3WYEA

Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with nad+
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
255
structure length
255
Chain Sequence
KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGIAQIKPLLEVTEEDLKQIYSVNVFSVFFGIQAAVEAFKKEGHGGKIINAASIAAIQGFPILSAYSTTKFAVRGLTQTAARDLAPLGITVNGYCPGIVGTGMWEQIDAELSKINGKPIGENFKEYSSSIALGRPSVPEDVAGLVSFLASPDSDYMTGQSLLIDGGMVFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of chimeric engineered (2S,3S)-butanediol dehydrogenase complexed with NAD+
rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
molecule keywords Diacetyl reductase [(S)-acetoin forming],L-2,3-butanediol de
total genus 103
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.1.1.304: Diacetyl reductase ((S)-acetoin forming).
pdb deposition date 2014-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wyeA00
2AQIA 3E5MA 3ZN2A 3B1JA 3BHJA 4II2A 2EGHA 5TLSA 3HHPA 2HO5A 2JL1A 2CF5A 4GX5A 3PPIA 3HFSA 1T2CA 3WWYA 3I9OA 2WJPA 1ZVMA 4ALKA 1QP8A 4TWRA 4E0BA 3VKVA 2YV1A 3PLNA 2VHYA 1CERA 4D44A 3Q2KA 4JIGA 1I0ZA 2CMDA 4IY1A 3RUIA 2EJWA 1J4AA 1ML3A 2VWQA 3C7CB 3LYLA 4IZIA 1ISHA 4ONEA 4A10A 2V6GA 3RUDA 1HYHA 3EW7A 1UP4A 1ADFA 1X7DA 1NVGA 1O5IA 2GUGA 3D0OA 1HDRA 2X6TA 3NRCA 4K6FA 4XA8A 3ULKA 3TDKA 4RLSA 3CUKA 4UVDA 3JQ9A 3DBLB 1P1FA 2JD2A 1TT5B 3KYBA 2QYSA 3A4VA 2NUAA 1K0UA 1UUFA 3JQ6A 4JX8A 4RDIA 2NADA 4NBTA 1DIHA 3PGXA 1DIRA 2Y1FA 2HAEA 1W0CA 1UDCA 5JDIC 3ZWYA 3VDRA 5BR7A 4IXWA 1I10A 4B7UA 4Z3DA 3PWSA 5BSFA 1NHWA 3C8MA 3RBZA 2G0TA 4HADA 4R3WA 1QG6A 4D0RA 4JLWA 3WG9A 4XR4A 3I9MA 5KVCA 3OEWA 3LT4A 1B16A 4J2HA 3RAJA 3BMOB 2C20A 3DHNA 5JCJA 3VPSA 4D3DA 1P1JA 4D46A 2Y0CA 4NI5A 4NJMA 3UFXA 2EERA 3WSVA 2GR9A 3RCBA 4XRRA 3WGGA 2VYNA 5L7WA 3OICA 3FSRA 1H94A 3LZ6A 2OORA 4J49A 4B3HA 4RV9A 4XX0A 4DYVA 3BMNA 1VJTA 4CMJA 4GGOA 2G82A 4UUOA 1ZH8A 4BGEA 3DMTC 4NDNE 3K92A 4CM5A 3L4BA 1GEGA 3BMNB 2UVDA 3H65A 3B20A 1DO8A 5DOVA 2J3JA 1CDOA 3VC7A 6LDHA 3F46A 1ZCJA 3FF4A 4PLWA 1GR0A 1IYZA 3HWRA 4NPCA 4O63O 4YBZA 1JN0A 4QX6A 4JBHA 2ZTVA 3KM0A 1WMAA 3FNGA 4CMHA 1K5HA 3K5PA 2NU8A 3R0IA 2YQ5A 4WGGA 3DTTA 2R2GA 5EERA 2JHFA 1LRJA 2VRCA 1A9ZA 2B4TO 1D1TA 3MOGA 4A0SA 1EFLA 2X4GA 5IZCA 3O03A 2ET6A 4WCFA 1B26A 2X9GA 2QG4A 2W98A 4B7XA 1SO8A 2C5AA 1OBFO 4J0FA 4E4YA 2GYYA 2VT3A 4FFRA 2HQ1A 1AN9A 1ZIDA 1C1DA 3JD2A 4GVLA 3QVSA 3FN4A 1ADBA 3DZBA 1H2BA 1ISFA 1NQAO 3PFWO 4IDAA 3BYZA 2X7HA 2FR1A 4J4HA 5DCWA 4EITA 4ZQEA 1LLDA 4QEDA 3NJ8A 4JGBA 3ROKA 4XR9A 4W9NC 1D7OA 4AVYA 2CY0A 3PJEA 1NR1A 1JU9A 5IDYA 5AQ1A 3OIDA 4F46A 2F1KA 1EDOA 1Z82A 4W9NA 2O7QA 3VTZA 5FF9A 4D3FA 1DPGA 2VUTA 3OQ1A 1IPEA 3ENNA 1W73A 2X5JO 3UICA 4CM6A 1ZJYA 2WYUA 3UF0A 3KSDO 2IZ0A 1MGOA 1R37A 4R5MA 3E18A 4PCVA 5DF1A 3L9WA 1HYGA 1B14A 2VWHA 1QYCA 3JQDA 4MJLA 4RZIA 4E2XA 2DLDA 3KUXA 2VZ9A 2EP7A 3HB4X 3UVEA 3V1UA 5EESA 3WR5A 4D42A 3L6EA 4E13A 4IJKA 2NVUB 4HNGA 3JQFA 4XKJA 5MDHA 5BNFA 3OETA 4EJ6A 1DFGA 1YQGA 3WYBA 4MO2A 1OC4A 5TJ9A 3LQFA 3FNFA 4YCAA 5JSFA 5ADHA 3KSZO 5K6AA 3EDMA 1B7GO 1RYEA 1H6BA 4Q3AA 2NLOA 3VOSA 5L9AA 2GSDA 3QW2A 4A73A 3AFNA 1N7GA 3BTOA 4RZHA 2PGJA 1WXDA 2P4HX 2X5OA 2XF8A 4QQRA 2YDYA 2ZJ0A 4ZRMA 3DBLA 4PRLA 1U4SA 5AXBA 1DIBA 3ICCA 1ZJZA 4P22A 1UXIA 1HZJA 4GI2A 4CUKA 3PJGA 1Y5MA 4TRMA 4IINA 2JD0A 1NX6A 1CQIA 1T2DA 1Y6JA 3B70A 3DZHA 3OJEA 4DBVO 2PR2A 1GYRA 3PI7A 4BNTA 3H6KA 5DOZA 1YL6A 4IJWA 2Y1CA 4F6CA 4Y9DA 1P1KA 5G0VA 3GR6A 3ROQA 1C0PA 3AOEC 4FDAA 1EVIA 2PKQP 2AE1A 1DXYA 3KEOA 4RVDA 4Y98A 4ZQGA 1GPDG 4BS9A 5MGBA 1EBUA 5ILOA 4DXHA 3GEGA 2FSSA 4GLLA 3UCEA 4OXYA 4MVJE 2DUUA 4BUCA 4EJ0A 3UUWA 2PH3A 3PJFA 2J5QA 2OXIA 1X7GA 4BO1A 1GYPA 5ITWA 1Z75A 5GY7A 5I7SA 1BDBA 2Q46A 4WKGA 4RPGA 1DHRA 1EDZA 3ZU3A 4DTIA 1ONPA 3OP4A 2W2LD 3SC6A 3M1LA 2FMUA 3JQFC 2EW8A 4HP8A 3ONFA 4R01A 3HB5X 4RO0A 5CDUA 1Z74A 4OSOA 1ZEMA 1E7SA 2Z1NA 4WCFC 1LX6A 3VZQA 3BTUA 3IIEA 3DZGA 3X2FA 3ZV4A 1OI7A 2BGKA 1T4BA 1KC3A 5TT0A 1BW9A 3K31A 1UR5A 1T2EA 2X9VA 1K6JA 3S2EA 2D59A 3AJRA 2GGSA 4RJTA 4YAGA 2Q1UA 2W2LA 2B36A 4CMAA 3GNQA 3P5SA 4NFSA 3GQVA 3RBXA 5EL0A 1AHIA 1DSSG 4XZ3A 3WGTA 3JQGA 3JQCA 1Y5RA 5JE8A 4U7WA 3VAZA 1E1LA 4CM4A 1EUZA 5JY6A 1HDGO 1IHYA 3BTVA 3WQQA 1C0LA 3RUEA 2EKLA 3IL2A 3AI2A 3QQPA 3U4HA 3O8QB 3D3WA 1PL6A 4O0LA 3MJSA 3HFGA 4FFLA 4AFNA 1GQYA 2C07A 5IN5A 2LDBA 3W4KA 1WDMA 4HFRA 4R1SA 3KHUA 4L76A 1WWKA 1B8UA 1R0SA 4TMFA 3Q9NA 4AJPA 4R1TA 1AHHA 1TB4A 4IQ8A 4WCFB 3H5NA 3PHGA 1U3UA 2Y99A 2JFGA 4WJZA 3U4DA 3NGLA 3GLQA 2A92A 4CM9D 3ENKA 3H2SA 4YJFA 4JP2A 4KQXA 2QIOA 4CMCA 4OH1A 2PKQO 1I2BA 1WP4A 3GHYA 1LQUA 1DLIA 4JQCA 1AXEA 1QYDA 3GK3A 4MOWA 3A06A 5CHEA 4EEZA 5DT9A 4M49A 1L1FA 1Z73A 2E4AA 4XDZA 1E3EA 4BO4A 4IM7A 4K1LA 5THQA 1WZIA 3AY3A 4OOEA 2Q2VA 3P19A 1PIWA 1MLDA 3BHMA 5DNAA 2C7VA 3LSYA 3UAGA 2EIHA 5I8WA 4BNMA 1SEVA 1ZSYA 4YAEA 4YRBA 4EUFA 3JYPA 3E48A 3ZU2A 1RM3A 1DRUA 2VYND 4DQVA 3GRKA 1GV1A 1ONNA 3ANNA 2CFCA 2X1HA 9LDTA 1NBOA 1O0SA 2AHRA 3JD0A 1ZSVA 3DAGA 3DHYA 4PIVA 3GMSA 1P33A 4JJIA 3ADOA 3I4CA 4R1NA 2R6JA 3CE6A 3HG7A 1DAPA 3D4PA 4ZD6A 1GFSA 4XD2A 1RKXA 3QLJA 4UUNA 5KKAA 1ENOA 4BNJA 4TKMA 4J7XA 3NEPX 3NX4A 1VM6A 4L4XA 1UH5A 2EWMA 