3WYGA

Crystal structure of xpo1p-pki-gsp1p-gtp complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
VPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gsp1p
publication title Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae awri796
molecule tags Gtp-binding protein/gtp-binding protein inhibitor
total genus 51
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wygA00
1N5JA 4JYCA 2GJKA 3OAAA 2RB4A 4JL5A 4WVFA 2WJJA 3ADDA 3TAUA 4CEHB 2DPXA 1T8TA 2NZ8A 3B1VA 2QP4A 1TEVA 2CXXA 3AKDA 4HAVA 1FL9A 1WCV1 2W83A 4W5HA 5P21A 4I4LA 3KQLA 1FX0A 2FDCA 1C4OA 4G1UC 4HUQB 3VR2A 2C99A 2OCYC 1L8QA 1DAHA 2NO1A 1NBMA 1UKYA 3U61B 4NYJQ 2W58A 5KUTA 2AKYA 3U4QB 2XEXA 3C41J 1M7BA 2FEOA 4TMWA 1MO5A 2J41A 1AS2A 3GLFE 1XD9A 3A37A 5IK2D 3QKUA 4DDWA 5KSPA 2XSZA 2PLRA 3ZZ0A 3K0CA 1FP6A 2V7QD 5FTNA 4DCVA 1R5OA 3CX8A 4B74A 1E9SA 2ZYVX 3AKCA 1Q3TA 3DO6A 2ODNA 5KOYA 1E2GA 1F2TA 3RS3A 5DI3B 3RS5A 4DSTA 2FMXA 1KSHA 4O0MA 2IS4A 3U3RA 1FZQA 1AZSC 2P2LA 2WVJA 2ZROA 4WIAA 2W6JD 3UIEA 2O8FB 4DCSA 2ZYUX 5C46F 5CITA 4FI3C 2BM0A 3DOEA 1Q22A 3JZAA 2IYTA 4XTCS 4M2LA 1KMQA 221PA 1XX6A 4KBGA 2J46A 2VSXA 2LCFA 4DC9A 3RS7A 4DDUA 4MDFA 2ZSAA 3KFXA 3VHLB 1X86B 3I62A 3TKLA 1GRNA 2BBWA 2H17A 1WXQA 2RGNC 4LDJA 3LVQE 3QKRA 2V7QA 3GPLA 1YKSA 5CLLA 1KMHB 4IHQA 4IOLA 1GNRA 1OE0A 1JEEA 4EPVA 1XEWX 2Z0MA 5CYOA 3IQXA 4XIGS 1NNEA 1HEIA 2QPOA 2ZYWX 4B34A 2NTYC 1NBME 5FUWA 3WRYC 3SYLA 2OLJA 3MUFA 3DZDA 1HTWA 3PQCA 2YINC 2CEAA 1KKLA 4NBSA 2QZ4A 4TMTA 2QSYA 1F2UA 2I4IA 3W8NA 4TL6A 3EG5A 3FWYA 1MRSA 5J4LA 2XGJA 2IT1A 5JHGB 2G1KA 4EUNA 1F5NA 1CBUA 4QJ5A 3Q5EA 5DISB 4ZI3A 3PUXA 3GFOA 5FPYA 1E94E 4NONA 4QHTA 3RRMA 4O2LA 1RIFA 4LHWA 1Z0FA 1KYIA 3FOZA 1R5BA 5G3ZA 1NN0A 2C95A 2IUSA 3MJRA 2Z43A 2ZSEA 4PZLA 4IDNA 1GKIA 2PLFA 3KXLA 2IUUA 3ZQ6A 5KU1A 3GJXC 5KYKA 1XPUA 2QP3A 1ETUA 4KU4A 1S2MA 4LC1A 4LJ7A 4G5SA 5IT5A 3VX4A 4JLMA 4US0R 4QXAA 4BEJA 2QSZA 4V0NA 3D8BA 1DAEA 2ERXA 3JVVA 3CR8A 3CONA 5GVRA 5EE5B 3F8TA 4B3CA 2GDJA 3WP1B 1GG2A 4KXFB 1WF3A 1D2MA 1II0A 1VECA 1SVWA 4DSNA 2OHFA 5KDOA 1N6RA 2X1VA 5FH9A 2VHQA 1MT0A 2REOA 5FUYA 3PUZA 4KYIB 3MFYA 2FX3A 2IHBA 1U90A 4PO8A 4ZCMA 5CB8A 4IDPA 4M1TA 2VO1A 2GJSA 2D62A 1YU9A 3EAQA 5G41A 3CRW1 5HCIA 1D2NA 2WMOB 3TQFA 1S9HA 2ZJAA 2UVQA 1IY2A 2EWWA 4DLZA 2N42A 5J4YA 1NJGA 3TQCA 2W2XA 5HCNA 1ANKA 4LV6A 1L4UA 3MD0A 3QIAA 1HV8A 2WPDA 4FMCB 2EYQA 3P27A 1X6VA 4Z1MD 3NH6A 2WJHA 4BLTA 1US8A 4Q18A 1XTKA 4ZKEA 5AJWA 4WXRA 2AX4A 1EFTA 4HDOB 1WBBA 4BASA 4E09A 1B23P 1GRRA 3GJ7A 3P32A 3CNOA 4P4UA 1P2VA 4BLRA 2W2VA 3E2IA 4QGGA 4LPKA 3QSYA 2YJTD 2AR7A 2B21A 1N0VC 2WIBA 4Q5IA 1E9CA 1U81A 1XCMA 5L3RA 1FNMA 2ZJOA 2F3RA 4WOPA 2ORIA 3FB4A 1OHHD 1R8QA 1PJRA 3ZZUA 2FV8A 3UMRA 2IYLD 2Z83A 3R20A 2PZFA 3RDPA 3RS0A 4ITRC 4JLDA 1O3YA 4NCNA 1P6XA 4DLUA 1QZXA 1WRBA 1OFTA 4LYHA 4QHSA 4Z1MA 1ZUHA 2ZANA 1U9IC 2QGNA 1YZGA 2HYIC 2OEPA 3QF4B 3MWYW 4ASUA 4CT4B 1U0HC 1XTJA 1E4YA 1XU4A 1VKJA 4M9SA 4RFVA 3SJCA 1KZ7B 5BW8A 3R7WB 2KBEA 1BKDR 1G8GA 4Y0AA 3ECCA 2VP5A 2HLDD 4CRWB 2F7SA 1JBKA 1GNQA 1RYFA 2WWHA 3WBKA 2P6UA 5FI0B 4ZDIA 5FUXA 2A5FA 1FW6A 3SFZA 2HF9A 3LNCA 3U44A 1JPJA 4QJ4A 4D0NA 4DDTA 1LF0A 4LHXA 3GJ4A 2ORVA 3RRZA 4E22A 1OKKD 5BWMA 1OHHA 2IF2A 2SHKA 2IX3A 5B57C 521PA 4CT5A 4B2IA 4B43A 4Q4AA 3I5YA 2J0UA 1RKBA 3VQTA 5DH9A 3H86A 4RCYA 1KI7A 4JT4A 5FPHA 3T06B 4PHTA 1KJYA 4ZDKA 4GPTA 4XWAA 3U6KA 5EZ5A 3K53A 4XSGA 2FE4A 3N2IA 2A7QA 1XPOA 1JJVA 1EFRA 421PA 3RAPR 2GF9A 1XEXB 2HLDA 1BOFA 4MKGA 4V0LA 4ZIRB 3QKTA 3AP1A 4RD3A 3CRRA 1SXJD 2AN9A 1NN3A 1XMIA 2ZSFA 1OKKA 4A8JB 4TLDA 1OXSC 5HKKD 4FD2A 3AUYA 4LRWA 4EIWA 2C78A 2ZYTX 2OFOA 3CNNA 4PXAA 2AD1A 3BRWD 3W6NA 2ZITA 1OXTA 3RS2A 3RRYA 4TZ6A 3FMIA 4CEIB 2BOVA 3LX5A 3X1WA 1OB5A 3WHLA 1HUQA 2RHDA 4B3XA 1ZCAA 1MH1A 1W4CA 1U8ZA 1E0SA 2JLVA 4PC2A 1JXMA 4HAXA 1TPZA 2RGDA 2XOKD 4URXR 2ZU6A 1DOAA 2V4ZA 1SXJA 2ZJ5A 2V54A 1CLUA 1D6JA 2VBCA 2Q9CA 2AK3A 1Q1BA 1Q1EA 2GZAA 4K8OA 1DPFA 2RHMA 4N0EA 4HLCA 3SJZA 1RJ9B 5GJCA 1AJEA 2WWGA 4J0QA 5TY0A 3KX2A 4AI6A 2EVWX 2R8RA 3EXAA 2J0QA 2G6BA 2VQSA 1Q0UA 2X19A 3B60A 1TF2A 3EW9A 1E9DA 4B48A 2YHSA 5FPKA 2EFGA 4F7WA 3AVYA 2FZLA 2R44A 5FPTA 2GVDC 2BMEA 4TL7A 3QY0A 1CR0A 3WMGA 1W2GA 1ZM4A 4EJSC 5DI9A 4BRWA 2OZEA 3HPRA 2ZE7A 4Z51A 3LAWA 5SZKB 3A1TA 4OL0A 2GJ8A 3GP8A 4O2RA 4L15A 4FCVA 2QPTA 2C98A 2NZJA 2V6IA 1AGPA 1F2TB 3E1SA 3T5GA 1Z6YA 4LV5B 4Q02A 5JSZA 1OH8A 4I81A 3A1VA 3V9PA 2G9NA 2EW1A 2FNAA 1F3OA 2ERYA 2YZ2A 2UKDA 2A3RA 4GOKA 1KY2A 4WXPA 1I2MA 2NO6A 3LH5A 2W00A 5CM8B 4PHFA 2ZRDA 4BUJA 4YDHB 2KSQA 2IA5A 2V55B 1SXJE 3DHWC 5CB6A 5F9FA 3GMTA 1UM8A 1N6OA 4BZPA 1E2LA 1XNJA 3THYA 3U60B 2H1LA 3C5CA 2OESA 3EZFA 1P2UA 1QG2A 1CIPA 2C2HA 2E1RA 2WWFA 3BH6A 1GUAA 2ZR9A 5CDFA 1E9BA 3CW2A 4BFTA 1T0JB 4CEHA 4V02A 1MO6A 1T5IA 1AIPA 2G88A 3UK6A 4C0SA 2CCKA 4F38A 3GLIA 3IQWA 3IDQA 5BQ5A 5H8WA 1T91A 2A5YB 4JIMA 2ANBA 5JBQA 3GLHA 2RH5A 2QTFA 4OI1A 1W1WA 3LA6A 3U4QA 1P75A 2XJ4A 4PSVA 3SHWA 2BC9A 4MKHA 1F2UB 4XVRA 2KBFA 3TSWA 4TSFA 2CNWD 2OBLA 1G16A 1VYVA 4ZI2A 2GAAA 2J0SA 2WJVA 3MMPA 4V0OA 4Q9KA 1EX7A 1HH4A 1QRAA 3EPKA 