3WYEA

Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with nad+
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
255
structure length
255
Chain Sequence
KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAAVEAFKKEGHGGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQTAARDLAPLGITVNGYCPGIVGTGMWEQIDAELSKINGKPIGENFKEYSSSIALGRPSVPEDVAGLVSFLASPDSDYMTGQSLLIDGGMVFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of chimeric engineered (2S,3S)-butanediol dehydrogenase complexed with NAD+
rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
molecule keywords Diacetyl reductase [(S)-acetoin forming],L-2,3-butanediol de
total genus 103
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.304: Diacetyl reductase ((S)-acetoin forming).
pdb deposition date 2014-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wyeA00
1X15A 1HSZA 5COQA 4ZQGA 4M8SA 2JJYA 4BKQA 4YWJA 4BNMA 2X8LA 1GUFA 2FOIA 2O7QA 3HDYA 1PSDA 3I5MA 3ZWPA 4CMAA 5IAAA 5G0WA 4Q3CA 1U9JA 2CVZA 4KWIA 4RVHA 3KO8A 3GA0A 1T2AA 2IRWA 3AM3A 3A9WA 1CEQA 2OBNA 3KYCB 2FWMX 1AN9A 3LC2O 4DRYA 3PYLA 1V6AA 4CV3A 1YB4A 3OJ0A 4QTZA 5F3RA 3H9EO 1Y9AA 3P7MA 1NQAO 1IE3A 2JHFA 2ZB7A 1BXGB 2X9GA 1LI4A 4UUMA 5C7OO 4KP7A 1NHGA 4M1QA 5HS6A 4PG4A 1YRLA 3L4BC 3RBVA 4KTVE 1ZNQO 2DBRA 1YXMA 4ALIA 3TJRA 3V1YA 4UVHA 5JAMA 4FQ8A 1EK5A 3KYDB 3HNPA 4IS3A 4IM7A 4GVXA 3AU9A 2QZ9A 5L7WA 3GVIA 3ZW8A 2OXIA 4E6PA 3FNHA 2GZ2A 3OIFA 5G0UA 5IDYA 4D44A 2NU7A 2Z1MA 4YPOA 1LRJA 4YDRA 4IDGA 1RKXA 4U6QA 2EF1A 3K9QO 4WNCA 3VPXA 7MDHA 2R6JA 4PGFA 4J4TA 3EDMA 3AW9A 1U7TA 2X1HA 3DMTC 3RC1A 1VL0A 4YJGA 4W7IA 2C07A 2Y1FA 3FN4A 2XAAA 3KB6A 3ZU5A 3S2FA 2X23A 1YJ8A 2E82A 1VJTA 1XLTA 1RJWA 1EVJA 2HUNA 2JL1A 4L73A 2ZYDA 5KJCA 1YQDA 3WMWA 2O3RA 2VUUA 3PHJA 1R6DA 2C2YA 3TL3A 2PZJA 4O63O 1HE3A 2Q1TA 2HMSA 3Q11A 2VHYA 1QORA 4Z9FA 2CDAA 5I9NA 3JD0A 1LLDA 1HE2A 1XHLA 3O4RA 3TPCA 5CDSA 1U4OA 5EESA 4HNHA 4Q9NA 5G4KB 5DNAA 1YJQA 1GZ6A 1CWUA 3PHIA 5TJHA 1GYQA 4GMGA 3CE6A 2FP4A 4ITUA 3D5TA 2EW8A 2R00A 4A73A 2GR9A 5ADHA 4ZHSA 3F3SA 4IDDA 1C0LA 3IP1A 2LDXA 4M89A 1U2GA 5TT0A 5A9RA 3VHRA 4QXMA 2I76A 5JC1A 1JVBA 1UZMA 3SLKA 4NH4A 5TX7A 4FGWA 1F17A 4U7WA 3I6QA 4L75A 5A02A 1P1IA 1RWBA 2HU2A 2YHIB 4E5YA 4CLRA 1F12A 1B15A 2YW9A 2VT3A 4PG6A 1UAGA 1SB9A 2RBEA 3F46A 2O2SA 5BT9A 1Z73A 4FFNA 4IPTA 4YJGB 1DB3A 1A9ZA 3UOGA 3WWYA 1M76A 5CHEA 4CMIA 4F3YA 1WDKA 4K28A 2X7HA 3NDJA 1GUZA 4PLFA 4LSWA 4GWKA 5HA5A 2E48A 2UUOA 3GNSA 2BHLA 4QEDA 4O59O 3MJCA 4GBJA 4IJUA 1TB4A 2WM3A 4LVCA 1ISJA 3DZIA 5DT9A 2PFGA 2ZYAA 1LEHA 2VRCA 2YDXA 5I7VA 2WJPA 4Y6PA 2YDYA 3QVSA 3ZWYA 1LBEA 8ADHA 4FBGA 4CR6A 4BO1A 3PQFA 1DXYA 3L77A 4IQ8A 2IXBA 2PGJA 4GKVA 4Z0HO 2WE8A 4GSLA 3H9JA 1E0DA 2C5AA 3CKYA 3K31A 3ONEA 1HZZA 3ZWAA 5L4SA 4IMRA 4DIBA 2WMDA 3TQHA 4CPDA 4DGSA 2PV7A 5GZ6A 1GY8A 5CDGA 1G1AA 3CINA 1V8BA 3VC7A 5CG1A 3V2UA 4HKTA 4YR9A 1DEHA 1NFFA 4GL4A 3U0BA 3JYPA 2PR2A 3HHPA 3I9NA 1OC2A 5JAZA 3CIFA 4DIFA 1TT5B 3TL2A 2A35A 3M2TA 1TT7A 4PRKA 4A5OA 4AJ4A 2CF6A 3IMFA 2W2LA 3RUAA 3WDSA 1U8XX 3U5TA 3OIDA 2C20A 3AWDA 4OXNA 3ZGYA 1FDVA 1DSSG 4CMIB 4CV1A 2J3IA 1YVEI 1KETA 1K0UA 4R1TA 4U6SA 2AEJA 3BMOB 4B3HA 3QWAA 3RFXA 4CMGA 3FPLA 3ZNOA 3U4HA 4EITA 2EERA 4YQYA 3W8FA 4RCVA 2AE2A 4IJVA 1ISMA 3AFNA 1CDOA 5A04A 4WKGA 1O89A 4ONEA 3I3OA 2XF8A 4G2NA 2VZ8A 1PS0A 1KVUA 1I32A 4D3DA 4EJ6A 1DHTA 1GL3A 3DMYA 3VAZA 3AY7A 1MXFA 2J5KA 3FHLA 2DLDA 2FMUA 2NTJA 3KRTA 3GZNB 2Y93A 1K2WA 4EI2A 4RQTA 1V3TA 2VCYA 4Y6SA 3WTBA 3OF2A 3RUCA 5L3ZA 4J49A 4FD3A 3GMSA 5BNTA 1XR3A 5ITWA 4KDEA 1IZ0A 2RHRA 2BD0A 3COSA 4EEZA 1V35A 1U2DA 2DFVA 3D4NA 4WCFC 3BTVA 1GZ4A 2EKLA 2Q4BA 3OJEA 3I4CA 3C8MA 3FR8A 2C7VA 1EMDA 1NX6A 1P33A 2V6GA 2WYVA 4R9SA 4YT2A 4J0EA 1DJQA 1I3KA 1K6XA 4B4OA 4ZQBA 1ULUA 5KJ1A 4RDIA 1KEUA 2OBYA 3AK4A 2EGHA 2BFOA 3HUDA 1R4NB 1YDEA 1F0YA 3GN2A 3N58A 1LSOA 3T4XA 4P8RA 3INRA 3C1OA 3ZWBA 2YZ7A 4RPJA 4Z9XA 2P9EA 2VWQA 2PKQO 2VNAA 3U3XA 2OP0A 5JCJA 5IG2A 5JAIA 2B69A 4RJTA 4HFRA 3C24A 4CLXA 4ZA2A 5TNXA 4KQWA 1RM3A 3C1TA 4DLLA 3CUKA 4E33A 5COBA 1PJSA 2VWPA 2VYVD 3BMCA 3I6IA 1BSVA 2PA3A 4CM7A 2GZ3A 2GZ1A 3BMCB 3PWSA 4P4NA 1KIFA 1LTHR 1YBVA 3BHMA 5ES3A 4Z0PA 1NASA 1BXZA 2FRDA 3PEFA 3TN7A 3WSWA 1YKFA 1HRDA 4I9HA 1VPDA 2HMWA 1U3TA 2W4QA 2A94A 2DTDA 3GY0A 5A1TA 3GOHA 4XEHA 4LMPA 3MJEA 3ITKA 2CSUA 4IZHA 3ZWCA 4E12A 5KOIA 1H0KA 3JV7A 2R00C 1U4SA 1TI7A 1KC3A 3HB4X 3QSGA 5G0TA 2WYUA 4Y67A 3GVCA 2Y0DA 3SLGA 2Q45A 3VPFA 1WMAA 4EEXA 3R6DA 4TQGA 3HWRA 2O23A 4J1SA 5DCYA 2LDBA 5A4DA 4N54A 3EY4A 1YWGO 1X1EA 2IDZA 3KEQA 1AXEA 3H3JA 5EN4A 3B1JA 9LDTA 3AJRA 4CQLB 2AQKA 1VSVA 2Z95A 1P1HA 2C7GA 4NBVA 3IUSA 3L9WA 5IDWA 3GEMA 2EV9A 2NU8A 3ZV3A 3VTZA 2CVOA 4ALKA 1EZ4A 1FDUA 1HEUA 1UDAA 3R0IA 4RL6A 4CMEC 1I2BA 3ONFA 4BOYA 1NR1A 2NQTA 2PNFA 2ZB3A 2O3UA 1BW9B 4TRRA 4BNLA 3MWDB 1BW9A 2HRZA 1P77A 1XQ1A 2FHSA 3DAFA 3OSUA 4XB2A 3D3EA 4PLWA 1M6HA 1OFGA 1DRWA 1HYGA 2B4QA 4K26A 1SZJG 3F1LA 2CZCA 4W7HA 3EVNA 1UXJA 4EUHA 2VOJA 1E3WB 1FF9A 3ETGA 4XQEA 4EBFA 4F46A 5CDTA 5IZCA 2YHUA 1H93A 2Y1GA 2FR0A 1E7WA 3H5NA 1JQBA 3JQ6A 3NYWA 1GU7A 3NV9A 1I24A 1D3AA 4R68A 3CEAA 2CVQA 3BTUA 1L7DA 