3WYGA

Crystal structure of xpo1p-pki-gsp1p-gtp complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
VPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
pubmed doi rcsb
molecule keywords Gsp1p
molecule tags Gtp-binding protein/gtp-binding protein inhibitor
source organism Saccharomyces cerevisiae awri796
total genus 51
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wygA00
1J8YF 2OFWA 4R71A 2E87A 3T12A 4LJAA 1NN3A 1BMFA 4NKRA 5KSPA 1Y63A 3A37A 2IT1A 4Q18A 4DSNA 1E98A 4UNSA 4O0MA 3NHAA 3PQCA 1KYIA 3LVQE 2IEYA 5ANRB 1YKSA 1Q0UA 2WJIA 2ZI4A 5CYPA 2O52A 3EARA 3VR4A 1KSFX 3CRW1 4JBXA 2P3SA 4M4SA 5D3QA 1U8AA 1LTQA 2AFHE 3O8BA 4B43A 1KJWA 4H1UA 1RRCA 2PZGA 5F2EA 4Q7KA 1VG8A 1YRAA 3K9LA 2IC5A 3TBKA 4XSGA 2IF0A 2ZYTX 3KJGA 3H2YA 3QF7A 4LYAA 5DI3B 1NJGA 5CB8A 4I1VA 2IS2A 3AVOA 4MKGA 4G01B 1TQDA 1X8LA 4YC7A 3TRFA 4P0TA 1XD8A 3P26A 721PA 1CR2A 3WBJA 4ZCMA 2AHOA 3LY5A 1DAKA 2VQSA 4D4KA 3CIOA 3RABA 4QBFA 1X3SA 3KXIA 5IK2A 1QG4A 1E9RA 5FBVB 3HWSA 4ARZA 4Z54A 1BIFA 3Q85A 4B2PA 1GFIA 1XJ0A 2IYUA 2OG2A 4G5QA 3KQUA 4LCBA 2O8EB 2HDNB 3A1TA 5EZ6B 4FMCF 1U8ZA 4EPWA 5F9FA 3TQCA 2G77B 3FDIA 1X1SA 1R7RA 3THYB 4GFDA 1KHTA 3U44A 1KNQA 1E1QD 1I2DA 2YC4C 3F5FA 4CW7A 3BS4A 4LPKA 3AVWA 1SXJB 2GCOB 1H8HD 1ZU5A 4TMTA 2BIFA 4MDFA 1MO4A 3B1XA 2ZRIA 3BB1A 1QHGA 3GLGB 2ZR9A 1N2CE 1COWA 2ATXA 2QQEA 3U7GA 3TSZA 2ZSEA 4DT1B 2VHTA 5LD2C 4U02A 4B3CA 4A15A 1XBTA 3SHFA 2ZR0A 4OK6A 4R9UC 2ZE7A 3GP8A 1YR9A 2FEOA 2QPOA 3O8RA 5HR5A 1Z5ZA 4AG5A 2QP9X 2C9YA 1XDBA 3B13B 3SQXA 2FZLA 2ORVA 4Q4AB 5E7JA 1VCIA 1DAEA 1KK1A 3F3YA 3TSOA 1QHIA 2RGAA 3K0EA 4OQNA 4NHOA 3KX2A 4DWJA 3TUIC 1FZQA 1U8YA 2ZRLA 1MKYA 1XX6A 2V3CC 3FTQA 4MQBA 1U9IC 3SBDA 2AKAB 3BB4A 1DAMA 3THXB 1VYTA 2BMJA 1ZCBA 4XVUA 4V0ME 4KLZA 1U98A 2ZRPA 2WZQA 2R44A 4NCHA 2O8FB 5FUVA 2QG6A 1OPXA 1D9XA 3GJ3A 3JZMA 4JL6A 2QROA 4MRNA 1AN0A 3DKVA 1PLKA 2D06A 4QC2A 2XAUA 2JJ2D 2MSCB 3LO5A 1WF3A 4Q19A 2C2HA 1DAFA 1G21E 1G4UR 1G5PA 4JBYA 2QGNA 3DPUA 1NVVR 2ZAMA 2ZRAA 2X2EA 4W5JA 1VHTA 2KJQA 3VX4A 3TVDA 4TLEA 1ZW6A 3KUCA 5L3RA 2IHYA 2F1RA 2F9LA 2Z83A 2W0MA 4RZ2A 3SI7A 3SYLA 2ZRBA 2WWIA 4PC3A 1KI1A 4AKHA 1US8B 4RZUA 1MT0A 1T4GA 3QKUA 3GLFA 5DN6D 3GEEA 3GLHB 1Z47A 4DLSA 4Q02A 3A1VA 3CF2A 1R4AA 1P4SA 1AM4D 4M2LA 3C5HA 4PANA 4TTRA 1CULC 1AZTA 2PX3A 3DKPA 3KQHA 3KKOA 2B7BA 1FTNA 2G1KA 4KFSA 5C4MA 1YJ5A 1G9XA 1N5JA 3FFBA 4YXWD 1JEEA 2C98A 1CKEA 1GNRA 1HT2E 2J0UA 1NRJB 4ITRC 4XWKA 4C2TA 1Z06A 2R8RA 3QBVA 1RKBA 1TU4A 1M34E 4YDHB 3VR6A 2ZM5A 4B71A 2XZPA 3V9PA 5G53C 4MYHA 3O47A 1E0JA 1VMAA 3RC3A 3GLIB 2PX0A 1D2EA 1FPMA 2PLRA 4A0HA 4JLDA 4DBLC 4MH0R 3QY0A 5HCIA 3R7WB 1MH1A 1OFUX 1UKZA 4P31A 1GIAA 1XXHE 2QNRA 1XCMA 4LBWA 2QQ0A 1E9AA 4OQLA 3UMFA 5HKKA 2GK7A 3BD9A 1Q57A 4Q4JB 3B6EA 1QF9A 4DLYA 3EPKA 4ZIRB 2Z5FA 4DXAA 1G4AE 5GVRA 3RRYA 4MYUA 1G291 3X2SA 4QBHA 4XD7D 2GBLC 4IDPA 4LYJA 4PC7A 2PH1A 3LA6A 1N25A 1OJLA 1G17A 1U0LA 1NLFA 3K09C 2LKCA 2UZ3A 3KKPA 2WAYA 2NOAA 8OHMA 5JS7A 4PAOA 5LDDC 1IN4A 5CDFA 3L8ZA 2DFKB 1QZXA 2WWFA 2H7VA 4LBZA 2NIPA 4A8JB 3K70B 4QFMA 4C0KA 3P27A 1E9DA 3Q8XB 1R5BA 2ZJOA 1TF5A 3NBXX 4YLGA 4B44A 3ZVMA 4C7OA 2ZI9A 4JYCA 4IEIA 1XPRA 1KJZA 4B3GA 4V0KA 1UF9A 1G3RA 3B5JA 3UWOA 4O2LA 4TSFA 5AJXA 4URXR 1WXQA 1KI3A 1PLLA 4HZUA 5K8IA 3V00A 1OXSC 1NVVQ 1BOFA 3K1JA 2A78A 1UBGA 2V8OA 2IYLD 1JXMA 2OO7A 3SQWA 2WWXA 1KK3A 3AVPA 3PUYA 4B74A 1U0HC 1KKLA 1RJ9B 2IX3A 4PFSA 1SQ5A 1EX7A 1WA5A 1HV8A 2QMEA 2JAQA 3VQTA 1CJVC 1YZQA 1XD9A 4N1AA 3KQLA 3LDAA 3GEIA 1DBSA 1Z0JA 4WA7A 3ZD6A 1UKVY 2C96A 2IBMA 1Q3HA 1Z6XA 1GNPA 1KI7A 5BQ5A 4GNKA 3EIQA 2YNMA 4XWAA 4ILEA 2OFOA 3HR8A 2C5LA 2N1BA 2V9PA 3KTAA 5H68A 2VBCA 4IXMA 4BFWA 4V0MA 2VLIA 3K53A 2DYKA 1P75A 3N2IA 3KKQA 1T3SA 3GFTA 4JLBA 4V02A 1X8KA 1JJVA 2FX3A 1W4RA 4AI6A 3I5YA 5KSZA 2BM1A 4XTCS 1N5KA 2WSMA 2Z0MA 3AKYA 4TLAA 2NO9A 3B1YA 3GFPA 3WHLA 1KI9A 1S1MA 3W5IA 5GJWC 5SZJA 3WMFA 2RGCA 3NIBA 4FXPA 5AUOB 4ZKEA 1TEXA 1DTSA 1Z0IA 2CL7X 2D2FA 3BH7A 2UVQA 3AVXA 2WKPA 1E94E 1R0YA 3T15A 4BLSA 1IONA 5F9HA 1XCGB 1U2RA 3KKMA 4DSOA 3FKSA 4A2WA 2AD5A 2RB4A 1VCMA 4A92A 4F4CA 4RFSB 1KI8A 3VKWA 1KI4A 4CT4B 4K8OA 5FR2A 5J4YA 1XXHB 4A0GA 1E9SA 1G20E 2CK3D 4HI0E 1PUIA 1CXZA 2JDIA 1RYHA 1P2SA 3E2IA 3OEEA 4NMMA 5E4FA 3VU9A 2PMKA 2BM0A 1SHZA 1W44A 2FV8A 1S3SA 1KO1A 1SVIA 4U7DA 4D26A 2OESA 2O8DA 5C46F 3WNCA 4EPVA 1Z0KA 4DLUA 5TARA 1JR6A 3PVSA 3QIAA 4X8MA 5KPJA 5JLJA 1JPNA 1NF3A 2CL6X 2H17A 2REBA 5TVKA 1JECA 5G3ZA 1S96A 2V1UA 3G5UA 4QNMA 1DAIA 4PHFA 4OHWA 4PQRA 5E95A 2ZRKA 3D7MA 5JCZA 1ZIPA 1GITA 1GRQA 1JR3E 1CR4A 2G0NA 3CRRA 5HZKA 4PZZA 3QVVA 2VIIA 1QDEA 4A9AA 1FP6A 1ZIOA 2NPFA 2XITA 3ZS9A 1B23P 2ODNA 3ECCA 3PITA 4JLVA 4AG6A 2YJTD 3OE7A 4EFMA 3LBNA 4KO8A 1LY1A 3TR0A 1R5OA 4O3MA 1KO5A 1N6KA 3OIWA 5KHOC 3G0HA 3LV8A 1G7RA 2GDJA 4URYR 2OLKA 4BFUA 4UNRA 1MRSA 4GMDA 3HU2A 1JXOA 2HT6A 3FGNA 4HAWA 2VH5R 4WZBE 1N0VC 1T3HA 2NZ8A 3W3AA 3EZ9A 1OE0A 4RZXA 3PG5A 1KY2A 2FSHA 4TTPA 3U5ZB 4UNPA 3AVUA 4DLXA 4ZDWA 1OH8A 1Z6YA 2QSZA 2HF8A 4C0SA 3VR3A 5CLQA 3KL4A 3FMFA 2CHQA 1YZKA 3VR5A 3U3RA 5DISB 3H4MA 1VIYA 3T1VA 