2IS1A 2O0HA 4OHXA 1MABB 2O8EA 2YWFA 2IYXA 3MWJA 2F9MA 1R10A 1YE8A 5E7JA 1XJCA 2GESA 3K0AB 5C1BA 2O8FA 1GM5A 4PQFA 5JJIA 1VPLA 4ZCIA 4IOMA 1J8MF 1XTSA 1QBKC 2FPKA 3K9NA 4MITA 2RGAA 3B1YA 1E2KA 4M8NE 5UKDA 1BMFD 4BFVA 4HI0E 2PEZA 1FOEB 4I1VA 2ASEA 2OBMA 4HLUC 2YYZA 1ZM7A 1KMHA 2X8AA 4DUGD 2A2ZA 3K9LA 5CDFE 1HYQA 2YKGA 3AVWA 2AFIE 3R8CA 2QPAA 1SULA 1BO6A 3D6TB 3ONWA 5EXXA 4AKEA 4PQYA 3GLIE 4DB2A 2XNDA 4ARZA 2QUZA 2PZEA 4C4PA 3GLHE 1G8PA 3K09A 1QHHA 3MRSA 4EPWA 2PJRA 2XAUA 4Q1FA 4AD8A 4TYWA 1KNQA 1N6IA 2J1LA 4PC3A 1W0JD 1M2OB 4R98A 2OG2A 1IN4A 1ZAKA 4PAQA 4DUGA 4A6XA 4IVPA 3DOFA 4DEXA 1TAGA 4HUTA 3U7HB 5DNYB 2BWJA 2QMOA 5H1YA 3TAHA 1RYHA 3EZ2A 4PAMA 3SFVA 4BFYA 2Q0HA 2REBA 3FMPB 1Z8FA 3FKSA 4PO1A 1D9XA 3LWNA 5SZJA 3NBZC 1T3SA 3OIVA 1NKSA 121PA 3Q3JB 1RW4A 1Z3IX 1NL3A 2HCJB 4HSEA 5G40A 1TQ6A 3RSLA 2OILA 4GT1A 1G7SA 3CR7A 5JS8A 1TMKA 2R65A 1G7RA 1W0JA 1KHTA 1I4DD 3I73A 2FWRA 1AGRA 1KK2A 2AL7A 1YHNA 1VIYA 1OXXK 1E9FA 1QHSA 2XXAB 4F92B 1Q12A 1XBTA 1OH6A 3I61A 3CIOA 1GKUB 1SVLA 2DFLA 3TE6A 3UWKA 5FBVB 4DWJA 3H84A 1KAGA 4OBEA 1E6CA 1XMVA 4UNSA 4U7DA 1JAIA 2EFEB 3IEVA 3MSXA 3W34A 4FIDA 2Q9AA 2C8VA 5SZIA 1YZUA 1N25A 1BYIA 4KITB 2JATA 1UF9A 4MUBA 4S35A 3ZS8A 4AKIA 5K8TA 4GP7A 3KJHA 4IFEA 4QBFA 3U3JA 3Q7PA 3PV0A 5DGXA 1NP6A 1P2SA 3MJHA 1YR7A 1J7KA 1DVRA 1EESA 2AXPA 1N0UA 2HDNB 3GJ5A 2F9LA 2BKEA 3KUDA 3LBNA 5C4MA 1S3SA 3FYHA 4IVQA 3AGQA 1NVXQ 1LY1A 2FFHA 3SNHA 5BN4A 1XP8A 3EIEA 2WICA 3B2EA 5C4GB 2J5XA 2AK2A 4B3DA 4MYUA 3IIJA 3QKSB 1KO5A 5AJZA 4KFTA 1LB1B 3QVVA 3ASYA 1M6NA 4LHYA 4BFZA 4OHZA 4A0GA 2DYKA 4DEYA 1TEXA 1TUEA 2QQEA 1R0XA 1XB2A 3TJZA 1IBRA 3N70A 2QE7D 3SS8A 3UANA 1MOZA 4CDGA 1QVAA 1UKVY 3QF4A 1Z08A 3RABA 3NC1C 2R6DA 1Z0JA 4TMKA 2DWQA 4XSHA 1OW3B 1CJUC 3EC2A 2QENA 1OF1A 4UXJA 2CHQA 1PVOA 4ZPXA 4QBGB 2O5VA 4JBYA 2JIZD 1N5KA 2IYWA 4M22A 3C8UA 4OI2A 2FSIA 1G8YA 4QG7A 1G7TA 3QXHA 4RD2A 2PX0A 4NCJA 2C5LA 4DLTA 2Q3HA 1SXJB 3MWLA 4TTPA 3EWSA 2ZVQX 3L0OA 4W9MC 2OCPA 4HB2A 1DTSA 3BH0A 1CJKC 1YZNA 3B1ZA 1XZPA 5JZVA 2QE7A 3DKVA 4RJLA 1KKMA 4BFSA 3K9HA 4XJXA 2WAYA 3IUYA 3PUWA 2O0KA 2ATVA 4UNPA 1OFUX 3RNLA 3LW7A 1NRJB 1XEXA 4KJZA 4LY6A 1GDDA 5FBWB 5KTYA 4LCBA 1KK1A 2GBLA 1FQKA 3P4XA 4ZIRA 4C7OA 4OI4A 3FFBA 2IEYA 3LVRE 3PUYA 4G5QA 1DAIA 1GWNA 4KFUA 4A0HA 2IXFA 4LYJA 1VG8A 3QI2A 1GRQA 1W47A 2NO9A 3BK7A 2R2AA 2CK3A 4CZ2A 5HTKA 1IJEA 4MRSA 5GADl 4BFXA 1EWRA 3NBYC 1KOFA 1NI3A 1CKEA 1P9RA 3MG9A 1GVNB 1ZUNB 3P26A 2DHRA 2DB3A 2JDID 1Z29A 4HAUA 4PC1A 5FTMA 3UG7A 1W4AA 5BN3A 5LPNA 4JVMA 2YNMA 3REFA 5H70A 3KKPA 4OHVA 4NHOA 3T12A 4NYIR 2PMDA 4D0GA 4E07A 1TUIA 4G3XA 1E0JA 3B1XA 3ADKA 4B75A 1ESMA 4WBSA 4UNQA 5TXGA 2ZJ2A 1N6LA 2G0NA 3E70C 4I1SA 5J47A 4JVLA 1N2CE 4X8LA 1W48A 2XJ9A 4YXWD 4R71A 3V00A 3LQQA 1VIAA 1RJ9A 3DM5A 4R9UC 3DDCA 2CJWA 4RKFA 4GZLA 1F60A 1SZPA 2FFBA 3BC1A 1ZIOA 2CVFA 3SN6A 4DSUA 2JCSA 2BBTA 3TUZC 4Z8YA 4B35A 5B30A 1E69A 2KB0A 1AZTA 1E2HA 3GLIB 1YR8A 2B7BA 4HB4A 4W7SA 1CU1A 3GLHB 1GL9B 1E99A 3OIUA 1Q21A 3NG1A 3OEHD 4S2EA 2PL3A 2MSEB 4JBWA 3SZRA 1MR3F 4C2TA 4ZCLA 4DCNA 5JRJA 2ZSBA 4P31A 1ZC4A 4V03A 3QEOA 1YR9A 1W4RA 2FF7A 1E1RD 4L9SA 1PLLA 2DFTA 4C0LA 5JHHB 2HEIA 4MYCA 1S96A 3U3KA 4Q9HA 5JWHA 3GJ3A 2BV3A 4B2LA 2ZI9A 2A5GA 3JZMA 1OYYA 4AKGA 1S3GA 1PZNA 2GF0A 3NHAA 4PPNA 3IO3A 3L8YA 3TVTA 1Z83A 2O8EB 1ZD9A 2BBOA 3L2OB 3QJYA 3LBHA 4YQFA 4L8GA 3N2EA 2PJZA 3KXKA 3ZIAD 2OM2A 3I32A 3SBEA 1E9RA 1EXMA 4IDHA 1D9ZA 3DMNA 3O8RA 2GNOA 2FU5C 3QG1A 3THOA 2W0MA 1II8B 4MGYR 4ABYA 1NVWQ 4DKXA 2BCGY 5KSYA 2FSGA 3OEHA 1E0KA 3Q7QA 2ZVPX 4FMDF 3MLEA 3H2YA 4LI0A 4TWZA 3AP2A 2V8OA 4M21A 2R6FA 3TR0A 1SHZA 1Y3AA 2ZS8A 5IK2A 1NF3A 2JEOA 5LB4A 4MRRA 3IGFA 1QHGA 2QMEA 2QY9A 4LJ6A 4MYTA 4JVSB 4ZO4A 1A2BA 5DLQC 3AF3A 1HA3A 1YQTA 5L8VA 1Z63A 3SU8A 1SVKA 1SVIA 4C0AC 3EPHA 4A92A 4JVNA 3AP3A 3RC3A 1O87A 2VHTA 2NGRA 1GL6A 2I1QA 5CLQA 2ORWA 2J87A 2W6JA 4ARZB 4A2QA 1BH2A 3ZIAA 3NTUA 3QG5A 1KI8A 4HATA 5JLJA 1QHHB 4PSKA 4YMWA 2XITA 2ZAOA 4RKEA 1E32A 1P9NA 3S1AB 5CIWA 3ICQB 3PG5A 1DO0A 4B44A 1Z22A 3ZQJA 2J3EA 4OQLA 2DWPA 4L9WA 3U7FB 4TMXA 3UXMA 1E79D 2OO7A 4RCZA 4LBWA 1VG9B 1ZNYA 4LGMA 4Q1AA 2O8CB 3EPLA 2QBYB 1MRNA 1MABA 4CVNA 5KDDA 2ZJ8A 5H68A 2GK7A 5ELXA 5DYIA 2GWHA 3K0AA 1JQLB 2BM1A 2QNRA 3CO5A 1QHIA 5EUMA 4OK5A 3CRVA 1OIVA 2GA8A 1DAKA 3LBIA 3EZ7A 2ZRPA 4PX9A 3BB3A 1NMXA 1G17A 1GOTA 2QL6A 4EFMA 2BDTA 2L0XA 1FFHA 1IXRC 1P60A 3VKGA 1X8JA 4D82A 4FMDB 2HJVA 1CTQA 5GVSA 1SQ5A 4NKRA 1Z0DA 3Q72A 3SHFA 3LFUA 3LXRA 2JJ8A 4LPSA 4OK6A 2C77A 1NSFA 1ZM3A 4FW9A 3NKVA 2ZRLA 1ODFA 3PEUA 2ZRJA 3RANA 5CYPA 4KI0A 4G5GA 3G0HA 3FKQA 3FHOA 2TMKA 1C1YA 2KWIA 1ZW6A 4QNRA 2G3YA 1KJWA 2VP2A 4HZIA 3RHFA 1DARA 1N6HA 4JSYA 2ZEJA 2HXYA 2HT1A 3NIBA 4LC0A 2GHIA 4FWTA 3THXB 1U99A 4PTLA 2B7CA 3ASZA 1YRBA 3VNVA 1XD2B 3SR0A 2VYFA 3BORA 3NDPA 1HQYE 1T9HA 2OAP1 4RZUA 5TARA 1NLFA 4NMMA 4D80A 2G83A 3BOSA 4LBYA 3ZVNA 5EP1A 4PPQA 1K6MA 1YVDA 1YRAA 4YMUA 2IW3A 5IRCD 3LDAA 1RVDA 4P33A 1TF5A 1RFLA 2WWWA 3LD9A 1G4AE 2OV2A 3ZVMA 4V0KA 2Z4RA 4Q1EA 1FTNA 2XB4A 4ZDWA 4HAWA 3WYFA 5LD2B 4DIEA 3J81k 3W5IA 3AF1A 4D4JA 3TVDA 