2B83A 2AQ8A 1BXGA 4FIZA 5I9MA 3TOXA 5B12A 6LDHA 3DOCA 3E5MA 1PR3A 3FNGA 2OL4A 3KYBA 3OP4A 4EJMA 1W0CA 2DBQA 4WLFA 2ZATA 3FNEA 4E0BA 4YJHB 1B8VA 1O0SA 4MVJF 2NACA 2NLOA 1QMGA 1F06A 1WDMA 3L6EA 1QG6A 4CM4B 3DHYA 1A4IA 5EL0A 2V6MA 4AJPA 4IZIA 1P44A 3DBLB 3PDUA 2BGMA 4EGFA 1H6BA 1EUCA 3IDSA 2YQ4A 5TT1A 1I5RA 4BMSA 1A7KA 1U3WA 1YQXA 4NU5A 2V7PA 1EFKA 4DQVA 1WDLA 3WG9A 3FPCA 3HFSA 3ZV6A 3IJRA 4IINA 3PQEA 3RJ9A 2PD3A 1I3LA 1N1EA 4PFJA 3WBFA 4BNFA 5DZSA 2EGGA 5FFFA 2D5AA 2VUSA 2YFHA 2HLPA 3WTCA 1ID1A 1JU9A 3ASVA 2C5EA 4XZ3A 3A14A 3H9QA 3FWZA 4MP6A 3C7AA 1H9BA 1KS9A 5G4KA 2C59A 4DXHA 5JBIA 3GHHA 3H9GA 5JMWA 1HTBA 1O5IA 1TLTA 3WSVA 4BMNA 2Q2QA 3ZNPA 5HBRA 4R3WA 4PLGA 4CM1A 3DAGA 2VHWA 2UDPA 1GYPA 1KY4A 3B1KA 4A0SA 4YRAA 2FN7A 3CMMA 2Y1DA 2DAPA 3OICA 1MUUA 4AJ2A 4CMJA 1QSGA 1PL8A 1DC4A 1T24A 1I33A 3K73O 3MJTA 2QQ5A 5F5NA 3JQ9A 3E03A 5AXBA 4ZICA 1EBFA 4BNNA 4TRJA 3GAFA 4FGSA 4PLVA 4J0FA 1I2ZA 4CUZA 4OOFA 2EKQA 4PLTA 4Q3AA 5KVSA 2Y67A 1H2HA 4CMCA 2H9IA 4JQCA 2QZZA 4K1LA 5T64A 3S8MA 2OP1A 4E2YA 5A5FA 4FC6A 4A27A 5I8WA 3KBOA 2BLLA 1C1XA 1E7MA 1LLUA 4D0RA 1D7OA 4KTTE 3UGKA 1BDBA 1NVGA 1Z45A 1O8CA 1YDWA 4K6FA 5F21A 3PIIA 3JQGB 3G49A 4ESOA 1PGOA 5LDHA 3ANNA 2W2KB 4A26A 3DQPA 5BSEA 4BO6A 4BGUA 1FK8A 4MP8A 1FDTA 4IGFA 1VJ1A 5IZCC 1CERA 2R2GA 2VZ9A 3LF1A 2DPGA 2IZ1A 5HTOA 1DC5A 2PH5A 3DC2A 4R41A 4IDBA 5ILOA 2C2XA 2UVDA 2ZKLA 5HS4A 4O0LA 3ZWNA 3TZKA 1X7DA 1E5LA 1YS4A 2C54A 2Q3EA 1JN0A 1ARZA 1WWKA 1Y8RB 1VJ0A 2VWGA 4K6CA 3NEPX 1IYZA 4YBZA 3W4IA 4GH5A 3WJ7A 3L6DA 1T26A 3DBRB 3NRCA 3RBXA 1XELA 3HN2A 3GT0A 4CR8A 2HSDA 4I5EA 2VTEA 3LC1O 1E7YA 4BV8A 4GGPA 1S7CA 4NK4A 3JQ7B 4XDZA 3WJAA 5HM8A 4O5OA 4AVYA 1E77A 1W73A 3RC2A 3ETEA 2G0TA 4D7AA 4F6LA 3F1KA 5DOZA 3OEWA 1HDCA 3TSCA 1A27A 1C1XB 3QE3A 4DBVO 4YAJA 1GEGA 2FPIA 2IODA 1DOHA 3BYZA 5DOVA 1C3VA 3AM4A 3ETDA 4Q39A 3JQ8A 2Y05A 2ZK7A 5A9TA 8LDHA 4LCJA 3BMOA 3NGXA 3AOGA 4WUVA 4J90A 2GDZA 3SJ7A 2XOXA 3GG9A 3MWEB 3L07A 1XDWA 2Y68A 4J16A 2VYVA 4N5NA 5GZ3A 4WEQA 1Y8QB 4N5MA 3TFQA 4AJEA 1Z74A 2RIRA 1GR0A 1X14A 3I4FA 3MTJA 2QYSA 2O3TA 2ZCUA 3TDKA 1CJCA 5G0SA 5KNLA 3K92A 1MB4A 3RU7A 4BV9A 3NAQA 3LU1A 4DPKA 3IKVA 3WIDA 3ZH2A 2NU9A 4JBHA 3JQCA 1ULSA 1ZW1A 5F1KA 2I99A 1N7GA 3PHHA 4MINA 1ZXLA 5JSFA 4CV2A 3JYOA 2DC1A 2EW2A 2IXAA 2JFHA 3UCEA 1P0CA 4TMFA 2EJVA 1F8GA 4PLZA 3F5QA 1PTJA 1TVEA 4O6VA 2I3AA 4MVJA 4BNHA 5B37A 1NP3A 1P9LA 2QRLA 1S6YA 5HWSA 3WGQA 2ET6A 3M6IA 5IFLA 3KXDA 2C29D 1ZBQA 2WD8A 1BGVA 2ZB8A 4Z3KA 3E1KA 1JW9B 1OBFO 4A03A 1M2WA 2IYOA 4ND1A 4C7JA 1LDEA 2NVWA 1XCBA 3JQ8B 3DL2A 2ZIZA 4IGEA 4GX2A 3PHLA 2IYPA 2X5OA 4I5GA 4KUHA 3HE3A 1DIAA 3HDHA 2VT2A 1KVRA 2VTDA 3MOIA 1RM4A 4UVGA 3AI2A 4R5MA 3Q0EA 2FY8A 4R3NA 1NWHA 9LDBA 1SOWA 4I5DA 4NJOA 2HK8A 3PXXA 5G0VA 3EZLA 4ZRMA 1N9GB 3LT4A 1DAPA 3RSHA 1T2FA 1JVSA 1PJ2A 2DBZA 2E49A 3K8ZA 3OIGA 3P2OA 2P9GA 1UJMA 1FMCA 1ZSVA 4ZRNA 1IB6A 4D3FA 4B79A 1EDZA 4ND3A 4BO3A 1GPDG 1UUFA 1SC6A 1EEHA 1OAAA 1Z82A 4I1IA 2AEMA 2X0JA 3NKLA 1PJ4A 5A06A 3WICA 3LYLA 4OGWA 3I9OA 1HLDA 3GGGA 2ZQYA 3VPGA 1N7HA 1R66A 5IXYA 4J1TA 1Y5MA 3LLSA 3PJEA 1BXKA 3WB9A 4E2ZA 5ILGA 1P3DA 1IUKA 1E7SA 2XXBA 4NJMA 4UEJA 2Y1CA 2GNAA 2YQ5A 5DCWA 3GUYA 3IJPA 4H7PA 1EVIA 3OBBA 4WNIA 5L7YA 3VKUA 3RKUA 4CM9D 4PZEA 1HXHA 3M1LA 1GV0A 2I5PO 3F47A 3RROA 1E6EA 4QQRA 4TRMA 4OSPA 5L4NA 4PG5A 3WGTA 3Q9UA 5G2OA 3DBRA 4YVFA 4YAKA 3M1AA 4YRDA 2IEDA 3BZUA 4PZDA 3L0DA 4D42A 3F9IA 2D5CA 3DWFA 3KHUA 4J1NA 3GHYA 4ZD6A 3PGXA 3PK0A 3X2FA 2UAGA 1XG5A 4OSOA 3W6UA 5FWNA 1HL3A 1QP8A 4PG8A 3ZU2A 3EGOA 4DQUA 1B16A 4PLPA 3FBGA 1AHIA 5DN9A 3RFTA 3TZHA 3NJ4A 4LGVA 3OH8A 3ANMA 3GN1A 5DCUA 5DF1A 2QG4A 3LSYA 1MP0A 4ALJA 1B26A 3C7CB 1LDMA 3G79A 4GWGA 4M55A 1MG0A 3JQDA 3PWKA 4KQXA 3RCBA 2P2SA 2J3KA 4ALNA 5IZ4A 3LQFA 1KBZA 3HSKA 4CM8A 4E5KA 2HKIA 2NU6A 1JKFA 2NUAA 4YJHA 1R12A 3PQDA 3T7CA 3DZGA 1Z6ZA 2G5CA 5JYDA 1DIHA 2W90A 3GVHA 1ZSNA 2WEKA 3SX2A 5JS6A 1NNUA 4L4SA 2RCYA 4BNYA 1P1RA 4DTIA 3IS3A 1VRWA 1ZEJA 3QIVA 1XU7A 1YBMA 2VZ0A 3PJDA 1VKNA 4PZCA 2VWHA 1NAIA 2JCXA 2X5KO 4OIMA 4YT5A 5KVCA 3DTTA 2C82A 3CTMA 3EZYA 2YUTA 1ENYA 3ROPA 1SB8A 4J43A 4BHTA 4BQPA 4RQUA 3O03A 2HDHA 1UP4A 4XYBA 5T6BA 3P5SA 5IN5A 1H5QA 1BVRA 2WDZA 3SJUA 1LQUA 1N2SA 2GPTA 3JQFA 1PJCA 4UVDA 3G1UA 2RHCA 3O9ZA 5FYDA 1MFZA 4IQ0A 3WGZA 4CV0A 1CQJA 3STHA 4BL5A 3TFOA 4RVUA 4PIVA 3AUUA 3DONA 1GCOA 5JO0A 4J7UA 1GFSA 3H7AA 3WGOA 3SEFA 1YL5A 3QWHA 1QR6A 4OHUA 2AE1A 4EW6A 4MPDA 4PRLA 1G0NA 4XJTA 1G6KA 2G17A 4HXYA 4NMHA 5ER6A 1I30A 3PJGA 1DIBA 4MVJP 3Q2KA 3ASUA 4RO0A 1AE1A 4JJIA 2HMUA 1U8FO 3K5PA 1YGYA 4U0JA 1JKJA 1B3BA 3DO5A 3RD5A 4MVJE 3QWIA 3MCVA 4G65A 4BNJA 3FBTA 2Q2WA 4WECA 2UUPA 1LXCA 5T8KA 3ADPA 3DMTA 1PJBA 4R1SA 1RM0A 3CSDA 2XPCA 3GMDA 5U4QA 4DYVA 3NGLA 4BNTA 1GZ3A 1SCUA 1N1GA 4BGIA 5ICSA 4CM5A 3EAGA 4NG5A 1MC4A 1YL6A 2ZQZA 5BQFA 4Y98A 2VNSA 3JYNA 4R16A 4R51A 3BTSA 1WMBA 4BKUA 4NQZA 3AUAA 4JLWA 3G1TA 4J9UE 2DKNA 1Y81A 4BQRA 3RI3A 3FTPA 3AI3A 1GD1O 1LC0A 2HK9A 4AICA 2X6TA 1ZMOA 3DFUA 3ZN2A 1PWZA 2J8ZA 3JD1A 3JQGA 3UICA 1KY5A 1PS8A 2WD7A 3RVDA 5CAEA 1IHYA 2HRBA 3AUSA 5TQVA 1QXSA 3O8QA 5IF3A 4CM8B 5JFOA 3OJLA 4JBGA 3NTQA 1Z75A 