 2ZU5A 4MLFB 4HI3A 5DP6A 1O3GA 1QR3E 2GJGA 2Z3DA 4LK4A 4GSOA 1K1MA 4K1SA 1DWEH 3RXRA 2ANMH 3GCHB 3PWBA 2ANWA 3ZVBA 3DHKH 1SFQB 1QHRB 1LPKB 1EATA 3NXPA 4MPXA 4CHAB 5FCRA 3LC3A 2J5UA 1ZMJA 5T6GA 1GHBG 1GVZA 4UONA 2UUKB 3MU1A 3MO6A 4FVBA 3O8RA 2D2DA 3IWMA 1ID5H 1Y3XA 3ODFA 2ZWLH 2OC7A 2A32A 1JXPA 1BRUP 2XWBI 1UTPA 1A3BH 2CK3D 4B2AA 4IN2A 3ENSB 4X8SH 3TITA 2W3KA 5TCAA 4P00A 1TNHA 2A5KA 2B7DH 1W0JD 2NU0E 2RDLA 5DG6A 4D7GA 4AX9H 4D76A 1EFRD 2A4OA 3V12A 1LTOA 2ZNKH 3LPRA 3SUDA 3U28C 2C8YB 5HXFA 2QY0B 4CBOA
chains in the Genus database with same CATH topology
4ABGA 1HB0B 3SHCH 3MTYA 1MTNB 4JK6A 1F0UA 3GY8A 1V2VT 3KF2A 3L3TA 1S0RA 4B2BA 2M5TA 1SG8B 4Z6AH 3M5MA 3M35A 2ZDAH 4Q80A 1EAIA 4JZDH 1P01A 5JBBS 3UFAA 1NROH 2TGAA 4E7NA 1DXWA 2CHAC 5GCHF 2B8OH 3VGCB 2GVFA 3EA9A 1Y5AT 4X0WU 1OSSA 1DLKB 3E0NB 3SU4A 4YOGA 2BYAX 2AYWA 1HYLA 1XMNB 3PMAB 2FIRH 3SNCA 1DS2E 4BANB 1D3PB 1F5KU 1G2MA 1B0FA 2C4FH 3H7TA 3LIWA 5E2OA 3KHVA 3S9AA 2QC2A 3MH5A 4A5TS 1J14A 5EXNA 3M7UA 3T29A 1GJ6A 1PPEE 4I8LA 3S9BA 1L0ZA 2AMPA 1GBKA 4UEHH 1CVWH 1PFXC 3P70B 4ZKNU 1ZTJA 4FXGH 1LVBA 2G5NA 3SW2B 1RRKA 2BY8X 2UWLA 3QZQA 2XRCA 1EX3A 1O2HA 3I78A 3GY6A 2V3HH 1BUIA 2Y7XA 4TWYA 2FMJA 4YESB 2CF9H 3KGPA 3RU4T 1CSOE 1IQKA 5A8XA 3STJA 1O2LA 4ISIH 1AUJA 1DFPA 1UK3A 3ATWA 4MPWA 2AIQA 3HK3B 5FX5A 2EI6A 3U69H 3UNSA 1CQQA 1HIAB 3CP7A 1DLEA 1S85A 1KYNA 3HATH 1C5NH 4GCHG 4WH6A 2ZHFH 2H9TH 4ABHA 1AB9B 4AFQA 5JB9S 1W7GH 1ARCA 2F9BH 2J34A 2DUCA 3BTWE 4Q7XA 3TJNA 3K65B 1PPFE 2XC5A 4KTSA 2HWLB 1SGFG 2EC9H 3BEUA 5LH8A 3Q3YA 2P94A 2SGQE 1O2OA 2BZ6H 1P3EA 1HGTH 1GBEA 2J9NA 2BDCA 1DITH 1ABIH 2OC1A 4H42U 2ZKSA 4WXVA 1EAXA 1EXFA 1HJAC 3ODDA 3ELAH 4AG2A 1TX8A 5FPSA 