4C2UA 1F6BA 1GKYA 1LTQA 4OQMA 3WYGA 1KK0A 1M7HA 2PH1A 3AF2A 1JR6A 3FHCB 4A0FA 2F1HA 4MGZR 4U00A 1RC8A 1BS1A 4GOXA 1SKQA 2ODEA 1CS4C 3KB2A 3AH8A 1W46A 5LDDC 1PUIA 3EWAA 3AVOA 4XH9B 3AEZA 3H4MA 4EPXA 2ZJYA 1XZQA 1JQJC 4MKFA 3QXCA 4F4CA 2RGGA 3T1VA 2ZQ5A 4D4KA 4P4SA 3BE4A 3BFVA 4HLDA 4C0QC 2ZTSA 4A8JC 1EK0A 2JLUA 1OXUA 3QXXA 1ZP6A 4D4MA 4JJZA 4ESVA 2ZI4A 2P67A 2AWNA 3B85A 3C4JA 4B3BA 1A2KC 1AS3A 3OEED 1XTRA 3NXSA 4HZUA 2WKPA 1W36D 2ZS9A 4B73A 1ZNXA 4M1YA 4A36A 4G5OA 5JI3E 5K8LA 1UBFA 2EYUA 1NVUQ 4KAXA 2LKDA 4TQ9A 3I8XA 4BFUA 1FMLA 4QHYA 2YOGA 2ECKA 1YR6A 4BGDA 2DBYA 1EG7A 3KZ1E 3U3OA 4L4UA 3AV0B 4UNRA 2WJYA 4JYBA 1A82A 4E5UA 4MDEA 1NLYA 2XTMA 2BMDA 4JLJA 4B32A 2YWEA 5EQTA 5AWFC 1KI9A 4MA4A 4MGIR 4GSYA 1QHYA 2Q9BA 2QAGA 1YZKA 4C0KA 5GJBA 3SC3A 3HDTA 4G01B 4DLRA 4TYQA 1R0WA 3X1DA 4BRUA 2WV9A 1EGAA 3QKSA 4YMSA 3IHLA 5HR5A 1P7CA 3U7EB 2QMHA 4C7OB 3LXXA 3WNDA 4US1R 4US2R 1XFAA 5D3QA 3P20A 4B6EA 2E9SA 1NIJA 1H8HD 3L0IB 3VR3A 4FMBB 2J9RA 1ZMXA 2N1BA 5G3YA 3M0EA 1QG4A 1W5SA 2PT7A 4AG5A 1RRPA 1V5WA 2OUKA 5HZKA 3SQWA 1CJMA 3K0CC 3TSZA 4A2PA 4QGHA 1ZNWA 1NMYA 3B7GA 1G3RA 4M1KA 4EQ6A 4AWXA 4PZYA 4URZR 3QF7A 3HWSA 4JBXA 1CEEA 1KI2A 4Q7MB 4GFDA 3ZS9A 4H1UA 2PEYA 3SDZA 2D7DA 4L5BA 1Q3HA 3KQHA 1PLKA 1XPRA 2GEDA 3CPEA 2H5EA 1U0JA 4MH0R 5CM9C 5HKKA 2X77A 4KCGA 4PANA 3HPQA 3OIYA 1NMZA 4KSCA 4W5WA 5HE9A 2CJWB 1SKYE 2F1IA 4YMVA 1GZSA 3VMFA 3NHBA 3B13B 3CM0A 4JLPA 4NYIQ 4A9AA 1KO1A 1G5RA 4D2IA 5FR2A 4DLVA 1E9EA 1I2DA 3D7MA 5JRZA 5K8IA 4DZZA 4TYPA 1K8RA 3T5DA 2XXAA 5EE3A 3VU9A 3PFIA 3AVVA 3AKEA 3LLMA 4Q01A 4M1WA 4GI7A 3LV8A 5FOXA 4BLSA 2CHVA 2VP0A 2XOKA 4IDQA 4M9QA 1WDTA 1X3SA 2HXSA 4NPHA 2P6NA 3AVTA 4YMTA 5KHOC 3UG6A 4C0JA 2RAPA 3U3MA 3DEFA 3ZVRA 2CLDX 3L0PA 3WHKA 2V3CC 1JAHA 4JT2A 5HE8A 5F3WB 3QEJA 4BE7B 4YDSA 1MO4A 1L4YA 4EPYA 2O8BA 2XZOA 1ZVQA 3CWQA 1KNXA 1VCOA 4NZYA 2WAXA 1Y63A 4ACBA 3L82B 2WSSD 2F3TA 2IHYA 4P0TA 4E03A 4Q4LA 2ZXUA 2DR3A 2CL6X 1RRCA 5JS7A 2GCOB 3SBDA 4TMVA 5FI1B 4R2HA 1W4BA 1KI1A 1IJFA 2HF8A 2OBNA 4B3FX 1JPNA 2ZI5A 2YV5A 5TDHA 2GCPA 2IF0A 2YWHA 2PZGA 2FJUA 3V4RA 4PPFA 1OH7A 1CP2A 1KI6A 4AKHA 1VCIA 1AKEA 5HPYB 4Q1BA 3AF0A 1DEKA 3DM9B 4HAZA 5FBQB 4BECA 4BEBA 1VCMA 2QEQA 5IDVA 4NYJR 3A36A 1R7RA 1BYUA 1XEWY 1JJ7A 1U8YA 1TQ2A 2HUPA 2ZIAA 1HY3A 2QN6A 2IXGA 3NBFA 2GEUA 2JLRA 1IN7A 3BAFA 4JL8A 4NL4H 4KSBA 2ZRCA 3GLGE 2ZRMA 3C7KA 2RGBA 1LFDB 2CHGA 2VHJA 4EDHA 5KPJA 4DJTA 3N5CA 3EA5A 1KJZA 2GZHA 4KFRA 4LUCA 4EJSB 4NCKA 4TT3D 2JLZA 3EX7C 3K9GA 4PZZA 3NDBB 3RWOA 4LX0A 2HYDA 4GZMA 3A1SA 2FFQA 1BIFA 1SVSA 1RRGA 2VHCA 1II8A 3HU3A 5BN5A 2P6RA 2Y8EA 1TX4B 1J70A 3A1UA 1CJTC 3H0KA 1OFIA 4Q66C 4H1VA 2CNWA 1B0UA 1AK2A 2VSOA 1IY1A 1K5DA 3CBQA 3TSOA 2FFAA 1J2JA 1UPTA 1W44A 2QM7A 5JFGA 2VHUA 3TNFA 3SI7A 4DHEA 1IM2A 2IXEA 1J99A 4AIIA 4M9ZA 5DN6D 4WA7A 5JJLA 3M4YA 3SOPA 3HYRA 5JEDA 2GVZC 2YC2C 4N3NA 5FOSA 3C14C 1EX6A 1EFHA 2RMKA 5G53C 1UKEA 4G0NA 1YZQA 4Q4HB 4URWR 3KL4A 2RGEA 1S4QA 3S1AA 1IN5A 1OV4A 4Q4JB 2OAQ1 2OFXA 3NBXX 3GCGA 3WXMA 1ZM9A 2ZRKA 4DCTA 2H18A 3I4LA 2CBZA 2VH5R 5EP4A 1BMFA 2J7KA 1E1QD 2O8CA 2P0EA 3TW8B 5CK5A 1OXVA 2QBYA 2VPPA 2WTUA 1I4TD 4AG6A 4LK2A 5KNBA 3VKHA 2ZRFA 3UATA 3B1WA 3LW8A 2BIFA 4Q48A 4MYHA 1PLJA 4NU0A 2IYUA 3IBYA 4X8HA 2WJGA 5AJYA 3AM1A 1KSGA 5TMPA 1T3HA 2JLYA 2RCNA 3CKLA 3PXGA 1W5TA 3FFAA 3VR1A 4XWKA 5AUPB 2YOFA 1GP2A 4WZBE 5JCPA 1CXZA 1UEIA 1JXOA 1KSFX 2BVNA 2LWIA 2ZE5A 3MGCA 5KNDA 4QC2A 2DFNA 2Z6VA 4UNNA 3BB4A 5L3QA 3AVPA 2KE5A 3CF0A 2CL7X 1E1QA 4P4SB 1S0UA 3SEAA 4D6PA 3F5FA 1W7AA 2W6ID 1GFIA 2ZR0A 5EXSA 2RGNA 4BLQA 4HZUB 5IHPA 4ZV4A 1GILA 3DZ8A 3FMFA 1GITA 2ANCA 3OE7D 3THXA 2R62A 1KK3A 4FN5A 1U98A 1UKZA 3Q5DA 1XD2A 2VA8A 4MGKR 3W90A 4F4JA 1T3LA 1COWD 1JEDA 4RD1A 5CJ2A 3TUIC 4URYR 2FEMA 4B76A 1DBSA 4XOIA 3RLFA 1P61B 1ZRHA 4MRVA 2GAOA 4KBFA 4I1OA 2IBMA 3I3SR 4B33A 1CRQA 3TBKA 4C9BA 2F1JA 5LB2A 1SXJC 5JJKA 4UKDA 4BPBA 1P73A 1SKYB 5TB5A 1FP7A 1NLZA 1QF9A 5ANRB 3K8YA 2QAGB 5FOTA 1OLOA 5J4VA 1Q57A 1T4GA 3ND8A 1IN6A 4FWIB 4IEEA 3RVBA 4YLGA 3U5ZB 1DG1G 1W36B 3OE7A 1ZNZA 2QGZA 3ZGXA 4FCTA 2IWRA 3LLUA 4AYTA 2J7PD 1LF5A 2F6RA 4CEJA 3LQRA 1COWA 2GXUA 3KJGA 5BYKA 2MSCB 2G1JA 4HYYA 4JL6A 3W6OA 3P4YA 2XTZA 2NMVA 1NN5A 1Z0IA 3MAAC 1LS1A 1ZM2A 2ZRAA 3B8HA 4UQOA 3PVSA 1DS6A 4IKEA 4CGZA 4KLNA 3KQUA 3KXIA 2IUTA 4URUR 2ZR7A 5LBIA 4EQ6B 2N46A 3ICEA 2CE7A 2KI5A 3CPJB 3KJEA 5E4FA 2UZIR 4AYXA 3F0TA 3OHMA 4GNKA 4TLAA 2B6HA 2JJ1D 2D2EA 3K70C 2J7PA 4LJAA 2EFCB 4JLKA 4MKIA 3MCAA 4CYMA 1XRJA 1AQUA 1OFHA 3R9WA 1KO4A 1CR2A 3VKWA 4DB4A 3I8SA 1QVRA 3WNBA 1XXHA 4IOKA 4JSTA 1AQYA 2JLSA 3A6PC 3CPHA 1CJVC 2GEVA 1DO2A 3KKQA 2DFKB 4LV8B 1NY5A 2CCJA 2YVUA 3IIMA 1RZ3A 5FBLB 1HQCA 4JKYA 3LO5A 5DSZA 1LNZA 2JIZA 1AKYA 3QPUA 4KYUA 3VU9B 3ZJYA 3UPUA 5SZHB 2EFHB 1VG0B 4JLOA 3L43A 2HT6A 2I1VB 3QPVA 4LHVA 4EFNA 1XJ0A 3CH5A 1FQJA 4OQFA 4KLZA 3GLGB 2NO0A 4A15A 3WMFA 3QE0A 5TV2A 2OLKA 4HDCA 4DLYA 4OQNA 2GILA 2JLWA 4M1OA 4N1AA 3A4NA 4DLSA 5FOVA 4JLAA 2QT0A 2F55A 2O8BB 1Z0KA 2VTKA 3X1YA 3SYKA 3R9XA 3FHTA 2HJGA 1NG1A 3A4MA 5EE1A 3EPJA 3IIKA 3R9IA 1E0AA 3QENA 4LWZA 