5B57C 2VHQA 3CNNA 3H84A 1BYIA 3AF1A 2FJUA 1OH6A 3FHCB 2H8KA 4URUR 5FOSA 3RS2A 3OFND 1W47A 2PJZA 1VHLA 3AB3A 2AXNA 2IYRA 3I32A 4RKFA 4Q9JA 3HR7A 2WTUA 3PUXA 4I4LA 1NBME 1W0JD 4LYFA 1JPJA 1F5NA 3K0FB 2OCAA 4F38A 2VRWA 1GG2A 4LPSA 2QUZA 2FDCA 4DJTA 2RGNA 4DVGA 2LWIA 1JAIA 2V7QD 2MSEB 1SVMA 2IA5A 3AKCA 1Z6AA 1UPTA 2O0JA 2P6NA 4M1MA 2ECKA 4HSEA 4GP7A 3PENA 4B6EA 3KQNA 1BH2A 4PZYA 5EXSA 5FL7D 5BN4A 4EAQA 1GNQA 1UKYA 2BEJA 2ZRFA 4W5WA 5H8WA 5M04A 4RKEA 1D2NA 4L16A 4OHYA 2GESA 5JWHA 4LY6A 5EJEA 3MGCA 1I4TD 2PL3A 4D4MA 3THWB 3IBYA 4JVNA 5A5GA 3A1WA 2C8VA 5HPYB 4HLCA 5CJ2A 1E9CA 4TQ9A 3RS4A 4X8HA 3AVTA 1U90A 1T8UA 2QZ4A 2BCGY 1UBCA 1MABB 3K0CC 5GJCA 1Z3IX 4YONB 3IHLA 2ZJAA 4M9XA 1G8PA 1II8B 2OILA 2C9OA 4BZPA 1TMKA 3B8HA 5JRJA 4RJLA 2GNOA 4TZ6A 1W0KA 3LBHA 5FOWA 2E9SA 4IVRA 3ZQJA 4YMWA 2ZS7A 3KFXA 4DIEA 4HAVA 2D74A 1E69A 1TL7C 1JAHA 3LAWA 3QPVA 2HV8A 1HQCA 4US1R 5L3SA 3VNUA 3SYKA 2ZS9A 3CX8A 2FPLA 4EJSA 3PV0A 3CRQA 2CJWA 3W8NA 4LJ4A 1E2LA 1NIPA 4NCIA 2PJRA 2IYZA 4URWR 2EFEB 2WMNB 3EPJA 1JNYA 4DIDA 3NHBA 5DYIA 4CT5A 1Z63A 4ZI2A 4HUTA 2PLFA 2AL7A 4OI2A 1MRNA 1SVWA 2GXQA 5FI1B 2F9MA 4XJXA 4Q47A 1RC8A 1SULA 1P2VA 2WIAA 3AKEA 3A8TA 4JKYA 2X77A 4PSKA 1JR3A 1E0KA 2RGEA 1G3IA 5EXTA 1G5TA 4V03A 1KMHB 1FFHA 2ATVA 5TB5A 4ZCIA 1OT3A 2FEMA 2XGJA 4CEIA 1NMXA 1N0UA 2ODBA 3IGFA 3ICQB 1DG3A 1FOEB 3IIJA 1GSIA 2ZE8A 3G82C 4NONA 2RHMA 4Q9HA 4D81A 4DCVA 1HA3A 2PEZA 1E96A 5BN5A 4MKIA 3CX6A 2A5JA 4IDHA 5JRZA 2XB2A 4LWZA 5FOUA 3RS5A 3SJZA 2LKDA 3ADBA 3AF0A 3ONWA 2W6ID 2WSSA 2MMCA 1EFRD 2YWEA 2OUKA 3M1IA 4Z8XA 4ZKDA 5KTYA 4Q4HB 1AJEA 4KV9A 4WZ6A 4OI4A 2H92A 4PX9A 3WMEA 2GILA 1Q1ZA 3DM5A 5KYKA 1R0WA 5J4LA 4TYQA 4IOJA 4UJ3A 1P9WA 4ESHA 2J0SA 2L0XA 1NJFA 1ZAKA 2QENA 4EQ6A 1NBMA 5J47A 3A4MA 4XTRA 5GJBA 2ZVPX 2EFDB 1ZM2A 2WJVA 2ZYVX 5B58C 3BH0A 4KXFB 1CJUC 2EFCB 2JEOA 2XSZA 3FFAA 4LHWA 2G6BA 4LHXA 3A58B 2CBZA 4DCTA 3RANA 2EU8A 2QE7D 4A36A 5JCPA 3RWOA 1YU9A 1EK0A 1NG9A 3TK1A 4CEHB 5JJIA 2ZITA 3ZQ6A 4R98A 4LJ5A 4Q1BA 1LS1A 3TNFA 1IHUA 2WPDD 3TIFA 4O2RA 3RSOA 3LX5A 3W34A 3AP2A 4C0QC 4JSYA 4LV8B 2P6RA 4TN1A 5KOYA 5FUYA 2JATA 1K5GA 2QAGA 5JSZB 1CJMA 1KO7A 4V0NA 3PFIA 1KOFA 4M1YA 1UAAA 1G6HA 1UBEA 2IYSA 3KFVA 1YHNA 1Q3TA 3EZ7A 2Q21A 4M21A 1DADA 3B2EA 5DLQC 3VHXA 5JI3E 1P73A 1T91A 2IWHA 4P4SB 5A4JA 4RZ3A 2FSGA 5D3MB 4TMVA 4US0R 1ZUNB 4X8OA 4Y0VA 5G3YA 4C0AC 1NMYA 1TADA 3UK6A 4XSHA 2RGDA 4L9SA 4BZQA 2V55B 3KJEA 4KYUA 3VTKA 2R65A 1G3MA 3FMOB 3DHWC 4L5BA 3CR7A 4YMVA 5B2ZA 3QKSB 2VP4A 2FH5B 1XTSA 4EPYA 4LC0A 2AD1A 2G1JA 2HCJB 2GZDA 2NG1A 4DZZA 2MSDB 5L8VA 4L8GA 1Z2AA 4IDNA 3AKDA 4FCWA 1GVNB 1E1QA 3MD0A 2DCUA 2ZREA 3QE0A 4MDEA 1F2UB 2X2FA 2IS1A 3A36A 4GI7A 1K5DA 4MKHA 1ZU4A 4B34A 1A82A 2Z4SA 3NBZC 4GRAA 2B8WA 1P2TA 1OFTA 5F98A 3EPLA 4QG7A 1NSFA 2OZEA 4DCSA 1TAGA 4AY2A 1TQ2A 2OCBA 3Q5EA 3AF2A 3RRNA 1P5ZB 1E1RA 1EWRA 3RS3A 1E9FA 1EFTA 1QHSA 2REOA 3LX8A 4NTZA 1KIMA 3IDQA 2PT7A 4V0OA 3PEVA 1GAJA 5HE9A 2EYQA 1JJ7A 1IY1A 4NCJA 4Q7LA 1F2TA 3SS8A 2PT5A 3WNDA 4FMDF 2Q0HA 5G41A 1DO2A 1N6NA 2XNDA 3SZRA 1TF2A 1QRAA 3T1QA 3W9YA 4I1UA 2BEKA 5EP1A 3TSWA 2NGRA 4GZLA 4N3NA 3GLHE 3RRZA 3L0SA 4M53A 3AP1A 1T0HB 3TLXA 4DDTA 3B60A 1L7VC 4EPXA 1CTQA 2CE2X 2WAXA 2ZUBA 4FCTA 1DPFA 4JIMA 4MITA 3R9IA 1R10A 1VIAA 4QKQA 1H8ED 3QEOA 4F4IA 3BBPA 4FWTA 3LLMA 4A1FA 4HYYA 4WXRA 5L3VA 1G7TA 5EE0A 4S2EA 1G7SA 4Q1CA 2IL1A 2HLDD 1N0WA 3FHTA 4BFSA 5IDVA 2EWWA 1N6PA 2JJ1A 2Z4RA 2ZI6A 2CHGA 1J7KA 3GLIE 2XZOA 4ZPXA 3T5GA 4HAXA 1QVAA 1XEXB 2XJ4A 5DI3A 4ZDJA 421PA 2J7PD 3EA5A 3ADCA 2QSYA 3FOZA 1XMSA 3CWQA 2AK3A 2IYQA 2ZRGA 4M9SA 4QHYA 1P72A 5LBIA 1ZM3A 2P6UA 5G40A 2KI5A 3T5DA 2DWQA 2QMOA 2WWYA 3C7KA 3GQBA 3I72A 3OAAD 1NI3A 3CPEA 5TV2A 4GL2A 1AQUA 4ZV4A 1X1RA 1GL6A 2J9RA 4RD3A 2WIBA 3L0PA 4IKEA 4TMKA 1KSGA 3TJZA 1OYYA 4J0QA 4IRUB 4IFBA 1E2HA 1KI6B 2O8EA 1YZUA 5TDHA 2XNSA 3VX3A 5CM8B 4HAUA 4IOKA 4DLZA 1IXZA 4PO8A 4MGKR 2G3YA 1SXJA 2GCOA 2ZRNA 3K9NA 1Q12A 3TUJC 1E79D 5KPDA 4BFTA 3U3KA 3EPHA 3GLGA 1XRJA 4BQSA 3V4RA 1OHHD 3D31A 4E5UA 2GRJA 1JQLB 2BOVA 4DT1A 3FHOA 2OSBA 4C3ZA 2P5SA 5FH9A 3VNVA 4PC2A 4Q1FA 2WJYA 1XCPA 2J59A 2C95A 4HB4A 4TLDA 1ZMXA 4GDFA 4G5OA 3T06B 5E7IA 2F1IA 1G64A 4Q4AA 3SJCA 4C0HA 4A2QA 2YWGA 3A6PC 3UPUA 1SKYB 4FMDB 5TXGA 2QPTA 3ZH9B 2EQBA 3AF3A 1QHHA 1VPLA 3QSYA 2E1RA 4PQFA 4KLNA 2J3EA 4TLBA 3TVTA 4RVCA 1BYUA 1TU3A 3THXA 3TGPA 4MRSA 1E99A 3QXJA 2CCJA 3U6BA 4FN5A 2VHCA 3K0AB 4PSAA 4AYTA 5GVSA 1LFDB 2WKQA 3PUZA 2ZROA 2GVDC 3VR1A 4QGFA 2C9CA 2WWHA 5FPTA 2O8FA 4DRZA 5DI9A 3CO5A 3Q9LA 3EZ6A 1ZVQA 3NDBB 4M8NE 1ESMA 3ADDA 4QL3A 3NKVA 521PA 1IXRC 3BH6A 1UBFA 1YR6A 2ZJ2A 1GKYA 5IK2D 5K8LA 2CVFA 2JA1A 3KKNA 1XPOA 1YZNA 3FWYA 3QENA 3QNUA 4A2PA 2OT3B 1XMVA 5KDOA 4CGZA 3IPXA 3ETLA 3U7EB 1TQ4A 3ZVLA 5J4VA 3WYGA 1WDTA 621PA 5IF9A 5CLLA 3I1FA 3L43A 3GFOA 1US8A 1T6NA 1R0ZA 5DH9A 4JLMA 5JFGA 4AYXA 3FMPB 4I1OA 4MUBA 1OYWA 4AK9A 4LSGA 4H1VA 4IW3B 1E2EA 3EIHA 4CEJB 3GLHA 4KBFA 4YMSA 1E2IA 1RW4A 1YR7A 3B78A 1TNDA 3NEJA 1ZD1A 3MSXA 3U3MA 1PV4A 3SEAA 3EC2A 2QTVB 4ZCLA 4C9BA 3L82B 4EPRA 2EWVA 4EJSC 4LJ6A 1JBKA 2GJAA 