3AI1A 4NBWA 1UP6A 2HK7A 4FOOA 4J91A 4DREA 4CLEA 5CEFA 3KETA 1PL6A 3E5RA 1P1FA 1GADO 4D3SA 1T1SA 1BG6A 3WFIA 3WOHA 1AHHA 4JROA 3KSZO 5LCXA 1DPGA 3IQDB 3RUEA 3L4BA 2VUTA 1ADBA 1ZK4A 3LDHA 2QW8A 4JP3A 3WWZA 3N7UA 4L76A 1P31A 5GZ1A 4CMKA 2AW5A 2QHXA 1ZJYA 4NDNE 1NFQA 3L4SO 5I7FA 4E2WA 3I9MA 1GAEO 5CDYA 4WCFA 3E6AA 1DIRA 2O4CA 3QHAA 3CZRA 5I9LA 1UH5A 4JN6B 5L51A 1YO6A 5A9SA 4CMBA 4NFSA 2RAFA 3WNQA 5BNIA 4DBZA 3DTYA 2TMDA 1EUDA 1RPNA 2Y66A 3RBZA 1NVTA 1UDCA 2JCVA 5DBFA 1KOLA 3OA2A 4RVSA 3BIOA 4OYRA 1KEVA 5COAA 5FEUA 3JTMA 5TC4A 2Y99A 2IZZA 4S3MA 3G3EA 3DZJA 1UR5A 1V3VA 1BWSA 2AQIA 5T5QA 3Q3CA 4UUOA 3K30A 3E9NA 3PGJA 4GQAA 1C0KA 4GPD1 3OJFA 1MC5A 2CUKA 7ADHA 2JD0A 2Q1SA 4AJKA 4YYZA 1ZK3A 5H83A 3IL2A 4A10A 4WEOA 2OORA 3ULKA 4YT4A 3VDQA 2PD4A 3ROMA 1E3SA 4TVBA 1B2LA 1I2CA 4B3IA 5A5EA 1Q0HA 5K0ZA 4RZHA 1LRLA 4RZIA 5IN4A 1B8PA 1V0JA 2G1UA 3ZDFA 1HDOA 1A71A 1ZXBA 4L0QA 2YV2A 2NVBA 1KVSA 4IQGA 5MGBA 4NR0A 1F8FA 3ZWXA 1UAYA 2WTBA 2CF5A 3WQRA 3D3WB 4L4RA 3GEDA 4CM9A 4PLYA 4PVCA 1E3LA 3AM5A 2DPHA 3NDIA 4BNZA 4BO0A 1NHWA 2PD6A 2YV1A 1NYTA 5KJEA 4GX5A 3L6OO 1NQ5A 1ONNA 4MVJM 1NM5A 4Q3EA 3NT5A 4JX8A 1ML3A 2BH9A 5JE8A 3PRJA 3H5RA 4L4XA 4Q3BA 1K6IA 1PQPA 3GDOA 4W99A 4U8GA 1KEPA 2O50A 1PL7A 2Y0CA 3GVPA 4XQCA 4DYDA 1PJTA 1U3UA 3U09A 3WQSB 1MXHA 3JYLA 3H8VA 3DHNA 4LSMA 4MJLA 5EINA 5L95A 3ZWWA 2VQ3A 2UYYA 1E7RA 3PWZA 3GH3A 1GQYA 3KSDO 5CP8A 1QYCA 2GO1A 4IDEA 1BMDA 3CZMA 4MIOA 3H3FA 2ZYGA 1GPJA 2H5LA 4WK6A 5L9AA 1OI7A 4J4HA 5K9ZA 1LJ8A 1R0KA 1H6CA 4JK3A 1L1FA 2AHRA 4R9RA 1FDWA 2JFFA 5JY6A 2O3JA 1C1DA 2XXJA 1ADCA 4OL9A 4IIUA 5JCJD 1HYHA 2X9NA 3PZBA 3PLRA 2IZ0A 3HFGA 1W6UA 3H2SA 2WWRA 4NU6A 3T4EA 1Q0LA 4PLHA 1SNYA 2B4TO 4HUJA 1EBUA 2POQX 3TZ6A 4CQMB 2AXQA 3CPSA 4ZGWA 2SCUA 3U4IA 4GX1A 5T57A 4E5MA 1A72A 2E37A 4S1VA 2BFAA 4MVJD 4J6FA 1XGKA 4G5HA 4CM4A 1MFPA 1ZVMA 3QRWA 5AXDA 2IEBA 4R4JA 3ZV4A 1HT0A 4NBUA 3H5AA 1R4MA 2Y1OA 4GX0A 1B3RA 1DO8A 2NVUA 2NSDA 2V6FA 4WLOA 1U28A 2B0JA 3MJSA 3OFSA 1D1SA 4PLCA 4XRRA 5KWEA 3BHIA 1NR7A 2FPGA 3C85A 5JCXA 3GG2A 3MTGA 3S55A 4CR7A 3FWNA 3G17A 1CIVA 3GZ4A 2OFPA 1ISFA 3QLJA 1SAYA 4FB5A 1XIVA 2PKQP 3AU8A 4CMHA 1SEVA 1E6WA 4BNUA 3P19A 3I52A 3C1AA 3M2PA 3LT2A 1GEEA 4WLEA 3HG7A 3MEQA 4BIIA 4UAGA 2JCYA 3ZW9A 1UXGA 3FI9A 4ALMA 4B4UA 4XB1A 1ZEMA 2NTNA 3MZ0A 2BELA 4I9NA 4IJWA 4LISA 3MJVA 1LNQA 4J2HA 2X0IA 4J4BA 4RV9A 4DC0A 2VRBA 1XU9A 3DEYX 4TKLA 3BAZA 1MGOA 4WASA 2O48X 4OOEA 4IIVA 2C0CA 2VHXA 1H6AA 1Y6JA 4J3FA 5AQ1A 1A7AA 2Q50A 3I9JA 3S1LA 3IUPA 1DFHA 3VH2A 4XWYA 4DMMA 1LX6A 4TVOA 3RFVA 2NV6A 2NQ8A 3GRKA 4B8ZA 3WMXA 1BDMA 1QLHA 2W2LD 1J4AA 1IPEA 2BI7A 1GV1A 1IZ9A 1RM5A 2JAPA 3IAHA 1E1LA 1ONPA 3DZBA 4GI2A 3AUTA 4W9NC 1IPFA 5DP2A 3GGPA 3GLQA 3NT4A 1LSJA 3BMNB 3GPIA 3ZWVA 3ZWOA 1J0XO 4X54A 5C7LO 4GMFA 2FZEA 5DULA 4CUJA 4GVLA 4RF3A 2H6EA 5AXAA 4D0SA 4BS9A 2V6BA 1I3NA 3CMCO 4D46A 1D4FA 4BVAA 1IHXA 2PTGA 2F1KA 1EFLA 1HE5A 3V1TC 3IP3A 3KM0A 4WJZA 3UW3A 4UEOA 4YCAA 3AY3A 4QO7A 3UUWA 4E5PA 4B8WA 3OECA 1WZEA 4OH1A 2WD7B 2OZPA 3UHAA 4EDFA 4YQZA 3A4VA 4BO7A 3RKRA 2D8AA 2Q2VA 2I65A 3N74A 4XYLA 4F6CA 3V5NA 3LK7A 3DBHA 3PTZA 3U49A 3VPHA 1E3EA 3JQAA 3D5QA 3EUWA 3WGYA 3V1UA 4OQZA 3FCOA 3BHJA 5TRTA 2WSBA 3L9XA 2YFQA 3MJ4A 4QT0A 2J5RA 4AJOA 4OXKA 5JLAA 3OQ1A 1DAOA 2GN6A 4HFJA 1PGNA 5FI5A 1ENPA 4E32A 4LK3A 1D1TA 1H2BA 1ISGA 1C0PA 1GYRA 5B4TA 5MDHA 2IE0A 1R15A 1AUPA 2ILTA 3PVZA 2D1YA 4NI5A 2O7SA 1E5QA 3OQBA 2O3SA 4J2OA 4Y8VA 2FSVA 2HMVA 4JIGA 5BSGA 1UZLA 4JBIA 1VLLA 1NVMB 4XYMA 3UCFA 3VDRA 4BO2A 3G0OA 2D2IA 2BKAA 1PS9A 3WQQA 1UZNA 3QWBA 5THKA 3U9LA 4XDYA 3VZQA 4B3JA 4CL8A 4YAEA 4IS2A 3OQ6A 5H81A 2B5VA 1Z7BA 1CF2O 1WW8A 5TJ9A 3TNLA 3I83A 1PU2A 1UP7A 1KYQA 2OO5A 5CEJA 2H1SA 4LN1A 3WYEA 1SEPA 1O94A 5JC8A 3S2GA 4Y6RA 3ST7A 3OEYA 3KOUA 1ZCJA 4XYGA 5KKCA 5L45A 1QYXA 2VN8A 4FFLA 3DR3A 1PR9A 3PFWO 3OHSX 4PCVA 3QVOA 1VM6A 4DPLA 3VOSA 3W6ZA 1B8UA 2AA3A 3NX4A 4FS3A 2AMFA 4AJ1A 4GLLA 4BB6A 4LRTB 5A3JA 2YY7A 5KKAA 4INAA 3B6ZA 3QW2A 3D0OA 5JDIC 3W4KA 5FF9A 2E6UX 3GFBA 2P5YA 1HDYA 1LDGA 1LU9A 4NFYA 4DQXA 1X0XA 2DTEA 2OUIA 1K5HA 4YT8A 1T2DA 2JAHA 4II3A 2X22A 5L53A 5DDIP 3BMNA 3Q1LA 2RH4A 5GY7A 4FFPA 4TROA 1ISHA 3LF2A 2BI8A 4YTEA 4N5LA 1MG5A 1HDRA 1FJHA 1I10A 3D4PA 3F4BA 3GPDG 3KSUA 5C37A 2PY6A 4AJLA 2NTVA 1TT5A 1HSOA 3DBVO 3DOJA 3OETA 3QY9A 4HP8A 3ZCXA 4CJXA 5TIIA 1UDBA 2PZKA 1OMOA 1L7EA 3KUXA 4WCFB 5ER9A 2EP7A 1UXHA 1LA2A 3EHEA 3BA1A 4RPHA 1LDNA 1JWAB 1NAHA 4LMRA 3NTOA 4MO2A 4D79A 3ADOA 1HWYA 4IY1A 4N7RA 2PZMA 5BNFA 3I23A 4CLHA 1E1MA 2GN4A 3UH1A 3V8BA 5DBGA 3UVEA 2B37A 1SPXA 4LW8A 2GERA 3AOEC 1LLQA 2E4AA 5TS3A 1P1KA 3NUGA 3WXBA 1FXSA 1U7HA 3LT1A 1YE3A 4IJKA 3SVTA 2AEFA 1EQUA 2OMEA 1NQTA 1E3JA 2YV3A 3ZNNA 4UREA 4P4LA 3Q2IA 3LT0A 4ZJUA 2GLXA 2D0IA 2RH8A 3DAPA 3KYDA 1Z7EA 4ZVVA 3UF0A 1DFGA 1JKIA 2JD2A 2YJZA 2FSSA 4QFCA 5ENDA 1HZJA 4MVJG 4CUKA 4BNIA 3TZCA 1ZSYA 3VTFA 3NTRA 4CODB 2ZTLA 2YHIA 3H4VA 1ZFNA 1JAYA 1O9BA 2G82A 4JJFA 4DA9A 3QQPA 4TWRA 3EYWA 2GCGA 3PYMA 4EZBA 1LC3A 2B35A 4RLSA 4XA8A 1N92A 1PJ3A 1EVZA 3GFGA 4HFMA 4QO8A 2Q1WA 2NNLD 5JAQA 3UFXA 4U5QA 1WAMA 4UUNA 4EYEA 4FOSA 2BMAA 1EE9A 4DWVA 4RVFA 4D43A 1LLCA 