4R51A 2ZB4A 2Q2QA 3BXXA 3TL2A 5H83A 3PZRA 5BSEA 3PHLA 1N92A 5KJ6A 5T57A 2Q2WA 2R00A 1QLHA 3EYWA 1YQXA 3UN1A 5A5EA 3VZRA 1KVRA 1UXGA 4YWJA 3H3JA 4DC0A 3JQAA 4E12A 1PX0A 3SC4A 2HCTA 3G1TA 4LGVA 2X0JA 1V6AA 2W2KB 1YDEA 4CR8A 3JD1A 4RORA 4HY3A 3N74A 4MIYA 3SLGA 4WOKA 1ZXLA 3LC2O 4UREA 1R4NA 3AM4A 3GVCA 1FDSA 3TSCA 3NDJA 3RKUA 1HL3A 3FWZA 3PHJA 4I5GA 1NPYA 4IDFA 3JQ8B 5F21A 4ND1A 5L51A 3MJTA 4CQLA 4QSMA 4FOOA 4CR7A 4URFA 3IS3A 5H81A 1LI4A 4IQ0A 1VE9A 2PZLA 3WIDA 4PLVA 5B12A 3HDHA 1IHXA 2P5UA 4CV1A 2POQX 5B37A 4R41A 5JCJD 3ZDFA 1FDVA 3EHEA 3UCFA 4PG8A 4F3YA 3CIFA 5EMHA 2JAHA 3AOEA 1KY4A 3AM5A 3GVPA 4OL9A 1OC2A 2AEMA 4DUPA 3LT0A 3WB9A 2AEJA 4LSWA 1PGOA 5IFLA 1DIAA 1MV8A 3ON5A 2YW9A 3DXFA 3WQRA 2W4QA 2W90A 2Y1OA 3EK2A 1PWZA 1YJ8A 3G17A 4OYRA 3NAQA 1B0AA 3JYLA 2VHXA 3ZWAA 1L7DA 4J7CA 5CDTA 4DIFA 1YXMA 2JKVA 3PK0A 1P45A 3PYXA 1KEUA 3ICPA 1C0KA 4MVJP 4DPLA 4ALIA 1TT5A 2VZ8A 4INAA 4BGVA 1YRLA 1ZO8A 4TSKA 3V1TC 4HFJA 2RHRA 4XJTA 3WMWA 3RASA 3HZZA 3L9XA 3GMDA 3DR3A 4D0SA 2JD1A 3ZHYA 4YYZA 4K6CA 1SNYA 4UEKA 3DB2A 1HYEA 4IBOA 2JCXA 4WLVA 1DJNA 4B79A 2VZ0A 3OJOA 4IDGA 1I30A 5A9TA 2XAAA 5IAAA 1PGPA 5JDCC 3UKOA 4XDYA 2B0JA 5CPBA 4NG5A 1E0DA 1B3BA 1BSVA 4PN3A 3DTYA 1DLJA 1GUYA 4F45A 2VHZA 4DIOA 3QWBA 1DBVO 3KYCB 4PZEA 3S55A 5T8KC 3COSA 3SJUA 4NJOA 3GUCA 1DFHA 1MG0A 3RI3A 1KETA 1KBZA 1VSUA 3K2EA 1ADCA 1P31A 5JMPA 4E5PA 1VKNA 2ZIZA 4WNIA 4FSHA 3PP8A 5ILGA 3ZZNA 3GG9A 4IDCA 1C14A 1IZ9A 4L74A 2YY7A 2FOIA 3M6IA 4TVOA 2HMWA 4KZPA 3UW3A 4LISA 3DOCA 3GN1A 5JLAA 4BNXA 3B6ZA 1QMGA 3VHRA 4YJHB 2O4CA 5DBIA 3JCZA 3C1OA 4B8WA 2AA3A 2TMGA 4XGNA 1EVJA 4B7CA 2IEDA 3PZBA 2Y93A 2WTBA 1NFRA 2HK7A 3E82A 4MVJD 3QWIA 1X1EA 1A72A 4PLCA 3RJ9A 3KETA 3JQAD 5IXYA 4NR0A 1YONA 1P0CA 1HETA 3LT1A 3KYCA 2Q4EA 2ZK7A 3WBFA 2I3AA 3NT4A 4XYMA 3PDUA 9LDBA 2YJZA 3WLFA 4E2ZA 4FC7A 2J3IA 1SB9A 2EXXA 3GG2A 1U8XX 5LDGA 1GCOA 1BW9B 4R9RA 3K30A 1YVEI 4EYEA 1PQUA 3WGIA 3OA0A 1I3MA 4I5FA 3AI3A 1DRWA 1PJ3A 1Z45A 4YAKA 3WGHA 4N7RA 5T8KA 4II3A 2P9CA 1E3WB 3I6QA 4FJ1A 3WLEA 5FEUA 4FQ8A 2QRLA 1ZNQO 2F00A 4YRDA 2GF2A 2FY8A 1KC1A 3QVTA 2B5VA 4OGWA 3EY4A 4B4OA 2ILTA 4BV9A 2W2KA 3F1KA 3BHIA 4Y6RA 1ORRA 1O95A 2CZCA 4EJMA 4C4OA 3CMMA 4OKNA 4H16A 2J6IA 2BKAA 1HDCA 1KVQA 2FHSA 2O50A 4IIUA 5JPIA 3ZWXA 2YHIA 4AJLA 4YT4A 3T7CA 3BMCB 2I66A 5TX7A 5KVVA 4XIYA 3AUSA 1EVYA 1NVTA 3VDQA 1X1TA 2DVMA 5C3MA 1HDXA 4UVIA 2FN7A 4XIJA 2P9GA 2Q50A 4J2OA 4PLTA 2GDZA 3ITDA 5JYDA 1J49A 3U5TA 4MVJH 1ISJA 2H63A 4CM1A 1CRWG 5FYDA 1JKFA 1ISIA 2B69A 4P4GA 4YQYA 4DMMA 3FCOA 1LA2A 2JAPA 4ZVVA 4AJ1A 1Q1NA 4XQCA 4LRSB 1XG5A 2J3KA 1TVEA 3ETDA 4BNKA 3I83A 3U4IA 1CYDA 4GSKA 3GEMA 5CP8A 3M1AA 2EEZA 4GBJA 3WGZA 4FFOA 2IEBA 4YEDA 2PGLA 1U28A 4M89A 3D7LA 1NNUA 1PEDA 1NPDA 1NHGA 3I1JA 2CDCA 3AUTA 3KXDA 4PGFA 4UVHA 4W99A 4WLNA 3TZQA 3ETEA 3VKUA 5HBRA 2VHWA 3FBGA 5JDCA 2PD6A 1SB8A 4WUVA 4QTZA 4IS2A 1DRVA 1MP0A 1BWSA 3ZWMA 4YRAA 5JYEA 5IF3A 1CETA 3JTMA 5CDYA 5A9SA 5JY1A 2UAGA 2FPPA 5A9SB 2EV9A 1F14A 3CPSA 1YWGO 4UUMA 4BMVA 5JC8A 2GN9A 3C85A 2NU6A 4L75A 2ZQZA 4RPHA 5COBA 1Q7GA 3RFTA 4BNNA 4ZICA 4B3IA 2NVUA 1ISMA 4GL4A 1FDTA 3ZWOA 3E03A 5ENVA 1P77A 4AJHA 3IJPA 3R1IA 2IDZA 1NAHA 1F8FA 1PJBA 3DEYX 3LF2A 1U9JA 3QY9A 2BH9A 2PZMA 4RLHA 3UCXA 3HQ4O 2AEFA 2NQ8A 5EPOA 4BO5A 4PLPA 5JO9A 4DRYA 4DC1A 2C7GA 2J5RA 5IXSA 3QHAA 5KCZA 4MIOA 2LDXA 4BKRA 1IY8A 3NT2A 2R00C 4KUEA 2BGLA 3IAHA 3ASVA 4QECA 4RVSA 5CG1A 3EC7A 1IL0A 3KYDA 1HE4A 1BRMA 3S1LA 1MG5A 2A9FA 3FWNA 3QVWA 3RIHA 5HWSA 3HDQA 4IGFA 4XQGA 3O9ZA 3Q9UA 4FIZA 4GX0A 4ND4A 5IN4A 4WCDA 3LLVA 5TC4A 4OXKA 3RROA 3E8XA 2P2SA 1YL7A 1EEHA 3TZHA 5FI5A 1H9AA 4CLHA 1Q7CA 5CG2A 1W4ZA 2D4AA 4G65A 4OM8A 4YA6A 2HDHA 3CINA 4W7IA 5C5IA 1K3TA 4UUPA 3JQ9C 2ZTUA 2BMAA 1QSGA 1ZEJA 1YBMA 3FHLA 1Q2XA 3WMXA 2H1SA 4W6ZA 2I9PA 4U8GA 2NSDA 4ALMA 4BO7A 1JW9B 2O3RA 3KVOA 4WE3A 3NUGA 4I9UA 3V1YA 2DFDA 4LW8A 5CPFA 2WD7B 1RYDA 1ENYA 3G49A 3W8DA 3GFBA 1KVUA 4MKRA 1XU9A 4U0KA 1SPXA 1F17A 4O59O 3Q6IA 4WLUA 2NNLD 5F3RA 4IMRA 4OOFA 3AY7A 1P9LA 1LDYA 2VQ3A 1KYQA 2D1YA 1E3IA 3W6UA 3WGQA 5JAZA 2AMFA 4CR6A 1MX3A 2RIRA 1G6KA 3N7UA 3ZV3A 2HKIA 4H15A 1M6HA 1I8TA 2HRBA 2VUUA 4RVHA 3ZI0A 5A06A 5L4NA 4JJGA 1PS0A 2V6FA 2CD9A 1MXHA 2VYVA 4DLLA 3T7EA 3DDNA 2IODA 4ZQHA 3GUYA 3O4RA 1SZJG 3MWDB 5T64A 3LU1A 2Y67A 4KDFA 2BFPA 1NQ5A 4LMRA 5CAEA 3DAFA 4L9RA 5TRTA 5KTKA 3L6DA 3E1KA 3DAPA 2PWZA 2AG5A 3AM3A 2D8AA 2P4QA 4D41A 4YAJA 4GKVA 4DBZA 4I5DA 1PL7A 1XQ1A 1I3LA 1P74A 1M66A 1WPQA 1YE3A 4AL4A 2CVZA 3OIFA 3ZHBA 1GAEO 3GPIA 3MTJA 3PLRA 1PZGA 2Y1DA 3INTA 1X14A 2Q4BA 2C59A 5HS6A 2PLAA 1PJQA 3RC1A 4HUJA 4E21A 3GGPA 1F06A 2PD4A 4O5OA 5I7VA 4B8ZA 4PG6A 2IZZA 3GF4A 4YJFB 3LC1O 2UUOA 1K2WA 2CDAA 4BO2A 4EEXA 1E5LA 1MXFA 2V7PA 4KWHA 2DTEA 1I36A 4LK3A 5IZ4A 1HE5A 2J3HA 2FR0A 4FCCA 3OQ6A 3K73O 4RPLA 3GH3A 2OBYA 3VZSA 3PDJA 5JFOA 3ST7A 5A1TA 3PWZA 3QP9A 4GH5A 4AJNA 4LSMA 3U4CA 4XB2A 3H4VA 3VPXA 1VL8A 2DBQA 3T4XA 3GZNA 2O2YA 3F4BA 5DCYA 2YFQA 3GVHA 1ZK4A 3OHSX 3Q1LA 4CL3A 3WGYA 3ZWVA 4H7PA 4OQYA 1UAGA 4CM3A 1V9LA 4ZRNA 4FW8A 5B4UA 4X54A 5DP2A 1E7RA 4M54A 4TQGA 4U6QA 4KTTE 1E7YA 3CTMA 4XGKA 3BIOA 1UZNA 3P2YA 4BIIA 3HDJA 