4O97A 1HCGA 1A1RA 1GBLA 1O3FA 3P17H 3SOSA 2ZPSA 3KQBA 4INLA 3K9XB 2VWOA 2PKSC 1JOUB 2FM2A 3PO1C 4ZAEA 4TWWA 2ZCHP 1SHHB 4YM9A 1NY22 1S81A 1WU1A 3UWIA 2YNBA 3UR6A 1AZ8A 1GBJA 5JB8S 1U6QA 2PKAB 1XM1A 3QDZB 4X8TH 3GCHC 1NM6A 3OY5U 2WV5A 1ZTLA 3AW0A 1HXEH 1O5EH 3GYMA 1QJ6B 1C5VA 1NU7B 4K1EA 4CHAC 1GJ5H 4YT6H 1UCYK 1XUJA 3N7OA 5GXPA 1CBWC 3R0FA 3MHWU 1TBRH 2OQ5A 1TNJA 1KSNA 1WTHD 1W2KH 4ABFA 3A7YA 3E0PB 4AYYB 3KL6A 1O3PB 2C3SA 2PV9B 4NSVA 1Y3VA 1GI1A 2B9LA 1GI5A 3OYPA 2O8UA 4XDEA 2FESH 4Q2KA 3OSYA 3OTJE 1DXPA 5EU8A 2XWAA 1ESAA 1W11U 5A8ZA 4KELA 1C9TA 2TPIZ 2NU4E 1YPHE 1P04A 2EEKA 3E91A 1SSXA 9LPRA 1GDNA 1OPHB 3ZVAA 2VU8E 1SGFA 1O5AB 1MCVA 3E3TA 1M9UA 1AMHA 1A5HA 2A1DB 3PM3A 4ABEA 5DP9A 1BOQA 1MTNC 2WPIS 2ZHQH 3EDXB 3MO9A 4CH8B 3EYDA 1P02A 1KXAA 1TMBH 1C5PA 1GI3A 5EW2H 1TNLA 3ZYEA 1G30B 3BIVH 3VGCC 1AN1E 1E35B 1AD8H 4XFQA 4KKDA 3ITIA 1ANDA 3T27A 4E05H 4ZHAA 1QB9A 3FP8E 2I6QA 5BPEA 3RXIA 2TRMA 2HOBA 4UFDH 2A4QA 3A80A 1AE5A 2G52A 1DM4B 2P3FH 2J2UA 4MNXA 1BTPA 2H9HA 4BXWA 3LONA 1GBIA 3ZZDA 1AIXH 1VGCC 4X6MA 3BTDE 1SOZA 4NZLA 1ELAA 2BD7A 3BSQA 4ZXXH 1EUFA 4FUJA 4NZQA 4JCNA 3KCGH 1N6XA 1KLTA 1THSH 5HM9A 5C5OA 3PROA 2SNVA 3MMGA 4ZKOU 3ATMA 2ZI2H 1DOJA 1ZTKA 2V0BA 4Y6DA 3A8AA 1JIRA 4K8YA 3ZVEA 1HAXB 5AVDA 5LPFA 1BTZA 3SGAE 1HAPH 1MTUA 5FHTA 3M7TA 2GCHF 3MH7A 5EXMA 5E0JA 1C1SA 3DFJA 3GCTG 2H5DA 5FX6A 4DIHH 1EQ9A 1TA6A 1AUTC 1LHFH 2BLQA 1AB9C 3LH3A 1HNEE 1CE5A 1NPMA 4O9VA 3PLPA 3T62A 4A92A 3R3GB 1FJSA 1ELVA 4WF8A 5HYOA 2BMGB 2XBVA 3A8CA 3UOPA 1V2PT 1MTVA 2G00A 1UTMA 1BCUH 1IQGA 1TIOA 1UK2A 3QTVH 2AEIH 1QB1A 2GCHG 3ZZ7A 1A61H 2Z9KA 3RC5A 1K9OE 1XXFA 1G32B 2QF0A 1OWIA 1C2HA 3M7QA 1UCYE 1ZHRA 2BDHA 1GVLA 