3I1JA 4NFHA 5JO9A 1LDYA 1HDXA 1SO8A 1VI2A 4IDCA 1HYEA 5TGDA 4YAGA 1X13A 1R16A 4B7UA 4Z3DA 3TF5A 1XSEA 4XR4A 5GMOA 2QYTA 5KIAA 1U3VA 3JD2A 2P68A 4DL9A 4K9DA 2VHVA 4NJMB 5G4LA 5B4UA 1WNTA 2X58A 4OKIA 1MLDA 1WZIA 3PHGA 4MDHA 3PJFA 4B4WA 1JTVA 1ENOA 2EG9A 2Z1NA 1B7GO 3PIDA 4FN4A 4R5HA 1HDGO 4BGEA 3ICCA 3GQVA 2PLAA 3HJAA 4TZTA 3GF4A 1SOVA 1WVGA 4WLVA 1PGJA 1W8DA 4WE3A 2PWZA 3NJ8A 1J49A 4KOAA 4AFNA 3ZHYA 2GRAA 3CXRA 2Q4EA 4MKXA 4M54A 4M87A 4GSKA 3RUHA 3QVTA 4HBGA 4KUEA 5JDIA 2DVMA 4NBRA 3VKVA 4BB5A 1Y5RA 1ISIA 1WPQA 2QRKA 3OM9A 3JCZA 4WGGA 5JXWA 1P0FA 1JWBB 2A4KA 1V3UA 1U5CA 3INTA 3E82A 3ZNQA 4BNKA 3UAGA 5T8KC 5A03A 5IDQA 1PGQA 1XYGA 4ROSA 3I9KA 1JLLA 4PN3A 4L74A 3PP8A 1B14A 4FW8A 3RJ5A 1P74A 5HRUA 4FFRA 4RF4A 4XJSA 2O2YA 1ENZA 1IY8A 3RASA 4FSHA 5BR7A 1QRRA 1VKOA 4ID9A 1E6UA 4KZPA 4ZQHA 1E7QA 2GF2A 1R4MB 4BGVA 5ENVA 1XKQA 1Q1NA 4WPGA 1QLJA 5JMPA 4E5NA 1NPDA 5KCZA 4RF2A 3EVTA 4DPMA 4E3ZA 2VYND 4WCDA 2CFCA 4MKZA 4OO3A 2G76A 2JKVA 3ANLA 1DBVO 5K6AA 1ADFA 3AFMA 4ND4A 5IXSA 4ZN6A 4NBTA 5EIOA 1JA9A 1ZK0A 2DT5A 3A06A 3PPIA 3EMKA 1GDHA 3JQBA 3ON5A 3KYCA 4Q3NA 4PG7A 4YAIA 3JD3A 1MX3A 3A1NA 1BVUA 4BNXA 1AXGA 1ZZEA 3JD4A 5A3VA 2VOEA 1UXKA 1C1DB 1CRWG 1IL0A 3D3WA 1E3IA 1ZJZA 2A92A 3JYQA 3R3JA 5I8ZA 1D8AA 4BO5A 4EUFA 3GEGA 2EWMA 1TA4A 4M49A 3IKTA 3ZZNA 3D7LA 4I08A 1R4NA 2HQ1A 1Y1PA 4Q3DA 2O3QA 4UULA 4CMEA 5KJFA 3LZ6A 4XGIA 4WOKA 3F4LA 4UEKA 2EJWA 3R3SA 2Y1EA 2FR1A 2BF7A 1PEDA 3Q6IA 4CQMA 2QIOA 4MVJI 1EUZA 1JDJA 4IDAA 4MP3A 1YQGA 3ZHBA 2EXXA 2FR8A 4ZQEA 3WFJA 4J7XA 4P4GA 2PGLA 3F5SA 1LSUA 3FRJA 1QV6A 2HAEA 5TF4A 3WGHA 2CDCA 4FJ2A 4GLOA 1T4DA 1HKUA 2DBVO 3GDGA 1HF3A 1ZO8A 3W8EA 2V65A 1V9LA 3WX0A 4E30A 3IIEA 4TSKA 5T67A 3PLNA 4JXKA 4HX5A 3QA9A 2X86A 3VZSA 4RORA 2BFMA 1E92A 2HO5A 4YXFA 2GD1O 2BRUA 1PJQA 3BMQB 4XRGA 4L8VA 2ZCVA 3ROQA 2ZJ1A 3RC7A 1T4BA 3T7EA 1VE9A 4GGOA 4JJGA 4E13A 2J6IA 4RDHA 3P2YA 5TSDA 1TXGA 3JQBC 3VVBA 1H9AA 3AOEA 2J5QA 4DLAA 5F1OA 2ZTUA 1KC1A 1PZHA 1A5ZA 2D4AA 1Y7TA 2DFDA 4YEDA 4YJDA 2W2KA 3H65A 1EE2A 1QYWA 1DRUA 4U0KA 1YL7A 1R37A 3A28A 1E1NA 1MV8A 1YOVA 2VRCD 3AY6A 4J9VA 4R1NA 2GGSA 2QX7A 4NPCA 3W1VA 2Y0EA 1Q7GA 3KTDA 4BO9A 3KZVA 5EPOA 4CM6A 4AJHA 3R1IA 4JNKA 3WR5A 1SMKA 1Y9EA 3K6JA 3TOZA 5I7EA 3VZPA 5AYVA 3E18A 1LSSA 1M75A 4GKBA 3HB5X 4XR9A 1WXDA 1DRVA 1HETA 3GAZA 3H2ZA 1FDSA 1Y8RA 1DJNA 2DTXA 4W82A 4BO8A 1HLPA 1ZUD1 5THQA 2B5WA 5AXCA 5C7IO 2X4GA 2W8ZA 4H16A 4QUKA 3RUIA 1J6UA 2ZTVA 3FD8A 4ILKA 1BTOA 3WGIA 4BNWA 1B0AA 4I9UA 3B70A 3JQ9C 4OKNA 3E9MA 3FSRA 3W4JA 3FNFA 3HDQA 2PK3A 3Q9NA 5JPIA 4BKOA 1ONOA 3RAJA 5DP1A 1I0ZA 1N5DA 2OHXA 1IOLA 2PZLA 3D64A 2GN9A 4FR5A 4HWKA 2JHGA 1M66A 6ADHA 2DU8A 1Q7BA 3E48A 1EDOA 3RWBA 3D4OA 4R54A 1R0SA 1CQIA 2PKRA 4E21A 5JY1A 3JQEA 1NWCA 1PWXA 1DLJA 2CDBA 3ABIA 2JFGA 1LUAA 4BNVA 1DLIA 3H9UA 3HN7A 3O8QB 5JYEA 3ZI0A 4R1UA 3GC6A 5FI3A 3W8DA 1PZGA 4R01A 3S2IA 2P91A 3VZRA 2GASA 1DDOA 4XIYA 4AJNA 1EQ2A 2Q49A 3JQAB 3UXYA 3WS7A 4OM8A 3RU9A 4WLUA 2FPPA 3VH4A 3ENKA 2I6TA 2PH3A 2CY0A 2CNBA 3KLMX 4KMSA 1YBAA 4Y9DA 5DBIA 2I9PA 4HFNA 4RPLA 3WBBA 1U5AA 1GCUA 4BMVA 1QV7A 2HJSA 2J3JA 3ZHXA 1PJLA 3DBLA 1VL6A 5L40A 4QSMA 4RPGA 4XYEA 1ZIDA 3GUCA 4W4TA 5B4VA 4NNJA 1K3TA 1N8KA 4FFMA 2NWQA 4UUPA 4FCCA 4DIOA 5K6AC 5L4LA 4IMPA 4YB8A 5EQDA 3NDRA 5JW6A 4P38A 3GNQA 2I3GA 3EK2A 3ZV5A 2B36A 1JAXA 2PGDA 4N18A 4DLBA 4RGBA 3BXXA 5CPFA 4RLHA 4YJFA 3H6KA 4CLOB 1DC3A 4BUCA 3JQAD 5A9SB 2GUGA 2GSDA 4YJFB 3ITDA 4CLOA 4B7CA 3GNTA 2WE7A 2X9VA 3BTOA 3DOOA 5AOVA 1I36A 3O38A 1SBYA 3OA0A 4RF5A 3UCXA 3VPSA 4FPXA 3RC9A 3ZWMA 2P4QA 4E31A 5EMHA 1HE4A 2A9FA 1X0VA 1ADGA 1YOVB 1YB5A 3QJ5A 2NADA 4QX6A 5CDUA 4RPKA 3QVWA 4HY3A 5BSHA 2B4RO 1H6DA 4H3VA 4QECA 4C7KA 5J23A 2QRJA 4WLNA 1QYVA 1ZH8A 4J1QA 1HDZA 5ICMA 1QKIA 4ND5A 5CPBA 4OJNA 4LCEA 1I3MA 1ORRA 3DDNA 1GQ2A 3JSAA 3O26A 4MIEA 3FTNA 4OXYA 3WNVA 5CFZA 2AG5A 4OQYA 2F00A 3DZFA 3FR7A 1AGNA 1BRMA 2D59A 4L9RA 4NK5A 4XIJA 5IDXA 1N9GA 4EJ0A 1VC2A 2HCTA 1GQQA 4W6ZA 3ZU3A 1M67A 3DZHA 4TZKA 4FC7A 1QYDA 4XQGA 4OAQA 3IOYA 3WGGA 5EERA 4CLDA 2EP5A 4KUGA 3RUFA 3KV3O 5JDCC 3WIEA 3SBOA 4AG3A 4CQMD 5CEEA 1UXIA 2DM6A 3PFFA 3VH1A 5F5LA 5LDGA 1ZK2A 3TWOA 4M86A 2EIHA 3WYCA 1T2EA 3RIHA 4A2CA 2Z5LA 2UV8A 3C3XA 3V2GA 3ZU4A 1GTMA 4UVIA 4R69A 5EQFA 4DVJA 3DB2A 1PZFA 3EW7A 3K2EA 5KVVA 5I7SA 5F1PA 1X1TA 1M6WA 4Z6KA 4AJIA 3DZKA 4IXWA 3LVFO 2GN8A 1CYDA 1WLYA 2HJRA 2OGUA 3KVOA 1XEAA 4FDAA 3WYBA 5B1YA 3GR6A 4D45A 3DHEA 3DXFA 3K96A 2DUWA 4DC1A 1VSUA 4TKMA 4DUPA 3GZNA 4IDFA 3B1FA 5JNLA 3GRPA 3PDJA 1XA0A 4LVUA 4XKJA 1CETA 5IJZA 1T25A 3ICPA 4BO4A 4KDFA 1DC6A 4WOJA 1WP4A 1NTOA 1VL8A 4HNGA 3V2HA 1DIGA 5A05A 4E2XA 2ZB4A 1X7HA 2TMGA 3SC6A 4MIYA 4I8XA 5TLSA 2Q99A 3JQ7A 1BHSA 3TZQA 4XD2A 1NPYA 1YONA 4URFA 1PX0A 3D1LA 4BKPA 3VVCA 4F45A 5L7TA 1Q2XA 3ROKA 5ITVA 4JGBA 4ZQFA 3OJOA 1PIWA 4PVDA 3U4DA 3VH3A 4JP2A 1RYEA 2FZWA 4XQ9A 2P4HX 1NBOA 2AQHA 3SC4A 4BNGA 4E4YA 1W4ZA 2DQ4A 2GYYA 1MA0A 1T1RA 2YYYA 2BGLA 2BGKA 1EK6A 4IXTA 2EEZA 3X2EA 3INGA 4OMUA 1OOEA 3F6YA 4EUEA 4Z0TA 4II2A 1PQWA 2ZJ0A 1Y8QA 4GAEA 4FJ0A 5C3MA 2NVUB 1ZMTA 4HADA 4MKRA 1XWFA 1RYDA 3ENNA 3DFZA 3NT2A 3EC7A 1O6ZA 2W98A 1YB1A 2D3TA 