4I9HA 1V0JA 3IUPA 1GV0A 5ICMA 1I3KA 5ER9A 2XPCA 2DC1A 2X8LA 5L3ZA 1FDWA 2ZB7A 4MINA 5FI3A 3H5AA 2JFFA 3NTRA 3E9QA 5F5NA 4DVJA 3JYNA 4ID9A 2ZCUA 5CEFA 2DQ4A 4EDFA 2HK8A 3BMQB 4CQMA 5KVSA 2H9IA 1A9YA 1EZ4A 4U0JA 4JBGA 3VTFA 4PG4A 2O23A 3RFXA 2DTXA 4E5NA 4TRNA 1PZFA 2EF1A 4MKZA 2ZYGA 3GY0A 3ROPA 5I7EA 2J5KA 3BZUA 2VN8A 3PHHA 4CLRA 1PGJA 3CEAA 1U2DA 1YL5A 1HKUA 4CM8B 5BSHA 2EJVA 3K8ZA 1QRRA 4BO9A 3U3XA 4J9VA 4HFMA 4PG5A 2EG9A 4ITUA 3TN7A 2Y1EA 1WAMA 1O6ZA 3I9NA 1F0YA 2GD1O 3JQ7B 4AG3A 1D3AA 4PLFA 2Y05A 1HXHA 2PD3A 2YV2A 3IP1A 3DOJA 4Q3DA 2IXAA 2WD7A 3NGXA 2X86A 2VT2A 1E6WA 3PQDA 2RH8A 3P2OA 3U62A 5DULA 4NMHA 1U1IA 2GN8A 4RQTA 2OFPA 4P38A 1OZAA 4FJ0A 1H6CA 1FF9A 2RH4A 5L40A 1XHLA 3IUSA 1BXKA 1EUCA 4DA9A 1X7HA 5I9NA 1VSVA 1J0XO 3GGOA 2ZKLA 4MDHA 3H8VA 5JMWA 5A5FA 1N5DA 2VUSA 2UV8A 4KWIA 4L4RA 3C7DB 4PLHA 5TQVA 4CLRB 3KYDB 4D7AA 4EI2A 4M87A 3TFQA 4NK5A 5K0ZA 3ZHZA 1R66A 3LT2A 1LQTA 1LSJA 2CF6A 3MJ4A 4B4VA 3RFVA 3LF1A 3OFSA 4MVJI 4O1MA 1ZZEA 3JD4A 1DC6A 4IS3A 3F5QA 1V3TA 5EINA 1NFFA 4MVJF 4NBWA 2P5YA 5L4LA 1C1XB 2E48A 1PQPA 1M75A 4J3FA 5JW6A 1WDKA 4J91A 1TXGA 1X15A 2YDXA 3AWDA 4CMIA 1LNQA 3IOYA 1KVTA 1BXZA 3QA9A 2TMDA 3WJAA 3PHIA 1Y9EA 3AW9A 4MVJM 4MKXA 4RF2A 2HK9A 5A4DA 4ZQFA 2PZKA 1YOVA 2CDBA 1E1NA 3NKLA 3NDRA 2FPIA 1QYWA 1UXKA 4P4LA 3U09A 3ANMA 2VWGA 3DBHB 3PYLA 3K9QO 4GAEA 1H6DA 4IJVA 3RVDA 3QE3A 4XYEA 1ISGA 4JBIA 1K89A 4XQ9A 4HXYA 3M2TA 1F12A 4DQUA 1JAYA 1E7MA 3VH3A 2E6UX 4Z3KA 4C7JA 3OQBA 2V6BA 4PZDA 1AUPA 1SOVA 2VWPA 4D45A 2JJYA 4MPDA 4J4TA 5K9ZA 2ZB8A 4IZHA 1WMBA 2DM6A 4M86A 4J4BA 5JDIA 4BNYA 4YJGA 4CQMD 5COQA 4CV3A 1WW8A 1MB4A 3OSUA 1CIVA 1PSDA 1SAYA 3ORFA 1QYVA 4ALJA 3W6ZA 2FRDA 1E3SA 1EQUA 2QZZA 1KEPA 4RPJA 1DDOA 5JC1A 2GN6A 1UAYA 4RVUA 1XU7A 4KDEA 3SEFA 2BRUA 1C1XA 4XYGA 1JVBA 3DFUA 2VOEA 4DPKA 1I2ZA 1NASA 4L73A 1D1SA 1SEPA 4E3ZA 4EGFA 1V3VA 5EN4A 5KKCA 3ZWBA 4HWKA 2ZB3A 3P7MA 4ZJUA 3GZ4A 2B83A 2GZ1A 1GYQA 2W8ZA 1JKJA 3IKVA 2C29D 3K96A 4OJNA 4FS3A 2WM3A 5A03A 4KUHA 4LVCA 1FK8A 4RDHA 4XGIA 4BNZA 2YHIB 4Q3CA 3ZHXA 3AI1A 8LDHA 2VOJA 5EJ2A 2UUPA 2DKNA 1RPNA 2C54A 5G4KA 4S1VA 2V65A 4YXFA 5C7OO 1A71A 5L7TA 3S8MA 4JP3A 1DJQA 4PRKA 1K6XA 5ICSA 3NTOA 1V8BA 2BFOA 3A14A 5G4LA 1KVSA 2VTEA 3ZCXA 1NFQA 3R3JA 1ARZA 1H0KA 2D5AA 1MUUA 4ZGWA 1JQBA 5ENDA 4CLEA 2IXBA 3AU8A 2CNBA 4CUJA 4IGEA 1A7KA 3PIIA 3S2GA 3GPDG 2FPGA 1EBFA 2FZEA 4IDEA 3W4JA 1ENPA 1R0LA 5AXCA 3JQEA 1EMDA 2X5KO 3MJEA 5KVQA 4HBGA 3VH4A 1Y8RB 5U9CA 2JFHA 1RJWA 5EQFA 3FPLA 4GX2A 1JTVA 1XIVA 2CUKA 2X58A 2ZTMA 1LDGA 4HNHA 1N1GA 5CFZA 4B4UA 1XEAA 2WE7A 4ZQBA 1PJTA 4ND3A 3X2EA 3BMCA 1KS9A 1QKIA 3EZYA 3IJRA 4IIVA 4WEOA 5A3VA 1Y9AA 1VJ0A 1JWAB 4DREA 1VL0A 3GDFA 4E5YA 1VPDA 4BGIA 1GADO 3RU9A 2O3JA 1LJ8A 4PLGA 4CM9A 1ENZA 3CSDA 4E33A 5HRUA 4RL6A 3SBOA 3H9JA 1CJCA 4FB5A 4YPOA 2IYPA 5TGDA 5C7LO 2GZ2A 1A7AA 1T24A 1LU9A 2OMEA 1ADGA 3ABIA 4PVDA 1P3DA 2AXQA 1XGKA 4YDRA 4KOAA 3GT0A 3H3FA 1QLJA 3JQGB 1IZ0A 1BXGB 1ZBQA 3A28A 4IXTA 4TKLA 2C82A 1IOLA 2DT5A 3A1NA 5KJ1A 1XWFA 3FR7A 1YO6A 1HDYA 2D2IA 1EUDA 4Z0PA 5LDHA 2DPGA 1HDOA 3KB6A 3IP3A 3ETGA 4DL9A 4JROA 4CLOA 3Q0EA 4LCEA 1ZK3A 2YUTA 3TZ6A 2JHGA 4DLBA 2PGDA 4CMBA 3EVNA 5JS6A 3HADA 4GWGA 1DHTA 4WK6A 2NM0A 5G0UA 1N7HA 1OOEA 1YKFA 1T1SA 1PR3A 2Y1GA 4LVUA 4I08A 2XOXA 3GC6A 1N1EA 4YAIA 5F1PA 3V2UA 1M76A 4N18A 2HJRA 4BMNA 4Z9FA 2FZWA 4QXMA 5IZCC 1HSZA 4D3SA 1BHSA 1HTBA 4QFDA 1K6IA 2DBVO 3KO8A 3HDYA 4N5NA 4BB6A 1DFIA 4GKBA 3OA2A 5TNXA 4BKQA 5JO0A 4IDDA 2Y0EA 5B1YA 4W4TA 3F4LA 5HS4A 1JA9A 1KERA 4Q3NA 2FR8A 4P4NA 2Z1MA 2PZJA 3GNSA 4XJSA 4FFNA 1O9BA 4BNFA 4D43A 1P0FA 3LC7O 3TL3A 1PL8A 3RU7A 5B4VA 4GQAA 4S3MA 1HWYA 1I3NA 1EE9A 3RUHA 1Y7TA 3VH1A 4OSPA 1NWHA 4OQZA 5G4KB 3U49A 2QQ5A 3A9WA 3WGOA 2ZQYA 3FTPA 4LRTB 4E5KA 4WECA 1RWBA 4YTEA 1BTOA 1LRLA 1JAXA 3WTCA 1XR3A 1I5RA 4FPXA 2UDPA 3ZWPA 3ZW9A 3RBVA 2OBNA 3I9KA 1HLDA 3RUAA 3D5TA 4OMUA 1MFZA 1U2GA 1PGQA 3RKRA 3IKTA 2X0RA 1DIGA 4J9UE 4FD3A 1H9BA 1IULA 3HNPA 4K28A 1JKIA 5DDIP 2P91A 2VYVD 4JCOA 3CXRA 1NR7A 1PQWA 3BA1A 4YVFA 3TWOA 1SMKA 2VNAA 3S2FA 4G2NA 3Q2IA 2I99A 4BQRA 3KV3O 1E1MA 3GDGA 5IG2A 1R16A 1SC6A 2DAPA 4BHTA 2JCYA 1H93A 1YGYA 1N9GB 2HUNA 2X9NA 4ZHSA 2I5PO 1PJLA 4IQGA 4YT2A 2Z5LA 4Q3BA 1C1DB 1X0VA 5KJFA 5KNLA 2DPHA 3FR8A 4CMEC 4QFCA 3HN7A 4BO8A 2BF7A 2ZJ1A 2EP5A 3AUAA 4FJ2A 2B35A 3AFMA 3FI9A 3QVXA 4N54A 4RCVA 5L4SA 3OMLA 3D1LA 1DB3A 5L53A 1HRDA 1LDNA 2CVOA 3INRA 1F8GA 2AQHA 2RBEA 2D5CA 3JYOA 1YDWA 2GZ3A 1E92A 1VL6A 3V2HA 4WLFA 5G0WA 2YYYA 3KTDA 4ALNA 4AJIA 4MIEA 4KMSA 4PG7A 4BMSA 5HTOA 3OM9A 3I3OA 3ZWNA 2FSVA 5EIOA 4BKUA 1BGVA 1D8AA 1J6UA 4CM7A 3HN2A 1U3TA 5A04A 4Z9XA 4BNUA 4EUHA 4WOJA 3DQPA 4RVGA 1BMDA 1E3JA 2QZ9A 3D3EA 4R5HA 4CMIB 3D3WB 1EK5A 3DWFA 1Z7EA 3L0DA 3FTNA 3LVFO 4YT5A 5DN9A 3ROMA 1U4OA 1O89A 1DEHA 1FDUA 1G0NA 1PU2A 3EGOA 4HX5A 2WYVA 4IJUA 1GU7A 3VVCA 4E31A 1WVGA 5COAA 5TIIA 4XQEA 3SXPA 1YB1A 2EW2A 4L8VA 1W8DA 3DBHA 4I5EA 5B4TA 1PS8A 4FFPA 1B8VA 4Y67A 2HU2A 3GNTA 3F3SA 2G17A 5ES3A 4A5OA 2EKPA 3WJ7A 4DQXA 4OKIA 1WNTA 3PXXA 1ID1A 1U5AA 3GAFA 4J6FA 5DP1A 2HMVA 5K6AC 4GMFA 4J43A 4ESOA 4JK3A 2P9EA 3IQDB 2A4KA 4CMGA 4IDBA 2V6MA 3ZNPA 4WEQA 