3JVVA 3SN6A 3UG7A 4ACBA 3AH8A 1KO4A 2DR3A 2WJHA 4H9GA 3MWKA 3U7FB 1KAGA 2F3RA 3SJAA 2ERXA 3VHLB 3LXRA 3ZLJA 2PBRA 1KNXA 1J2JA 1CU1A 4L9WA 2F3TA 2ZE5A 4LGMA 1KO8A 4UXJA 3T1OA 1R8SA 2QORA 4CIDA 3MLEA 5ELXA 3AVQA 2D2EA 4TL7A 3CWZA 3U2QA 4QXAA 4LHVA 2AXPA 4GBMA 4RD1A 3GLIA 1OKKD 3R7WA 2ZSAA 3T34A 2PMDA 4LBYA 3CONA 5FUWA 4BLRA 4DUGA 4M1OA 2IUTA 1OIWA 2HYIC 4QGAA 1W46A 2JIZA 1V43A 4Q4JA 3RRMA 1D9ZA 3SJBA 2V4ZA 3I62A 4LJ7A 4ZIRA 5IT5A 3ZIAA 4C2UA 1LF0A 2VF7A 4TMZA 4NCNA 4ASUA 2GCNA 4HUQB 3QKRB 1TX4B 2EFHB 1E4YA 2D3WA 2ZIAA 4JS0A 2ZRMA 3W8RA 2QT0A 2CK3A 1FMJA 4DCUA 4LZZA 3O8CA 2O8CB 4LHZA 2KB0A 4OL0A 5BYKA 1CRPA 1UDWA 3GMTA 1SKQA 4A8JA 4D0LB 4EIWA 1YE8A 1RZ3A 2ASEA 4ZDIA 4XWOA 2QBYB 1CR1A 1E2FA 3HDTA 2JASA 1P61B 3HYRA 4JVSB 4TYWA 2GKSA 2DB3A 1QG2A 3X1WA 3U6KA 3LH5A 2PEYA 4B6FA 3TR5A 2YKGA 3B1WA 1KDOA 1EXMA 1ANKA 1ODFA 1KK2A 1H65A 1OSNA 3CW2A 4FD2A 3U61B 1RJ9A 4BZXA 2XXAB 4PHTA 3FE2A 2FGJA 3DL0A 1W1WA 4DSUA 1L4YA 3WRXC 2FN4A 1K6MA 1LV7A 1T8TA 2IF2A 4GPTA 5BN3A 1NG1A 2RGXA 4R7ZA 3U4QB 1GRRA 2CCGA 1OIXA 1OW3B 1T5LA 1UDXA 3I61A 4JBWA 2O8BB 5BWMA 2BC9A 4Q9LA 1E32A 4D25A 1XEFA 1RFLA 5BYJA 3PUWA 3BWDD 4E22A 5FL3A 1G3QA 5CITA 4FINA 2JLXA 5LB2A 1W36C 1MO3A 2WVJA 2D62A 3ND8A 4GOJA 3I3SR 2CNWA 4KVGA 1DVRA 1E2PA 1R0XA 2G83A 2FA9A 3DVLA 5FPHA 1AA9A 2CVHA 2Z6VA 5FPSA 5KU1A 1EESA 3EAQA 3QXCA 2IUSA 3OFNA 1XEWX 1UEIA 1ETUA 1VG9B 2PCLA 2F1HA 2BV3A 2R6FA 2VSXA 4LJ8A 1GM5A 3N2EA 3CPHA 4LX0A 3LD9A 3ZDQA 4FI3C 1FUKA 1W0JA 3P1JA 4KJZA 5JJLA 3L8YA 1S8FA 2HEIA 1KDTA 3ZZ0A 1IN8A 4M22A 2OV2A 1GZSA 2FG5A 2CL0X 3KXKA 4PAMA 4Q03A 3X1DA 4JLOA 3GEHA 1L8QA 3R9WA 4M9ZA 2DWOA 2VTKA 5EXPA 2V7QA 2J0VA 4KFTA 5FBWB 2YOGA 2A5YB 2FNAA 3EWSA 4P33A 2OBLA 4OHVA 2REXB 2F43B 5KSYA 1UADA 3JVUA 3KZ1E 4FIDA 1S1CA 2V54A 4KCGA 2ONKA 4EPTA 4HLUC 2D4HA 1LB1B 1O3YA 4RFSA 3S1AB 2F1JA 2H5EA 1XXHA 2NZJA 2RCNA 4TL8A 1G1MA 2WBLC 1CR0A 1Z8FA 2FWRA 2YWHA 4A0FA 5P21A 2KE5A 5LD2B 5JECA 1Z0AA 1N5LA 2VSOA 2X1VA 3MAAC 4UXHA 3KQKA 5BXQC 4JLPA 3NTUA 2OXCA 2IS6A 1EFUA 1NLZA 1R2QA 2GF9A 4LUCA 1F48A 4PPFA 1W4BA 1IAQA 3K8YA 2WV9A 4Q21A 1XTIA 1ZUHA 3IQXA 3Q7QA 1TUIA 1ZINA 2XZLA 2BKEA 3EASA 3IO3A 3UXMA 2R6CA 2Q3MA 4B2IA 3KUDA 3CF0A 3KXLA 2W2VA 4CYMA 2ZSDA 3A1SA 4B2LA 3HU3A 2OE2A 1WCV1 5J40A 3HYTA 2OBNA 1QVRA 4BEBA 1EFHA 2JLRA 2QPAA 5CIQA 1ZM7A 2X19A 5KNDA 3QKTA 1FX0B 4PC1A 4Y0AA 1C1YA 1AGRA 4MRRA 3UMSA 1ZNXA 3GJ7A 1X86B 4NU0A 4ZI3A 5JHHB 4AD8A 1QHXA 1EX6A 4TMWA 1W5SA 3DMDA 3EWAA 1Q20A 5JHGB 4R2HA 1DS6A 2KBEA 5J4HA 2WM9B 4RFVA 2GETA 1G8YA 2BDTA 2VA8A 4EKDA 3AV0B 1G8GA 3RVBA 3R9XA 2YOHA 3FKSD 4GOKA 2D7CA 2OBMA 3W6PA 5F3WB 3GJ0A 3AEZA 5JWRA 2GJKA 1HQYE 3NDPA 4HATA 5JS8A 3C41J 1UJ2A 3TH5A 2BBTA 2I3BA 1MOZA 4Q1AA 3QOFA 2PZEA 2XB4A 4TYNA 3UG6A 1KSHA 2JDID 3QPWA 3CUEF 4QHSA 3OEED 4AKEA 3K0FA 4IVQA 2IS4A 4MKFA 4KAXA 3SOPA 2FZ4A 5FTJA 3C14C 2FFBA 1M7HA 2EW1A 4NYIQ 3IO5A 1ESNA 1YRBA 3QJYA 4M1WA 2ZR7A 5CK4A 5LPNA 3IEUA 2ZJ8A 3CBQA 5K8TA 3MUFA 1XB2A 5C2JB 2W6IA 2ZI5A 1EFRA 1WP9A 3CNLA 3BERA 2ZJBA 1HYQA 1G19A 5BW8A 4LYHA 3Q5DA 1Q22A 2FE4A 2YVUA 2FSIA 1U81A 4RD6A 4B47A 3CM0A 4C0BA 1A1VA 3IIKA 2BJVA 2R9VA 2UKDA 4JVLA 4OJQA 4D80A 1XJQA 3EZFA 2QTHA 4UNQA 4B48A 2ZUDA 4W9MC 2WOJA 3IEVA 3C15C 5AJZA 3WMGA 1SVLA 4BECA 5FFMA 1VKJA 2XOKD 5HE8A 1II8A 2DHRA 1EFCA 2FFHA 1E2MA 4KSBA 2C99A 1AKYA 5EZ5A 1OV4A 2VF8A 2ZTSA 3IBGA 4BFZA 1E2DA 3RDPA 2JGNA 4MGZR 3WP1B 3EA0A 5K8UA 5AWFC 1HURA 4OHXA 4QJ3A 2VP6A 4HEJA 221PA 1C4OA 2ZRDA 4Q1DA 5FOXA 3PJRA 2YYZA 4NE2A 1A4RA 2FPMA 4MRVA 5EP4A 5A0FA 4F92B 3H1TA 4CEIB 1N6OA 3K09A 4OQFA 3LQQA 3X1ZA 1OFHA 3BOSA 1SHKA 4KODA 2WKRA 1HE1C 3R8CA 1CP2A 1AZSC 1ZD8A 3EG5A 1I4LD 1UFQA 3T61A 3RSLA 2NQ2C 1HUQA 3QBTA 3RS0A 1XTJA 4D6PA 1OXTA 3TE6A 1E9EA 4IXNA 1QHYA 2IYTA 4XVRA 3HP1A 5SZHB 4JJZA 4ESVA 1KMHA 3OEHD 4YQFA 1UKEA 4HDQB 3IPYA 4OK5A 3NC0C 1Z0DA 4HB2A 1I2MA 2VYFA 2ZYWX 4LRWA 1R5NA 4TTQA 1GILA 4IDOA 4EUNA 3RWMB 2ZYUX 3U60B 2J87A 3CRVA 3HPQA 3H86A 4OBEA 4ZO4A 4B35A 2SHKA 4AIIA 1AS0A 1ZM9A 4LBVA 1NIJA 1W0KD 1FQKA 1ZNYA 2CDNA 4JSTA 3SYNA 4DLRA 5EUMA 2ZJ5A 1RYFA 3EIEA 4I81A 2NO1A 4PPQA 4Q4HA 1LF5A 2QGZA 1NN5A 1W36B 2AK2A 3TAUA 2AX4A 4BLOA 1FQJA 2ANCA 2ERYA 2VL7A 4NH0A 2XEXA 4TT3D 1GOTA 2BBWA 1KK0A 3A4NA 3QF4B 2FOLA 2W83A 1NL3A 1DOAA 2GK6A 3B9PA 4PQYA 3K9HA 4BUJA 3AM1A 3CZQA 1I4DD 4URVR 2ZJZA 4DDVA 1GP2A 2Q9CA 4DDWA 1M6NA 1NY5A 1FL9A 5DHAA 2FMXA 2HUPA 3UATA 1M8PA 5EP2A 1UEJA 1AKEA 3I5XA 1RPZA 2QN6A 1J70A 2WJJA 1IY2A 1ZM4A 3BK7A 4OJKA 1NSTA 3GCGA 4NCKA 5EXXA 2DFLA 2EFGA 4G5GA 4JZKA 4FW9A 2GJ8A 4PHHA 3SFZA 1E9BA 4QNRA 1D5CA 2GAAA 1T3LA 3EXAA 3OHMA 2V1XA 5L3QB 4QM6A 4C4PA 1VDZA 4CEHA 5CYOA 4NL4H 2RMKA 4LV5B 2G9NA 2BWJA 3ZGXA 4MGYR 1IXSB 2QT1A 3JZAA 4DB2A 4NBSA 1VTKA 2GZHA 1JI0A 2AR7A 2NO6A 4PAQA 1XD2B 2NMVA 4LV6A 5DGXA 4KSCA 4QOSA 4B33A 1E0SA 5FBRB 1PUJA 5JSZA 1DEKA 2ODEA 3K70C 3GJ6A 1FNMA 3R8FA 4Q5IA 2AN9A 4L15A 1N6IA 2X8AA 2QM8A 4DC9A 1E2KA 1NVWQ 4DEYA 2GZAA 1XTRA 1ZBDA 2J7PA 3OIVA 1R6BX 4E09A 3I8XA 4OKSA 4Z51A 4LJ9A 2QEQA 4P4SA 4TMXA 4TLCA 5D3MA 1T5IA 5H70A 1H8HA 2VHUA 1M7BA 1P7CA 3PUVA 2FFAA 2V6IA 