4BKRA 4P22A 4FFOA 3IC5A 2P9CA 5KTKA 4YRBA 5KVQA 4JCOA 5LC1A 3B20A 4O1MA 1YH3A 2I66A 1ZK1A 4HV4A 4TRNA 1NFRA 2VYNA 4ND2A 1KVQA 5H82A 3ORFA 3HZZA 1EVYA 4NIMA 3ZHZA 3S2EA 3RUDA 4FJ1A 4CL3A 4UVEA 3WLFA 5U1PA 4XGKA 1TEHA 1J5PA 1KERA 1A9YA 3DBHB 4RVDA 5BSFA 4Z9YA 3QVXA 3TRIA 2EKPA 1G0OA 3C7DB 5AVOA 3QWFA 2VHZA 1NPTO 2P5UA 4I5FA 2JD1A 2DUUA 1KEWA 3LLVA 1I01A 3QP9A 4CQLA 2X0RA 1KVTA 2BFPA 2WYWA 2X0NA 3MOGA 3U62A 3PYXA 4D41A 3U4CA 1PGPA 3HQ4O 1O95A 3JQFC 4ALLA 1OZAA 3FF4A 2EHDA 4YACA 4C4OA 3HDJA 3PZRA 3KLPX 4NHEA 1ZKMA 1E1KA 4MVJH 1GUYA 3ONDA 5C5IA 3BMQA 1C0IA 1H94A 2Q46A 1A4UA 4W9NA 4B7XA 4QFDA 2AG8A 4G81A 3LC7O 4XCVA 4B4VA 2H63A 2J3HA 3KEOA 1E3WA 1U1IA 4DMLA 1XQ6A 1DFIA 1LQTA 2O4UX 4CM3A 1P1JA 4IBOA 4A7PA 1C14A 1T2CA 4CLRB 2CMDA 2CD9A 3GK3A 3SXPA 1Q0QA 4IUYA 3PI7A 1I8TA 2HMTA 1K6JA 1NQOA 2ZTMA 3UKOA 3OMLA 4AJJA 3GDFA 3K2BA 3WLEA 1DHRA 3I9LA 2I67A 1LDBA 4J7CA 4ZU3A 3E9QA 3UN1A 4RVGA 5U9CA 4XX0A 4YA6A 3CH6A 3E8XA 2X5JO 3QV1A 1OC4A 4MOWA 1LRKA 3GVXA 4XGNA 2NM0A 1R0LA 4H15A 3GGOA 1F14A 3HADA 2OOSA 1X7GA 5JDCA 4AL4A 4LRSB 1PQUA 5KJ6A 1NXQA 5CG2A 1P45A 4KWHA 1Q7CA 3RQSA 5EJ2A 1IULA 2Q1UA 4NZ9A 1K89A 1PZEA
chains in the Genus database with same CATH superfamily
2GTHA 1O9GA 1CFZA 2UXDB 2JJYA 1S8FA 4R6XA 5GONA 1FE8A 4EY6A 4YWJA 1GUFA 2YZ2A 4QPCA 5NLLA 2KI5A 1MEOA 3V4OA 2GBIA 3GA0A 1T2AA 3G9TA 4A15A 3FPKA 3KYCB 1WPRA 3CWCA 1L5SA 4CV3A 1FTNA 1FXWA 1RWPA 3OJ0A 4C6TB 3QPCA 1P2GA 5F3RA 3RE1A 1Y9AA 2C3UA 3BWDD 3NBFA 5BNWA 4Z4IA 3QBVA 1Q12A 2O14A 1JYEA 5JAPA 3CB2A 2JHFA 2ZB7A 1BXGB 2GZSA 3F9CA 2B1GA 3GP3A 3JWPA 4YJ2F 3UHOA 4TLMB 4KP7A 2WIFA 1P9OA 4JSTA 3U2QA 3KX2A 3W1EA 5J40A 1NC1A 1NSFA 1QQ6A 1Z5NA 3L1KA 1EUQA 3LI2A 1JQ5A 3PDHA 1NYRA 1ZWLA 2H54A 4WW0A 4DSUA 1EK5A 5EPUA 1XT6A 2ZSJA 2O59A 2FFRA 4IVRA 1G1MA 2ORYA 2PAAA 3HH8A 4N4AA 4YMUA 2PKYX 3NU1A 1FIUA 1GGMA 1UBGA 2JIRA 2G4CA 4BEBA 3ZW8A 4LMBA 5BV1A 1Y1LA 1P29A 4PHFA 1G291 4DUGD 3RAEC 1S02A 3LP6A 4AZVA 4DW8A 2WF5A 4HN4B 2Z1MA 1G3MA 3U6BA 4QOIA 1THZA 4BV2A 1FCJA 1KFBB 5E3HA 1QH0A 1WD7A 2WPDD 4W9RA 1QBKC 1FXWF 1XEWY 3M4ZA 3NI2A 4FI3F 4C3UA 3K4HA 3AQIA 2H1WA 4OX9B 2C07A 3FN4A 4EOGA 4WOCA 3IVMA 1TUBB 4EL5A 2JRLA 2HF9A 4HGPA 5IH7A 1J1ZA 4J0CA 4WADA 2AWOA 1E58A 1XTIA 2ZIVB 3E7PA 3SE0A 2ZYDA 3IHTA 3Q6MA 4MR8A 2V1UA 1H4TA 1YQDA 1PT5A 2O3RA 2BEJA 3O1JC 3N2IA 1UPTA 2MOKA 2VTBB 2VJKA 3INNA 1K8RA 3KQSA 5DRTA 4KLAA 4KO1S 4LPKA 3IBTA 4HATA 1DDIA 5I45A 2R2AA 3JY6A 2CXHA 4UAJA 1HE2A 2FCRA 2J5XA 5CDSA 4GBMA 4MWZA 4HNHA 5DNAA 2CT8A 1YJQA 4HNRA 1CWUA 3HY3A 3PHIA 3UAVA 4MW1A 4DFDA 1D5WA 4FWIB 4WKNA 2RGWA 1AURA 2FP4A 2EW8A 4WXPA 3K0KA 3IDOA 1CY7A 1NVKA 3IP1A 1KP9A 4JENA 4MRSA 4RY8A 4WZAA 3EMVA 5TT0A 1UBNA 2G9NA 1O4VA 5JASA 2R1TB 2NGRA 3A6LA 2JAQA 3GCXA 1U0OC 4UAUA 3ZQ4A 3YASA 1WMDA 2BV3A 5JC1A 4P5EA 2PMFA 2V7TA 3SLKA 5LBIA 2WQZA 3SCZA 1TK2A 5KYVA 4AQYB 4M22A 5TX7A 4XFJA 1QCZA 2Z3WA 3PUHA 4IOLA 1L9KA 1P1IA 2AN1A 2VP0A 3IV7A 5MN4A 2CXQA 1CEEA 1BGXT 4EHIA 1F12A 3I76A 2AC2A 5EEHA 3WK9A 1BKSB 3D3NA 3DKPA 4EUSA 3TSOA 1Q0SA 2XRYA 3AVOA 1CS0B 2D7CA 1OI3A 4L4YA 1DOZA 2ZAGA 4FFNA 3T0GA 2JGJA 2C8VA 2RFLA 3OHPA 4ZI5A 5BUQA 4BMDA 5GV7A 2XTZA 2B30A 5KYKA 3HBMA 3WWYA 1Z38A 4NULA 1LJLA 5CHEA 3U7QB 4GM1A 1KZ6A 1RCFA 3ICWA 4UBIA 1N2IA 2X7HA 3NDJA 4G37A 1GUZA 3VR6D 3MWFA 4LSWA 1ZAYA 5HA5A 3ITNA 2UYQA 2WJZB 2CN1A 3DT9A 3NOXA 4PQGA 3MT9A 2G77B 2IY7A 4L6AA 3MJCA 3AEKA 4IJUA 4PC7A 2WM3A 4TTSA 3W2HA 4QBKA 3WKCA 3SXUA 4DWWA 1ISJA 3DZIA 5JD3A 2PFGA 1LEHA 1I1OA 1KE2A 4N0DA 1JJVA 3JALB 3I9FA 1O96B 4QM7A 3G82C 4B17A 3ZWYA 5BUZA 2OGWA 2DF8A 1ZUIA 1XTRA 2FGKA 3MT7A 1U0TA 8ADHA 2H2WA 4DM7A 3PGMA 4XPIB 1EA7A 2RD2A 4KQCA 2B94A 4XCQA 5ICEA 1H4VB 4GSLA 1RQ7A 4DQ0A 4GM0A 4AC9A 3NXKA 2WC1A 2GEVA 5DM60 2Y9PB 1QZZA 2IE8A 3IUNA 4HI0E 2ZDQA 4YAOA 2MSNA 2W8BB 2VJCA 1UC8A 1O6GA 4LC1A 4DIBA 4CPDA 4N65A 4DGSA 2PV7A 2VXYA 1GY8A 3CT6A 3P97A 1TYAE 4O4IF 3OKCA 1V8BA 4G4JA 1MDBA 4PCAA 4R1PA 5FTJA 3VC7A 3V3KA 1JBQA 3WISA 1Z83A 5BVHA 3L8EA 4EUNA 4LGYA 3AHHA 5FDFA 3U0BA 3JYPA 4GW3A 5GVSA 3GLVA 5EEGA 3SQLA 1Z18A 2GPNA 3H2YA 1OC2A 1D4ZA 1WPGA 5JAZA 3KKZA 3CIFA 1M0TA 2A35A 2C00A 4PRKA 5JCOA 1EM8A 2CF6A 2ZWAA 3ZD8A 3WL8A 5D2CA 3WDSA 3U5TA 4UM8B 3COYA 2C20A 1U8EA 1OZHA 3AWDA 4I50A 4K9NA 4E22A 3UK6A 1TYCA 3TZEA 2FUG6 4PZLA 4YI3A 1YVDA 4CGYA 1YVEI 4UU0A 5KTMA 3FW1A 4QPJC 3BMOB 1XJQA 3R8CA 4GR9A 2QYOA 1NDQA 3E8MA 6REQA 5DIFA 1ECCA 2EERA 1GKUB 1VIDA 3B51X 3GI1A 3I73A 4YQYA 3W8FA 3GP8A 2SBTA 3AFNA 3QG1A 1J8FA 3QY0A 4PPNA 4XH9B 5TPZA 4L2IB 1L5GB 3SI7A 3UK7A 3TNFA 1K8ZB 1V6CA 3R3VA 1JSRA 4X90A 4AYWA 3F8SA 2F6RA 1GAJA 3S2SA 5HEKA 1XI2A 2VZ8A 3E9RA 1PS0A 3LQ1A 3SMQA 3TIVA 4CNBA 3CLRC 4D3DA 1QUEA 1GL3A 3HFRA 2AUNA 2WWFA 1DWOA 2CXOA 2BZ0A 2XCQA 1KJQA 1I7PA 2DLDA 3E53A 3F3MA 3KRTA 4UNSA 5FI1B 1TYDE 3GZNB 4DCJA 1JJFA 1K2WA 4RQTA 3TMAA 4KPYA 1HLGA 4AWXA 2IF0A 4B3TB 2OCYC 4MICA 4N8EA 3WTBA 2GZDA 3OF2A 3QNWA 1IHPA 5B3JC 3I12A 1XR3A 5ITWA 2CJWB 4KDEA 3FDZB 3S68A 3C5CA 2GJSA 1QO7A 1Y7IA 7YASA 4C7OB 3THXB 3D4NA 5EHGA 5EQTA 3EQ6A 1MO2A 3BTVA 1GZ4A 3KJGA 2EKLA 4BAGA 5LQDA 1QGUB 4IG4A 3I01M 3O3OB 3TI7A 1Y48E 4JT2A 1GQOA 4V0SA 3N0RA 4B44A 