3OAAD 2P3SA 3X1XA 1KI3A 2JAQA 3HP1A 2FZ4A 5JWRA 4POAA 2OT3B 1M8PA 2ZETA 3PEYA 1M7GA 1U8AA 1G6HA 2XZPA 3H1TA 1XXHE 4Q47A 2H7VA 4LHZA 4A82A 3KB1A 1KI6B 1OT3A 2JDIA 1NIPA 1Q1ZA 5FL7D 2ZJZA 2QMUA 3QVUA 3SQXA 1KZGB 4MRPA 2C04A 4OHYA 2WWIA 3L0SA 2X2EA 2XSZD 1AS0A 4GOJA 1T0HB 1KGDA 2ZI7A 5EUQB 2NO7A 2UZ3A 3TK1A 3F3YA 3K09C 1N6NA 1JNYA 3QPWA 4NTZA 2H8KA 2ODBA 3FMOB 2P5TB 4LOAA 4YXWA 2R6GA 4LSGA 3T1OA 2O8DB 821PA 4HB0A 4Q9JA 4TMZA 4C30A 4G5RA 4B71A 1M74A 4TN1A 3JVUA 3DPUA 1UJ2A 2C03A 1ONBA 4DBLC 5FL7A 4F91B 1UADA 4K46A 2ZSDA 4LYFA 4A6PA 1ZYUA 3O8DA 2F43A 4HB3A 1OYWA 4NH0A 3ZDQA 3ADCA 3A1WA 4KV9A 3ZYCA 1KY3A 5DHAA 4Q7LA 1Z28A 3AGPA 2CL0X 2GCOA 4Q1CA 2VL7A 5L3SB 3EIQA 3IKJA 2WSMA 3K0FA 1E1RA 5TVKA 1E3MA 4NYMR 2R6AA 3BBPA 4TL9A 3A8TA 1Z07A 1E2EA 5FTLA 1ELOA 3QOFA 4RZXA 2QU8A 2WIAA 2FH5B 2V1XA 1HE1C 2IYSA 2CVHA 5EE9A 4GDFA 2JASA 4OJQA 4IW3B 3TH5A 4KVGA 2BJWA 4B47A 1A4RA 2ZU0C 1N6PA 1RE0A 2ZRHA 1KTVA 3UMFA 3I72A 2ZS7A 3EARA 1JB1A 4YONB 2ZI3A 1G4UR 1P2TA 1UDWA 2GJ9A 3HJNA 4QJ3A 3DL0A 3EA0A 3IBGA 3A4LA 3BH7A 3CB4A 3CZQA 5E3HA 3KTAA 4TZ0A 1A7JA 5KO2A 1S9DA 1ZC3A 1G291 4RVCA 1GSIA 3OFND 2C9CA 3GFPA 1TQDA 4PHHA 4EJSA 4M1SA 1XWIA 4LZZA 1X8LA 2PBRA 4DVGA 2C9YA 1U94A 3VAAA 4DXAA 4II7A 5CK4A 4OJKA 5FBRB 3CZPA 4FXPA 3ADBA 5LD2C 4FMCF 1LW7A 3GQBA 2AXNA 2JGNA 3VR4A 1G3QA 1I4LD 1SVMA 2NQ2C 1VYUA 4R2IA 4ZDJA 3RRNA 4Z54A 3WP0A 5DE3A 2QTVB 1G21E 4U02A 5J40A 3AVQA 3B82A 1G8HA 3BFXA 5IF9A 3K0EA 5L3QB 5B2ZA 4LJ4A 1E79A 1Z0AA 3X2SA 2IYZA 4M53A 3EIHA 5FFMA 4Q21A 1R4AA 1TU4A 1UBCA 1E2NA 3OFNA 1KI4A 3Q85A 1TQ4A 4DLWA 4D25A 1IQPA 2QI9C 3EC1A 4V0MA 4P4TA 5A5GA 4PQRA 2FA9A 4QBIA 5FUVA 1E2DA 4BZQA 2WPDD 5EE0A 3G5UA 4Q4HA 2YWGA 1KDPA 4ESHA 3CWZA 4RD0A 4Q4JA 2ZREA 2AFHE 3RC8A 5JMTA 1NN1A 3W3AA 1KDOA 4Q03A 1IN8A 3AUXA 4CIDA 2WWXA 2OCAA 4DLXA 4LJYA 1VYTA 4DSOA 2JJ2D 4ZKDA 4FINA 2JLQA 1NVVR 2O52A 1QHNA 3LX8A 4IFBA 3RWMB 3IILA 3TMKA 2FG5A 4DIDA 4JLVA 1G19A 2BJVA 4TTQA 2F1RA 2A9KA 2FSHA 4XTRA 4OHWA 1R0ZA 1G1MA 1IHUA 1NJFA 3OESA 2IK8A 3C16C 2QG6A 4LJ5A 3UKDA 1G18A 4RD6A 4Q19A 2QRZA 2IEZA 3CF6R 5J4KA 1GIAA 4C0HA 2GJAA 3EZ9A 1ESNA 2E87A 2J45A 4CEJB 2WJIA 4ACAA 4BQSA 1S8FA 1G20E 1T8UA 1IY0A 4ASUD 1ZU5A 1TU3A 2JJ2A 2GBLC 3O47A 1G5TA 4KFSA 1E2PA 1VCNA 2VF7A 2X2FA 3D31A 2Q6TA 4O3MA 4RZ2A 2FN4A 2IS2A 1XEFA 1E2FA 4V0ME 5EJEA 4TLBA 2ZRIA 4WAUA 1S1CA 4HLUA 3PR1A 1ZINA 3IO5A 4TTRA 4JLBA 2NG1A 3BD9A 1LVGA 1UDXA 3B5JA 1G7CA 1OB2A 4RFSB 5FTKA 3SJAA 2A30A 2AHOA 4AY2A 3QNUA 2NPIA 2QP9X 4EPRA 3ZLJA 2FSFA 1D5CA 1NG9A 3CNLA 4QRHA 1HURA 5JEEA 2ZM5A 3PJRA 4TLEA 4RD4A 2IS6A 1FUUA 2GXAA 4GMXA 1EFRD 2OFWA 5KSZA 5L3VA 1DG3A 2YOHA 1L7VC 4Q9IA 2W0SA 1JR3D 3W5JA 1XXHB 4A4DA 3KJIA 4HDQB 1D2EA 1WP9A 2OXCA 3TR5A 3OEEA 2ZUBA 1XJQA 2MMGA 4DRZA 3PENA 2ZUDA 1CRPA 3DKPA 3DMDA 5DYGA 2WWYA 4H9GA 1P62B 3KQKA 3C5HA 1PV4A 2REXB 1S1MA 3B9PA 1TL7C 1K5GA 1P9WA 1N5LA 3FDIA 3VFDA 1HT1E 3WNCA 1FNNA 2WOJA 3ETLA 1OH5A 3CUEF 4NP6A 2A5JA 1KAOA 2B8TA 4PHGA 2IYRA 2WOOA 3KKNA 1Z6AA 3FVQA 1DAFA 3O8BA 1JR3A 1VG1A 1AN0A 5B58C 4GP6A 4KO8A 3ZZTA 4JZKA 2D06A 2I3BA 3T1TA 3D3QA 2RGXA 5HZHA 5AJVB 1NSTA 4M0LA 3Q9LA 2GETA 3GLFB 1EWQA 4DT1B 1KDTA 1AA9A 1N6KA 2EFDB 4L16A 5J4HA 3X1ZA 5AJXA 5F9HA 2VRWA 2NPFA 4WZAE 1P4SA 5FOUA 1H8HA 1NKTA 1UBGA 1DE0A 3SYNA 3BIFA 2AWOA 3P1JA 1E2MA 1Z06A 2HV8A 5JWOA 1Z2AA 2KJQA 4UXHA 2OE2A 5AUQA 3NEYA 3WY9A 1J90A 2AD5A 2OXRA 1FTSA 5JI2E 3CH4B 3FGNA 5EZ6B 5AR1A 2BEJA 1X8KA 3RYTC 2WHXA 1ZJ6A 3KKOA 1ZBDA 2MMCA 3K1JA 3BERA 4OK3A 4DDVA 3PEWA 3VHXA 3GEEA 3THWA 2JLXA 2VP6A 3UMSA 4X8OA 3WYAA 3GLGA 1WBDA 3IHWA 4A1FA 2HCBA 3C15C 3K70D 1X1RA 1OIWA 3R8FA 1FX0B 2ZE8A 4HLQB 1XCGB 1JR3E 3ND9A 2FGJA 1G8FA 2IYQA 3W6PA 1ZD8A 2ZRBA 4B3GA 1YJ5A 1IOZA 2V9PA 3ZVLA 2PCJA 3K0SA 3OZXA 3Q8XB 5AK0A 5J5CA 4D26A 2XNSA 4R7ZA 2F43B 1ZIPA 3ZD7A 1EFUA 4P32A 1Q20A 1XTQA 4WZ6A 5D3MA 3SE0A 5CJPA 3I92A 4IXMA 1NY6A 1JI0A 1G9XA 3PIRA 3K0FB 2XTNA 5BXQC 1OPXA 1IONA 5GJWC 2PX3A 1JECA 4JKIA 1FPMA 1SHKA 3TRFA 3T61A 2QT1A 5M04A 4RZ3A 3GJ6A 4IDOA 4Q7KA 1TTTA 2EU8A 1Z6TA 3RSOA 1E2IA 3TUJC 1E96A 2WZQA 4TSFD 1MO3A 4AURA 4QBHA 2PMKA 4P3YA 1N5IA 2C9OA 3BFKA 3QXSA 1A1VA 4BLOA 2WSSA 3CX6A 1UAAA 5CIQA 1PUJA 2RKOA 1E98A 1OSNA 2VP9A 1LS6A 3CRQA 3QKRB 3I1FA 3BWDD 2BHRA 2ZI6A 4KVAA 2QTHA 5E7MA 2WMNB 4NYMQ 2GXQA 2XZLA 3GJ8A 5A0FA 1XMJA 3KTAB 2O8DA 2VP4A 3GFTA 4BZXA 4OYHA 2CCGA 6Q21A 721PA 1XD8A 3CLVA 3MWKA 4PR0A 4HUQA 4D81A 5AUNB 1GTVA 2O0JA 3E5HA 4NDZA 4TLCA 3VR6A 3PUVA 3VR5A 5DO9A 1XTIA 1G3MA 1SVOA 3HR7A 4NCHA 5JECA 1AM4D 3U6BA 3WBJA 2A78A 621PA 1Z6GA 3HYTA 3I5XA 2CDNA 3IEUA 2EQBA 3L8ZA 5FR1A 1DAGA 4OQXA 1N3BA 2B92A 2OSBA 4XVUA 2NOAA 3KUCA 4I99A 4XD7D 1T6NA 4URVR 3GD7A 5FOWA 5B64A 5L3SA 4LYAA 2IYYA 3BS4A 2C96A 4Q00A 5DI3A 1L2TA 3NEJA 2XNDD 3CX7A 5C2JB 1QDEA 3ZH9B 4RSGA 1CR4A 3BGWA 4MRNA 4MUAA 1U2RA 4QOSA 3NC0C 2AKAB 4TT3A 5BYJA 1P5ZB 3U7GA 4PSAA 4AYWA 4LJ9A 4HEJA 4GRAA 2MSDB 1G3IA 2ZAMA 4ON9A 4TL8A 2JA1A 2VEDA 2VF8A 1LV7A 2A5DA 2W2TA 3WRXC 2BCJQ 4XD7A 4Y0VA 4Q9LA 4F93B 1W49A 2RGCA 2GZDA 4AK9A 3T15A 3KQNA 2H92A 5KSOA 3O8CA 4IXNA 1Z5ZA 1WE2A 1G64A 4N0DA 