4NBRA 1LSSA 2X0NA 3FBTA 3RD5A 4Z6KA 3MCVA 3S2IA 3T4EA 3IDSA 1Y1PA 1NVMB 2E49A 2PA3A 3IC5A 1QR6A 1EE2A 2WWRA 4M55A 3GRPA 3GGGA 3OJFA 4PLYA 2G76A 3B1KA 2I67A 2E82A 5TS3A 1T2FA 1E5QA 4P8RA 4NZ9A 4Z0HO 2Q1SA 3OF2A 3CKYA 3QSGA 3F9IA 5ER6A 3G79A 1IPFA 1BVRA 4FN4A 3BAZA 4Y8VA 1QXSA 4WNCA 1UDAA 5AYVA 4TZKA 3AOGA 3CH6A 3ZNOA 4WPGA 2C0CA 1X0XA 3DO5A 2B4RO 4M8SA 1XSEA 3WIEA 2H6EA 4WASA 7ADHA 4R54A 3ZV5A 3BMQA 2GNAA 1CEQA 3H9EO 4CQMB 1I24A 1PZHA 2G1UA 4G5HA 4KTVE 4MVJA 2QRJA 2Y66A 1PJ4A 4XCVA 4BKOA 5TSDA 1RM4A 1NM5A 1QORA 1UZLA 2EHDA 3DBRA 1KEWA 3JSAA 1U5CA 3GVIA 3G1UA 4K9DA 2B4QA 4YB8A 4B3JA 4E5MA 3RC9A 3Q3CA 4CMKA 1GL3A 1A4IA 3BMOA 4ZN6A 3MOIA 1I01A 2VNSA 1LLQA 3TZCA 3F6YA 5DBFA 4GVXA 3ZNQA 2NTJA 1D4FA 4E30A 5T67A 4LCJA 3WX0A 4MP3A 2DUWA 4AJOA 1EVZA 3NYWA 4AJJA 1Y8RA 2C2YA 1YJQA 3R3SA 4RPKA 6ADHA 3AY6A 4CMEA 1XELA 4AJ2A 1XKQA 1U3WA 5JAQA 2QW8A 1PJ2A 1P1RA 2VHVA 1B3RA 2YFHA 2Z95A 1X13A 4GGPA 1BVUA 1LDMA 3D64A 3STHA 3RQSA 4LMPA 4BO0A 5DZSA 3E9MA 2FWMX 1YOVB 1R12A 1S7CA 3OBBA 4DLAA 2HMTA 3ONDA 1BXGA 1N9GA 5JAMA 2EGGA 5L95A 2O3TA 5A9RA 2OUIA 1YS4A 3C3XA 3WNVA 1E7QA 4N5MA 3EVTA 1PJCA 1NQTA 4BVAA 4BNVA 1GQ2A 1ONOA 4U5QA 3ZH2A 1LDBA 1UP7A 4L4SA 3VPFA 1KOLA 2Y0DA 2GERA 4GWKA 4IPTA 3WNQA 4NQZA 5H82A 2Q99A 2X22A 3EUWA 5C37A 1KIFA 1MC5A 3WOHA 1Q0QA 4DPMA 2A35A 4AJEA 1A5ZA 4FR5A 4CJXA 4Q39A 2E37A 4QUKA 4IUYA 2YV3A 4PFJA 3TRIA 2BI8A 4CQLB 3QRWA 3RWBA 1MFPA 1GD1O 3WBBA 5I9MA 4HKTA 5F1OA 2I3GA 2AQKA 4JJFA 3JQ8A 1ZMTA 4ROSA 1E3LA 3BTSA 4K26A 4XYLA 4RGBA 2HRZA 3FRJA 1YB4A 2O7SA 3QJ5A 3RUFA 4TRJA 3PRJA 1I32A 2ZCVA 3DC2A 1NTOA 2GO1A 3RC2A 2WMDA 4BNWA 1WLYA 4CV0A 1SBYA 1M2WA 1NAIA 5AOVA 5BNIA 4J1SA 2RCYA 2VCYA 4YT8A 3U0BA 3W4IA 5LC1A 2C5EA 3EMKA 2ZTLA 4MVJG 1AGNA 3SLKA 1VC2A 3UXYA 3GAZA 2RAFA 3I52A 4OXNA 5I8ZA 1PWXA 3W1VA 1V3UA 5KOIA 1ZXBA 1DOHA 4NH4A 4YJDA 3F5SA 5GMOA 5T5QA 1QV7A 1E1KA 4JNKA 1E77A 1E7WA 3V2GA 4A2CA 1WZEA 4UVEA 3OJ0A 4C7KA 4JXKA 4UULA 3ZV6A 1E3WA 1XLTA 2WD8A 5KWEA 4BNHA 2OHXA 1Z6ZA 3TQHA 1LDEA 4HFNA 3E6AA 4FGWA 5L7YA 2BGMA 3OJLA 4U6SA 1JDJA 2DBRA 2GASA 2HSDA 3HE3A 4BKPA 4CLDA 4RVFA 1B2LA 1GCUA 1LTHR 3QIVA 3WQSB 4E32A 2Y68A 3VPHA 1RM5A 4D79A 1VJ1A 3D4OA 3HSKA 4FBGA 3ITKA 4R1UA 1E6UA 1JWBB 3DZJA 4PZCA 1HF3A 4PLZA 5T6BA 4NFHA 3D4NA 4QO8A 1QV6A 2NVWA 1GUFA 4BOYA 4J90A 2ZYDA 3QV1A 1R6DA 5HM8A 3PIDA 2NQTA 2X0IA 5L45A 3SX2A 2Q1TA 3D5QA 4QT0A 3RUCA 2XXBA 1ZFNA 3B1FA 1JVSA 2BFAA 1C0IA 3JD3A 2JCVA 3CMCO 1TEHA 3SJ7A 4BO3A 4BV8A 3GZNB 1H5QA 1XYGA 2QYTA 2WDZA 3ADPA 1ZKMA 4Q3EA 4XEHA 2C2XA 3TZKA 4WLEA 1P44A 1IUKA 4DMLA 4ND5A 4ZA2A 2D0IA 2G5CA 2O48X 4RF4A 5EQDA 3I9JA 5IDQA 2GCGA 1GY8A 1GTMA 4RQUA 1LC0A 1VLLA 5JBIA 3IMFA 1E6EA 1H2HA 1UP6A 3PQFA 2OOSA 4TVBA 1G0OA 4J1TA 3WYEA 2PH5A 3WXBA 1CQJA 1ULSA 1YB5A 5CDGA 1FXSA 2XXJA 3KLPX 4H3VA 4OO3A 3W8EA 1LRKA 3C7AA 4NBUA 1LXCA 1HT0A 1N8KA 1LLCA 4FC6A 1LLUA 4CM4B 3TJRA 4MP8A 1NWCA 3ZNNA 4O6VA 4I9NA 4NIMA 1IE3A 3GEDA 1DAOA 3WFIA 2UYYA 1PTJA 4Z0TA 1PS9A 3AK4A 3U9LA 3E5RA 3GA0A 1YBAA 2O3QA 1U8FO 3JQBA 2OP0A 3DBRB 4HV4A 3JYQA 3KSUA 4R4JA 4FOSA 5G0SA 2RHCA 2OP1A 3JQBC 3EZLA 4J1QA 2P68A 5ITVA 2GRAA 3KLMX 5GZ3A 2H5LA 3AUUA 4NJMB 3OIGA 4GPD1 2WEKA 3KBOA 1XQ6A 4EZBA 1U7HA 4CPDA 2HJSA 3DBVO 5FFFA 4R16A 2NU9A 3OH8A 1PR9A 4XWYA 4BNIA 1GUZA 1VI2A 2ZATA 5KJEA 1HE2A 4DWVA 1UXJA 3WS7A 2PY6A 3QWAA 4R69A 1W6UA 4OHUA 5IDWA 3ZU4A 1HDZA 2O3SA 1Q0LA 1TA4A 2I6TA 1ZW1A 3DL2A 4F6LA 4CM8A 5FWNA 3E9NA 3GDOA 4AJKA 1UZMA 2SCUA 4ALLA 3DZFA 1GZ6A 1HSOA 5CEJA 1DC3A 2GPTA 4YQZA 1TT7A 2Q1WA 1BDMA 3MTGA 5DBGA 1JLLA 4TRRA 1T1RA 4TROA 3TF5A 4CLOB 4J16A 1Y8QB 5KIAA 2WSBA 1M67A 1S6YA 4E6PA 3PGJA 2O3UA 4YJHA 1GZ3A 1LBEA 2NU7A 3ZW8A 1B15A 2OO5A 3WTBA 4YACA 1A4UA 1LUAA 3WYCA 3DMYA 1UDBA 3WICA 3K6JA 1GPJA 2BHLA 3RSHA 3V5NA 4NNJA 3UGKA 4YR9A 2HLPA 4BQPA 4M1QA 1XCBA 1EFKA 3KZVA 1ZK1A 5A3JA 1KY5A 4ILKA 2DFVA 4NBVA 1M6WA 1FJHA 3H7AA 4UEOA 4QO7A 2NWQA 5F5LA 4BNGA 1CF2O 1R0KA 1AXGA 1N2SA 5C7IO 4EW6A 2B5WA 2OL4A 4ND2A 1Y8QA 1Q7BA 1ZUD1 2BLLA 1AE1A 4N5LA 1GDHA 3CZRA 4E2WA 4DYDA 4XYBA 1Q0HA 4W82A 4BL5A 4YJGB 4BGUA 4NU6A 3I5MA 2QRKA 4XB1A 3DHEA 3C1TA 1WDLA 2QX7A 3R6DA 3ZWWA 3DFZA 1EK6A 3QWHA 3C1AA 3ASUA 3LLSA 4W7HA 4A7PA 2Q45A 1I2CA 3VPGA 4CODB 2IZ1A 3FPCA 2BFMA 4G81A 4Y6PA 5F1KA 1XA0A 5AXAA 4DGSA 2Q3EA 2HMUA 4JN6B 3VZPA 3PVZA 4IMPA 1QYXA 1H6AA 4Z9YA 3H9UA 2VRBA 5A02A 1VKOA 4ZU3A 3LK7A 1GQQA 3PQEA 2FP4A 1U3VA 3FD8A 5BQFA 2VTDA 4BO6A 2NTVA 3QWFA 3K2BA 3VH2A 2NTNA 4CUZA 3I4FA 2OZPA 1OMOA 4Q9NA 1YQDA 5TT1A 3PYMA 4CLXA 3PEFA 2YQ4A 2BD0A 5CEEA 5I9LA 5GZ1A 1YBVA 2HMSA 2WYWA 3TOXA 3MEQA 3UHAA 4B4WA 4FFMA 5U1PA 1CWUA 4OIMA 3INGA 2YZ7A 2IE0A 2EKQA 1L7EA 3HUDA 1G1AA 3N58A 1P1HA 4R9SA 1NP3A 3G0OA 3GHHA 3MWEB 5A05A 3QVOA 3H2ZA 1SCUA 3OEYA 5CDSA 3GVXA 5G2OA 4CL8A 1UXHA 3F47A 1SOWA 3GN2A 1HE3A 4OAQA 3JV7A 4NHEA 1OFGA 1PJSA 4LN1A 3FNEA 1LSUA 1T26A 3NJ4A 3NV9A 5IJZA 5AVOA 4R68A 3TPCA 3NT5A 3RC7A 3MJCA 2PTGA 2AE2A 5I7FA 2O4UX 3AU9A 5HA5A 3OECA 3V8BA 1HEUA 2GN4A 3KOUA 4GMGA 3ANLA 2WE8A 2CVQA 1TI7A 2DTDA 3DMTA 3LDHA 5U4QA 4UAGA 1UJMA 3DZKA 3TFOA 5BSGA 4Y6SA 4BNLA 1GEEA 4RF5A 5DCUA 5G0TA 2IRWA 4I1IA 4XRGA 3PWKA 1R15A 4AICA 1LEHA 