2OM2A 2RAPA 4BFYA 3UMRA 5EP3A 2W6JD 3P20A 1NKTA 3LBIA 3LNCA 2A5DA 4KHZA 1SKYE 1PLJA 3QKSA 2P65A 4ABYA 1GDDA 2IXEA 2OCYC 5FTMA 5FOTA 1DE0A 2HJVA 3SBEA 4DDUA 3ZVRA 1KI2A 1Z0FA 3I73A 3QEJA 2JLVA 4DLVA 3AP3A 4QGGA 1F2TB 3W6NA 3MJHA 5JJKA 4K46A 5FR1A 4GP6A 2ZSFA 2ZEJA 2TMKA 2NPIA 2XSZD 2GJ9A 2ZPTX 4HZIA 3GLFE 1Q1QA 1F2UA 1YZGA 5AJWA 1W36D 3WHKA 3PCRB 1E79A 3UKDA 1Z29A 2JLYA 5FPYA 1HTWA 3IHWA 4Q66C 3MCAA 4M1KA 4MYCA 1OHHA 4CRWB 1JB1A 2QU8A 3FMIA 1RVDA 4XOIA 4F4JA 1UM8A 4G5RA 1NP6A 3KB2A 4HLDA 3M4YA 2IHBA 1W4AA 1KJYA 2ZI7A 4WVFA 4DB4A 3EZ2A 2JJ2A 2UZIR 3WYFA 4D0NA 5LB4A 5FBLB 1P9RA 3F8TA 1Z6GA 3CNOA 3IQWA 3TQFA 3TAHA 4ARZB 3U3OA 2G0TA 5AJVB 4M9QA 4AC9A 2BJWA 4PXAA 2J0QA 3NEYA 2XTNA 4JLKA 4Z1MD 4Q1EA 1G8FA 4E03A 2O5VA 1U0JA 1NKSA 3ZYCA 3U44B 4OI1A 1Q21A 3Q7PA 1II9A 5DN6A 2VO1A 1XMIA 2CCKA 4MA4A 3E1SA 2GEVA 2W00A 1TQ6A 4TYYA 1FTSA 5CJPA 3SHWA 4RD0A 4WIAA 5E7MA 2BCJQ 5FTKA 5CDFE 2C04A 3HU1A 4JYBA 4P32A 3REFA 3TKLA 1XNJA 3FVQA 3OIYA 1D2MA 2ZRJA 3W6OA 4BLTA 1FMLA 1NN0A 1W2GA 3K0CA 2VP5A 3BJIC 3CR8A 5SZIA 1XEXA 4RY2A 4YXWA 1KKMA 2C77A 4XVQA 2ZXUA 3KB1A 3THYA 3AGPA 3IIMA 4NZYA 1ELOA 3C16C 3C5CA 3T35A 1BMFD 5IRCD 2R62A 3QXXA 3AUXA 4JLAA 3UWKA 1IQPA 5HCNA 1B0UA 4LI0A 1E4VA 1E1RD 4BWYA 3NWJA 1ZCAA 2HXSA 2QP4A 3QXSA 3SR0A 3X1XA 4D4LA 5AUPB 4BGDA 2ZU6A 3NH6A 2BBSA 2O0HA 1GKIA 1HY3A 1N6HA 3OZXA 1KI6A 1Z83A 1VG1A 1A2BA 4TL9A 4XD7A 4ERNA 2A7QA 3MRSA 3VMFA 1CF4A 2GTPA 4CZ2A 3TUZC 4NYMR 4QM7A 1QHHB 3M0EA 2XNDD 4P4UA 2P5TB 5FPKA 1NVXQ 2EVWX 4AKIA 4LC1A 2J46A 1N6RA 4D4JA 4B76A 1F3OA 5C18A 1W49A 4IJMA 2RGNC 2XX3A 1OKKA 2H1LA 1ZYUA 4KFRA 3B9QA 4PO1A 5B30A 2MMGA 4KITB 1LVGA 4IOMA 4TQUS 3ASZA 1IM2A 4QRHA 2YOFA 2K5UA 3OESA 821PA 2JCSA 2ZU0C 4I1SA 4TWZA 3GLFB 2DPXA 1OXVA 1S9HA 1GTVA 5CK5A 5IHPA 4M0LA 2A9KA 1PJRA 1KZ7B 5B64A 2HCBA 1WQ1R 3LFUA 1Z6TA 2N46A 4BRUA 1ZC3A 1T9HA 1MR3F 1IN7A 3RC8A 4EDHA 2JJ1D 5DSZA 3BXZA 1X6VA 1BO6A 2IEZA 3WRYC 5FI0B 1LS6A 3D8BA 1ZNZA 3K0AA 4IVPA 2J0UB 1E2QA 3LXXA 4BLPA 4KFUA 5FTLA 3W90A 2B6HA 1G16A 1XTQA 1FNNA 2DY1A 2QL6A 3REGA 2VEDA 4Q01A 1D6JA 1P3JA 3P4YA 5JMTA 5AJYA 1FW6A 5KUTA 4M1SA 2HYDA 2ZANA 3PXGA 1COWD 1N5IA 2XTMA 4EFNA 1Z08A 2PCJA 4DLWA 1KDPA 2CHVA 4DLTA 3BGWA 3B82A 1XEWY 2AWOA 3T1TA 3GPLA 1TF7A 1RE0A 3CH4B 1WB9A 2ZAOA 3BFXA 1K8RA 3V4FA 4LJYA 2WOOA 4N0EA 4FMCB 4TL6A 6Q21A 2HT1A 3MMPA 1RRGA 2JLZA 4GSYA 1AIPA 2ZUCA 4LHYA 1SXJD 4G1UC 2OAP1 3WXMA 2P2LA 5KSOA 4I99A 4CEJA 3Q3JB 2QP3A 2IUUA 2C78A 2KSQA 4C7OB 1XU4A 4Q4LA 1P2UA 1DELA 1GL7A 1TEVA 2WWWA 2ZRCA 4B75A 3QUSA 3B1VA 2EYUA 3QVUA 1CBUA 4OQXA 5KNCA 1W7AA 1SZPA 4HB3A 4HZUB 5KDLA 1GL9B 4NYMQ 1DARA 2WHXA 3VR2A 2YC2C 4JVMA 4WBSA 1J90A 1KY3A 2CXXA 4WW0A 4BEJA 5AR1A 4MGIR 1XPUA 4BRWA 4L4UA 5E3HA 1YZLA 1KZGB 4NPHA 1VYVA 1YQTA 1GUAA 4MRPA 3VKGA 1HH4A 2CLDX 2QI9C 1IBRA 2WWGA 4A6PA 3CKLA 1GKUB 2DBYA 3KJIA 4RD4A 2NO7A 2ZETA 3WNBA 5DYGA 3DZDA 1JALA 5EE5B 1PVOA 1W4CA 1KAOA 2A3RA 3LW7A 2VSFA 4HUQA 4M1TA 4PO9A 4X8LA 2OHFA 3KTAB 1OH7A 2ORWA 2ZE6A 3QKRA 3ZVNA 4AURA 2IW3A 1M1YE 2OAQ1 4Q00A 2W2TA 3NVAA 2O8CA 2GEUA 5CIWA 4LOAA 2IYVA 2J45A 4G0NA 2FF7A 4BASA 3BC1A 1VECA 3Q72A 4U5XA 5DHFA 3VAAA 4NYJR 4PTLA 4YDSA 4PR0A 4U00A 1D8TA 2QBYA 2GAOA 3DOEA 2BHRA 3GJ5A 1RRPA 4JKIA 5TMPA 2BMDA 2WJGA 2AWNA 4MUAA 3K9GA 4Q48A 3CB4A 3BB3A 3L0OA 3LW8A 1A2KC 4FMBB 4JL8A 5SZKB 1C9KA 3H0KA 4DEXA 2WMOB 3L0IB 2HF9A 4B32A 2O0KA 2GEDA 2XJ9A 5AUQA 2GXAA 3TW4A 5TY0A 1Z2CA 2GF0A 2BMEA 5HKKD 3PEYA 5C4GB 2OCPA 2XXAA 4KVAA 5JZVA 2GHIA 3BE4A 4CVNA 2B21A 2R6GA 1HEIA 4BPBA 4AWXA 3I92A 1IOZA 3U4QA 3LRPA 1HT1E 3NBYC 2FSFA 2IXGA 4UKDA 3PEUA 3CPJB 3W5JA 4ZDKA 3RAPR 1XP8A 2O8BA 3DZ8A 2FPKA 3CRMA 2ZJYA 4R2IA 3VU9B 3NBFA 2OXRA 1OH5A 3HPRA 2QAGC 2IWRA 4E07A 2AFIE 2CLCX 1OB5A 3BFKA 3MWLA 2O8DB 1FUUA 4DUGD 2YV5A 2ZRHA 3M6AA 2JIZD 1ZD9A 1DAGA 4K81B 3HJNA 4TSFD 4HDCA 4C0LA 2B8TA 5GJVC 1Q1BA 3ZIAD 4B3FX 4WZAE 3QPUA 4FCVA 1CJKC 1ONBA 4ASUD 1OB2A 4NYIR 1S3GA 2FU5C 3GJ4A 4RD2A 2BBOA 1NLYA 1S4QA 1AGPA 4PZLA 1MO6A 5FL7A 1X8JA 1L4UA 3NXSA 3K0SA 1Q1EA 3LQRA 1Q44A 2ODWA 3K70D 2QY9A 1Y3AA 5HTKA 3C8UA 3LWNA 2IXFA 2ZS8A 5FBQB 2FGKA 2VHJA 2GA8A 2W0SA 1VCOA 2GWHA 3SDZA 3DOFA 2F55A 4IOLA 2LCFA 4Q9IA 4JLNA 5C1BA 2F43A 3ZZTA 4ACAA 4BLQA 4QBIA 2BMFA 2ZQ5A 2NO0A 1KSJA 3CH5A 3O8DA 4PC6A 5DIFA 3BRWD 4US2R 3AGQA 3DM9B 4NYJQ 3S1AA 3BAFA 1E2JA 1KGDA 4FWIB 1GWNA 1L2TA 2A30A 4YMUA 1E6CA 2DFTA 4C30A 4HB0A 4D82A 3N70A 1F60A 3B1ZA 1ZUIA 3GJ8A 5J4KA 1MV5A 5KNBA 4QBGB 4TZ0A 5KDDA 5FTNA 5DO9A 1EG7A 3DMNA 3MG9A 4URZR 1A5TA 3QQ5A 2XOKA 4TYPA 1IN6A 3ZD7A 1EWQA 4PPNA 3RS7A 4IEEA 5AUNB 2Q3HA 4HLQB 1U9IA 2XTZA 4B3DA 2J41A 1M7GA 3I8SA 2Z43A 2A5FA 1Z07A 2HJGA 4POAA 5EE9A 1AS3A 1JEDA 4DKXA 4HAZA 4NP6A 4PSVA 5DNYB 2CNWD 2JJ8A 4Q7JB 4KBGA 1SVKA 4PPGA 3ZJYA 2ZVQX 3DDCA 1TPZA 1WE2A 3SFVA 1RIFA 2YZ2A 1FX0A 1WBBA 3MJRA 3QG1A 3I4LA 3GD7A 2R2AA 2QMHA 1GRNA 3FB4A 2P67A 4IDQA 1AS2A 2H16A 2GXUA 1G6OA 4HDOB 4GOXA 4UNNA 1MO5A 1FP7A 5CB6A 1WMSA 3ASYA 3IILA 2A2ZA 2FFQA 4CDGA 2GXSA 1WRBA 2Y8EA 3L2OB 4F7WA 3U3JA 2ZSBA 2VP0A 3CZPA 4S35A 1QBKC 4B73A 5JWOA 1CEEA 2QAJA 1IN5A 3RLFA 4C0JA 