2WKRA 4EFLA 4D4LA 1IXZA 2VSFA 3AQ4A 4PC7A 5DN6A 4B2PA 1VHLA 3FKSD 3V4FA 3U2QA 5KPDA 1DADA 3TLXA 2IWHA 3AVUA 1H65A 1V43A 2FPLA 2BKUA 5AUOB 4IJMA 1E2JA 4LJ8A 5A4JA 2PT5A 1E9AA 2V1UA 4W5JA 1J8YF 1TADA 3VNUA 4X8MA 2QAGC 1W0KD 3SJBA 1GNPA 3NWJA 1TNDA 4KHZA 3B6EA 1M1YE 1NVVQ 1W36C 1GL7A 1EFCA 2NIPA 1HE8B 2R9VA 5C18A 1US8B 4EKDA 1XF9A 2H57A 1FMJA 1W2HA 3IPXA 3PCRB 4NE2A 3UWOA 4A2WA 2IL1A 4BLPA 1WA5A 4M4SA 5EXPA 4TYYA 4GBMA 4BFWA 3KDSE 1WB9A 3BB1A 3M6AA 4QGFA 3LRPA 4FCWA 2XX3A 2G0TA 3NVAA 4Q7JB 5KDLA 4IEIA 2CE2X 1FUKA 2D3WA 3W9YA 4PC6A 4D0LB 3QQ5A 1W0KA 5F98A 4TYNA 1DAMA 1OIXA 5FL3A 2J59A 2FGKA 3ZD6A 1CR1A 1H8ED 3IPYA 3EASA 5DHFA 5FPSA 2QROA 5FTJA 2WKQA 2P65A 4B6FA 3TIFA 2GRJA 1IAQA 1UEJA 2ZPTX 1JALA 4IOJA 1VTKA 2W6IA 3GEIA 4XWOA 2Z5FA 5JCZA 1ZUIA 3M1IA 1Z2CA 5KNCA 3T34A 1M34E 1G5PA 2GKSA 3U44B 3AB3A 4LBZA 2ZUCA 4JJKA 2BEKA 2GTPA 4PAOA 3OF5A 3W8RA 1T5LA 2FOLA 4QNMA 4Z8XA 3T35A 4PFSA 2VLIA 4JMPA 3REGA 1G41A 2D74A 1ZD1A 4Q4AB 2J0UB 2Q3MA 1R8SA 2Z4SA 2PCLA 4QGAA 3W3ZB 3HU1A 2H16A 2XB2A 4GL2A 1H8EA 2BBSA 4K81B 3BJIC 4NCIA 1SGWA 1KO8A 4ILEA 4TQAA 2DCUA 2ZRGA 3BXZA 5EP2A 1QHXA 1Q1QA 2QM8A 1RPZA 2QAJA 1G3UA 2GXSA 4OKSA 1XCPA 1A5TA 3PEVA 2D2FA 3NH9A 2WBLC 4OI0A 4RY2A 2ODWA 2VIIA 1KO7A 2ZRNA 3WMEA 1WQ1R 1N0WA 3EZ6A 8OHMA 4RFSA 4ERNA 4HAYA 3AKYA 3CF2A 1P3JA 3KFVA 3VTKA 1UFQA 4MQBA 3HR8A 4M1MA 4Q1DA 1YZLA 4QKQA 2BMFA 2BMJA 3R7WA 1MKYA 3QUSA 5DIFA 4PO9A 2ONJA 1R5NA 1XMSA 4CF7A 1DELA 1Q44A 4UJ3A 1VMAA 4JS0A 3DVLA 3GEHA 3QXJA 2DWOA 2FPMA 4TQUS 4A0RA 4U5XA 3AF4A 1R0YA 4QM7A 1Z6XA 1ZCBA 3LY5A 3FE2A 2CK3D 2JJ1A 4AC9A 1F48A 2QA5A 2WM9B 4YC7A 4JLNA 3B78A 2ZJBA 4KODA 5GJVC 3THWB 3RS4A 4CW7A 4M9XA 2QORA 1UBEA 3A58B 3OIWA 1IXSB 5EXTA 1XDBA 4QM6A 2Q21A 1KDRA 2ATXA 2D4HA 1C9KA 4IVRA 2QRNA 1R6BX 2QQ0A 3FTQA 4I1UA 3CRMA 3T1QA 2D7CA 1VHTA 4C3ZA 2CMKA 2R6CA 3TGPA 1E4VA 3GJ0A 1HT2E 2CLSA 3HU2A 4UJ5A 1CULC 4IRUB 1U9IA 4LBVA 4A8JA 5E7IA 4C0BA 1CF4A 1ZU4A 2EWVA 2GCNA 2GK6A 3FPAA 2B8WA 4DT1A 3GLFA 1R2QA 1KIMA 1KSJA 2G77B 5K8UA 1GAJA 1D8TA 1X1SA 2J0VA 1U0LA 2LKCA 4QL3A 5D3MB 4EPTA 3QBTA 4F4IA 2P5SA 4UXIA 2YC4C 5EP3A 4CEIA 1VDZA 2K5UA 5JSZB 4EAQA 3AVXA 3VX3A 4WW0A 4QFMA 4O25A 2ONKA 1NBMD 3K70B 2DY1A 4DCUA 1E2QA 1WMSA 5F2EA 5E95A 2IC5A 1YZTA 3PITA 1OJLA 2CLCX 3TW4A 1RRFA 2IYVA 1TF7A 2V6JA 3B9QA 3QBVA 3G82C 1II9A 4PPGA 4BWYA 2Q3FA 1G6OA 2OCBA 3THYB 4XVQA 2ZE6A 3KKMA 1P72A 1Z47A 4GMDA 1MV5A
chains in the Genus database with same CATH superfamily
1N5JA 2JK0A 2GJKA 3OAAA 2RB4A 4WVFA 4KR9A 3KSAC 1EVJA 4CEHB 1ULAA 3B1VA 1D4AA 5THXA 5EIBC 2CXXA 3AKDA 4FOSA 4FUQA 1FL9A 1H2HA 1WCV1 1G2QA 5DNVA 2GN6A 1HMYA 2FDCA 1QIMA 3ZCTA 1XTBA 3VR2A 2GD1O 2DGDA 3FCAA 4UU8A 3V34A 3IEMA 2P69A 4AJ2A 4NV0A 1FRNA 1UBJS 2JI9A 4TS1A 3UJDA 4DDMA 2AKYA 4RS3A 4POOA 1SHLA 5CA0A 4D7AA 2FEOA 3EUFA 1TGYA 1MO5A 3EXFB 1R6AA 2J41A 3H7IA 5IK2D 5BWBA 1Z38A 1NUSA 2XSZA 5AMXA 1P0QA 3N7TA 4Q3KA 3VO1A 4AP9A 1R5OA 2I4TA 3JALB 1EHCA 4ZO7A 4ZVTA 2D7JA 1XMPA 1Q3TA 2WWRA 5KOYA 3GU3A 2UUOA 1EH5A 5CR9A 2AMVA 3FDZA 2FMXA 4DA9A 1KSHA 7REQA 5K0EA 2DQSA 4XX0A 2IS4A 1C0LA 1FZQA 2P2LA 2YXNA 2ZROA 1TYEB 2W6JD 1V16A 1SO8A 1ISJA 2PBZA 3HQ4O 3KJZA 3OOWA 4JH0A 4PSDA 4FI3C 3CVOA 3DOEA 1L4EA 1YO6A 3ZE6A 4NJEA 3MXTA 2QN2A 3PGXA 2EZ9A 2J46A 3V4ZA 3VDRA 4LS3A 2ZSAA 3KFXA 3PC8A 1EAYA 1S2NA 1X86B 2H4FA 2H9YA 4GKVA 3EZGA 4K28A 5LXTB 3I62A 1BX1A 2H17A 2NUAA 2WFLB 2RGNC 2HPZA 4LDJA 1E6LA 3I9OA 2IH2A 3G0GA 1PK7A 3JCZA 2EKZA 2VZ0A 4W99A 5CLLA 4X1IB 1RWPA 2CF5A 4P5DA 1AB6A 1KYWA 4IOLA 3NTOA 4BHTA 5LQAA 3AHJA 4ZAGA 5KWEA 1T4BA 2J3JA 1JX6A 4XWTA 5CYOA 4XIGS 4CDNA 1NJ6A 4HDAA 1HEIA 1ZHOA 1XDGA 4PYRA 1MJGM 1SXIA 1NFFA 1WPXA 2C3YA 2NTYC 3D59A 4O2AF 4UCFA 2OLJA 4YPFA 5E4JA 5H3CA 3WRYC 3H99A 3DZDA 3HKDA 4CKYA 2G1AA 3I9LA 1KKLA 1OU4A 1QANA 5A6SB 4PTYA 1N1EA 1SN7A 5JY1A 4IQFA 4RA9A 1HLGA 3EF3A 5ALLA 3T3OA 2IT1A 1JFSA 1SH7A 1F5NA 3OU7A 1PFUA 1RJDA 1GPLA 3O74A 2PIAA 3FYUC 5DISB 5G0UA 3TMAA 4MUEA 2CDAA 1DBVO 4ZN6A 1OI2A 1I32A 1VMKA 4O2LA 1Y4SA 3P9RA 1U28C 4I50A 4IQ8A 1H3NA 2J0EA 2XZTA 4RKRA 1RQNA 5EKSA 1UMDA 3NHRA 5KU1A 2QD1A 3GJXC 3EVGA 1ETUA 1FSGA 1X14A 3RODA 4G5SA 4O08A 2ZAYA 5TPZD 4QXAA 3TM5A 4LY3A 4O63O 1N57A 2ERXA 1ZPDA 4PGAA 1ABEA 1FNCA 1SU4A 2E4AA 3VR0A 3VNBA 3W4IA 1J1UA 2GDJA 4MO2A 3WP1B 5B2EA 2QXYA 4DUPA 3GEMA 5BOSA 4LAFA 4OMCA 4D9KA 3DE2X 1WPQA 2B82A 1VECA 1SVWA 3JQDA 1HT0A 2BGTA 4NF2A 3OOEA 4KC0A 3V7YA 5KQSA 4DSNA 4KREA 3NCTA 2XI4A 3T4PA 1IQ0A 5KDOA 1S3FA 2VHQA 2M98A 2REOA 4KYIB 2ODTX 4C5BA 2C3MA 1RI5A 3ZY3A 3U37A 1TC1A 4I4IA 1GUBA 2DOKA 4DPMA 2VO1A 4E5YA 1JDUA 1YU9A 5HCIA 1B41A 1U1DA 1DC6A 4O2AB 2JGIA 3TQFA 1S9HA 2HU7A 2EWWA 3GT0A 4DLZA 1NJGA 2JGLA 3C8DA 3W7BA 1R15A 2MHCA 3IELA 3C74A 5HCNA 4ZHSA 1CQIA 3EG9A 1ANKA 4LV6A 2VTDA 3EZXA 1JIKA 1BG6A 1HDIA 2WPDA 2WYVA 5FWXB 1B7GO 4IBOA 1X80B 1IK6A 4Z99A 1RWWA 2PWZA 4AUNA 4EA7A 1X6VA 4R7GA 1V1JA 4FFVA 4XAQA 1PBTA 2FI1A 5KKNB 4DAOA 1US8A 3KQWA 3AJ9A 4ZKEA 1H6CA 4AO8A 5AJWA 2BTOA 4WXRA 2AX4A 1EFTA 4HDOB 2ZT5A 1UQRA 2DQYA 4BASA 5EJ4A 3P32A 5JZMA 4MQ4A 5A7HA 3UW3A 2PY6A 1NM5A 4QGGA 5A5EA 3HDVA 