1P1IA 1VRWA 2O2SA 3VVBA 2BELA 1B8PA 2AW5A 2Q49A 3DOOA 3FNHA 3ZGYA 3I6IA 3WWZA 5BNTA 1MA0A 4L0QA 1EQ2A 3PJDA 4NFYA 1C3VA 3JQAB 4KUGA 3NDIA 4KP7A 3WDSA 1V35A 1ZSNA 4I8XA 4GLOA 1BG6A 1NYTA 1ZK0A 1I33A 3L4BC 1T2AA 5LCXA 1PZEA 5JCXA 3ONEA 4WLOA 3W8FA 1NPTO 3DONA 1O94A 2PNFA 2NV6A 2VRCD 3ZU5A 3ZWCA 2AQ8A 8ADHA 1T25A 1A27A 1KEVA 3KEQA 2A94A 3I9LA 4J1NA 5GZ6A 7MDHA 5IDXA 4A27A 3O38A 4EBFA 4J7UA 1T4DA 1TLTA 2IYOA 1ZMOA 4GSLA 2PV7A 2AG8A 4DIBA 3L07A 4NK4A 4A26A 1ULUA 4CV2A 3O26A 3O8QA 4UVGA 3L6OO 2I76A 3UOGA 3GOHA 3RJ5A 3C24A 4PVCA 1LC3A 1R4NB 3H5RA 3L4SO 2J8ZA 3UH1A 5JNLA 1OAAA 2BI7A 3DZIA 4R3NA 1PGNA 2I65A 3WSWA 2PK3A 3HJAA 1Z7BA 3TNLA 1IB6A 2B37A 4TZTA 1YH3A 3GFGA 1NQOA 5THKA 1MC4A 1DC4A 2OGUA 2PFGA 3L77A 2X23A 4FGSA 3MZ0A 4KQWA 1O8CA 3H9GA 5AXDA 2NACA 4MP6A 5JAIA 5JXWA 3MJVA 1DC5A 3JQ7A 1HLPA 3F1LA 5TF4A 2DU8A 3PFFA 1U7TA 1GZ4A 4E2YA 1RM0A 1XDWA 4BB5A 2D3TA 1FMCA 2QHXA 3G3EA 3NTQA 3TOZA 1NXQA 1LSOA 2CSUA 3KRTA 1R4MB 3M2PA 4GX1A 4A03A 2DBZA 3SVTA 4AJ4A 1R4MA 2PKRA 3PTZA 3H9QA 5BT9A 2GLXA 5TJHA 3CZMA 1HZZA 3I23A 1Y81A 2ZYAA 4EUEA 4J0EA 5J23A 4RF3A 1J5PA 2NVBA 3Q11A 4NU5A 1ZK2A 3EAGA 4UEJA 5KJCA 2YHUA 3WFJA
chains in the Genus database with same CATH superfamily
5KPDA 2QTRA 2V03A 2IUTA 2IEZA 3B1JA 3NBMA 1U0FA 1BE1A 2Q0QA 3HHPA 1JDNA 1VBMA 1EWKA 2YN4A 4IVQA 2GEVA 1IN7A 3L8GA 3HFSA 3IP5A 3EXHA 1XNJA 2R47A 1HG0A 3OUTA 2BGWA 1ZP6A 2CJFA 3QYPA 1QZUA 2FAXA 3R6GA 3EVGA 4TWRA 4MV9A 3WLIA 4KR9A 1T6YA 4KO1S 4Z4QA 1FUEA 1X1DA 4KRXA 4JIGA 3KLNA 1I0ZA 1NG1A 5FQOA 2CMDA 3RUIA 2R86A 1IQRA 1T9GS 2BKEA 3C7CB 1JPUA 2WJ3A 3WWPA 2FPGB 1XMOB 4UOQA 3C4JA 4N1AA 4CIDA 1ISHA 1I1NA 3WP0A 5EY5B 5JATA 1R7RA 4V2IA 2V6GA 4QJ4A 2CDRA 4AY6A 2XCTB 4MDEA 5B58C 3I8SA 3DMFA 1X7DA 3P8ZA 4MZXA 5FL7D 1QDUA 3D0OA 1TGYA 2FX3A 1TC2A 1HDRA 3KJQA 1JXOA 2WMOB 2BF4A 3A1SA 3P9ZA 4QGGA 4CKWB 3NRCA 4ZXPA 3WYFA 4XQ0A 5C1BA 4XA8A 2BONA 4WV3A 3E1GA 3TDKA 2HCRA 2DFNA 2JVIA 2ZVJA 3B38A 3E9ZA 4EJ2A 4EO9A 4RLQA 2C0PA 2N1BA 5JBQA 4LY9A 2XCLA 3R3YA 2JD2A 3H2IA 2PVSA 2OV3A 3A4NA 5H4HA 1TT5B 3KYBA 3BRWA 2QYSA 3V7WA 2XH8A 5IARA 5LQSA 1UUFA 5K4GA 1F7VA 3W5BA 4CKBA 2DCMA 1LVHA 4JX8A 4RDIA 1BO6A 4HNSA 3F5FA 3PGXA 3GLFE 1DIRA 3DMRA 2HAEA 1TTTA 3HGTA 3KFVA 2HRQA 2OSBA 3A1FA 3PQ2A 4N6GA 4ZVMA 3CA8A 5KNBH 3T95A 4MQEB 2VTBB 1I10A 4B7UA 4I9GA 2HWUA 4H0FA 3PWSA 5C1OA 2YR0A 4GI7A 2ZJBA 3C8MA 3N75A 2G0TA 4HADA 3SS7X 2ZI4A 1Z5UA 3K1ZA 3WG9A 4MPRA 5KVCA 2PUJA 3FM9A 3OEWA 4KXWA 4V0LA 1KDRA 2R8BA 3N3AC 3RAJA 1ZVVA 1OLXB 3O84A 1U2TA 3DHNA 2I7DA 1BEZA 1GVNB 1Z28A 2EERA 2JHCA 4G0MA 2GR9A 4NJMA 5T4EA 3RCBA 3WSVA 4A2WA 1FNDA 3UOAB 3WB1A 3TKYA 2I9KA 1IRIA 8ABPA 3KJHA 5L7WA 1XTJA 4UPEA 3Q3IA 3OICA 2OBXA 3DA8A 3FSRA 4Q4LA 3LZ6A 2OORA 5JD6A 3OOYA 1B6GA 2AH5A 3LKBA 3KQKA 2B8EA 3CEPB 3QG1A 4F5DA 1P60A 4XX0A 1J99A 2ISQA 3N2NA 4L5YA 3VX3A 2FWAA 2Y0PA 3SDZA 1VJTA 2BFDA 3BFJA 1U8UA 4BTLA 3NHLA 2CUNA 3B1XA 4UUOA 3RSLA 3AI7A 5GM1A 3V8VA 4WTOA 1JDVA 2AG6A 4LDJA 2HWWA 2VPWA 2VG8A 4BY9E 2J3JA 2IY7A 3VC7A 6LDHA 2VPYA 3F46A 3KR1A 3FF4A 3BCHA 1UOQA 1W19A 3HWRA 1JN0A 3GGCA 1T9GR 1T5SA 1Y63A 4QX6A 3WL4A 4FQ7A 4JEUA 3THRA 3BXZA 3D2BA 2N47A 2FDCA 5DN6A 4BZXA 3RJZA 2I7VA 2XWBF 4UMVA 4BJ3A 1QWOA 3L84A 1J06A 4W5QA 2DEUA 1EXWA 3BWVA 2ZTHA 3G2MA 4MR7A 3C6MA 2P6OA 1FPQA 2JHFA 2P6PA 1LRJA 3EFEA 2B4TO 3Q9LA 4OFZA 3UHJA 4FLMA 1X1CA 1MF7A 1NJ8A 1T5HX 4M0KA 4MW4A 4U3JA 1EFLA 4PHTA 2GVZC 5AKZA 3O03A 4HC4A 3NAGA 1N2CE 5J2TF 5JT1A 5JG7A 3ET4A 1BA3A 4OQNA 1W29A 4LVOA 1WRBA 4BNDA 2H2GA 2VT3A 4FFRA 5CM9C 1AN9A 1C1DA 3AHCA 3RPEA 1DE0A 5DHPA 4LXYA 4Q1AA 3QVSA 4H77A 4RJKA 4JJKA 4ZHQA 1FSPA 1ADBA 3DZBA 1AHNA 3F0TA 4P34A 4QAQA 1MZVA 2FPLA 2XNCA 5DCWA 2QGZA 2ATEA 4PX2A 2YVQA 3IBFA 3WKDA 3WLAA 3D8TA 3NJ8A 3WXMA 1NQVA 1VG9B 1YNOA 1L8AA 4ZYWA 4AVYA 1QHXA 2CY0A 4OYLA 2YZGA 4IVPA 3DV0A 1Q50A 4AP5A 1QQBA 3OURA 4R7ZA 1GRCA 2NT4A 4F46A 5TEVA 1IZYA 1EDOA 4ERXA 1Z82A 2ZWPA 2D6FA 3OFNA 4QUGA 4Y30A 1N8SA 5FF9A 2O8VA 3BG5A 3VTZA 4DWWA 1YA6A 1DPGA 4L78A 2PQ6A 1QGED 4B71A 1IPEA 1BROA 1ZC4A 2ZYTX 3AJAA 3ENNA 1SKAA 2X5JO 2PS1A 3ITEA 2WILA 1ZJYA 2FPUA 3UF0A 3OLWA 1OB2A 2IZ0A 1O77A 1YMUA 4QIHA 1CFJA 3E18A 5L6MB 1YDFA 4PCVA 3LVBA 5C9ZA 4UTRA 2ON6A 1KQ3A 1XAGA 2C0QA 5I6DA 3NNNA 4DQ0A 3U80A 1FMTA 3CF0A 1XCMA 5E1MA 1EFAA 3K32A 3UVEA 3G9ZA 7GPBA 3L6EA 3G02A 2WAMA 3CISA 3COPA 4LXGA 2NVUB 4E13A 2RGYA 3MTDA 4YFYA 2QP3A 3OM0A 4GHWA 4HNGA 5AKXA 4CI9A 5JYCA 3LXUX 2C57A 3CW2A 3HP4A 4XKJA 1RQLA 3SXJA 5MDHA 4E5DA 1SIWA 2B6NA 3KPVA 1WEKA 1DBPA 4IO1A 5KAPA 3T8YA 4EJ6A 3P9KA 1XB2A 3TX6A 1KJWA 5J5AA 5TJ9A 3WAJA 3BDIA 1SXHA 3GEEA 2NZ8A 3EF1A 3P9CA 4TTJA 4Q01A 2GHTA 2JGFA 1RU3A 3UA3A 3B2QA 1TFUA 3SZUA 1GIAA 3O94A 4BEJA 2AZTA 1XZBA 1QGDA 4D02A 1H6BA 4J0JA 4LUCA 4MH0R 4O4LB 4Q3AA 5KVAA 1Y4SA 4OQQA 2AFHB 2QYHA 3OOEA 3QW2A 1UK9A 3BTOA 3INYA 3A3YA 3OZUA 1WXDA 1H23A 4HX2A 2YDYA 4ITRC 1XQXA 3TI7A 1AS2A 4CF6A 2A5YB 2I6FA 2C4UA 5JNSA 1NDHA 2H57A 2QL7A 4K8OA 4UPVA 2GRUA 5CRIA 1P4AA 1DIBA 3Q85A 1YT5A 1ZJZA 1HZJA 4DCUA 3AFGA 3EBLA 2I6XA 3GIWA 2KX7A 3OWXA 3PJGA 4Y6GB 2QR3A 4JNCA 8GPBA 2Q27A 3TPZA 10MHA 3PGVA 4OREX 3WWOA 3WLSA 1RZRA 2GF9A 2XMPA 1YZGA 2Y1KA 