1W48A 1XZQA 4UJ5A 1IJEA 3P4XA 3BFVA 3CF6R 1G3UA 1W2HA 1A7JA 3OEHA 2JLUA 1CRQA 5FOVA 1JQJC 4EFLA 4OHZA 1IJFA 2RGBA 1CIPA 1BS1A 5L3SB 1AQYA 4N0DA 3THWA 2B7CA 4EJSB 3OE7D 2CJWB 2RH5A 2RKOA 1S9DA 3NH9A 3RNLA 4JT2A 1XFAA 3SE0A 1TTTA 2DWPA 1MABA 2B92A 2F7SA 2KWIA 2RHDA 4NDZA 5AK0A 4UQOA 4W5HA 3AVVA 1J99A 1CLUA 1P6XA 4QJ4A 3VKHA 5EQTA 1OF1A 1SXJC 2R6DA 4CF7A 3ZS8A 3KJHA 4F93B 1SGWA 1E2NA 4A82A 4G3XA 4YMTA 1G18A 1M74A 4OQMA 4TT3A 1LNZA 1G5RA 4G5SA 5UKDA 1BKDR 2IYXA 3EW9A 3ZZUA 3EX7C 1DO0A 2QE7A 1OXXK 3ND9A 2W58A 1HE8B 2GBLA 3QI2A 3B85A 2KBFA 5HZHA 3SU8A 3MWJA 1YR8A 3FKQA 1N6LA 2WPDA 1E3MA 2J1LA 4BE7B 3AVYA 4RCZA 2QA5A 4P3YA 1SVOA 2AKYA 2JLSA 3FPAA 4DSTA 2D7DA 5H1YA 1IY0A 4OYHA 1ZNWA 1XWIA 4PHGA 1G8HA 1EGAA 1S2MA 3B7GA 4AYWA 1G41A 4V0LA 2GJSA 2YHSA 2IYYA 4II7A 2OLJA 2ANBA 2G88A 4Q9KA 1P9NA 4JMPA 2ONJA 3UANA 2GVZC 3FYHA 2QMUA 5EUQB 5DE3A 5CM9C 1LW7A 1AK2A 2IYWA 2CE7A 4A4DA 5KO2A 4IHQA 2WICA 2YINC 3D6TB 1WBDA 1U99A 1XTKA 4Q7MB 2CEAA 2Q9BA 3PR1A 3R20A 2I1VB 2ZI3A 3AF4A 3LLUA 4B3BA 4EQ6B 2QM7A 3PIRA 4ON9A 1NNEA 1DG1G 4A0RA 1YZTA 2Q6TA 1ZRHA 3MFYA 2OFXA 1OIVA 1OFIA 3LVRE 3BORA 4OI0A 1XJCA 2R6AA 3EC1A 4JLJA 4GZMA 1NY6A 5JBQA 4RCYA 3SNHA 4RSGA 3A1UA 3WY9A 2A5GA 2V6JA 5JEEA 1XMJA 2QTFA 5EE3A 1XF9A 1F6BA 2W6JA 3TW8B 3BIFA 3N5CA 3CLVA 3VFDA 5J5CA 5GADl 1CJTC 5JEDA 2VP9A 1KDRA 4IFEA 2I4IA 2H18A 3MWYW 2QRZA 3QXHA 5EE1A 1KMQA 1Z28A 1YVDA 2VP2A 4GMXA 4DCNA 2BVNA 4KU4A 1KTVA 4BFVA 3IKJA 2ORIA 2QRNA 4JT4A 4D0GA 2QAGB 2IK8A 1NMZA 4F91B 4UXIA 4JL5A 3RHFA 3A4LA 3PEWA 1G7CA 1II0A 4HAYA 1NN1A 3GJXC 4W7SA 4Z8YA 1S0UA 1W5TA 3OIUA 4D2IA 4TQAA 1T0JB 3E5HA 3QF4A 2DFNA 1VG0B 1O87A 2JLWA 4P4TA 4A6XA 1U94A 1JR3D 3SC3A 1M2OB 3TMKA 4DHEA 4B3XA 1N3BA 3F0TA 2J7KA 1E0AA 121PA 1H8EA 2PZFA 1VYUA 3THOA 3UIEA 3QG5A 2GCPA 2Q9AA 2OEPA 3X1YA 3RYTC 3CX7A 1RRFA 2HLDA 3AQ4A 3J81k 4JJKA 1OXUA 1P62B 1SXJE 4A8JC 1R8QA 2C03A 2HXYA 3DO6A 2RGGA 1CS4C 3NC1C 2P0EA 2NTYC 1OLOA 4Z1MA 3GLGE 1DAHA 1E2GA 4XIGS 5FUXA 4QHTA 2WSSD 2W2XA 1XZPA 4WAUA 5JI2E 2I1QA 4GT1A 4BFXA 5L3QA 2J5XA 3WYAA 4HLUA 3E70C 2YWFA 3KDSE 4XH9B 1Z22A 3W3ZB 4WXPA 2CMKA 3WP0A 3IUYA 3ICEA 1NVUQ 3AUYA 3OAAA 1XD2A 1PZNA 1V5WA 1ZC4A 1P60A 4LK2A 3DEFA 4MYTA 1J8MF 1ZJ6A 2Q3FA 2F6RA 3OF5A 2JLQA 1TUEA 4KI0A 2VPPA 4QGHA 1NBMD 3NG1A 2H57A 1ZP6A 2BKUA 2CLSA 3C4JA 4LDJA 1SVSA 1VCNA 3P32A 4OK3A 4WOPA 4KYIB 4AKGA 3D3QA 4O25A 3ADKA 3WBKA 3U7HB 2N42A 4QJ5A 1QHNA
chains in the Genus database with same CATH superfamily
4HDKA 3KRTA 1J8YF 4L5CA 4TV9F 4NKRA 1CFZA 3PRHA 2IT1A 2R84A 4EB8A 4GI5A 4UNSA 1LUAA 1RXYA 3PQCA 3LVQE 1ZD5A 4IAOA 4K86A 4P4NA 4PLHA 3OBBA 1Q0UA 5D8DA 4Z99A 1HXHA 4W6QA 1GAEO 1B6SA 5CYPA 1PYDA 4GZ6A 1U0BB 4BVKA 1MB3A 3VR4A 3CRW1 2HY7A 2E3JA 1NUHA 2FLWA 1UWCA 5CX1B 3Q1LA 1OPRA 3IULA 1KJWA 4H1UA 4DZTA 4CCWA 2ZT5A 4UTZA 4H08A 3ZU5A 1PW7A 4PLPA 3D8SA 3JZDA 3PT5A 3CZMA 7AT1A 2AW3A 3C3KA 1SEPA 1W1UA 2V4UA 1I6KA 3ZDCA 1TCBA 1LC3A 2JAWA 4B3IA 4ID9A 4EYEA 1MIHA 1JZQA 1NI5A 3N2LA 1WS6A 2WAOA 1HTTA 1Z4IA 2Z5LA 3NANA 4G01B 4M0CA 1X8LA 4MR7A 2M2IA 1XELA 2VF4X 1Z36A 4WY8A 3H1AA 4FQ8A 5DYTA 3UWDA 2NNWB 3WBJA 4BEVA 721PA 3FLMA 4HEA1 4CTKA 2AHOA 4LDNA 3U09A 3UHJA 4CLOB 1DAKA 3WGHA 4Z7OB 1FDSA 3CIOA 2BM9A 1HDEA 4HUJA 2Z04A 5AYVA 3TTTA 3TLJA 2WTBA 9GPBA 4FFNA 4HNAA 5IK2A 5BSMA 2F3UA 4YA6A 3FVWA 3KYJB 2OXIA 3HWSA 4ARZA 1FYWA 2Q1XA 4BB6A 4GX2A 2HFJA 3Q85A 4R2XA 3W4KA 2DWUA 1MZPA 2OG2A 1VLHA 4G5QA 5I7UA 3V7NA 3JW8A 2FHPA 3LFHA 3FN4A 1XA0A 2O8NA 4RZSA 5EZ6B 1L5HA 4F06A 3BSFA 5AOBA 2JFYA 4URHA 3PXUA 2X0JA 4C4ZA 3LK6A 5EJFA 3THYB 1I36A 3U44A 1E1QD 1EUDA 1VE1A 2MSKA 2OV3A 1GSOA 3A6FA 4MKXA 5CVEA 5A7GA 1SXJB 1PR9A 1CUAA 1H8HD 3OE4A 4FEGA 3ZKAA 4G0MA 3W77A 1M0SA 1MD9A 3ER6A 5JAIA 5TQ2A 3ZHZA 4AZWA 4FCCA 1QM5A 2FSUA 2ZKIA 4MQFB 4D6XA 3URKA 5A02A 1GNLA 4DA9A 4DTIA 2ATXA 1YE3A 4DT1B 3QX9A 4U02A 4Y2UA 4ILKA 4B3CA 5BNWA 4OK6A 1MB4A 3DUFA 4R9UC 1YR9A 2GO7A 3I53A 4HEA6 2ISCA 2G36A 4AG5A 3WTBA 3FUWA 2JL1A 3WGLA 1Z5VA 3NB0A 2H1WA 4KX3A 5JASA 4EUHA 1I7LA 2P8SA 1KK1A 3I2GA 3EGIA 3N8NA 3MINB 2YXEA 3GI1A 4HDNA 4MYDA 3NU1A 3KX2A 1ZI9A 4PYQA 4C2AA 3TUIC 3LOQA 1IWBB 4PZPA 5TSDA 4RKWA 1XX6A 3FTQA 2A1UA 1C0EA 5T4BA 1E20A 4O1IA 3THXB 4JBHA 1USIA 4L8VA 4X93A 2OXFA 4K6GA 2SBTA 4OCZA 2RJ3A 3DSRA 4Y3UA 2RK3A 4LYDA 4J0EA 4WSOA 1TVMA 1U98A 2BGGA 1R88A 4DPMA 4JIGA 2YXDA 4M38A 1NE2A 1F8YA 3N2YA 1PNTA 2QG6A 2VDOB 1B7GO 2MU1A 3IVXA 4JL6A 2QROA 1QDUA 3PIIA 3RUEA 2ZQZA 3CGGA 1AUQA 3DKVA 1PLKA 1BEZA 1RCUA 2X5OA 3HB1A 4UBJA 3VU8A 1G8JA 3PGMA 2JJ2D 2X22A 1DAFA 1G4UR 1V6AA 2PNFA 2QGNA 3DPUA 3EXEB 4Y9DA 1NYLA 1A8QA 3L8HA 4F5EA 1VHTA 1E7YA 2JI8A 1R0LA 2W6QA 3IQGX 3OF2A 3Q8WA 3QU4A 4ZVUA 3E9NA 4B4DA 4TV9A 5AM1A 4BBPA 1Y6QA 3D6MA 3EN0A 4IF6A 4HYTA 5L3RA 3UV6A 2OTCA 2Q2NA 4M46A 5I45A 2Z83A 4GKVA 4RZ2A 1JFLA 4IQ8A 1U1GA 3MTQA 5A6SA 4E2YA 4CKXA 5CFQA 5EHIA 2G1PA 4WNAA 1VGQA 4QDTA 4UHBA 2R7AA 1WU8A 1T4GA 3D5QA 1NRIA 3FCAA 1M66A 3N07A 3D5EA 1SCIA 3R24A 1WQ3A 2H1RA 5I4KA 2VNJA 4HHEA 8ADHA 3LZ6A 1A8UA 1E18A 1R4AA 1YS7A 3I64A 3PA6A 3ROEA 1P4SA 1SD1A 2C7QA 1AM4D 5IUJC 1YQXA 1EE9A 1DTEA 