3TGIE 3S9CA 1L2EA 3UR9A 1WUNH 1PQAA 1GL0E 2PGBB 4WY3A 1BT7A 3URCA 2XCFA 3SO3A 1GBFA 2THFB 5DPAA 1SQTA 1MCTA 3HPTB 2G81E 1P2IA 2IPHA 4RKJB 2SFAA 2Z94A 1EPTB 3A86A 4MPVA 4DVAU 1P2NA 1HDTH 5F6MA 1OWEA 1QQUA 1GGDB 4LZ4B 4CRCA 3ZZCA 5I46H 3S7HB 1TA2A 1O2RA 3SU6A 3ZZ6A 3PMHB 2A7JA 4X1SU 1J17T 2ZDLA 4MVNA 5DGJA 1SHYA 1ELTA 3Q3KA 3F9EA 4TY6A 3RMMH 2CXVA 2GV7A 2FEQH 1AKSA 4Y0YE 1GHYH 5JPMH 2W5EA 3KQCA 1XUGA 2Z3EA 4AORA 2FOHA 2XBXA 1XXDA 1O3NA 2ODPA 1NN6A 3AW1A 6GCHF 3NZIA 1J8AA 2ZFTA 2R0KA 2A31A 3SGQE 1ANBA 3UIRA 3FANA 1T4VH 4MNVA 4H4FA 1HFDA 1ZHPA 3MI4A 1DICA 1C5SA 8LPRA 1SLWB 1V2TT 4FUEA 1DANH 1RIWB 3UWJH 1BTYA 4ZXYH 5IYTA 1JMOH 1O2UA 1YP9A 6LPRA 2HRVA 3S69A 1KXFA 1RJXB 3OY6U 1YLCA 2YNAA 6GCHG 4KTUA 1VCWA 2G4TA 2ZCKP 1ZR0A 3A8DA 1WBGB 1ETRH 4Y10E 1V2UT 2WINI 1BMAA 1SR5C 2O8WA 3E8LA 1DE7H 1W13U 3HGPA 2ZP0H 2FS9A 1EPTA 1TRYA 2ZPQA 3RU4D 3TJUA 2FI4E 1MAXA 1KIGH 4O03A 1Y59T 2Y6TA 1JRTA 1L4ZA 4CR9A 1SMFE 2ZHWH 3BTTE 1OS8A 1TPOA 2VVUA 1QRXA 4Y0ZE 4PROA 4UDWH 2RA0A 1A3EH 1NZQH 2GZ8A 1O34A 1W12U 1O3DA 3T5FH 1AVXA 1GMDF 3FAOA 1UHBB 5GIBA 2BXUH 1XUIA 1UJ1A 1A46H 1B5GH 1EKBB 1MBMA 3VB3A 4A1XA 4MG3A 3T25A 2DE9A 5TCCA 1LHGH 4DJZB 2R3UA 4NIYA 3V7TA 2ZECA 1D4PB 3Q76A 1RTKA 5EXLA 5DO4H 3MU8A 4HTCH 2UUYA 3MO3A 2OBQA 1LHCH 2IJOB 2XBYA 5A2MH 4FUIA 1GMDG 5CHAB 1BRCE 2STBE 4K69A 3TNTA 2P3TB 1AI8H 1CHGA 1C5ZB 2Y82A 1C1QA 2VH6A 3KIDU 3V13A 4ZH8A 1FQ3A 1GBHA 3SV8A 4HFPB 4AB8A 2G5VA 1YCPK 2AGIX 4JYVH 1N1LA 4I32A 1O39A 2ZFFH 4AFZA 4X6PA 2ODYB 3P8NA 3F9GA 1Y5UT 1GHBF 1O2XA 4X1NU 1ELEE 1OP2A 1G3BA 3PLBA 1TMTH 1YCPM 2OLGA 1OWDA 3MYWA 1EJAA 1GJDB 1QL9A 2ZDMA 1NRQH 4XBBA 1MU6B 3O8CA 1ZMNA 1C1NA 1T8NA 2ILNA 2FP7B 2R0LA 1PPCE 1TNGA 