3OO1A 3R0ZA 4IINA 4Y1RA 1AQJA 4CEHB 2YZKA 2CVPA 3DZHA 3EMBA 3KEMA 1JE0A 3AWIA 3NWJA 2VP3A 2RGWA 3H6KA 5DOZA 1YL6A 1PP4A 2AZMA 3TOCA 1BDHA 3GR6A 1C0PA 5DJ5A 3RVBA 3VV3A 5L3SB 1EVIA 4EMTA 2AE1A 1QYIA 1FFSA 3KEOA 4RVDA 4Y98A 4ZQGA 2QB5A 5KYWA 1G63A 4AXXA 4IV8A 5MGBA 3MFQA 2XUJA 1T8YA 5ILOA 3VU1A 3PQ3A 2PX4A 2R1TA 3GEGA 3NIWA 2HEIA 2WMNB 1AHPA 4KAJA 4MVJE 5DIFA 3VKHA 4EJ0A 1OGJA 3UUWA 2PH3A 3L0OA 4EO4A 4YV0A 3QFSA 3KOYA 2R5NA 3GEHA 3OLQA 2OXIA 2JIQA 5AMXA 5BVHA 3IDFA 2O0MA 3JALA 2WYHA 1JSCA 1YACA 1H4TA 4O25A 2I3ZA 2AFVA 2JFNA 3WB2A 5AVWA 2PFKA 3OP4A 4Z4HA 2FMUA 1SG0A 1YZFA 1GNRA 2ES4A 3RIMA 2PT6A 3HB5X 1FSGA 5CDUA 4AWAA 3ZHVA 2AYYA 2CNKA 1TRHA 2W8BA 2XYPA 2G9NA 3HXMA 2MSEB 1P9RA 5JWHA 4DV7B 3IAXA 1AURA 4LAFA 2HNAA 4YRCA 1VI6A 1EB8A 1AQYA 4C89A 4WCFC 1C30A 1LX6A 4NOJA 2JKYA 4ZODA 1MHPA 2WJIA 4R31A 3CTPA 3X2FA 1OI7A 3B8EA 5CB4A 2BBOA 1Z4JA 3AUXA 5TT0A 2C9DA 3EDOA 2ERCA 4RTLA 1BW9A 4DV4B 1IJFA 2UXDB 4B6JA 5CVEA 2G5TA 4PNHA 4EHJA 3W7AA 4QXQA 4PGHA 3R7WB 3S2EA 2A8YA 3H4IA 4JASB 3TTSA 5FP0A 1QU2A 1G42A 4YAGA 1RBMA 2W2LA 2IK8A 4DJAA 1ZUNA 4U7PB 2B36A 5HRCA 2VXOA 3GNQA 3AESA 3P5SA 1NVFA 3ACDA 4CMAA 1OJ7A 3PFCA 4ESHA 1MDFA 5K3AA 3HCCA 1NIPA 3H0EA 3GLIE 2RAVA 2HA0A 1TC1A 2ONJA 2C4KA 1GPYA 2QR5A 3WGTA 4ASUD 5C46F 5J4LA 4TYNA 3JZFA 3VAZA 4ZIRA 1J9EA 2ECPA 5JEDA 4R8VA 2HOQA 4LYAA 3WQQA 4TPKA 4RXTA 2EU8A 4D1YA 3IL2A 1XJQA 2YMQA 3HB9A 3O8QB 3U4HA 3D3WA 3MJSA 1LV8A 3A3PA 4DIUA 1DX6A 1HEYA 1V5EA 3Q5DA 2V7QA 3Q40A 4JI8B 3ICWA 2G5GX 5AUQA 4LWQA 4RS3A 1R0YA 1B6RA 5AJUA 3P9RA 1Q15A 1SXJC 4C43A 2LDBA 4IJMA 1QBGA 1WDMA 1XZCA 3ZVRA 1B0ZA 4KPEC 2X3UA 4Z86A 3STVA 2A5FA 2HDWA 2QAGA 4TUYA 4AZ3B 1LPOA 3B6KA 1B8UA 1JAHA 1WQ3A 4BNJA 2J59A 3Q9NA 1GRVA 2W71A 1TB4A 2VDPB 4R1TA 1G5HA 1V3QE 2Y99A 4GNKA 2E4ZA 4WJZA 5DCLA 1X2BA 3I76A 1OR8A 3KD3A 3GLQA 3NGLA 5WRFA 2PQ2A 3ES9A 3UAXA 4YJFA 4JP2A 4KQXA 4BQFA 4DMHA 5KB3A 2XXAA 2QIOA 5KUTA 4P2BA 4HH1A 3D8BA 2OLEA 4I3HA 3E22A 1WP4A 4EECA 4PGMA 4YMVA 1Z8HA 1DLIA 1W34A 1SCIA 3FB1A 4IFIA 5CM2Z 3A06A 4EEZA 4B85A 5EUMA 2IITA 2IIVA 4JZYA 1FUKA 4DZTA 5THQA 3AY3A 1N9KA 4LDAA 4ZPXA 2Q2VA 3P19A 4FM9A 2QM0A 3Q0IA 4OQLA 1B1AA 5DNAA 3LSYA 4RLFA 1QVWA 3UAGA 2EIHA 2YCBA 4TV8F 2FTKE 2BE9A 4BNMA 3CH4B 3FWPA 7AT1A 1WX1A 3WE7A 1NBMD 1Q7TA 1WM1A 5J47A 5AT1A 3E48A 3ZU2A 3H8SA 3MINB 4UW9A 4EM6A 2K5UA 4ENVA 2VYND 4A3SA 4EBBA 1NR5A 2ID4A 4KFTA 4XOIA 2LNDA 3ANNA 3UO8B 4BN4A 1XKLA 3B78A 1QTQA 4AKGA 2ATIA 2XRFA 2X6QA 4JZKA 1OI3A 5I4IA 3OOWA 4J94A 1ZSVA 1L5QA 5IEBA 1DXQA 3FHOA 1VECA 4MUAA 4JGGA 5ADVA 3B2NA 4W5OA 1SIBE 4FGUA 5CX1A 3A36A 5B1DA 3S1AB 1W2GA 1BIFA 3UKJA 4EJSA 1KR5A 1TQ4A 2E85A 1IRXA 5HILA 1ZNWA 3RB8A 3FA2A 2PRSA 4EGJA 2O59A 1WTCA 3L4JA 1LWNA 2H16A 2RAPA 1NN3A 3DF7A 3NEPX 4K6KA 4LXIA 4L4XA 2PUEA 1JHRA 5BWNA 1NI5A 4B9EA 1Q20A 2QT9A 3FYUB 2Q2QA 2W7TA 3NCTA 4R51A 4NAVA 5H83A 3PZRA 5HSGA 1WR8A 3E53A 3HR7A 2ZRPA 1FX0B 3W5SA 5T57A 1GTRA 2C88A 2I8CA 2Q2WA 3FLMA 5CXUA 2IU4A 4KLRA 3EYWA 4QJ5A 2XTNA 2A4MA 3DDWA 3UN1A 1JFRA 4HQKA 2D13A 5K5EA 5B53A 1YR1A 1ZOSA 3QG5A 2IFTA 1BKSB 3RIEA 3IQFA 1PX0A 2ZIEA 1QQ6A 3RYHA 5DPMA 3S68A 5SZJA 1YDEA 2I6QA 3QEMB 1IHDA 3OZWA 3F4KA 4LGCA 1ZXLA 5CLHA 3TSCA 1G8KA 2CXQA 2MMGA 1SUIA 1P5ZB 3DSRA 3HA2A 1U0OC 2Z0MA 2WWIA 2MR6A 2ZWIA 3CGGA 1NPYA 3DKPA 3EIHA 4IDFA 4UFNA 3SJZA 2QM8A 4GP6A 2YHBA 4Z1MD 6AT1A 3BE4A 2ZIXA 2JARA 2V8BA 1YKSA 4WFJA 3SMQA 4FOOA 2OCLA 5C1PA 1XVLA 2B3DA 2ZJ6A 3ZCTA 3ANSA 3DOEA 5JWRA 2OAGA 3WL3A 1X7XA 1RI3A 1J2TA 1LI4A 2D2FA 3ELWA 4IQ0A 4FOLA 4PQYA 5DT2A 4Q12A 1H1LA 4DFDA 4PLVA 5KTSA 5M5BA 4LF9B 3SJAA 2QD2A 3DFMA 1JQ3A 2E4YA 5AK0A 1R0RE 1T9BA 4CEJB 5IKMA 4R41A 2NGRA 1RI4A 2OY0A 2OBMA 2WTUA 4Z4EA 1X1RA 1OXTA 3E70C 5HQJA 3EHEA 2LXNA 2WKQA 3CIFA 1KK2A 5EMHA 3VKWA 4DCNA 2YHSA 1BGXT 1FLNA 3GVPA 1KQOA 1D09A 4JQSA 3PNKA 2AEMA 4IIFA 4PONA 4RH1A 3LLCA 1PR5A 3NTXA 3KKEA 4ZVOA 1E9CA 1PGOA 4I6EA 1AO3A 1ZA2A 1YGPA 3WI7A 2G04A 3ON5A 4YCJA 1E1DA 3STTA 1S3GA 2W4QA 3HKCA 2Y1OA 1KZ4A 1Q0PA 3EK2A 1PWZA 1Y8ZA 1QVRA 3BFPA 4OYRA 5EP4A 4M9SA 5EG5A 2JJ2A 2WWTA 4C2BA 3ROXA 2QPTA 1IK6A 3KUDA 3TLAA 5CDTA 3FUUA 3U48A 4GVPA 4L8YA 1FBTA 2V0NA 3DMDA 3ICPA 1C0KA 4MVJP 4R0NA 4DPLA 5K8JB 1RFGE 5DHTA 4U2DA 1MEEA 3LO8A 1CJMA 5IK2D 3LBFA 2Y71A 1CUUA 2VZ8A 5JMOA 4IIJB 4RELA 4BGVA 1YRLA 5JTTA 3RSGA 1ZO8A 5F2NA 1F2TA 4TSKA 1RWMA 3NBAA 4CIAA 2GBFA 5J9FA 3GB9A 1EHYA 4ZT7A 4C0SA 1QS0A 2QTMA 4YLYA 1XK7A 1A95A 2C4MA 2JFPA 4LZPA 3ZHYA 4DNQA 4IILA 1SNYA 4XCXA 4UEKA 1A9QA 1AC5A 2YS6A 2A84A 3R41A 4QEZA 4IBOA 4WLVA 1QHHA 5AJVB 3D2AA 1Z4KA 4IDGA 4ODIA 4U00A 2QK4A 3L7NA 4NE7A 1PGPA 4ZT5A 3STWA 4ZVRA 4F1KA 2P3OA 2B9VA 5EVJA 4MI1A 4JYZA 3BXOA 1BSVA 4GC9A 4PN7A 1AKNA 1KRXA 1PD1A 2OUKA 1EFDN 2VHZA 1AGRA 4PZEA 1SUWA 4NJOA 2FGKA 2G71A 1WXXA 2A33A 2HSZA 4WADA 3RI3A 1IXYA 4I1PA 3OCZA 1MH1A 1VSUA 3CX3A 1QP0A 2V74B 4X1YA 1E9SA 1E79A 2JFUA 3EA0A 1GAJA 3DW3X 5F2OA 2ZIZA 5JMPA 4WNIA 4DCJA 1E2EA 1YVUA 2FPRA 3PP8A 2PSJA 4D8WA 3EFOA 2QMZA 3ZZNA 3PI6A 4Q34A 1VHLA 2I4TA 1GZ5A 1M2OB 2PT7A 2VPXA 4NENA 3H6GA 2FOIA 2HMWA 2Y92A 2XECA 3Q0TA 3UW3A 3DOCA 1O94D 1TUBA 5ELLA 3RDPA 3T7SA 3EZFA 4BNXA 3EFBA 1A9PA 2CLMB 2FZ4A 1RWVA 