1YJBA 2D54A 3C5HA 3B6KA 3RVJA 4S3MA 2PX3A 4EVSA 5H4GA 1AMOA 3KQHA 3DC2A 3HN2A 4GC5A 1RYYA 2WFAA 2CUTA 4F3CA 3FYUC 1HNZB 4ZCTA 1PN3A 1EMDA 4HWRA 4L4YA 1N5JA 3FFBA 4LY0A 1N9GB 4LRQA 2AFHA 3E05A 1GNRA 4G1MB 1HT2E 2BZ1A 2J0UA 2IEGA 3FM9A 4ITRC 3IOMA 4M49A 2XVZA 4XWKA 1DX6A 1RKBA 3ES9A 2PT9A 5LU8A 1T5BA 1FMTA 3E1KA 1DIBA 3CH7A 2ZUWA 1B0PA 3DCJA 3V9PA 1LPPA 3IP8A 3U7IA 4MYHA 2ET6A 1RABA 2AEFA 1UT6A 2A1IA 3DEZA 3FHJA 4LE0A 3RC3A 1FPMA 1OAKA 3CBGA 2PU7A 4JLDA 4L0CA 5E2AA 4DBLC 1TIPA 3T3HA 4N8SA 3AMVA 2QNRA 4LBWA 1H6AA 3W1EA 3V4PB 4DGSA 1Q57A 5K0CA 1RZVA 4RS4A 2FMUA 3L4EA 1QF9A 4ED9A 2FPIA 2BKAA 3FPEA 4ZIRB 1ADJA 4B17A 1SIUA 2VZEA 4MYUA 4F3RA 1S2NA 1ZQ1A 3IYLW 2JVJA 2PGNA 4LYJA 5D6NA 5CVJA 3LA6A 3OURA 3PB3A 4X3OA 1CUXA 4PVCA 1U0LA 4DNPA 4H1TA 5E8RA 3G1WA 3PWSA 3C7DB 4HSGA 4JR0A 1FRVA 4LTMA 1IN4A 4Y2SA 3Q0TA 2RI0A 1HX7A 1QZXA 4EZBA 4QFMA 3P0FA 4B44A 1R5BA 1P29A 3PC6A 2OB1A 5CBPA 3FWHA 3LUPA 2EL7A 3OX3A 1UF9A 3JYOA 4C78A 3UWOA 1GY8A 4O2LA 4GX5A 3L3BA 4URXR 2E4AA 4JN6B 3H4TA 2AFVA 3IP9A 1DOZA 1AT1A 4X5OA 2A78A 1DLIA 1UBGA 4WJLA 3N86A 4QUDA 2BR4A 1Q5PA 3NAQA 4Y8VA 1TD1A 1ZMOA 4FOTA 1OX4B 4RK0A 5F9MA 3WLHA 3MS4A 4QYIA 3KO8A 5EWJA 1SQ5A 2AOTA 2VJYA 1PGNA 5M5BA 3ZGVA 1QRSA 3GNTA 1CJVC 1JI3A 2W6CX 3UYLA 5BN3B 3HNOA 3PPWA 4L95C 1A88A 1Z0JA 1CFJA 1TK3A 1I32A 2YZKA 5CFNA 3I6ZA 4KQHA 3ACDA 3LO8A 4B85A 2YMPA 2BGLA 4X1IB 4KR6A 2QZJA 3O4FA 4DYDA 5K1ZA 1JXAA 3DE1X 4ILEA 5LC1A 5A5DA 2OFOA 3HR8A 2C5LA 1B8OA 1Y3HA 5IJWA 2VBCA 3KSBC 4MHSA 3BRWA 1HFJA 1ZISA 2VR1A 1ZR2A 2DYKA 1IZ8A 1IAVA 3N2IA 3KKQA 3H83A 5AHKA 2C00A 4H60A 3PQ8A 5I7WA 3PDIA 1K4KA 1KZ4A 3PE3A 1X8KA 4JLBA 1R8YA 4Y6LA 1AK9A 3VPGA 1JJVA 1JT2A 4ER0A 2ATCA 5C8XA 1W4RA 2UUCB 5U1PA 2WUDA 5ICFA 2VWPA 4N18A 5JBIA 3A9RA 2WSMA 3GELA 4UUOA 5AHWA 2C2MA 2RHOA 2PWYA 3P0EA 3WHLA 4OB7A 1AMNA 1YL5A 1BWQA 5FEUA 3FYSA 3NPMA 1VE9A 4GIBA 1DJNA 5GJWC 4BNMA 3NIBA 4MVJH 4L72A 1YCHA 4FXPA 4ZKEA 3H1PA 4DV7B 2XT9A 3D7SA 4QFDA 5GGXA 2C7BA 2CL7X 2OV8A 3EXIA 4YK7A 5I9LA 4IKPA 3S81A 3T3MB 5DTQA 3N5KA 4B4VA 4BLSA 4CL3A 5EYPB 1Z12A 1DZ3A 3N53A 4KWCA 4HJRA 5TPZA 3ABIA 4R9SA 3VR2D 1HE4A 4KQ6A 3TNLA 3LTNC 4A1OA 4FYPA 3DB1A 4FJ2A 3K30A 1K2WA 3ZWVA 5HW0A 1KI4A 5K6RA 5FR2A 4DJDC 5JE8A 3GBPA 5K3FB 4HI0E 1KYZA 4DPKA 1YK1A 2JDIA 1RYHA 4EYOA 2V7PA 3E2IA 1DPGA 3ETJA 1X92A 2DCMA 3G1TA 3LLSA 1HO3A 5I7RA 1DWOA 1W44A 1RBZA 1PS8A 1QK5A 1S3SA 1KO1A 1TYBE 1PBTA 2IUFA 3CR3C 3IVAA 2AZXA 1B2RA 1Z0KA 3K2IA 4JP3A 4WN9B 1JR6A 3AX6A 4YAOA 3KE8A 3QIAA 4X8MA 3U5TA 3WA7A 1VA5A 2QXUA 1NF3A 1CF9A 4FLMA 4IQ0A 3VZRA 4M0FA 3ZXYA 1S96A 1NFRA 1GFSA 1DAIA 4PHFA 3RK4A 1M0EA 4OHWA 1XKXA 4PQRA 1JLMA 3ESCA 5E95A 3WJAA 4G5YA 1FX1A 5BNTA 1GRQA 3HXKA 2XYRA 1JR3E 2UDPA 5ALEA 3SMVA 3I9MA 1IBKB 5GIOE 2VIIA 5ADUS 4AIRA 1FP6A 3W06A 3MMSA 5ECGC 1X74A 2BPOA 2B0CA 4IJUA 4LF9B 1JHPA 1CP3A 1OAOA 4YJ3B 2ODNA 3N8DA 2P68A 1HDRA 1JHZA 2JAHA 3EVAA 3OE7A 3OQBA 4JOCA 4EFMA 1SD5A 1CUEA 1P5RA 1LY1A 4O3MA 1KO5A 1N6KA 1N1EA 3CW8X 4JP8A 1DEHA 3I37X 5BOSB 4FXOA 4URYR 3R23A 4YAIA 4PY2A 4HAWA 5K3SA 1U0FA 1A96A 1GT6A 1C80A 1YOVA 2J9FA 1T3HA 3BGOS 2Q6OA 4QA9A 3V7FA 5JAUA 2JEZA 1NMSA 2IP1A 3P9QA 5JO9A 5A7FA 2XOXA 4Z9YA 1L5NA 3DTVA 3Q8MA 1KY2A 1J22A 4BNGA 1Z8HA 2C3UA 2HTFA 4PSUA 2WMDA 4DLXA 4ZDWA 2I8AA 2W9XA 2A9FA 2QSZA 3OZRA 2PQ6A 4C0SA 5KYXB 2Q4DA 3R9XB 5CLQA 4JYAB 1L6IA 4BNYA 2I4RA 4QWWA 4RGQA 3H4MA 1VIYA 5B57C 4BQPA 3VR5H 4BX2A 1K4YA 3FHCB 3L93A 1RZRD 1EVZA 4XQGA 4YRNA 2VEOA 1W47A 2E21A 2XKBA 4GPIB 2IYRA 4Q9JA 3TSAA 3O8QA 2WTUA 3KZXA 3AJDA 3N2GA 3FGOA 4I4LA 4B6OA 1W0JD 4UPVA 4XB2A 4PGMA 1JPJA 3TXXA 4PIVA 2INGX 3K0FB 3LWZA 4HGOA 4QTUB 5JROA 1GG2A 3BXHA 4E3WA 3IL2A 4MSUA 1AG9A 3VVLA 5E9QA 2VHEA 3MTGA 1HT0A 4JODA 4RNDB 4Z9FA 2C4TA 3D2CA 1YSCA 3PEEA 1BQ3A 4RQUA 3HKCB 1C14A 1JAIA 3OBIA 2V7QD 2YDXA 5E1OA 4Z0PA 5TMBA 5LOVB 1ZEMA 2IA5A 3AKCA 1E62A 4KZKA 5DLDA 3V33A 5KYTA 3B12A 1LPNA 4GI1A 4J1TA 2WJ6A 4J7UA 3NAGA 1E3IA 1FFSA 3P9YA 4B6EA 3PENA 2QRGA 4YRKA 1BH2A 5DTEA 1D4ZA 3GYBA 2WM3A 3RRJA 2FSVC 4G67A 4B6GA 1UKYA 4IWYA 4X6XA 1KYTA 4W5WA 1D2NA 1V71A 4AJKA 5JWHA 1UP6A 4JI2B 3L8MA 2ZB2A 5EJEA 3MUOA 5F23A 4LKOA 4CXMA 5AVRA 3KEOA 4D4MA 1MC4A 3THWB 3IBYA 5IVDA 3UTDA 4TTIA 5H59A 3WLRA 1KDZA 4TQ9A 3WRYA 1NRXA 4KQWA 3O1LA 4MV6A 3I30X 2Z8ZA 4HYEA 4U7PB 4Y2RA 3K6KA 1MABB 3IAXA 4YONB 4KR7A 4PZCA 1II8B 1LPSA 5CRIA 1LNQA 4BZPA 1TMKA 3ZQUA 3RFVA 3LBHA 2HPZA 2E9SA 4IVRA 1QF6A 1NYQA 3SVTA 3KFXA 3OHSX 1SCQA 4L0DA 4RM2A 1O5TA 4HAVA 3WAKA 4MMXB 2CLEB 3GLUA 1TL7C 3Q0IA 4N3AA 2C5FA 1DKPA 1B8PA 3OJXA 2VQ6A 1HQCA 3DVAB 5HQTA 4ZRNA 2GN2A 2FPLA 3CX8A 3B6ZA 4HGPA 4K26A 3VBCA 2FUG1 4LJ4A 4M0UA 1JDNA 1JIVA 5LA6F 4IV8A 3VKVA 1RWBA 1MFPA 1C7IA 2CYAA 2FWMX 3OZFA 4RESA 4L2IA 3JALB 3BWYA 4KVZA 5KOHB 2HRQA 5AD1A 4BQFA 3UB4A 2HM7A 3BMNB 4D99A 4DIDA 4UVHA 4MWGA 4CUZA 5C32A 2HGZA 1C3LA 3JU3A 1B0AA 3P45A 4MQ5A 4UQPA 1X80B 4RA9B 3DE3X 3HA5A 3PHJA 2PLFA 1N0HA 2MSNA 1MRNA 5H4HA 4YRTA 3BDIA 4H4CA 5FI1B 4ALKA 1FNDA 4KPEC 4KPYA 3NX4A 3DJYA 2PYIA 1RC8A 1PJ4A 2Y2VA 1SPXA 5IAKA 3UK7A 3WB0A 1PT5A 1TJNA 4DN6A 3BE5A 3N8GA 4NOKA 4IQ4A 