1P33A 1NX6A 2V6IA 3ILXA 3TSYA 3ZHRA 4YT2A 1KZHA 4JR1A 1CRZA 1DJQA 1L4HA 1JEAA 3FB4A 4HX9A 4US2R 1H9CA 3VPDA 2AYXA 2EBUA 1J7KA 3IQIX 4K9KA 3SQXA 3AJDA 2HK6A 3LUCA 1RYNA 5C18A 3GN2A 3N58A 1LSOA 1C7QA 2XUDA 3DW3X 4FYHA 2CXRA 3A6FA 3H2IA 3S1AA 3UENA 1N4AA 2FMIA 3LTEA 3M9WA 4ZVPA 4F97A 4L5JA 4RPJA 1AKWA 1Q3TA 4OGFA 2CJFA 4UCFA 5ESRA 2P9EA 2B7LA 3B2EA 2PKQO 1YZ3A 1Y4DE 3LH5A 1NU8A 1IN1A 3LCUA 5DK6A 2QDXA 5JAIA 1VMDA 4HXEB 3RVJA 1RPAA 1U9CA 4X7PA 3W3AA 2GCEA 4RABA 4ERXA 3T4UA 1RM3A 4FKBA 3TVTA 1S4MA 4NZPA 4I46A 3CUKA 4LY9A 4MQEB 4E33A 3F67A 1PJSA 2VWPA 3IA2A 2AB0A 1L4MA 2PA3A 3E58A 1YUBA 3WL5A 3DEIA 4V38A 3JXEA 2R8OA 1JPUA 3BMCB 2ID8A 2QGZA 4ZEWA 3MELA 1E4EB 3BHMA 5ES3A 1S2LA 3MJHA 3W78A 1ABBA 2XDAA 3PEFA 4ENUA 2QN6A 2R8ZA 1RQXA 2Z04A 5IYZB 1N5IA 1UEXC 1YKFA 4I9HA 1VPDA 2HMWA 2W4QA 2ZJBA 3PFKA 4KYVA 2YC4C 4ZVTA 3GY0A 2HNBA 1WXQA 1JRLA 3ITKA 5KOIA 4YDSA 3TSWA 3EXFB 3JV7A 3OUZA 4C03A 2P0AA 1M34E 2WYUA 2Q07A 3GRAA 5IH3A 1Y3FE 3UHFA 1PF7E 2QN9A 1WMAA 2YQZA 1PBTA 1LBSA 3USCS 4TQGA 1JNXX 1V37A 1Q0PA 2DHQA 2YX1A 3HWRA 5J2UB 4D57A 5CB4F 2ZEJA 2GJKA 3T1OA 3N75A 4IJ5A 3OVMA 1FU8A 3C3AA 3QVMA 5E6RA 1AXEA 5EN4A 1L5OA 3Q7EA 5CLHA 2AFHB 2ATIA 2I4OA 3B1JA 1NLUA 3EBOA 3AJRA 4BQFA 5I3ZA 2XJ4A 5CM8B 2QM0A 1ND5A 2HIHA 3N87A 5D3ZA 4D4GA 1DQYA 1BFUA 3AWIA 1NBMA 1X1RA 4B6GA 4LAFA 2H7VA 1FDUA 1GN8A 3OIYA 2I7DA 1FX0B 2CLKB 3UAXA 1Y0BA 3LBAA 2PNFA 3VYWA 1XVVA 3L5OA 3E9CA 5B2ZA 1EP9A 4ATNA 1T2NA 3OIVA 4E31A 1E20A 1PQYA 4M0CA 1A77A 2DFNA 4X6YA 3MWDB 1JT9A 5DI3B 3W9YA 4RAQA 1ZESA 2GK7A 2Q9UA 2BKUA 1O1YA 1AKEA 2WF7A 3QEKA 5IJ9B 2IHNA 4K26A 4B2YA 1ZX1A 3F1LA 1PFYA 4EUHA 3IPXA 1UT6A 1E3WB 1FF9A 3ETGA 2C7QA 4F46A 1GL9B 2YHUA 2V59A 3F6RA 3T5CA 3ZCSA 4PSDA 3VU8A 4N3NA 5LP1A 2CL7X 1JEEA 1NW9B 4C4AA 4GZ6A 3NYWA 3QH4A 4FZ5A 1JBEA 3OEEA 2H1LA 3U1BA 1UODA 5SZIA 2CVQA 3BTUA 2B83A 5DGDA 1UKCA 4HVLA 6LDHA 4UMVA 5BY2A 2J07A 3E5MA 2CLIB 2PJDA 5DT2A 3FNGA 2OL4A 4B83A 2VJOA 2DBQA 2FWRA 4TQAA 4YV1A 5FUYA 4MUAA 5DBIA 3SSOA 3SHOA 5JI3E 5DHTA 1I7SB 1OI4A 4BWGA 4WDQA 1QMGA 3V1NA 1RMTA 3MTEA 1WDMA 3L6EA 5B2EA 3GEHA 1A4IA 1E61A 1F5SA 3HCBA 2HIGA 4DV3B 5IVIA 5KNCA 4R2MA 1ATIA 2V6MA 3IA7A 3II6X 4IZIA 3PDUA 2BKXA 2H1CA 2C58A 1FZQA 4QNRA 4M7PA 4MYSA 4QYSA 4HPXB 5TT1A 4MQBA 1XVLA 1O6FA 1A7KA 2MIIA 3IERA 1WVMA 3PX3A 4NU5A 1RCUA 4UU7A 5E3IA 4ZOQI 1MV5A 1TZ2A 1G5FA 1WDLA 1KSHA 2BKEA 3RFCA 3FPCA 1KH2A 4DIKA 1OROA 2ZRQA 2D06A 3HFSA 2HSZA 4KPGA 5DLPA 2PD3A 1I3LA 4IIJA 2I8CA 4MLCA 3LY5A 3DLBA 2A1IA 5FFFA 1XUOA 4FMCB 3GQBA 2HLPA 3HWSA 3QF4A 4KRGA 4Z8XA 5HSGA 1LV8A 4AMUA 2JBWA 1GHTA 4H6VA 4BU1A 2GOYA 3A14A 4MUNA 5MN5A 2NVOA 1VI5A 3H9QA 4PHCA 3AHIA 4J0DA 1HT1E 3WYAA 4KB5A 4C29A 5G4KA 1IVSA 3Q7RA 3H9GA 4IHQA 5JMWA 4EJSC 1HTBA 1TLTA 2X40A 4DMFA 3OY7A 4BMNA 1HQDA 2CFOA 1L5KA 3EDCA 1FSZA 2EOAA 4GYWA 4PLGA 2G4VA 4R3WA 4D6PA 2HCJB 3KXPA 2YS6A 4M36A 4YMWA 1GYPA 2CLEB 1OWMA 1TF5A 2PRIA 2FN7A 3DM5A 3CMMA 2Y1DA 4FDUA 2RI0A 1K27A 3IHWA 3QX7A 4AJ2A 1JT2A 1L7RA 4IUDS 2VPTA 4MI6A 4DSAA 1PL8A 1VIMA 3B3QA 4V1CI 1I33A 3IMCA 3MJTA 1EPUA 1A8HA 4F04A 1Q1AA 4OAPA 4E70A 4KXMA 1PVVA 4BNNA 4YP0A 2DGDA 4J0FA 3P9KA 2YWDA 3P0JA 4O29A 5ARDA 4OOFA 2PT5A 3TAXA 2EHJA 4LI0A 1CE8B 3L8FA 1B93A 2QT9A 4Q3AA 1Z28A 1K6EA 4R0VA 1FQOA 2HA2A 1N0IA 1QHEA 3TRJA 1N34B 2H9IA 2OV2A 4K1LA 4EFNA 4EF6A 3CF6R 3IHLA 2A3NA 1ZIXA 3DHVA 3KBOA 1IBSA 3K53A 2YXBA 4JGGA 3K9GA 1ZG3A 2BJHA 3ZHVA 1PNOA 2XSZA 4XAQA 4IDOA 3OIWA 1UINA 1E7MA 1IEXA 2ZBDA 4URYR 1RWMA 5BUCA 1KH3A 3X44A 4WZ6A 1NVGA 1PNQA 3DTNA 3ICVA 2O5RA 4ZGGA 1DC7A 1J25A 1NUUA 3M34A 1RYBA 2R47A 1UM9B 3GJXC 3JQGB 2WA1A 2C96A 5A1JA 2QRQA 3QEMB 4BX0A 3HCDA 4NENB 4ESOA 3MGGA 1CQJB 2DSNA 1YJXA 2FJUA 2ZSIA 2XTJA 3ANNA 3DBOB 4Q1DA 3HZRA 1EQAA 4Y30A 1D9XA 3ZZUA 3DH0A 5BSEA 1ZRHA 4BO6A 4BGUA 1Q17A 1GGVA 1VJ1A 2MSKA 3KR9A 3LOQA 4HTFB 2C1EA 1MJNA 2VZ9A 5I4IA 4W9MC 2XODA 1ODLA 2XBUA 3IYLW 3M4JA 4AQDA 1YJ5A 2WA2A 4ZOLF 4R41A 1CZUA 3KC2A 1S2MA 3DMDA 4AYTA 4W5QA 4DSOA 5ILOA 3HU2A 1NN5A 2C2XA 3IAS6 4I36A 2ZKLA 3DAYA 4G01B 3F74A 5F73A 4Z2AA 2JJ1A 4O0LA 3ZWNA 1CJTC 4TXLA 1CBUA 4NYIQ 4A36A 4XIGS 1YS4A 1FRFS 3G2PA 5DM4A 2PYZA 1R8YA 4IIDA 4KXWA 3V6MA 3GYBA 3T12A 4KE8A 1JN0A 1WWKA 1NSYA 2VWGA 1VJ0A 1T9BA 1TL7C 2O6LA 2VT6A 5GTDA 2VATA 3HCAA 3L8ZA 3FI0A 2IUSA 3WJ7A 4DIUA 8ATCA 1RI2A 5BV7A 3DBRB 3RBXA 3DDWA 3AO0B 3WADA 2ZS7A 1MRSA 4MULA 4CCYB 1KI7A 4UZSA 1GQFA 1NZDA 2ZSDA 3CLVA 1FFDA 3H2JA 3OZXA 1U7ZA 2F55A 4XDZA 3OM1A 4KH0A 4GYYA 4AVYA 1DJPA 4Y9SA 4UM7A 1HDCA 2GDJA 4ZOLB 3TSCA 4GMKA 5KYXB 5KNBH 1I14A 2EX1A 2IZ7A 4DBVO 4MKFA 3L06A 2EX4A 5EMNA 3W6PA 2IODA 1DOHA 1GSAA 3BYZA 4JVNA 3AM4A 3ETDA 5E6UA 5G3YA 2SKDA 5IX8A 4LF8B 1JR6A 3JQ8A 2Y05A 2ZK7A 3V8PA 2EP8A 4Q7EA 8LDHA 5HE8A 1J56A 1BXRA 3AOGA 3CS3A 4J0KA 2R87A 3EYAA 2GDZA 3TPZA 4TWIA 2WP0A 3CN7A 4GNKA 4WXHA 4Z7JA 2IXEA 2HUPA 1D2NA 4WT7A 3WBJA 5H59A 3SXUB 1UWCA 4EQ6A 3BSFA 3RRYA 3L07A 1GNTA 2P9QA 4GQIA 5AH0A 4LHXA 4AO7A 2HMAA 3C8DA 4ZJPA 2FH5B 2RIRA 2WIJA 4AS2A 3I4FA 1SN7A 2WVHA 3QMWA 1JL3A 1ZI6A 2ZCUA 3HY6A 2Q0QA 1NVBA 3KVYA 4IJMA 4WI1A 2F9MA 3L49A 4WZAE 3A4MA 1QU3A 3MTBA 2A33A 4X6XA 4E1AA 2H4ZA 1CY8A 4ZOEA 3K92A 5EUBA 