2R5WA 4YJHB 4MR8A 5FL7A 3C1OA 2AA3A 1MX9A 3EH1A 3P2MA 4EJFA 5H70A 2PVPA 5BUQA 1EPUA 4NCKA 2IZ5A 2Y93A 2WTBA 3E82A 4MVJD 421PA 1USIA 3ED5A 4Y0VA 2P7IA 5DM4A 4CF3A 3GLFB 2G8NA 3UJDA 4CFSA 3EZ9A 4Z7QB 3NHYA 3WAKA 3W90A 5JR3A 4MRNA 1DZ3A 1YONA 2COEA 5B3JA 1HETA 1KGSA 2HREA 2YINC 1Z0SA 1QFYA 3GW8A 3IHTA 1EGQA 2ZS8A 3D6AA 1QE3A 3PDUA 5BY2A 1SB9A 1JE1A 5E4JA 2P35A 3Q3JB 4DBLE 3LBHA 3MWGA 3OD5A 4H7DA 3G5MA 4EVRA 2QVGA 4EYEA 3WGIA 2VSOA 3KZCA 3AI3A 2FZLA 1ZONA 2P2LA 4C7MA 4QM7A 1MHTA 2R1VB 1FW6A 2P9CA 1E3WB 3EG9B 4K1XA 3WLEA 2E89A 5FEUA 4FQ8A 5CVVA 1GAXA 2QRLA 1ZNQO 3UGQA 3N7AA 1JDUA 2X2OA 4QGFA 1EB9A 1YS2X 4M46A 1EFCA 2MU1A 2FY8A 3GROA 1NY6A 5DGCA 5AJZA 1DPFA 6Q21A 3BK7A 1GXSA 3E8SA 2VYFA 4B4OA 4AS2A 4WY2A 3EOAI 3F1KA 4RDXA 4IVRA 2VT6A 2PU5A 1O95A 1FP7A 5D00A 3OY2A 5C8YB 1XNGA 3N5KA 4L6CA 4C4OA 3CMMA 4H16A 4HWOA 1HDCA 2FHSA 2YZNA 1Z68A 2YHIA 4PSKA 2HA3A 3CLUD 3BMCB 2A0XA 3E81A 2I66A 1MIHA 3TJZA 4US2R 5KVVA 5B57C 3AUSA 4IXNA 2GCIA 4X6UA 4B2IA 4HT3B 1XTBA 4DSZA 1CKEA 1GKKA 1ULTA 3WYGA 1LK5A 2VBGA 5BOVA 5HUQA 4O4IF 2FN7A 1IQUA 1SK8A 1N1DA 1NUUA 2KSQA 2NXCA 3IR5A 1U1GA 3AZOA 4PLTA 4Y18A 3TR5A 1I6KA 1J49A 1XKXA 4HDMB 2D5IA 2OHGA 4Q9KA 5FYDA 3VR5H 4QBHA 1ISIA 4P4GA 4H1HA 3SC2A 1NXWA 4G0YA 5K6RA 4WNAA 4IUDS 3WKCA 4ZVVA 1UT5A 2CXSA 2P40A 4F04A 5CFQA 3PEWA 5LBUA 4OY3A 4XQCA 3S70A 2ZXUA 1V1JA 1XG5A 3HI4A 2R0QC 2J3KA 2CE2X 4NESA 4B6GA 1ORDA 4AQ7A 1C9KA 3SR3A 4KXNA 3CZ5A 3JWPA 3RFFA 5I7HA 5AOBA 5ADWA 2ID7A 3I5UA 4GBJA 3KPYA 4QBIA 4GPAA 3TUIC 1D6NA 5BWMA 3WGZA 2YNMA 5IT4A 2ZCJA 3FCCA 3G2IA 1VSQA 4KE8A 3LNTA 4RSHA 3QVLA 1VMEA 2VJAA 4FYIA 3EZXA 2I1QA 4PGFA 1PEDA 5AHWA 3AUYA 4XGRA 4WLNA 2C95A 4L4UA 4D57A 3RVJA 3KDPA 4F3TA 2HX1A 2VHCA 5EA2A 2BE7A 4WDQA 2I78A 2VEOA 3NB0A 3ZDYB 4OMDA 4QTZA 4IS2A 4AXBA 5DMXA 1UIMA 1O3YA 5IEJA 3GJ0A 4BE4A 5CDYA 2FPPB 5JY1A 4DOMA 1RYMA 2DMRA 3C6QA 4TXLA 3CPSA 3QBTA 5DISB 3JZDA 2GN9A 2HCFA 3IX7A 2H9YA 2VDMB 2NU6A 4L75A 4QYTA 2X6RA 1JEYA 4ZICA 2WG2A 3UMVA 2NVUA 4S04A 4ZJZA 1KS2A 2WWVD 3BZBA 1FDTA 1AQLA 5A5VA 3E03A 2VDLB 5ENVA 4AJHA 5F7JA 1X1AA 1SC4A 1EGAA 2IDZA 1PJBA 1SXIA 4ZTUB 2C7QA 1M33A 1U9JA 1VMAA 1WW3A 1YS6A 1P2SA 4EZEA 2WTAA 5M3BA 4AZ3A 1XAJA 1E20A 5EPOA 1LH0A 3GWGA 4C20A 4E2YA 1TF5A 4NE2A 2C7GA 4PHCA 3TEJA 5CCXA 1GPUA 4H27A 2XE4A 2LDXA 1XJWA 1IY8A 1UFRA 4JB0A 3NT2A 2HHLA 3RWMB 4E14A 2ZZNA 3EGIA 5HIJA 1KFJB 2R00C 1CQZA 2NZXA 1P72A 4KUEA 3ASVA 4QECA 4RVSA 3BX1A 5K45A 1IL0A 2OQIA 2WTMA 4CF7A 3S1LA 1MG5A 3OZXA 3FWNA 2QVBA 3QVWA 4LFBB 1F2UA 2BP7B 2ADOA 1RPZA 3HACA 4V0MA 2W2XA 2JIPA 4UE3S 1Z4OA 4P6VF 4GX0A 4UEWA 3L7IA 1V5FA 5ALLA 5IN4A 5KNDA 1QNLA 3OX1A 3FDXA 3Q5EA 3QF4A 4OXKA 3WGKA 1VE5A 2G36A 1IZZA 1AT1A 1H9AA 2CBXA 2XD9A 3Q7IA 1S01A 3F90A 5FUBA 5AICA 1W4ZA 2FU5C 2ZRMA 5I3CA 1TK9A 3NHSA 4MQEA 2GHQA 4H2DA 4HZUA 3JQ9C 2ZTUA 2BMAA 1QSGA 1ZEJA 2XJ4A 3FLBA 2C3PA 1N0WA 4YCMA 4EI8A 5KOHB 1L4EA 2C3OA 5JZ9A 2OA0A 3PA8A 3KVOA 3V1YA 4G24A 4ZO7A 4I9UA 5CVDA 3C5VA 4EY7A 2VCEA 1N7IA 5GIOE 1PV2A 3MGAA 4MIKA 4Y2UA 5MFZA 2Q6OA 3GQBB 4BN5A 1K0FA 1ZMXA 2Q2OA 3O93A 4R84A 4Q7LA 1YZNA 3GFBA 4C5BA 2HADA 2GBLC 1Z0AA 4UKDA 4U0KA 1SPXA 2W9XA 3GP8A 1SQ6A 1MEOA 2GEDA 3F8TA 1KPIA 4FFBA 5CIWA 4OHCA 3FOZA 2NNLD 4IMRA 1CY8A 1E63A 1KKLA 2D4HA 1PEKE 3DFIA 3EMDA 1Y7IA 3DOUA 1EFPB 2IPAB 1MX3A 1ND5A 2M6KA 3ZV3A 1UMKA 3WMGA 4CR6A 4D9GA 1GUAA 4DSUA 3NDBB 1XI2A 2WOJA 1M6HA 1U0HC 2BFFB 2HRBA 3AHHA 3FXAA 3NHMA 3S40A 2ODWA 5A06A 5HEKA 5AVQA 5JZSA 4X1IA 3R9XB 4RJIA 2V6FA 4ENUA 1MXHA 4TYYA 1JG6A 5DHQA 3TXXA 2JFZA 3V4SA 1DKPA 5ES4B 2IODA 5KQGA 2QSUA 1TQ8A 1A76A 1OWLA 1YA8A 3MFYA 5LA6B 1NQ5A 2EJBA 5CAEA 4L16A 2QJRA 5TRTA 1LW6E 2YV4A 3IAM6 3L6DA 5KTKA 1J1ZA 2XB6A 1U7ZA 1U7XA 3GGDA 4RPIA 1XZIA 1WHSB 4CZ2A 3F97A 4I14A 2O54A 2XMQA 2ZJ4A 4S1OA 3ISTA 4YAJA 2DR2A 1UBTS 1XQ1A 3ESCA 1FDOA 1M66A 1WPQA 1OIWA 2CVZA 3DVSX 1EFHA 2ZRCA 2H8KA 3PR2B 1GAEO 4LZNA 3AB7A 4JELA 5GIPE 1KI8A 2IVZA 3GPIA 3HGQA 2IV3A 2G3YA 1X14A 3I34X 2IUYA 1YBFA 5FTWA 3N6RA 5CD1A 3BB4A 1M6YA 4KO3S 1PJQA 4JEMA 4LJKA 2XNJA 4D9JA 4FB4A 2WWGA 1C4KA 5KAMA 2D2EA 4BUZA 1IY9A 3OUZA 2BEKA 4H6VA 3K15A 4HWPA 2UUOA 4OUKX 4TWIA 3ORHA 4YJFB 2PMEA 4BO2A 1QZ3A 2HDNB 3U56A 2XGOA 2V7PA 4AWBA 5IZ4A 2FUG1 3N86A 1SKYB 3K73O 5I45A 4FKBA 5TXGA 3VR4A 4C01A 3RK4A 2FJPA 3VZSA 3PC8C 1SUDA 1LVGA 1CUBA 3ABRB 2ZRAA 4PWYA 2NZYA 2W2MA 4QOSA 4CBVA 2Y8EA 3QV2A 3U4CA 4XLLA 3VPXA 4B6PA 5AVZA 2K4MA 4C4RA 1G2OA 1YDHA 2WWWA 3MGGA 2DUMA 1KJ9A 2F7SA 4RQBA 3TVDA 2GCPA 1ZK4A 1F5SA 2DKOA 3KEFA 1HO3A 4NCXA 3WGYA 4EHNA 3DOFA 1N5RA 4H7PA 4MJ7A 1MW9X 1DO0A 1HOXA 1RZUA 2BISA 2QVYX 2RC6A 1D6SA 3H84A 1CJSA 1ECBA 1W1WA 1ZN8A 4HNAA 4KIGA 4TQGA 1ZM9A 4KTTE 3L5KA 1E7YA 3CTMA 4S2EA 1M54A 4XGKA 3FWYA 4Z4CA 1M74A 2C31A 1Z6GA 5HX7A 3P2YA 5AIBA 4Z4IA 2ORVA 3IDQA 4I9HA 5DTJA 4B6EA 4D8UA 2ZYUX 3QOFA 1GV0A 2PGNA 4E7PA 4XE5A 2X0DA 5FWXB 1POWA 3QENA 2DC1A 2X8LA 4I55F 1FNMA 5L3ZA 4NV0A 1KQFA 2DF8A 1WMFA 2ZB7A 5FI3A 2PZGA 2VJYA 4BEVA 2QTCA 2JFFA 4BLUA 4DSAA 2NV0A 4RGYA 1J33A 3KZKA 5F5NA 4ID9A 2ENWA 2ZCUA 4EX6A 1E4OA 3LP6A 5BN3B 2DQ4A 1Z6QA 2PMDA 5EHZA 2HK8A 3NPMA 4Q7QA 3FKJA 4CW7A 4BBPA 4QUJA 3SHOA 4H9GA 4QKQA 4U0JA 