3QSYA 4MR8A 4EVRA 3AI2A 1QLHA 3MYYA 3AJDA 4IZOA 5JG7A 4F0JA 3KHTA 4JQOA 3H5RA 4L78A 1FNMA 2ZJOA 2F3RA 3FETA 3ILVA 2YVQA 3KVOA 1EP3B 3FB4A 2ONCA 3G5LA 4JAVC 1JIJA 3GDGA 5I9BA 4BBPA 2FV8A 3QLVA 3KQTA 2WINI 4QDKA 2DPLA 3NJ4A 1QH8B 3E22B 2XA2A 4YEDA 3X44A 2VBFA 1PJZA 5FKJA 4JLDA 3FKJA 1F17A 4YCMA 1VL2A 3AFIA 4CMBA 4BLWA 2WE7A 2PNJA 5ALFA 5K6AA 1WRBA 4Z1MA 3O03A 1AKVA 3WB0A 3KXDA 1GQYA 5DM2A 2QGNA 2OEPA 3IV9A 3MWYW 4ASUA 2AC4A 3U56A 1U0HC 1XTJA 4MRMB 5DEOA 4E4TA 5K5EA 1R8XA 3KV1A 5BW8A 2KBEA 1BKDR 1G8GA 4JJFA 4BO6A 3H2GA 3PPXA 2H2AA 1XRRA 2WQ7A 4CODB 3SFZA 2HF9A 4KQJA 2H4XA 3RE1A 2AZDA 1OX4A 2ZPUA 4QJ4A 4D0NA 1XQ9A 3EGXA 1QFYA 5JQWA 5KU7A 3LF1A 1LF0A 4UCWA 3GJ4A 3RRZA 3FJOA 4EJMA 4W5OA 1AURA 1C2YA 2VQDA 1JHVA 1BNCA 2DTEA 4R41A 4C1NA 2ILTA 4R1TA 4DQVA 4XOUA 2Z2ZA 3W5AA 4MW2A 1E66A 4EG6A 5BUCA 1VKOA 3QE9Y 5PNTA 4YI5A 4YK7A 3DO8A 1KE1A 1IEQA 3B5EA 3L41A 4UHEA 4XKJA 1NURA 4QUGA 4S0XA 5EINA 3U6KA 2A5LA 4RPCA 1AUPA 5EZ5A 4B4DA 4FGUA 5LP6C 1SKAA 4BO5A 4N7RA 3WHPA 3PP8A 4QYIA 1WQ3A 4OB8A 1FCJA 2QYSA 5AM5A 4KWTA 4O4IF 1C7RA 3ZWQA 1C9EA 5DM60 3S8YA 1NE7A 4ZIRB 3UJ9A 2OGSA 3CRRA 1SXJD 5ALUA 3VUEA 4CFSA 3M6XA 1DNPA 1HG1A 1NN3A 1XMIA 1L4GA 1OKKA 4XIIA 3VNRA 3WGGA 1OXSC 1K27A 4YIHA 4CIVA 3D7RA 4BO3A 4AS1A 1DRUA 2HV9A 3CF4G 3TBFA 2IYAA 2X4DA 3B52X 1ACMA 5GONF 2XPCA 3DR5A 1PK8A 4R2XA 1ZMRA 2NVOA 5KHLB 3VZCA 3RC2A 3C3BA 4AM8A 2HRRA 4MW6A 4CEIB 2QLLA 1O6BA 1SOMA 3PGLA 1NNSA 2Z8YM 3HUDA 1V8DA 4ND1A 1OZGA 1C1DA 5EWLB 3GO4A 1B8VA 2C54A 2PX5A 5HFNA 2C0CA 5CFQA 4E6EA 2GBCA 1K06A 2P7IA 4AMYA 5IABA 4KIWA 2WF5A 3KLPX 2JLVA 4MVYA 2XOKD 1GQ2A 3ZU6A 4EG7A 1Q91A 4URXR 2YIMA 3QPCA 2V54A 4LE2A 3G0BA 2VBCA 5CEEA 2AK3A 3GX1A 1Q1EA 2GZAA 3VDMA 4WBNA 4JITA 4K8OA 5BO5A 1DUIA 2RHMA 4U2EA 5DM70 3CGGA 1EHYA 2W22A 4FNGA 5AVJA 1KYVA 5JXJA 4HWRA 5CVEA 4J0QA 3KX2A 2EVWX 2J0QA 3ZLVA 4B48A 4EM6A 4JLSA 4BO0A 1E9DA 1PZGA 1N0IA 1WQ4A 2PL1A 4HBZA 2HSZA 2EFGA 4XDHA 5KVQA 3AVYA 5FPTA 2ZBVA 1BAPA 2BMEA 3UYLA 4X6UA 4KR3A 4TL7A 4X94A 3RB8A 5JE8A 1HGXA 4X6XA 3IHKA 4BVHA 2N75A 3QEAZ 3BCHA 2EHJA 1ZM4A 3OIFA 3F3SA 1E8DA 1XQVA 3WKDA 5DI9A 3WSVA 2QPLA 1G0OA 1TO1E 3DMHA 3UAZA 4F72A 4HNTA 5FWYA 3DCIA 3NHPA 3HPRA 2ZE7A 2BFBB 4Z51A 1V3UA 1Y89A 4I2VA 3W6ZA 4E11A 2V58A 4PLTA 5EJ7A 2VRCD 4H1HA 2BONA 4MVJP 5EJMA 1GPH1 2FR8A 1A9OA 5KQLA 2HF7A 4N4AA 1QS0B 5GONB 4YMLA 2P75A 2QS9A 4WKBA 5EPOA 3T5GA 3ZNPA 1X1EA 4XJTA 4QG3A 1Z12A 4I81A 4X84A 4ARAA 5BV8A 2BGLA 1OH8A 1QZ3A 2HQBA 3PL1A 2G9NA 2FMHA 3U62A 2ZWAA 3SZ3A 4AN0A 1Y8QB 1F3OA 2ERYA 4GOKA 2A3RA 3P2EA 2Y1WA 4CIAA 4HEA6 1I2MA 1ZMTA 3WZMA 3COSA 4YP6A 1NZFA 4UBJA 4L8FA 2E4UA 3L40A 3BDAA 1XNJA 2GARA 1AQ6A 3Q6IA 4RK1A 4CU5A 1QG2A 2E1RA 1UZAA 1EFDN 2JI7A 1DJNA 4P7FA 1XK7A 4AMZA 1Q11A 3R41A 2OYCA 4Q6BA 4OUKX 4NS1A 3CW2A 1ZN8A 4GZ3A 4GR5A 4TXNA 1MO6A 4FD3A 2LXNA 3VJRA 5DT2A 4JC4A 2Y66A 4RL6A 4XFJA 1AX9A 4B4UA 5H8WA 4P0QB 1T91A 4K9OA 1YFLA 2OXTA 4JIMA 5JBQA 4RA6B 1E3SA 2RH5A 1HZZA 4OI1A 3T3GA 5CDYA 2MYPA 3U4QA 3RJ9A 2WILA 1UBOS 2RHRA 1WSDA 2XJ4A 3FWPA 1F2UB 1USGA 1IZ0A 2QN8A 3H5TA 1YQGA 4TSFA 1QBGA 1G16A 1G2IA 1RXIA 1VYVA 1CY1A 3E0XA 3MJEA 2QXTA 3AINA 4KG7A 4M83A 5TF0A 4EY5A 4G5HA 1GU0A 2JBHA 3TI7A 2QJFA 3VC3A 4MWGA 3HR4A 5G4KA 3S7ZA 4AMVA 5JTUA 5LQRA 5DHPA 3SQOA 2HNKA 3MMPA 1QFXA 2Q8PA 3ZDRA 4Q9KA 1EX7A 1CY4A 1MV8A 2JD2A 2JVJA 3EPKA 4LNHA 4OHXA 4YUVA 1MABB 2O8EA 1M8FA 3V7FA 1RP7A 1T5SA 2MYTA 2YWFA 4OD0A 4DA6A 4FHGA 5E7JA 2F9MA 3P0FA 5K0LA 3K0AB 2GESA 2O8FA 1GM5A 3AHDA 3CLHA 1UT5A 5JJIA 1IQUA 4DREA 3NFRA 4ZCIA 1X8XA 2VHXA 2HD4A 2ZVDA 1F9AA 3AHIA 3FPLA 4G26A 3S40A 1EGQA 1W34A 3LFHA 4JWTA 3HA5A 1L9XA 5FTWA 2RGAA 1TKCA 3NRBA 4I55A 3ZDDA 3K9CA 1TRKA 3MCWA 4LE1A 5DYNA 5LWQA 3HUEA 5F1YA 1XQWA 3ESAA 1WZIA 2VDNB 4BFVA 1R00A 4HI0E 3V7WA 1X39A 1UPFA 1FOEB 1KJ8A 1L5MA 2HHAA 2ASEA 2O2DA 4RH3A 1BC5A 2UVDA 2OGUA 1KMHA 2PRKA 2X8AA 4OGKA 4DLNA 5CDFE 1A9XA 3A4IA 3G2MA 1CUUA 4QVKA 3P0IA 1R3UA 3F97A 4GPBA 3I1JA 1PN3A 3OPXA 1JEAA 3D6TB 3Q3IA 1BO6A 2RJ3A 4WHMA 3MW8A 3TZ6A 4KMOA 5EXXA 4B09A 2PUBA 4DB2A 5IVHA 1C3XA 3OTOB 2EIXA 2XRMA 1DXYA 2IQIA 3OZAA 3ZJVA 4FR5A 1QKJA 1G5HA 4Y6RA 1M33A 3DUFA 1QHHA 4RQTA 1GV0A 5BV2P 4TS9A 5DCYA 1QORA 5AOBA 3PNSA 2PPLA 4IJ5A 2ODPA 4LRYA 4R16A 3HCEA 4HY3A 4J3NA 4E4YA 4LF8B 2XVYA 4AD8A 1YRYE 2IXDA 2ESRA 4DRYA 4HDKA 4H7EA 4C06A 1UC9A 4UMEA 4Y1EA 5DWDA 4UTNA 3LO8A 1YFZA 1YS7A 2QJTA 4ZI7F 1W0JD 1M2OB 1RABA 2R7NA 2O05A 1GXSA 1XDDA 3NORA 3G2KA 4U7TB 1CY0A 5AP9A 1D09A 2NUBA 3JQBA 2BWJA 3AFGA 2IITA 1RWMA 4NDNE 5IWCA 5H1YA 4ZU1X 3AM3A 3TAHA 1ABBA 4X1KB 4C07A 4GE0A 2DE0X 1TIBA 1QCZA 3SFVA 1Q16A 2VYND 1C0IA 4N5HX 1KJIA 1T4DA 2BFWA 3FKSA 4LEIA 4NEHB 3EJ6A 4DNQA 4HGPA 2H7XA 3EEFA 2IGTA 3O9VA 1TMGE 3VGJA 4BWFB 5JC8A 1C8VB 2AZTA 4A0QA 4EFDA 3SJ7A 3A10A 1NL3A 3H8WA 1TQ6A 1YQQA 3KQOA 2OILA 1RQ2A 2C31A 1SKBA 2YW2A 2H63A 4P7GA 3OCWA 3ZHZA 1OC2A 2QVLA 3I73A 2NV6A 1EP9A 3CEAA 2HWXA 1AOXA 2DU8A 4B3SB 5H82A 3L3BA 1NJ1A 3ANYB 1FYVA 3C8ZA 4IINA 2XT9A 1ZHFA 1ESDA 4R9VA 2GYYA 5KYUB 5LBTA 4F5ZA 1GKUB 4RTSA 2DFLA 3TE6A 4UQLA 4OHFA 3FJYA 4YUWA 2Z6UA 4DWJA 1J24A 3ACBA 