2PUAA 1XAIA 4KQHA 1P7CA 1RWQA 2DETA 3IKVA 1IK4A 2PCJA 3WIDA 4ENQA 4CDGA 1Q6ZA 3V48A 1OVGA 2JK1A 2XTMA 3T8YA 2FPRA 4JQZA 4NPHA 2BGGA 3CNNA 1CJKC 2ZYRA 5D7BA 1NL3A 2I99A 1N7GA 3NRJA 3Q41A 2VJDA 1DUVG 3BQNB 3BICA 4C6SA 1JHYA 1CFJA 1L5QA 4WZBA 2HF7A 4KX5A 1ZIYA 2O8BA 2EW2A 5LZ5A 1P0CA 4G56A 1D6NA 3OQIB 1W0JD 2VJBA 4RHCA 4PLZA 3F5QA 1PTJA 1TVEA 4G1VA 4O6VA 1RRMA 2VCEA 5GVRA 3CM0A 4EY5A 1ZHHA 1P9LA 2QRLA 3AILA 2C57A 3LQQA 3IIJA 3ZLTA 1JIJA 4DLPA 3QYFA 4N3CA 2B8EA 4NOKA 2ZB8A 2CK3D 3NH6A 3VR3D 1TLFA 3Q15C 1XVIA 3T1QA 2GESA 2IYOA 4JKYA 4LYAA 1LDEA 2GRUA 3B6EA 2ZR8A 3ND6A 1ZD5A 3FCCA 5FOXA 2OB2A 2Z5GA 4IGEA 4JCCA 3RRNA 1KJJA 1Y7HA 3K20A 4V24A 2XZDA 4ZCLA 3H87A 4KQMA 3BC1A 1CR2A 1DIAA 3C5WP 2ZR7A 3HDHA 4L2IA 1OSNA 2A5DA 4XPIA 1YBFA 4C2BA 5FPSA 4QA9A 2VTDA 3ASYA 3F6EX 4U2KA 2ZREA 1U8UA 1A7UA 2C9OA 3GP5A 4UNPA 5EJ9A 1NWHA 4GR4A 1VPWA 1SOWA 2P0YA 3NEJA 4I5DA 2IY9A 3P4UA 3KP1A 2YVKA 3PXXA 5G0VA 5M29A 4ZCQA 3MTAA 2ZM5A 1V4VA 3WDKA 2ZRMA 2NZYA 1KZGB 3IE1A 1XWIA 4ROTA 1SH7A 3OIGA 2P9GA 5AW4A 1UJMA 3VNQA 4QYIB 5DM1A 3CVVA 5KOYA 1JFFB 3GW8A 3V6LA 5K3SA 1XDZA 4B79A 5FNVA 1UUFA 5HQ3A 1SC6A 1OAAA 3FZYA 2HCFA 3P4YA 4CKCB 4BX8A 3W6OA 1PDWA 2QRMA 3CZAA 4U7TB 3GRCA 1EWYA 1ABFA 1PJ4A 1XZEA 5A06A 1BGWA 1KKUA 4OGWA 2GEUA 4DM4A 3N0WA 1DARA 2L19A 1UBKS 4U2DA 4D9IA 3N5CA 2DYKA 4JLMA 4M4SA 3VPGA 4EPWA 1R66A 1KK2A 2PH1A 5JSZB 3UK2A 1Y5MA 1BXKA 5FLKA 2G88A 2D2EA 1IQ0A 4H08A 1P3DA 2RHBA 3FMIA 4JQOA 4UEJA 4RACA 3RT7A 3ND5A 4RGVA 4HN2A 5L7YA 4H7PA 5LSAA 3CNLA 3RKUA 2BSXA 4PZEA 3M1LA 4KFSA 1RRFA 4F5EA 5IRCD 4XDGA 2WUWE 1CR1A 1ZD3A 4EX6A 1VE5A 3D7NA 5E2AA 5CYOA 3MERA 3CKKA 1TIPA 3O9VA 1NXWA 3LHIA 4NE7A 4OSPA 4PG5A 3RJTA 4QTYA 5G2OA 3UJ6A 1CT9A 3M1AA 4YRDA 3HFJA 4D6YA 3HUEA 4Z99A 1KDOA 3CUUA 4L78A 3QVGB 3NZEA 4J1NA 4MEBA 4TTIA 4RK7A 4ZD6A 4YP6A 3V42A 3HYCA 4UEWA 1TIBA 3FOCA 3ZQUA 2YIVX 2SHKA 2KBEA 5CDFA 1I4LD 2J09A 2H2HA 5CX1A 3Q72A 2GH1A 5FWNA 3RC3A 5IC4A 1CW2B 3FYUA 2FB9A 1YVRA 2O1SA 3OPYI 2VI5A 4AK9A 4PLPA 5H3CA 1ZNXA 2WJHA 4QHSA 3KQYA 3DLAA 5H4HA 4B74A 3ZVMA 2GBGA 4BATA 5EJ4A 1NNEA 5EJIA 5FWYB 1AJEA 5DF1A 1IDN1 5DN6A 4P33A 3LSYA 4ENSA 3WLNA 3G79A 3HEBA 3FCAA 3LKZA 5AI8A 4H35A 4CFSA 4FX5A 4R1OA 5IZ4A 3UHJA 4EO7A 4C4SA 3TR5A 2WFMA 1ZD4A 2Z6VA 421PA 5JHGB 4YO7A 4YJHA 5KU1A 2I2BA 5FP0A 3HRHA 1DAHA 4JB0A 3EGIA 2AHOA 3WP1B 2G5CA 3A7EA 2I62A 1DIHA 2ZBFA 3GVHA 1ZSNA 2WEKA 2DFKB 2N46A 3LYUA 4OQQA 3WKDA 5KSZA 3IV9A 3A7DA 4F86A 1NNUA 3TZLA 2I6SA 3OCWA 4FMDF 1YBHA 3IS3A 1ZEJA 5TR9A 4QQNA 4IOMA 4H7KA 1CY1A 2VSFA 3FUXA 5DHSA 3IALA 2X42A 3EF0A 1Z0JA 1SHZA 2HREA 1CUSA 3H2BA 3NDPA 2ODEA 2X0FA 2X5KO 3EXHB 2PXXA 2VO1A 5JD4A 2C82A 3VR5D 4EYKA 5BURA 1ZC3A 1ENYA 4IKEA 2OCIA 1PFVA 2EYUA 4J43A 4QICA 4TYMA 4BHTA 2W42A 1YCFA 4RZUA 1EXWA 1DC8A 4DOMA 1UBCA 1CC1S 2OV3A 4X8OA 2IDJA 3B2QA 3K0SA 2HDHA 4MV7A 2D0DA 3FDIA 3UO8B 4JI4B 2ZRJA 4UM9B 1QRSA 1BVRA 3LLMA 3SJUA 1EJBA 3AKDA 5G41A 3JQFA 4L5BA 4UVDA 5JD6A 4EENA 2RHCA 4WESB 1VE6A 1SCNE 4R98A 3A3PA 3HVUA 4IQ0A 8AT1A 4S1TA 1D2EA 3WGZA 4CV0A 3O2NA 2NU9B 4BL5A 3R3WA 2DFPA 3RYHA 1ZHOA 3T9CA 3ROZA 4RVUA 4LYEA 1YFKA 4PIVA 1TAHA 1F4LA 3DONA 1DJOA 1M6VA 1GFSA 2F3QA 2C5SA 1NE2A 2ZB2A 1R6BX 3H7AA 5AHRA 5ALLA 4N76A 3IRVA 2B99A 2J9FB 4KQJA 3CNOA 4O3FA 3DV2A 1BH6A 4GEKA 3AG5A 1ZA2A 4MPDA 4PRLA 3TKLA 3HVRA 2XD9A 4XJTA 1N9ZA 1G6KA 2IEGA 2R751 4HXYA 1Z8FA 4PYRA 3EDRA 3D3KA 1DIBA 2ATVA 3WK7A 5IJWA 5DIZA 2HLDD 4W5WA 4Q12A 2ZULA 3KWLA 1JKJA 1B3BA 2AFRA 2P9TA 2QD3A 3DO5A 4MS1A 5GM2A 4UBOA 2VDQB 4GDMA 2ES4A 2J08A 2VIIA 1GN9A 4G65A 4QRHA 2H1OA 4HEQA 2C31A 5GV8A 1LXCA 5T8KA 4UTOA 3RYTC 4HAXA 4BQOA 5HZKA 2XPCA 4Z54A 3M0EA 3R5JA 4YALA 2FPMA 3AKEA 3GV0A 2RONA 3NGLA 4BWVA 5K8JB 1XDSA 2EFHB 5D1HA 4B84A 3OEHA 2O2XA 4EH1A 3CEMA 4ZXFA 4NG5A 3HKEA 1YL6A 4KZKA 5BQFA 2QX6A 3PCXA 5LL6P 3FCUB 3MNFA 3OE7D 1B8NA 1QO9A 5LBTA 3BTSA 2GBCA 2XDQB 1Z5OA 3B13B 4I55F 3EEQA 3QTLA 1VQ1A 2OR3A 1RWOA 1MO5A 2F9LA 4J9UE 1DAMA 1FB5A 1Y81A 2QD4A 3BD9A 4HEHA 4XGRA 2CUTA 4X60A 4OF4A 2KBFA 3ECSA 1JBKA 1YRYE 1GD1O 1ZM3A 3WO1A 3VJRA 4FYVA 1YS6A 2FW9A 5M5BA 3HCNA 3DFUA 3I9V6 1PWZA 4FGUA 1K88A 2IYAA 3ZXUB 1KY5A 5AW0A 2WD7A 4JUIA 2R6DA 2ZBUA 2AIRA 3OURA 3DMHA 4RBNA 1QYRA 2VK8A 3ZY3A 4EY4A 4BB9A 1XNHA 1KGSA 2UXCB 3N76A 5JFOA 1I4TD 1W76A 5B58C 1WTAA 3K5HA 2YWGA 4JBGA 2H48A 2JFNA 5DE3A 1BDIA 1H4SA 2QJRA 3AI1A 4JYBA 5EIXA 1JDTA 5FLYA 4YJKA 2VF8A 4F8EA 1FMTA 2H0AA 3AERA 3KETA 4KV7A 4NJEB 3WNDA 1R4ZA 3QXJA 3L41A 3T61A 1QM5A 1T1SA 3TSAA 3C87A 1SKBA 1AHHA 2G1KA 4JROA 3WGMA 4PYQA 3N2ZB 5LCXA 3ZLVA 4BBPA 4BX9A 1DPGA 4MS1B 5CXUA 4RQAA 4ZOBA 3GFQA 3ROXA 3RS3A 1HQYE 3K1YA 4BQSA 3FOEC 2OGTA 4DR5B 3LDHA 2QW8A 1KBQA 2CWWA 3DS8A 3JQQA 3WWZA 3LX6A 4EHAA 1ZXXA 3LPDA 3ZCPA 1ECBA 3A2LA 1MIHA 4JOSA 2ZJZA 5BQ3A 4FFSA 1AKRA 1JHZA 1I6KA 1QQ7A 2GM5A 1GAEO 1Y4ZA 1W5AA 3H2HA 3BGWA 4OU4A 4A6EA 3VVMA 3U6KA 3CZRA 1UH5A 1UOEA 1KORA 3OTWA 2FZLA 4CMBA 5J2UF 4LWQA 4WBNA 2NPFA 3WNQA 4JVMA 3DTYA 1TGVA 2TMDA 2V45A 3T7IA 3TGWA 2PSFA 3I72A 4RPIA 3PEUA 2Y66A 4M21A 5K3EA 1U3GA 1QFMA 2JCVA 1ZNYA 1SCKA 3H4IA 3W9SA 4LPSA 5BSKA 5DBFA 2X2OA 1PAUA 1PR5A 3F5MA 3GJ6A 1KOLA 2Z09A 2PLFA 3QKWA 2H4XA 