2C5FA 3MM4A 4L95C 4RIIA 5I4KA 1JLHA 4DR6B 1B1CA 4HDKA 4J07A 5L3RA 4TRNA 1PZFA 2VF7A 3RFXA 3GY0A 5I7EA 1VLHA 2FCRA 3L7AA 1AKWA 1J8QA 1Q2UA 5FD8A 2P9BA 2VN8A 3PHHA 2R84A 1TMGE 2CLHB 3QPWA 4ENTA 4YCNA 4CGZA 2GFHA 1RIFA 1TZCA 1YL5A 2WFMA 4CM8B 3K8ZA 3LFTA 4GPIB 2QG9A 5HGXA 1J1IA 3FTFA 3CX4A 4HFMA 2HLNA 4M6WA 5LZ2A 1EHIA 2Y1EA 1ZVKA 3QEMA 3EPLA 1F0YA 1ZS9A 3JQ7B 3A6JA 4IWYA 2Y05A 5K3BA 1AVTA 1KK1A 3R5KA 4MRSA 1XTVA 4DMUB 2WD7A 3RODA 1UIRA 3ZQKA 5IAKA 3OLXA 1QTRA 5ENZA 1E6WA 3PQDA 2RH8A 3P2OA 3Q88A 3THXA 4JA2A 1E1QD 1Z5PA 2RKBA 5EFZA 3I32A 4Q4JB 2KBEA 4RQTA 4AMZA 1II9A 1TW2A 1RC8A 1EQAA 2DQKA 3CKMA 4MVYA 4Y0NA 4FJ0A 3T7TA 3JRXA 2HJVA 3REGA 3PFGA 4MUIA 3VYVA 5FBQB 1H22A 2RH4A 2EZ4A 5EXEA 2BFWA 3FYUA 4HWGA 5IBRA 1XHLA 2VHJA 4Q16A 3U3KA 2W37A 4OQFA 1T4CA 4BBJA 3PNBA 2OGSA 2EFJA 2ZVQX 2AV6A 2VJOA 1MT3A 3EIEA 4DWOA 4ER7A 4JU8A 1EM8B 4NONA 5JMWA 4JBLA 1N5DA 2F43A 2J31A 3HRHA 4KE6A 5LR6A 2ZBDA 2WTEA 1E9RA 2UV8A 3I12A 3DM9B 3EGXB 4G5XA 3T7KA 4M87A 4IXMA 1JSZA 4TV9B 4EI2A 1J2UA 2O0KA 2TS1A 3VO8A 1REQA 4JFAA 1LQTA 4P7FA 1ODKA 3OPNA 1JTFA 3NAMA 3LO5A 2P1DA 3OO0A 4X66B 4ZVNA 4MVJI 4O1MA 1ZZEA 1ZIYA 3JD4A 4EPRA 1SU4A 2EDCA 2WR8A 4X7MA 3F5QA 2IS1A 2GXSA 3UBTA 3RVKA 4MX8A 5DYTA 2B82A 2GVNA 3KSRA 5AVUA 4EPWA 4TV8A 3W04A 2I8AA 1TEZA 3AVQA 1ILWA 1C9MA 2VHQA 2WAYA 2WKWA 1XL0A 4KE7A 1TXGA 1QX3A 5E1BA 5C5EA 4CMIA 4GOMD 4LTMA 4IW3B 4WMLA 1SGWA 5CNMA 4IRXA 5K2MA 1TVMA 5EKSA 1WOMA 1Y9EA 1G6HA 5JV5A 4W5RA 3L18A 4F1WA 2HK9A 2J3MA 3LL7A 2JGNA 1YOVA 1R6AA 3NKLA 3E3OA 3MTBA 4WXYB 5KWIA 3RUPA 3U09A 2B0CA 1U31A 5I7OA 4LYJA 4DMRA 2VWGA 5I9BA 5FUQA 2CNWA 3K9QO 1E2IA 1H6DA 4GAEA 2ORED 1R64A 3RVDA 4F5EA 1WSAA 1UQRA 3GELA 5F51A 1K89A 3BHNA 3KE8A 4DG9A 2Q0SA 3VPCA 1I5OA 2IVFA 1F12A 4H17A 3N5CA 1E1RA 1E1YA 1SCAA 2ADMA 3LFHA 1HR0B 3OQBA 4E22A 1L9XA 1QGZA 3DOHA 1SOVA 3LDUA 5E9WA 1L4NA 4X97A 1CJKC 4A1OA 4D45A 2J46A 2Z8YA 3BK2A 4J4TA 2R1VA 4UMFA 4IZHA 4YIKA 1RYBA 2DM6A 1D6MA 2CBGA 3LAWA 4JLMA 4YJGA 3RW9A 3GPLA 4CV3A 5LXTB 1WW8A 3OSUA 1HQKA 4MW9A 1PSDA 4HGPA 5BV8A 5AVVA 3ORFA 1ZAKA 2QP9X 2GZSA 1F48A 4JOCA 2QZZA 1WE2A 4RPJA 5FWDA 3ECCA 4XPIA 1M2GA 4M0PA 3KU1A 1OWMA 2FRDC 4GICA 3FOEC 3FDZB 4R7GA 1Z83A 2DWOA 3HEAA 3NHUA 4OHZA 1FTGA 4KDEA 4NZMA 3SEFA 3L82B 1C1XA 2K2WA 2QJWA 4IQFA 5GJWC 2WNSA 4QOEA 4QU0A 2EZUA 3V1LA 2C96A 3RRNA 4L73A 1LVUA 1D1SA 5K0NA 3MMPA 1OH5A 1WW2A 2P2GA 4I99A 1H8ED 1G66A 4LJYA 3AXTA 3TQSA 4EGFA 5IASA 2H08A 3RVQA 2JGKA 1C4XA 4IIYA 2XEDA 2RG1A 1SHJA 3K96A 1TEXA 3LQQA 1VG1A 2GFQA 3EIFA 4Z49A 1FK8A 4ZCTA 4RDHA 5BYBA 1QQ7A 2XADA 3AI1A 2HBYA 4P58A 2F43B 5CB8A 3FAZA 5E7MA 2QLTA 1RPNA 2C1XA 2RGUA 3LYAA 4XJVA 5G4KA 3TTYA 5ALSA 5AP9A 2V65A 3UT5A 1GWNA 5CBKA 4KV9A 2ZBPA 3DFFA 8OHMA 3R3UA 5MFPA 2HQSA 4JP3A 1KR2A 3DTVD 4PRKA 5E95A 1K6XA 3V4OA 1EVQA 3GDWA 2QMYA 3N3BC 2BFEB 3NTOA 2CVHA 4MLZA 5FOQA 5K09A 2CWDA 1Y6FA 1DP4A 2Z8XA 1EVEA 3QELB 3M5CA 3A32A 4H1VA 3O92A 3F9RA 3SMVA 7REQB 1RKUA 2F2TA 1ITZA 3CNHA 3R3JA 2C2OA 2L69A 3LRPA 1ZR4A 2VP0A 4TTTS 2VP6A 1SUSA 3USES 3OQNA 3B48A 1KP9A 4HDAA 4AKIA 3RE1A 5EIBD 3OUUA 4B83A 3HDVA 2QVLA 4OUDB 1NRWA 5H59A 1LBIA 1U0JA 3NOXA 4FBMA 3ZHOA 3A37A 5LOVB 4IDEA 5DMHA 4P3XA 1Z6PA 3TSAA 2WHRA 1CZHA 5B6PA 1GDDA 2GCOA 3IOBA 2DSTA 4NYJR 5KVQA 3WK8A 2UVQA 2Z98A 2JFHA 5U9CA 5FLEX 5EQFA 3FPLA 4PHGA 1PFGA 2CUKA 4YJ2F 3WY9A 1UC5B 2XVYA 4P32A 4HNHA 3DL7A 4MCJA 2RHLA 3UFBA 3GLSA 3P0IA 1ULAA 4LY3A 4PX9A 1OPXA 1QQ5A 2TECE 3AILA 1MX5A 5DHUA 5EIAA 5F9FA 3UA4A 3BMCA 3EZYA 1QKIA 2RI0A 3QVUA 1UMBA 1TMYA 2YBDA 4IIVA 4K2HA 1VJ0A 3HKDB 1UBOS 1VPDA 4MHOA 1GADO 1FYWA 1RCUA 3HJHA 2E0IA 2NT3A 4PLGA 3P97A 1QX4A 2PN1A 3N8IA 4QPZA 1KI7A 4E33A 4A36A 2QAIA 1E66A 3IVCA 4RMIA 3H9JA 4UMDA 5ICSA 1YQQA 2CW5A 2QTAA 4HS4A 4BKMA 1OT3A 4U02A 1YZKA 4YPOA 3E9YA 3IYLW 3LHKA 5ALIA 4EKYA 4WFQA 1T24A 2OBLA 3HCNA 1ADGA 4PVDA 2GFIA 1P3DA 2AXQA 1XGKA 2DYKA 1SIUA 3MUNA 4Z3OA 4KJXA 1U1FA 4KOAA 3H3FA 4AURA 5DLQC 1IZ0A 1ZBQA 4RD1A 2IELA 5JYBA 2C82A 3R44A 3MS4A 3ZJYA 2WF5A 1AG9A 2XWSA 1MENA 5KJ1A 1UFOA 1IOZA 1F1BA 5FT9A 3O4FA 1HDYA 4U7FA 3HC7A 2DPGA 1KHHA 4OQMA 4FYMA 3ETGA 3PR3A 1D4ZA 2ANBA 4CTNA 4G4GA 1QFZA 4JROA 2OC9A 1KDYA 4LCEA 2BEWA 4TYWA 1THTA 5IVKA 2JHGA 1W5TA 2XQKA 2D7DA 4RKWA 3CLRC 4NSNA 4U7DA 4G1EB 2QROA 1PWEA 3SHTA 1XX6A 2BFFA 4I36A 4KX3A 5F2EA 2ZZMA 3RHSA 5H4GA 2OAP1 2GBIA 2R4TA 4WK6A 1B2RA 4DGQA 5G0UA 3ZLVA 2ZJAA 1H2YA 3L6CA 4KMOA 3R0QA 5KYVA 2KI5A 4UCQA 1FFYA 4CG3A 4ZDJA 3PFHA 1PD0A 4JJEA 1EINA 2DJIA 2G63A 5CFMA 2Q5JA 5FOWA 2R2AA 4GP9A 5F1PA 1RSZA 5JNUA 2FZWA 4BJ6A 4KJZA 3MQFA 4D3SA 3WKEA 3OJCA 2QY9A 2WVJA 3KO8A 5AVJA 4IOLA 3ECAA 4MYRA 9ATCA 1EGVB 2JIMA 1VTKA 2I6SA 4HZUB 2YVKA 5B1YA 2Y0EA 3IMEA 3S81A 2GK3A 5EXSA 3F4LA 4QNMA 5HS4A 1JA9A 1KERA 3RTGA 4QE3A 4F9GA 4FFNA 1XEXA 3LC7O 1XD2A 1SQFA 3KCQA 4LTDA 1HWYA 1I3NA 1GG5A 4AM8A 4OSPA 3U49A 1N34B 3LVQE 2QQ5A 4M3NA 5JQGF 4E5KA 5FV4A 13PKA 1PUJA 4LRTB 2OKCA 4FZ3A 1RWBA 2JEZA 4WECA 1RE1A 4C4YA 4NU0A 5LU9A 1GSHA 1LRLA 2AC2A 4IIHA 1K8RA 1U2QA 4IFBA 4Z7JA 1I5RA 4FPXA 2P3SA 3GZTB 1PUIA 1RXWA 4TTQA 3IDZA 4EMUA 2OBNA 3I9KA 1HLDA 4Q3KA 4ETNA 3RKRA 1U2GA 3A9UA 4D99A 1A5BB 5K1ZA 1H8HA 5J5CA