4WKNA 4OPMA 3NOQA 1XMVA 1T13A 2XKBA 4KK4A 4U7DA 5JW6A 3DE7X 1YA4A 1TA0A 4GS5A 4JT8A 1ZGAA 2D0IA 4LOJA 4X3CA 3FHLA 3TIVA 1YZUA 1N25A 4KITB 4KNYA 1TVKA 1RADA 1UF9A 2C4WA 4ZI7B 3ZS8A 3HLTA 3I2IA 4N54A 4RVHA 2YN4A 2VHZA 3KELA 3NCHA 4YT4A 3ICPA 2H48A 4GLLA 4ZVOA 3ZWKA 1H2BA 4ENUA 3B2NA 1Q0ZA 3RUCA 1EESA 4RSMA 2JFPA 2BKEA 4ZVNA 3HEMA 3WKCA 4IGIA 1S3SA 1U3TA 3UFXA 5BN4A 1NVXQ 1LY1A 3COYA 1D5WA 1ISHA 1GUYA 4MVWA 4RLHA 5K0TA 1EK5A 2FW8A 2P8JA 3SR3A 1MVLA 2A3NA 2ZATA 2Z3VA 4MYUA 3QKSB 3F3KA 4M6WB 5IBRA 1MEJA 3NU1A 4JB3A 4KFTA 3UFBA 3VSAA 2OHJA 3CG0A 4H77A 3KLNA 3EBOA 1M6NA 2ZAIA 3JV7A 3P9IA 3AR8A 4DEYA 4DV4B 3FCEA 1QX3A 2OVFA 1QV9A 2P1DA 3UANA 2X15A 5KCMA 1R6DA 3RYCA 5C8YA 3RABA 3NC1C 4KDEA 1SY7A 4FSHA 4XSHA 1L7EA 2P9FA 1TD1A 1OW3B 1CJUC 2XWSA 3EC2A 4G84A 4N0MA 3VTZA 1ZXXA 4XVHA 3A4VA 1NDQA 3O1LA 4ZPXA 4Z4CA 4YRCA 1H1LB 1T34A 2JIZD 4MUNA 5JU6A 4M22A 5F9MA 3GMDA 4YJGA 3Q3CA 4INZA 2VKTA 3WLEA 3ANSA 3CW9A 4QG7A 3W2HA 3FSEA 3WA7A 2HRDA 1JQKA 3C6XA 4JI1B 5ETJA 4P81A 1P8JA 2ZWPA 3HKCB 3MWLA 4FBGA 1N2CA 2NX2A 2OCPA 4ZVSA 3F47A 3MWEA 4HB2A 3FB1A 1PX2A 3RTDA 1ZJJA 3IMKA 3DKVA 4RJLA 1U02A 2ZGVA 3BZUA 3EODA 3QWBA 5CX4A 2JKYA 4BQQA 2IXAA 2XUFA 2RONA 1OTXA 3NB0A 4PLVA 4ZODA 4ZQHA 3GVPA 1QU3A 3ILSA 3KJXA 1KFKB 4LZNA 3WV5A 4U7JA 2FPIB 3ESXA 1DFIA 1OFUX 1P74A 1J33A 5JMOA 2V7GA 3LW7A 4S04A 4ZMSA 1YZFA 3RU9A 1GDDA 2WG0A 4M86A 3WR5A 2J5KA 5BURA 1XDWA 3F90A 4XFDA 4GG1A 1FQKA 3WL4A 2FJ0A 2IEYA 2AMLA 3PUYA 2FQXA 3A4YA 5LQUA 4A0HA 5KOHB 3SLGA 2DBVO 3C97A 3AEUB 3NYRA 3QI2A 1SIWA 1L7DA 4JQSA 4ZOLF 1W47A 4II2A 2R2AA 2CK3A 3ZBQA 1Q50A 5HTKA 4YV1A 2PKWA 3KRTA 3GD5A 3KLOA 1EWRA 1WU8A 4MRSA 5GADl 1L7QA 1KOFA 3EZYA 4OOEA 5KOJA 4MIYA 3MJVA 4FYVA 2JDID 1JH9A 2CXPA 4CUZA 1TI7A 3ZIUA 3ZNOA 4UHJA 1JTVA 5BN3A 1AK9A 2HO5A 4K6KA 4CM7A 3OOJA 3A3YA 1IBSA 1E0JA 1JKIA 5AJTA 1E58A 5C51B 4B75A 1ESMA 3H19A 1PQYA 4HWTA 4WBSA 4UNQA 1D2GA 1QF7A 4I1SA 3V8QA 1XL0A 3LCCA 1P0CA 3CX4A 4Q05A 3VI4B 3QLTA 3VO2A 4X8LA 3W2TA 5E0OA 3L7MA 2XJ9A 4ZQCB 3QMVA 1MPTA 4YWHA 1ISFA 3AI3A 3SGLA 3V00A 1L9KA 3LQQA 3OJCA 4AX8A 3M6FA 3T3NA 2WEKA 1RJ9A 4IGAA 1MGPA 4EB8A 2CJWA 2DZDA 3V6LA 4GZLA 3G13A 2O5EA 3I2YX 2QX8A 1WSBA 2CVFA 4JR2A 1J8QA 3LL4A 1QCYA 5LYJA 5DB4A 1FX1A 4B35A 1I01A 4KO3S 3MWFA 2Z1MA 4N3AA 1AZTA 1EQUA 2EL9A 3DZFA 5GWXA 3F7OA 4NOJA 2ZYAA 1N4AA 1OXMA 3HE3A 3FR7A 1GL9B 1E99A 3GLHB 3NG1A 3QLUA 1RXSA 1H1TA 2AFRA 2P77A 1NR1A 4D0RA 1LA2A 1UJBA 2PL3A 3GY0A 1ZD4A 3T5TA 4DCMA 1EFPA 3HY6A 4UCXA 4ZT7A 2XCQA 2ZSBA 4ZCLA 3UJCA 4DCNA 1YVPA 3RSCA 2IIVA 3QEOA 1YR9A 2E55A 1W4RA 4L9SA 1E1RD 4A73A 4ZOLB 3ZEIA 5TJ9A 4C0LA 1FYEA 5AVUA 2VUTA 3BA1A 3F6CA 3PJEA 5U4QA 2X2PA 1SKMA 3WGJA 3K6JA 2A5GA 3JZMA 5FQOA 5CLJA 1ODJA 4PYJA 5FLYA 1XZMA 3KSRA 2GRUA 3L2OB 1KERA 1Z8HA 4LDQA 2YWCA 5CRIA 3D8NA 3H6HA 2XCLA 4K1XA 1RBMA 2VT3A 4IY1A 1N9KA 3DKKA 2P6OA 3LJKA 4HDRA 4DIBA 1EXMA 3SXUA 1D9ZA 4XCQA 4XPIA 2GNOA 3MRVA 3THOA 3FFTA 3WKEA 4C87A 5KYGA 4MGYR 4ABYA 4MP8A 2IPLA 5EMHA 5T4HA 3BGOS 2DWCA 3IJ5A 1A9QA 4CL3A 3DOUA 2FSGA 4XIYA 3OEHA 2W8ZA 2ZVPX 3MLEA 3H2YA 3IE2A 3AP2A 1NNI1 2LDBA 1JMKC 3D8RA 1QMGA 2ZS8A 5IK2A 3W0LB 2JEOA 1VLVA 2DPYA 2NPOA 3N9IA 2X2OA 1S2GA 2Q07A 4S1NA 5KTRA 2ZTMA 4G1EB 3OPQA 1J7JA 3TKYA 4Y1RB 1HA3A 1QMPA 3ZJ4A 4TWAA 2DBQA 4Q3OA 3U7RA 4QQ8A 3SU8A 1SVKA 1SVIA 2IOHA 1NW3A 1O87A 2VHTA 1ZXLA 1NBHA 3RHTA 2W6JA 3L93A 4FYWA 5I4CA 3LX6A 3QG5A 4HATA 1KI8A 1M2HA 1FFYA 3L9WA 3LZ6A 1HYEA 3ZLUA 1W0CA 3PFWO 4KQGA 1F06A 4L08A 1F5SA 4MQ6A 5PGMA 5CIWA 4YJ3F 5ILOA 3BN3A 1E1YA 1Z22A 3KETA 1ZJYA 3IOMA 1QGAA 2FZCA 1FFAA 2R6ZA 2ZYIA 4YFYA 4NCAA 1AHHA 3TQQA 3O7WA 3U4CA 5JZSA 1WUIS 4LBWA 4LGMA 4Q1AA 3AJ8A 3LCMA 3EPLA 4DVJA 5LNK6 1VPTA 1TMOA 4R3WA 1X87A 2RGUA 3RASA 1YTUA 2GWHA 2WFZA 3CMMA 1JQLB 2QNRA 3CO5A 3GIWA 4I1PA 1OV6A 4TXMA 1RM0A 1X7HA 2WJ6A 4UHHA 4RENA 4OK5A 4NH4A 1DAKA 2P40A 3LBIA 1OGJA 2ZRPA 3BB3A 2VC2B 4KDFA 1JU4A 4QBTA 2NU8B 4F2PA 1G17A 1HRKA 1R50A 2VYVD 2BDTA 3BD6A 4RIFA 3RBXA 1FFHA 2X22A 2HCTA 3IURA 4EW1A 1IXRC 1AGNA 2AT1A 3WIOA 2Z6QA 5KCZA 1NDHA 3EDYA 4ZCSA 5AFSA 3DZJA 3ZD9A 4B6RA 2L42A 3FHJA 2GK4A 2OO5A 3Q72A 1I7SB 3SC2B 4E33A 3GN1A 1A9RA 1UINA 1IE3A 2QI9F 2QW0X 4LPSA 3NW9A 2Z5GA 1CUVA 3KBBA 5JYCA 2F4VB 1JIIA 1WS6A 3NKVA 1ZEJA 4BVFA 4S2UA 3PXCX 4G5GA 1NNLA 3FKQA 3V4PB 1Y4UA 3ZIDA 5IN4A 4UW9A 2J4DA 1MAWA 4YRAA 4HZIA 4QOJA 2ZEJA 5G0VA 2ZBUA 5FWDA 3KL2A 2IY9A 2JBAA 4BNKA 5A3QA 5ADVA 1GKKA 1W9HA 2BTQB 3B20A 4JT9A 5G1NA 4D9IA 2AJTA 2GUGA 1JHDA 1I7PA 2GBFA 1X19A 1YRBA 2I9PA 2YJ6A 2BR4A 2E5FA 3DCNA 4MCJA 4YJ3B 3LT0A 1IK4A 5JPDA 3JASA 3KTDA 5TARA 3FOEC 1NLFA 4D80A 1QIEA 4WV3A 2G83A 4LF5B 3NWBA 4FLMA 4IP0A 1K6MA 3ZVNA 2JLCA 1YRAA 4S1OA 2YY5A 4YMUA 4CETA 4G97A 2PH3A 4P33A 5C4IA 4L75A 3LD9A 3TBHA 1CUXA 3CISA 3H2BA 5B5SA 2ETXA 3K1AB 3KSDO 2XB4A 4EKNB 4MEAA 4QFBA 4N0PA 4DIEA 3WSWA 5JYDA 3J81k 1XLTC 2FP4B 1PD1A 1V3TA 3AF1A 3WYGA 4OQMA 2SKEA 1KK0A 4UDOA 5IWAB 1M8KA 3AF2A 2OQVA 3R5KA 4DLLA 2QLNA 2H59A 3T41A 1JR6A 1IL0A 4EEXA 3OFVA 2EQ5A 4A0FA 1B3BA 5JNWA 4XCVA 1BS1A 4N03A 2ODEA 1T43A 3VO9A 1XAHA 3KB2A 3IJPA 5JAOA 5DCWA 1QRSA 