2UUJB 5F03A 1YPGH 1F92A 4ZROA 4BAOB 1ORFA 1JIMA 3SJOA 1K21H 1UHBA 4JZEH 1EZSC 1EPTC 1C1WH 4U32A 1IQEA 5DP4A 3SV2H 5AFZH 3U8TH 1IQNA 1GGDC 5K0HA 1O2QA 3ESTA 4B71A 5ABWA 1F0TA 5DP7A 4CRFA 5GDSH 1PYTD 1A4WH 1A0LA 3ZZ9A 2ZC9H 2WYGA 4ISLA 1PPHE 4IMZA 4BAHB 4ISOA 1P2QA 3M36A 1PPZA 3GCOA 1MAYA 2GCTB 4XE4A 8GCHG 3O8DA 3TLOA 1QA7A 2ZPRA 4CR5A 1BJUA 2ALVA 1SC8U 3SV9A 3MNBA 1SLVB 3GY3A 1G2LA 3TK9A 1QURH 4BOHA 5ETXA 5PTPA 1N6YA 2HPQH 1MQ5A 1V2QT 1AE8H 2ZGXH 4J1YA 1O3KA 3U9AH 1BJVA 1VJAU 1O30A 3AVZA 1C4V2 4JZIA 5DK1A 1TGSZ 3P8GA 3SJIA 2Q6FA 1HLTH 5DP5A 3ATIA 1ARBA 1LDTT 2HNTC 4A1VA 1RIWC 2BLWA 1FY3A 3RXLA 1TPPA 1G3DA 3LH1A 1NT1A 1TOCB 4SGBE 1LHDH 4CREA 4NWLA 1CU1A 2FXRA 4A1TA 1C4Y2 1SGCA 2ZU1A 1L1GA 3EE0B 1BITA 1TAWA 1V2KT 2GV6A 2H2ZA 1FPHH 2GMTB 3SUGA 2ZDNA 2Y5HA 3DUXH 2ASUB 4AYVB 3G01A 1K1IA 3URDA 4Y8ZA 3RU4E 2BLVA 1DX5M 1V2LT 1SGTA 1NESE 1SGIB 3B23B 3ZZAA 1EJMA 4GCHF 1T8MA 3SU5A 1IQHA 1BTXA 4X2YA 4ZKRU 5J4SA 5FXLA 2WPJS 3VXEH 1NFYA 2OTVA 1O33A 4RSPA 5DP3A 1ELCA 1SFIA 4AZ2B 4WXIA 2CJIA 1SQAA 4INKA 3BTHE 1V2JT 1K1PA 2AGGX 2LPRA 4DG4A 3NKKA 4I8HA 1MKWH 1SGPE 1GJ9B 3CS0A 1C5TA 1N8OB 2ZQ2A 2I6SA 1YPKH 5E0HA 2LNCA 2WV4A 4YOIA 2BQ7B 1DDJA 4XBCA 2XNIA 5L6NH 3BTGE 1GBBA 4Y7BA 5EQQA 1S6FA 3ATLA 4NIXA 1OYQA 4MNWA 4B2CA 3LT3A 1TGNA 1EJNA 4R8TB 3M5NA 4YTAA 3NWUA 2AIPA 2BHGA 2PSXA 2WPMS 3MH4A 1IQIA 2ZDVH 4I7YH 1MUEB 4AG1A 9ESTA 2V3OH 1TBQH 2Q6DA 2CF8H 1HPGA 2ZZUH 2A5IA 4OGXA 1Z1JA 3TH4H 1FV9A 1FY4A 1FI8A 4BXSA 2C8ZB 1H8DH 3QGJA 1F5RA 2G51A 4IN1A 1SL3A 1KXBA 1HAOH 4ZHMU 1B0EA 4CRBA 2BQ6B 1O5CB 2G55A 4WJG2 2VIVA 2TGPZ 3P8FA 1TBZH 4JMYA 5JBTA 4KP0A 4AFSA 3SORA 2QXIA 1KTTB 3OU0A 6CHAB 1FY8E 2ZQ1A 3P92A 1PJPA 1BIOA 