5KBYA 3I6YA 2MMGA 1XTKA 4LJ7A 3JTMA 4OQNA 4YAUA 1UK9A 5LIPA 1UKVY 5EQJB 5FA8A 3W5CA 2BCEA 5AI9A 2Y99A 2IZZA 2I2DA 3AKCA 3CONA 3DZJA 1V3VA 1L4YA 1GXSB 1KP3A 2ANCA 3OEED 4JJAA 5CB8A 1CUAA 2ENWA 2IW1A 2Q8NA 3E9NA 2H2AA 4UUOA 3PGJA 3U7JA 3TIGA 4HQNA 3IR7A 4P08A 4Z7NB 4EATA 1K1EA 1JEYA 4GPD1 1OILA 4A8JC 5F78A 1X7ZB 3Q3IA 1XA3A 3BK2A 2CUKA 4HZGA 3ZXXA 7ADHA 2FDCA 1Z9BA 1K5GA 1JMVA 2QTFA 3N05A 4RD3A 4XQ0A 5DRYA 3VNUA 3RSLA 5AUPB 1ZK3A 4L8LA 1OFIA 3EXEB 2J3QA 4HWSA 4DG5A 4TYYA 1B23P 2PKCA 4O2BA 4A10A 4C1BA 1JR3D 1Z47A 1DCKA 1E2DA 4ZAYA 4YT4A 1JKMA 2H2FA 3ROMA 1P4GA 5AVTA 1QRAA 4H6WA 1ZM7A 5DBHX 3T54A 2WWYA 2OHFA 3AUXA 1ZN7A 1O95D 3K6KA 2VSNA 5GJCA 4NXMB 1TX4B 3OPYB 1ZNWA 2QXTA 3K0FB 4QHTA 4S0ZA 1AQNA 1NI4A 4XE5A 1V0JA 2G1UA 1L5FA 1G55A 2J59A 2RSLA 2ESRA 1A71A 1YC5A 1IAQA 1ZXBA 3O2QB 4FMBB 4L0QA 3HKDB 1P6XA 1IJBA 1F4VA 2GT1A 4P7JA 2YV2A 2IH4A 1KVSA 3K9HA 1NBMD 4I4CA 2NXCA 4GZMA 1AKYA 3ZWXA 4EEKA 1UAYA 2CXUA 1EM6A 2WTBA 4UBLA 4L4RA 3WQRA 4N41A 1UF9A 2QN1A 1OBOA 4DC9A 2DPHA 1TF7A 1NHWA 3OCYA 3OSZA 2CEAA 5EUCA 4GX5A 5KJEA 4ZO9A 1ONNA 4ER6A 2QMOA 2XX3A 1OLUA 1Y1KE 4JDPA 5E2IA 2OHOA 4EPVA 2I6GA 1ML3A 5LLSA 2IYXA 4U5XA 3L7IA 2PM8A 3B9QA 4NOLA 3H5RA 2HRRA 5JE8A 3WYNA 4GQBA 4LJ6A 3QX3A 4F21A 2OILA 4W99A 5JNVA 1RW4A 4U8GA 4ZHQA 3GJYA 4NCAA 2OUKA 3GVPA 1VDZA 3A6KA 4DYDA 2B8TA 1YIOA 3U09A 3WQSB 4NWIA 1B00A 3U7FB 4QU0A 2FWPA 1EXVA 3R7FA 1MD9A 3DO8A 3DDSA 1V1MB 3NBZC 3BH7A 2FMFA 3PXAA 1P6QA 2Z08A 3IXLA 5L95A 2VQ3A 2J0QA 3UMGA 2CE2X 4V0RA 3ZD9A 4TYWA 4KAAA 5HMMA 1FFBA 2BHNA 4LXXA 2VS1A 4UFNA 5CP8A 4EQ6B 4FDTA 2O9JA 1DWQA 1Q11A 3AF5A 2IZ5A 3MBIA 3PTLA 4IDEA 2XGSA 4OHFA 1WD5A 1UQTA 2AYYA 1CZRA 1H85A 5CURA 2R8XA 1PWYE 4FGZA 3QK7A 2R60A 4J4HA 2X8AA 2Q21A 4YAFA 2VP9A 4FUTA 2CMGA 5DGHA 1L1FA 1VGQA 3SZLA 1YU9A 4LF9B 1FDWA 3W3AD 4ARUA 4YRGA 4HBZA 1PVDA 1UJNA 2QB5A 2X9NA 4FEEA 4IIUA 5ED0A 3CURA 3ZGNA 3PLRA 5JCJD 1R27A 2IZ0A 4ENVA 3H2SA 4QXQA 2WWRA 3CG0A 3MIZA 4N03A 4NU6A 3BJRA 16PKA 1Q0LA 2PMDA 5BSRA 2AFIB 1V1JA 4YFVA 2HDOA 1G8AA 5HG0A 3BGIA 4Q93A 3DDUA 4XUEA 4Q7MB 2WFLB 4CE6A 4NG4A 1XNQB 3TZ6A 2JGRA 1IN8A 2IHUA 3WNBA 1CIPA 2BN4A 2E87A 1N2HA 4RCZA 3BB1A 5AD1A 2E37A 2BFAA 5EXDA 4MVJD 1JMKC 1QCYA 2C4KA 2QNRA 1MFPA 3UMSA 2X3UA 1W4CA 3FMFA 3LAWA 4UHCA 4BZWA 2VF5X 2IJGX 2IEBA 3QE4A 4N5IX 4BXOB 1A50B 1U2QA 4MDFA 3ZV4A 3TGPA 3LCJA 4NBUA 3UXEA 1JQKA 3G2NA 2F8SA 2NVUA 2V6FA 4L9AA 3S40A 5KX5B 3KJXA 1POWA 1W85B 3MJSA 3HJUA 4MEJA 5KWEA 1NR7A 2QS9A 5D7NA 2FPGA 5AT1A 3GG2A 3MTGA 3S55A 3VDNB 3W8NA 3R9WA 5EJ6A 2XITA 3G17A 1CIVA 1V3QE 4UXIA 2Q7DA 3KXKA 3PSHA 1GFZA 1SAYA 1PRYA 2R7NA 3UKDA 2BM0A 3F6SA 1SEVA 3CX3A 3FPBA 1TM3E 3R44A 2I2FA 4BNUA 3M2PA 2CYBA 1YQQA 3M6XA 1JFRA 5LA6B 3SF8B 1YRHA 3F98A 4PAMA 4W1SA 5SV2A 4B3FX 1RBZA 3ZW9A 3FZQA 4HDRA 4ALMA 1BFDA 2V3CC 4D26A 1WCIA 4FWTA 4ZDWA 3ZBTA 1RCTE 2VLIA 2AOUB 4V2IA 1NVAA 3IBFA 3MZ0A 3KLOA 3THXA 4LISA 4EAQA 1AF7A 4RV9A 4DC0A 2VRBA 1XU9A 3DEYX 1RT9A 4ZXPA 4CKCA 3ASZA 4IIVA 1OFUA 2VHXA 1Y6JA 4J3FA 4AKSA 1A7AA 2Q50A 3DVAB 3H19A 2VBCA 1M8FA 2A58A 4M1YA 4OCZA 1NBIA 5CR9A 3CVYA 3V33A 3LCMA 3ZPXA 4L3WA 3ZQKA 4FW9A 3B9PA 2NQ8A 2PZEA 4B8ZA 1V45E 5HJ2A 2BUBA 2Z3VA 2JFZA 2DH5A 2H31A 5CLGA 4E5DA 5FIUA 3MTDA 2DEUA 5CD9A 2BI7A 1XNJA 3S29A 1OWPA 2YWJA 2Q3LA 2QV0A 4LNAA 4XSHA 3IAHA 4I6JA 1ONPA 2CV1A 2EZ8A 4RH1A 4LK2A 1Z6AA 1SBZA 4W9NC 5DP2A 1HNZB 5A4AA 2PR7A 3BZBA 4MO9A 3MFQA 3NT4A 3OOSA 3UBTA 4TM7A 1ULAA 3ZWVA 3WHLA 1YZHA 3BOSA 3SIRA 3QENA 5EA2A 2CE7A 1GU0A 3AYXB 3P9NA 5DULA 4RF3A 5EWJA 4CUJA 4DLKA 5A0TA 2NYUA 4I8DA 4QTTB 4IO1A 4OBEA 3C74A 2FUCA 2X8JA 2VHUA 4KGZA 1MF7A 1K9SA 1BYUA 2OLEA 5DI9A 3GBPA 1IHXA 2FDXA 2CLMB 2OCAA 4P2BA 1WMEA 1HE5A 2DR3A 3V1TC 2Q3HA 3IP3A 4FILA 5KDDA 1TJYA 3A3YA 4I9FA 4OXXA 4YCAA 3AY3A 3UUWA 4ZYXA 1QG4A 5ITZB 2WUVA 5LA6A 1H8HD 3HXKA 1R88A 2YWEA 1Z0ZA 1A82A 4NYJR 1VKJA 4YQZA 1VPVA 4RS4A 2F1RA 3REQA 3RKRA 4PYJA 3IKLA 3PC6A 4QUGA 5CVJA 4XYLA 2QTWB 3OTHA 3WJ2A 2XIQA 4MX8A 4MRRA 1P39A 2DWPA 3I5AA 3FIUA 3PTZA 3V5NA 3S0JA 3VPHA 3C0KA 3EUWA 4AUKA 1ZUHA 5IDVA 1DNPA 3FCOA 2ECFA 1GQRA 1FNCA 1DUSA 1ZOOA 2JBAB 3BEDA 4C4YA 3R6TA 2J5RA 1BO6A 2VYQA 2FF5A 5EP2A 2FW6A 2COEA 5JLAA 1N5JA 3OZRA 1DAOA 3MRXA 4GGMX 2OV6A 4J7AA 4TS3A 3UJAA 2HT1A 1UIMA 2EEPA 5ARCA 4LK3A 2PA0A 2XHZA 2FU5C 1D1TA 1H2BA 4JELA 1C0PA 3GT3A 5B4TA 5K6TA 1S0UA 3BKXA 1MIOB 4B43A 1W44A 2ILTA 1AS3A 3KAQA 3QKTA 2D1YA 3EPRA 1US8B 4JMPA 1CX9B 1J99A 2IXDA 2IYLD 4J2OA 3LWZA 2YH2A 3V8RA 3RYIA 3A27A 5K3FA 1EWKA 4NDZA 2M9MA 4P35A 2CL6X 3KVNA 4JBIA 4WCVA 4CQJA 1U0GA 4LF6B 2AMYA 1N3IA 2BDTA 1NUSA 3SZRA 3UCFA 3G0OA 3DE0X 3WQQA 3O92A 4EG0A 1UZNA 2ACVA 2B3DA 5D6NA 3BXPA 4XDYA 1Y1QA 1OTHA 4IS2A 1GOTA 3TNLA 1Z7BA 1CF2O 3PD0A 3I83A 1T5BA 1TGYA 1KYQA 1L7OA 2OO5A 3I2JA 1K8YB 4LN1A 4Q21A 3R5SA 4B6EA 3FYDA 4WN9B 1DKNA 3LO5A 3MMXA 1MABB 3BD8A 5H70A 5JH7A 3ST7A 3P9ZA 4LHSA 3KOUA 1CQIB 1ZOPA 2ZJ3A 4XYGA 4G84A 5L45A 3QPBA 4LHVA 2JJ2A 1JEOA 1QIJA 2M98A 3IPLA 3NHZA 3VR4H 2C7RA 2WYOA 4PCVA 1KY2A 3VNAA 1EFRA 3TQTA 3VOSA 2H11A 2I4LA 1GKIA 3FCYA 1N8SA 4TLCA 1B8UA 2PZGA 1Z8DA 2QLJA 3O8BA 1LQ2A 1RHUA 4V3BA 4CT5A 5IABA 4M6WB 1EP1B 4BB6A 5A3JA 2B78A