1JG6A 3H4MA 2LCQA 3FROA 2JGJA 1XZFA 1AGXA 2CMDA 2J9FA 3QXCA 1NW8A 2HSEA 4W5QA 3SF8B 4C0QC 3F73A 2ZTSA 1ZK4A 1EK0A 2J3DA 2M6SA 2W93A 3GZJA 4D92A 3K9BA 2I80A 1ML4A 3L0BA 4A1OA 2F3SA 1EM8A 3H5IA 4PRYA 5U1PA 2AWNA 4KAAA 3BWVA 4IF6A 3ZCRA 4ESVA 2CSXA 3OEED 1XTRA 4HZUA 3B53X 3VTFA 1BVYF 1WMBA 4XIJA 1AXGA 2IUYA 3ZQKA 4A36A 1GYRA 3M9LA 2B98A 4M9CA 5E9WA 3M3DA 3DH0A 5JI3E 1UBFA 3P5BA 2VSYA 5I7AA 3M6LA 1QFMA 1PJTA 2GH1A 4BFUA 4E31A 1H85A 4DR3B 1FMLA 1NBAA 4QHYA 2YOGA 5K3AA 5LOVB 3PGKA 2E5WA 1PRYA 5CXXA 4FJ2A 3BGDA 4KYTA 4TUYF 3EHDA 3C5VA 4BGDA 1EG7A 2FKNA 3HVKA 4BGVA 1RR6A 2A4MA 2JGFA 1V7ZA 4Y9UA 1VCHA 3VR3D 5YASA 1DEXA 5L3QB 4N18A 2Y1GA 2YS7A 3CC8A 2VZ8A 2DG2A 1RU3A 2WF7A 3C3CA 2I0FA 3KUUA 4PF1A 3Q3GE 3ECSA 3AHCA 4F2WA 4MGIR 2GM5A 4PLGA 2Q9BA 2VNSA 5K51A 4YFVA 1R3DA 5DGDA 2I65A 4IQ0A 1REQA 4DLRA 3WKBA 5HZMA 1BFDA 3KPJA 1R0WA 4S05A 3X1DA 3NHLA 4MP6A 1XZJA 5DX8A 1MG0A 3A25A 1RXYA 1XDZA 1I33A 3G8AA 1I6WA 3F6EX 1O6CA 3HO8A 3P7MA 1A7UA 3LECA 3WI7A 3O93A 3P20A 5AW2A 3JR7A 4HGNA 1L4MA 2V7XA 1JQEA 2APJA 3FGOA 1H8HD 3A31A 4XASA 4WFJA 4BRSA 1ZLYA 3MCVA 1A76A 3R3UA 3FSJX 1QG4A 1W5SA 2PT7A 3EGOA 2C5SA 1V5WA 3V8NA 1CJMA 1YA6A 3TSZA 4D56A 4QGHA 2XKJE 1AUQA 2CMGA 1T9GR 1W73A 5CX1B 2VKQA 4ICIA 1XLUA 5BNZA 2YYYA 4AWXA 2IEAA 3F7MA 4PZYA 3TGLA 3LLCA 4GECA 4CE6A 3EVCA 4YP7A 4D42A 3WL7A 4GFDA 3HV0A 3R9XB 2D7DA 3OKAA 1Q3HA 3ZCQA 1WV0A 2EDAA 2BGNA 3GEGA 2RH9B 3RBAA 3MCTA 4TUYB 4X62B 5CM9C 2GHTA 2H8GA 5DBIA 2W71A 1D2CA 2D2IA 1IAVA 1LRKA 2ZJ1A 3HPQA 1UBSB 5F2OA 4MPPA 4KSCA 1BN7A 1SKYE 2LNDA 1JLSA 3UQYS 2UZ0A 4AJLA 1YVRA 4FVTA 3F67A 3BE5A 3PQFA 4L5CA 1N2SA 1DCKA 2EG5A 3MM4A 1KO1A 1G5RA 3G2OA 4MUHA 4NYIQ 2CHEA 2FMKA 4UE3S 4DZTA 5CD1A 3D7MA 2NUTB 3G68A 1J1ZA 1V7QA 1NVKA 3C6KA 4UUNA 3AKEA 3AL0C 4N65A 3RVLA 1HO3A 4R3UC 5JFTA 1CS0A 4GI7A 3LV8A 2PWPA 2WU4A 5C35A 5KS2A 2XOKA 4QDXA 4M9QA 2PDAA 3MWDA 2J67A 2P6NA 2WUGA 2HDWA 3GLSA 2DMRA 5BR8B 2CZQA 2RAPA 4RJJA 5JD5A 1SUCA 4X1OA 4DRXA 3L6UA 1A8HA 4YMHA 3ISTA 1IBCA 4JT2A 3NHFA 3CUWA 2W2OA 2IZZA 3BX1A 3BEOA 4J2OA 4RUKA 4B84A 4BE7B 4YDSA 1QP7A 1L4YA 1OFVA 4XM0A 1OGYA 2XZOA 4NSNA 3CWQA 3N2GB 5IDXA 5LVAA 1QX4A 1P9LA 1CUBA 3PPVA 1S5PA 1Y63A 2O19A 1K8QA 1SQFA 5TPWB 4JROA 1K2VN 4ZCQA 2DR3A 4MUJA 2QD3A 4ITVA 5JS7A 1TJ3A 4YASA 4EMUA 3VJMA 2Q3BA 3LA8A 5JDCC 4BC0A 1KI1A 2HF8A 2A84A 3K94A 3INTA 5EJFA 5LU9A 1OYVA 3IP9A 4B3FX 3NX4A 3V5NA 2VRCA 4L0CA 3M1YA 3GARA 2HDHA 3K6RA 1KI6A 4YO7A 1HNNA 5TRTA 4UHCA 3EVBA 4MPDA 5F3RA 2P62A 1ORWA 3TIGA 1LBSA 3DM9B 3B3JA 5DHUA 1SC6A 1MB3A 3KO8A 2OGZA 2E5LB 3DEKA 1R7RA 2GS9A 3PQEA 1V9CA 3BF7A 1IEWA 2CWDA 1IWOA 1U8YA 3BVPA 2HUPA 3DL7A 3R5JA 1HY3A 4HH4A 5F73A 2VG8A 2VPZA 2IXGA 3R3XA 3NBFA 4R2JA 3S2IA 8ATCA 3W8DA 3BAFA 3E35A 3CH6A 1RPAA 1SOWA 4KSBA 1VI5A 4NL4H 2OGTA 1RBQA 4TWRA 3G5TA 4C4XA 4CR6A 4DV3B 2W6CX 3GLGE 1GPJA 2OBXA 2AYZA 3I6YA 4L1KA 3HL4A 4AMGA 1LFDB 2V6GA 3V33A 1WAMA 1DPGA 2ZDGA 4H7DA 4KQHA 2XMSA 4C4SA 2GZHA 4EJSB 2FWPA 3PNMA 4BMCA 2BI8A 4CHGA 2JLZA 3WLRA 1W19A 3OTQA 2NM0A 1JHZA 3QI7A 4G4SO 3DCJA 1YONA 4KQ1A 4PZZA 2RARA 4LX0A 4UDYX 3A1SA 1HL7A 2FFQA 4ZJYA 2Y4OA 5A4KA 4JB0A 2WWVD 1KAEA 1SVSA 4Y2HA 1II8A 5AQEA 3VOBA 3R3SA 5IMBA 2QTWB 3GQBB 1PR9A 1J70A 4WECA 5EIBD 3STVA 2I3AA 4GLJA 3T5PA 3NGLA 4CJXA 1Z37A 5FNZA 1YQ9A 4WZBA 1IDOA 2BRUA 1TM3E 3DYIA 2VSOA 2VJBA 4DADA 4GO1A 4F6RB 4JJEA 2NU6B 4YP1A 5F4BA 2CN1A 2HGZA 5JFGA 2VHUA 4FP9A 3L1KA 3ZHCA 3SI7A 5F12A 1IM2A 2Q1TA 4AIIA 3DTVA 5DBOA 6YASA 1Y8ZA 1C4WA 3SOPA 1W96A 3FRJA 3HYRA 5AJHA 5GGXA 5JZBA 4YAGA 4TM7A 2YIVX 3C14C 5ELMA 1EX6A 1U1GA 4OO3A 3UT6A 5BMVF 3TR6A 5CBKA 2F8TA 5G53C 3NXKA 1GHTA 2D0OB 4F04A 1B4DA 2NZWA 4FSDA 4OJTA 4Q4HB 5I4BA 5KC9A 2A0FA 2YXDA 1ULUA 1Z4LA 4Q4JB 4XCXA 4Y2PA 5K3FA 2JKZA 5DNWA 1H0RA 4IDAA 5CA1F 2JG3A 2Q1WA 1C14A 4AAYA 1N8NA 1NHGA 2PGIA 4I3FA 2B36A 4MUXA 5EP4A 2J7KA 5H59A 3ZOKA 5LLDA 1E1QD 5F33A 5CK5A 3KZXA 2OZPA 2WTUA 1B0AA 1Q0LA 3FTCA 4GW3A 2PRIA 2HA4A 5BRAA 5MN6A 1UQUA 3RK0A 2ZRFA 2ZT8A 8GPBA 3B1WA 3HXOA 2XODA 1CF9A 4Q48A 4MYHA 2QV0A 2IYUA 3HYSA 1K9SA 3DZHA 3JQAD 4BQNA 1JKXA 2JLYA 2DCMA 3PXGA 1W5TA 4WGFA 3LQFA 2AA3A 1J09A 1FJHA 5AUPB 3D0RA 3INRA 3CA8A 4E14A 3OLYA 1CXZA 1KWKA 1JXOA 1X1CA 2LWIA 4QUJA 3TLMA 1ZVJA 2XWJI 3D54D 1PFVA 1DFHA 1BHO1 5I48A 2ST1A 3TJMA 3I9JA 1TZKA 3WWYA 3QU7A 2OHXA 2W6NA 3MPOA 3C3YA 5B7PA 2WHYA 4P4SB 2GM9A 3G2LA 1JZQA 3F5FA 4D6PA 1Z0UA 2CFCA 3ORHA 3VPGA 5L7TA 4MI6A 2HXGA 3TW6A 3WLIA 2BE7A 4BNNA 4DCGA 1Q6ZA 1DC8A 1H4VB 2QUJA 4ZZ0A 5FYDA 5KNCD 2K2WA 5BMVB 3E61A 2QTZA 3TB6A 4PCVA 4CKWB 5ALVA 4ZV4A 2NLOA 3HCDA 4M1QA 5CT5A 5HG0A 1LGYA 3NHSA 3FDXA 5AKGA 4AJPA 3ZCVA 3NYIA 3NPAA 5I9LA 2H5LA 4OAPA 1KK3A 4P35A 1BZYA 1XD2A 2VA8A 1RKUA 3L77A 2C5FA 1KBQA 1COWD 1QONA 2Q6KA 3EEYA 3PWZA 5CA1B 2RB5A 2ZM6B 3ZVKA 4FDTA 5CJ2A 1ZEMA 3FYSA 4URYR 3UHAA 4XOIA 3LBAA 3WDLA 3QX3A 1PWEA 1R0RE 1P61B 1EMDA 4MRVA 2GAOA 4KBFA 3C4QA 1CX9B 3M3HA 2IBMA 4EG5A 4CKBB 1CRQA 1X9IA 5ICFA 1YU6A 2PGLA 5JJKA 1U0RA 2G40A 5IAKA 3LF2A 3B3QA 4UKDA 2A67A 4BGUA 1P73A 1R88A 4N6GA 3X2EA 4RAOA 1NLZA 3HL0A 1KIFA 3LU1A 3P9SA 4EGAA 3EN0A 2A9PA