1WO8A 4C7JA 1G5TA 1UK7A 1NVDA 1KMIY 2H2GA 4ZCIA 4LF5B 5K0BA 4EP1A 4CIAA 4WDQA 1A4XA 4CEIA 1NMXA 3U26A 3DLCA 1I9CA 4UNIA 3ICQB 3A2LA 4BO4A 5KYYA 5LN1A 2IELA 1W6RA 1DINA 1MX1A 3G82C 4PCLA 3WL4A 1XF1A 2M1XA 4FW8A 5G4KB 1S01A 3BWVA 1H22A 2QUKA 1GZUA 1YB2A 4FR2A 4XX0A 5BN5A 2JK1A 3CX6A 3IODA 4IZ6A 4V1CB 2O2XA 2XB2A 4LWZA 3TAXA 5JSUA 1V1JA 1YJXA 3OZCA 3HN7A 2RBGA 2Q27A 2X4GA 1YNOA 3B51X 3NQ41 2W6ID 3HDQA 3KEGA 5FPPA 5BUSA 2BYTA 5MN5A 3TOSA 4Q4HB 5TGZA 1DWUA 1FVXA 2ZIFA 4KV9A 5C5IA 3UJNA 4NV0A 2FN7A 4LZNA 4HWPA 3KR9A 3QTBA 4FX2A 2JFVA 2RHBA 1O95D 2BFFA 4IM7A 3V8PA 1Q1ZA 1MX3A 4FNGA 5A4FS 5KYKA 3QEMA 2WAAA 3HABA 5D7BA 2VRBA 1R0WA 1EK6A 2YXPX 3W7AA 2ADOA 1P9WA 4HY3A 5CP8A 1N2HA 1XZMA 3BQNB 1DKLA 3CISA 1NJFA 3ETCA 2J0SA 1ZAKA 4DNFA 2EFYA 4C5CA 1J33A 1W94A 3PPXA 4GE0A 1VHQA 2BFCB 3PHBE 5HFJA 4DLNA 5J47A 2VBGA 4XTRA 1JPVA 3QVSA 3MM4A 2O50A 5HIIA 3TXAA 5GJBA 3CC8A 2WJVA 4UBOA 4RVOA 2ZYVX 2LNDA 2P1DA 1TC2A 4BNTA 5B58C 4KXFB 4DBLE 3WLPA 3AV3A 1LWOA 1K0FA 2JEOA 2XSZA 1EB9A 4IMJB 5C1DA 5KREA 1T9CA 4LHXA 1WD5A 2D8AA 4L51A 3CKYA 1I1NA 4DCTA 4JNKA 1CHNA 1ABFA 2HRRA 3K73O 1NI4A 3DLPX 4X84A 2EU8A 1H3NA 2QE7D 4ANFA 3SWWA 4A36A 1YU9A 1ZJ4A 3OT1B 3PBKA 1BS9A 2QGFA 4AFNA 4CEHB 2WF6A 3PXXA 1R50A 4KNVA 4N5IX 2OUIA 3ZQKA 1K4MA 1ENYA 1GFZA 4RUKA 3TNFA 3S28A 4BWFB 1ODSA 5C51B 3RSOA 3SEZA 3LX5A 3RU9A 4QNNA 5KS2A 1ESCA 3EUWA 1Q74A 4ENPA 5FUYA 1K5GA 2CFRA 1ZN8A 2XYQA 4UC0A 1KEPA 1UKAA 3JVEA 5DGIA 3BMOA 2PSHA 3QWBA 1M5TA 4V0NA 3UWSA 1KOFA 1J97A 4BP8A 1EP1B 2VAVA 5DHQA 1K6EA 1N2GA 4KXVA 4JUAA 4CQJA 1B8NA 4ZYVA 4TUYA 2AI1A 4EY8A 4L5YA 2F8LA 5HOQA 1KQPA 3ECSA 3EZ7A 3F96A 4M0PA 3ROPA 3SE7A 3S8MA 2X9VA 2P9JA 5DLQC 3ORHA 4R40A 2EKDA 1P73A 5LA6A 3PC3A 5A4JA 4P4SB 5DRYA 1T4CA 4RZ3A 2FSGA 4CBVA 1L5YA 4FC7A 4US0R 1ZUNB 4X8OA 4Y0VA 3V8QA 4C0AC 3O38A 4XYBA 5JNUA 4RHTA 4C76A 1HLPA 4J43A 1WOMA 1YIOA 4XSHA 3UICA 3AI3A 4QQNA 4R6WA 3KU4A 3LPMA 3LKBA 4DVJA 3QWFA 3IAUA 3F5QA 4O2BB 1QAQA 4L5BA 4YMVA 4AJPA 5B2ZA 4G0XA 3VZDA 5AW0A 2ENUA 5AKYA 2DF8A 5I7EA 2JAXA 2FVXA 3A9TA 4MHOA 3G2LA 4BYMA 4CM9D 1Z4JA 1M6VB 2I7VA 2ZYDA 4J49A 1ZOOA 5ECWA 5JAZA 3VDQA 2MSDB 3D64A 5L8VA 5G02A 4J7CA 3AKDA 1R37A 1I80A 1GVNB 5BYAA 2R6ZA 3CLTC 4ZEWA 1ZZEA 3WXBA 3MD0A 3QE0A 2ZREA 1F2UB 1FFGA 2OBYA 4N3GA 2X2FA 3PJEA 2X1HA 2JKZA 3Q88A 4MKHA 3WYEA 5CB0A 3KE9A 2NVWA 3GBSA 1A82A 1G55A 1AKVA 1WTCA 2Z4SA 4GRAA 5F98A 1QJCA 4YUVA 1TAGA 2JGEA 2XE6A 3Q5EA 3K4PA 1S3IA 1EWRA 3RS3A 1TK9A 3V2UA 4OX9Y 6REQA 1ONPA 2Q4OA 2QHXA 2REOA 2YN0A 1KIMA 4L3VA 1RZUA 3R6TA 1GAJA 2VP3A 4FFBB 3ZLBA 1IY1A 3M8KA 2QL7A 3B89A 3G2KA 5HEKA 3AHEA 3SS8A 3T9CA 4FMDF 4CM5A 4Q9AA 2ZJ1A 3EOBI 3ZK8A 3P7MA 4F4UA 3R41A 1NGSA 1QRAA 1TF2A 3ZJUA 3NOXA 4I1UA 1T36B 5EP1A 3TSWA 1UQRA 5FWDA 3M9LA 1E89A 5C37A 2H11A 4IUYA 4N3NA 3GLHE 1LRLA 3L0SA 3RRZA 4BUCA 2CY0A 2QRVB 2C57A 3AP1A 3KOOA 4OYLA 2OZLB 4OA8A 4EVRA 2AW5A 4WY5A 4YFYA 5JAMA 3MCWA 4RL4A 2Q3DA 3QHQA 1R10A 3GRUA 5EJIA 5F1KA 1V11B 1H8ED 1YZHA 2FPPB 2NT3A 2X1LA 4QBTA 1B26A 1H6BA 3AUTA 4FWTA 1LK0A 2ESRA 1FSPA 4Y2XA 3O92A 1G7TA 1D4AA 2G63A 3AB7A 3MD9A 3NEAA 4GEGA 5EE0A 5JSYA 5I7OA 4GVLA 3FHTA 2VJDA 3W5VA 4BO0A 3EDCA 1GHTA 5IDVA 4UREA 2EWWA 1WSDA 4WFKA 3I52A 4CMEC 2ADFA 1TRKA 2Z4RA 2ZI6A 1CT9A 4LNAA 1BDMA 2Q8QA 4G0WA 1IB0A 1Y6JA 4HAXA 1TM7E 5A03A 2VUUA 2XJ4A 3CUWA 1ZDMA 421PA 4D4GA 3UHPA 2QSYA 3R9KA 3IEMA 4QHYA 4M9SA 1JHMA 5LBIA 1A5ZA 4ZQIA 2PSJA 3T5DA 2DWQA 2WWYA 4WD3A 3C7KA 3WDLA 4UDYX 3FYCA 3GQBA 2CV1A 3WKDA 5CLIA 1DEAA 2RHGB 5TV2A 5H3CA 3RC2A 3WWPA 2H2HA 1LX6A 4C7XA 2J9RA 1E3TA 3GVPA 2H52A 1XYVA 4O59O 3AIOA 1RS0A 1XL1A 2WIBA 1NBIA 4MW4A 1W88A 3DP9A 1FTGA 1KSGA 1AUPA 1OYYA 3AK4A 3EGOA 4UBNA 5FXMA 4MV0A 3BA1A 1Y7HA 2JVIA 5LQMA 4Q15A 1U2TA 3DB2A 1YZUA 3V46A 2BFDA 4KO4S 2XNSA 4ZT6A 1EVYA 1QVWA 2E6UX 1A9TA 1NPTO 2WLSA 4EJ2A 5GTDA 3W0LB 1IXZA 1OWPA 1JQKA 4H7EA 2FWPA 4BAUA 1PL0A 5B6IA 4Q3NA 1H2ZA 4N3BA 3I05A 2G3YA 4LOJA 1IRXA 4XR4A 4MW0A 1GA4A 3O2QB 4NAUA 5BXYA 4EL5A 4EG8A 1XRJA 5HMLA 3VO8A 4BQSA 2VSNA 1FP2A 2JGKA 4QVGA 1OHHD 1U0GA 1N8SA 3EVZA 4XLZA 2GRJA 3G0GA 3JRWA 5HDQA 4CQLB 1UPXA 1HSZA 5DNCA 3F8SA 4KWHA 1NC3A 4UFOA 4NDAA 2WJYA 3VR4D 1XCPA 2GN8A 3DOCA 3NEPX 2GLTA 2NUPA 4HB4A 3NXKA 4L28A 4RHFA 5E7IA 5EIFA 3E7WA 4ARAA 3KAPA 3R3ZA 1UBOS 2GYWA 3B52X 2FW7A 2VCHA 4HNRA 2CC2A 2XNCA 2YWGA 3GRVA 1SKYB 4F8EA 1P1HA 5TXGA 4D56A 1UJCA 1BW9A 2EQBA 1QHHA 1VPLA 2IVZA 4MRMA 4UOEA 3BSWA 4M0EA 1IPHA 4AQDA 4E6EA 2YHIA 3R6GA 1IM5A 3D0RA 3MS7A 2YMLA 4YJKA 1E99A 1KOJA 4R3NA 1ZCZA 2AJTA 1MOQA 3H2BA 2K2QB 1LFDB 1TJPB 1XQYA 2HJHA 3GP3A 4QASA 2ZROA 3Q7EA 4CL0A 5FF9A 2MTBA 1U7TA 5ALKA 5TVGA 2MINA 3Q9LA 4EJMA 5IKMA 4QDZA 3ETNA 1ZVQA 3NDBB 4UULA 4M8NE 3F5SA 1QC5A 3NBAA 4FNMA 3VJKA 3WLLA 2PXXA 4HRVA 4FR5A 5L4LA 4UUBA 2ZJ2A 1S2OA 1GPMA 3OUZA 5BQOA 4A03A 2CVFA 5IK2D 3UAGA 5IJ0B 3KKNA 5CPFA 1TQHA 4ZGWA 4Z3OA 3LC2O 3WX0A 3WAJA 5M7EA 4CGZA 3AR3A 3FWPA 3IPXA 3U7EB 2Z95A 1X1TA 3ZVLA 5I9TA 4BNFA 2NSLA 1WDTA 2Z57A 1Z4KA 5FLYA 1E3DA 4V38A 2GEFA 4OMCA 5GGYA 2QD3A 3GFOA 2DQSA 1R0ZA 3ULKA 3DA8A 3DL7A 3AXSA 3ICWA 3ELYA 3LUKA 4I1OA 2RG1A 1OYWA 