2FPZA 5EQRA 3S0NA 3RXFA 1C2LA 2XXLA 3RXBA 2WUCA 1G9IE 3BTKE 3BEFB 1DUEA 1FONA 3ZV9A 5FPYA 5EODA 2BY5X 1S82A 4IBLH 4U30A 2R2MB 1JBUH 3A82A 5A0CA 1BTUA 1DPOA 1EZQA 2ESTE 5FBIA 3QX5H 5AF9H 5EPNA 5JBAS 3MNCA 3RXGA 3ZVCA 1ZLRA 3KEEA 2F9VA 3PLKA 2JH6D 4ABIA 2AMQA 1HIAA 2ZA5A 3VB4A 3RXSA 1V2RT 2FOGA 2BDGA 1Z7KA 1GCTB 2A7HA 4MPUA 3SGBE 3HKJB 1CGIE 2A2QH 1HRTH 2BDBA 1P9SA 2ZFQH 4H6SB 2V6NA 4X1QU 2Z9GA 3RXOA 3KQEA 2OCVB 1NTPA 4RKOB 6ESTA 3RXUA 1GDUA 1YPLH 1D9IA 1QIXB 4I8GA 1UTJA 2GCTC 3EA7A 4UD9H 5EGMA 5E2PA 3FFGA 1W14U 1NRPH 2ZFPH 1ZJKA 4BAKB 3H7OA 2ZHDA 1P9UA 2AH4X 2PHBA 5EPYA 2F91A 3JZ1B 3Q77A 1Z8GA 1IOEA 1C1UH 1T8OA 3C27B 1GBTA 4ESTE 2J94A 3P8OA 3L33A 2WYJA 4X2XA 4Y79A 1AVWA 3P95A 1Y3YA 1DT2A 2VIWA 2GP9B 3PV4A 3LJOA 1O2IA 1Z8IB 5A8YA 1GG6B 1KDQB 3F68H 3MU0A 8KME2 3PMBB 1K1LA 1CHOF 3EGKH 5B6OA 4FVDA 1BBRH 2UWOA 3UOUA 3QK1A 5E0GA 2PKAA 1K22H 2GMTC 2YOLA 4ASHA 5C1UA 2J38A 4Y11E 1THPB 3FZZA 1DVAH 2BOKA 1QRZA 3BN9A 3T28A 2B0FA 1A0HB 1DUAA 1B7XB 2QA9E 3GCTF 4GAWA 5EOKA 3SU1A 2Z3CA 1PQ7A 5G4BA 1OOKB 3ZZ4A 1JWTA 3GICB 3ZZ3A 1O3MA 1QTFA 3RXKA 1F7ZA 1OP8A 1CHOG 1TNKA 2P8OB 5K7RA 3FVFB 1CT4E 1UTQA 2C90B 5A0AE 1TABE 1BDAA 1FIWA 4SGAE 1MTWA 3SZNA 2VINA 1ZJDA 4X2WA 7ESTE 2BM2A 3BV9B 4XBDA 1T8LA 1VITH 3BEIB 4Y71A 3ZYDA 1SB1H 2BD9A 2HNTE 3M3TA 1INCA 2RA3A 2R2WU 1ZPZA 1CO7E 2ZFRH 1N8OC 4YO9A 3UY9A 1PPBH 1XUKA 1ZOMA 3TVJB 3KQDA 3RXDA 1ELGA 1TWXB 4D8NA 2R9PA 3ZVDA 1O3AA 1O2WA 2TBSA 4O3UA 1ZSJA 4FUBA 2TIOA 3E90B 1P03A 5CE1A 1O2PA 1AWHB 1HAHH 4TY7A 2FOEA 3VFEA 4U2WA 1UVOA 2J4IA 4K60A 5FCKA 1C5QA 1GJAB 1QGFA 2OP9A 3HKIB 1E38B 3OX7U 5F8XA 3MU4A 2BVRH 5F8TA 3DT0H 2O8TA 2A45B 3QUMP 1HAVB 1GJBB 1KY9A 2OC8A 3W95A 2FTLE 1TYN