3K20A 2QB5A 3PVCA 3WHIA 4H1VA 2G4VA 4S1VA 2B78A 1E2EA 4L07A 3DWGA 4G5FA 5D1HA 3KLOA 4JLUA 3L1UA 1RQ7A 1RW4A 5BPHA 3O31A 3SQLA 4ND5A 2PMEA 3HKDA 1GQRA 3HH8A 3EEOA 1F2VA 5KJ1A 3WOVA 1R3UA 3JVVA 3P5SA 2XUKA 5DGDA 5DW0A 3AH8A 5T41A 1KO4A 1T43A 4L8WB 4N0MA 3U7FB 4QODA 1HYGA 2ZYHA 2IDKA 1MDBA 1QBGA 2ZIZA 3CFYA 3EEQA 4R1SA 4QWMA 3SP1A 2VXBA 2QVBA 3IXLA 1NXVA 1R9MA 4CTOA 4QEDA 1KNXA 4IG4A 3KCQA 1PV1A 4BTEA 4L9WA 1CU1A 4UXJA 3OWOA 3VNSA 1R8SA 5DKFA 3PTAA 3MLEA 3RR2A 4TL7A 4WUVA 2BRUC 4QXAA 4B5LA 2AXPA 3G2JA 1QH8A 3LBAA 1QF7A 3V8MA 1GPYA 3R7WA 2ZSAA 3T34A 2I91A 4RXMA 1SOMA 3O9MA 2IUTA 3FR8A 1A9YA 4ZV9A 4QGAA 1E63A 1C41A 1K86A 1W46A 2JIZA 4Q4JA 2ST1A 1C7EA 2V4ZA 5HK8A 1UBRS 2A0YA 2H0RA 2DR0A 4LJ7A 2VH1A 4U6SA 4FONA 2DQYA 3LGXA 1PK8A 2O54A 5DK6A 4BN5A 1LRKA 1R18A 2XUQA 3FOWA 1TX4B 1LDGA 4JBLA 2ZRMA 3W8RA 4B6JA 3NAZA 2CK3A 3O8CA 4O4HF 4KUGA 3ELWA 1G42A 5JQGB 2I34A 4Z4IA 1DFIA 3GJQA 1CRPA 1IDN1 4LW8A 4UATA 3GMTA 3VDMA 4A8JA 1B15A 4EIWA 1RZ3A 1YUBA 2ASEA 4ZDIA 1Y98A 3II6X 3JQAB 1CR1A 1NX6A 5IHPA 2JASA 1P61B 1PT7A 4JVSB 5COAA 2NMVA 4DJFC 1J2UA 1OI2A 1P17A 1OGYA 3BJEA 2DB3A 2HWKA 3KQSA 4ZT5A 1XLUA 5GZ1A 3FTCA 2DLNA 2Z98A 5AM5A 1W73A 3MS2A 2W93A 2FF5A 2X8JA 4FB4A 1YI0A 4ND4A 3NHSA 4X71A 2GOYA 5JNVA 3LX6A 1EXMA 3TIGA 4GMFA 3ZD9A 1KK2A 1T5SA 3BULA 3VZPA 1VMKA 5IABA 3WQSB 3ZJ4A 3U61B 3KOXA 1RJ9A 2PXAA 4FS8A 5GONB 1TCAA 1G5FA 3WK8A 2IP4A 2NZ2A 1QO0D 1HOTA 3PE6A 3PXEA 4DSUA 5BV8A 3WRXC 4OP2A 1K6MA 1JVSA 1LV7A 1WW3A 4O1HA 1VL0A 4R7ZA 3S29A 4K9RA 1GRRA 1VSBA 2NAFA 4J0CA 1OIXA 4D9HA 4N76A 1QOQB 2PQ0A 1UWLA 5F3DA 4D8UA 4D25A 1E32A 1VXOA 1HNWB 3ER8A 1X9HA 5CR9A 4Z0HO 3V9AA 1A7KA 1WSAA 3HA3A 3HCBA 4G4IA 4E22A 1G3QA 5BPFA 3CGWA 3I42A 2G80A 3IV7A 4Q4CA 4Z2YA 4GBED 2JLXA 2GD0A 1W5EA 1TKAA 1QCDA 3AR8A 2Y92A 1MO3A 3JX9A 4E31A 1SHUX 2D62A 4HQRA 5T8KA 4GOJA 3AESA 2XBUA 3RV4A 5KNCD 1GGNA 2CNWA 3O7WA 3QFTA 5KHLB 1N32B 3E81A 3IT2A 4TM8A 1QG6A 4CFSA 4EEKA 3DVLA 3AXTA 1K88A 3UXYA 2APJA 4IX1A 1CUSA 5REQB 3AHFA 1VG9B 1E7RA 1RAIA 2PCLA 3PNPA 2G25A 1FFAA 4LJ8A 2GYVA 1PI3A 2ZBVA 3N2EA 4LX0A 4XWTA 4F5YA 5CCBA 4KJZA 2ZQYA 1CJBA 2HSEA 3L8YA 3P2OA 3IQFA 1S8FA 3KG2A 1OTHA 3QP9A 4WV3A 2HO4A 4EATA 2XCRB 3ZWPA 3ZE8A 3X1DA 4HDRB 4MVJM 4JLOA 4FT4A 2IQIA 1CZHA 5FA6A 5BYBA 3GEHA 5B3AA 3T9FA 1KC1A 3R9WA 2DWOA 3TCKA 5B2EA 4FVTA 1MHPA 2VTKA 3QVLA 2J0VA 3R5JA 4KFTA 3EB9A 4MLPA 4QLAA 3TPZA 1K6XA 1TD9A 2F43B 1GCOA 1UADA 3OIFA 3KZ1E 3VO2A 5KSYA 3MW8A 2V54A 3WMRA 2ONKA 3E9QA 5EMKA 3WHPA 1O4WA 2R11A 3H2ZA 4NLLA 4P98A 4RFSA 1F8FA 4MDYA 1XXHA 3ESQA 3P97A 5I47A 1BDJA 3GT4A 3NR2A 1TMOA 2WBLC 1CR0A 1NVGA 2FWRA 3O94A 1RWXA 4L08A 4A0FA 5ILQA 1A9XB 4MV5A 5P21A 5CFLA 1SUPA 2IXTA 4NZOA 1LI7A 3VC1A 1CF2O 3AFIA 2NYRA 4JGGA 1Z0AA 1CDDA 4AY4A 2NZXA 2OXCA 4FGLA 4R1QA 1SELA 1AKUA 2GM9A 1U04A 4MVYA 4YXWD 1EFUA 1NLZA 1GCGA 1R2QA 1V7QA 2C9MA 2VHWA 3DBLB 2WC1A 3HGTA 4MQ6A 4BHTA 4ENTA 4PLWA 1Z5OA 3OPNA 1IAQA 2E6KA 3K8YA 1X7YB 2HU8A 3IQXA 3JQBA 4P83A 4TSRA 1ISIA 1M6YA 2BKEA 4P81A 3UXMA 4GLJA 4HDMA 2XPCA 1QH1A 4LA4A 4NBKA 3GDOA 5IVPA 3KUDA 3CF0A 3KXLA 4BB0A 2W2VA 3C6KA 4O4HA 3HKEB 3BL6A 2WV7A 2Z3WA 3VR0A 1EUYA 1SRQA 1RHRA 2BFBA 2WF7A 3UKOA 4BMCA 1WCV1 3D4IA 3BD8A 2L17A 1YTLA 4BEBA 1JJIA 5JAPA 5CVUA 3FMVA 3DV9A 3KT8A 3OVMA 5CIQA 1ZNQO 5BUQA 2Y71A 3QMPA 1MGOA 1MOSA 2J08A 4DAOA 1AGRA 1CRZA 2QJTA 3PJGA 4M60A 4MRRA 5LQDA 2JNWA 4ZI3A 1Y6FA 3IT3A 1QQBA 4W8HA 5ITZA 4OGFA 4LQLA 3EQ2A 2YJNA 4FU0A 1BNCA 5KSWB 3CE6A 1U4OA 1NJ2A 1U02A 4F8JA 1UR5A 2J30A 1CY6A 3W7BA 4D8YA 2AC4A 2JVKA 1JKIA 3BMQA 3GJZA 1JA9A 5DEOA 2X8WA 2RGYA 3A0RB 5IUNC 1J25A 4P53A 2BDTA 1KXZA 2JA2A 3AV0B 4Q39A 3R77A 5TPZD 1I14A 2R4QA 3RVBA 2X5NA 3SIWA 2HHLA 3EZLA 2IU6A 3OJEA 2EERA 4J4TA 3TS1A 3MJVA 2M6RA 1JSZA 3B3QA 3W6PA 4BRZA 4PR3A 3Q2OA 1HQYE 3NDPA 2ZLBA 4JD5A 2F3SA 4R6XA 1HORA 4NE7A 5KTPA 1V3UA 4ALJA 1HMPA 1K06A 1UJ2A 1SEVA 2GD6A 2WM2A 1MOZA 1OWMA 3IV9A 1FB5A 2R7NA 3LLCA 3Q3GE 3QOFA 4MDHA 3A1FA 5DM2A 1K89A 2JDID 4MIYA 2HDOA 4FSXA 1W85B 3D4OA 5FTWA 3V42A 2PUEA 3DW3X 3FCEA 4IVQA 3COVA 5JCJA 2IS4A 4YO7A 4HLNA 3OQIA 5FV7A 5KIAA 3IUNA 1J0EA 5EJ5A 1UMBB 4NYIQ 2OG1A 3ZW9A 4WOKA 4K2HA 3IO5A 4NX2A 1YRBA 1J7JA 4EABA 3O9VA 4XJTA 3FIUA 3EC7A 5FAKA 1C0KA 3EFOA 1TAUA 2KW5A 3MUFA 1H9AA 5K8TA 5EWLA 4YALA 1H94A 2VJNA 3BWEA 3USZA 4U0JA 4YRAA 3BERA 3MEQA 5BW8A 2YRXA 4LJSA 1QR2A 4UQLA 1Q22A 1R4NB 2IYOA 2FSIA 2YVUA 4B2YA 5E6UB 3NDJA 1M9NA 4C0BA 3ZVKA 2EIXA 2QRQA 1GL3A 1IBLB 4A26A 4OJQA 3DE7X 3QVGA 1XRNA 2J9ZB 4ZYXA 1ZIXA 4ZYYA 3EIFA 3EUAA 3FCYA 1BFKA 2WU8A 3EZFA 3QYFA 4R3WA 4UNQA 3AR9A 4REQA 4EI7A 3TEJA 2VYVA 1RFGE 3F6SA 1W19A 3INGA 1IEWA 2WOJA 3RC9A 4W9MC 1DNPA 5AJZA 1SVLA 4UE6A 4UZEA 3JQFA 5F35A 4YUZA 4C5BA 3GRFA 4JI3B 3ZE0B 2CLLB 2DHRA 2WQ6A 1ND5A 5DX1A 4YCNA 2C99A 1V1RB 1CSEE 2DUMA 3KPJA 4AZ3B 1YMVA 2Z08A 3REQA 1HC7A 1R4MB 2IU4A 3G6WA 2XVMA 3IBGA 1E2DA 1FSZA 2JGNA 4MB2A 3RDPA 3AF5A 3W2GA 1G38A 4AN4A 3AWDA 3HNPA 4X45A 3G9UA 4TTJA 2AIRA 3A9WA 3L02A 3M6VA 1ULAA 1VE6A 4PEVA 2Z6UA 3PD1A 4MZXA 5KQLA 3M4JA 1BXRB 2ZRDA 2R1TA 1UC5B 5FOXA 2YYZA 3F7OA 3SKYA 4J3JA 1GAXA