3WYGA

Crystal structure of xpo1p-pki-gsp1p-gtp complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
VPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae awri796
molecule tags Gtp-binding protein/gtp-binding protein inhibitor
molecule keywords Gsp1p
total genus 51
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wygA00
1WB9A 4FI3C 4TSFA 1Z47A 2FZLA 4N0DA 2WKRA 4Q4JA 1LW7A 2DWQA 5JHGB 5J4YA 2OO7A 5AJXA 5DLQC 5GJWC 4JYBA 3VNUA 2Z83A 3EXAA 4BLOA 1LFDB 5CM9C 1SVOA 4NMMA 2J9RA 4TYQA 1W1WA 4N3NA 4LC1A 1XP8A 5BXQC 1P73A 4QJ4A 4NP6A 3CF6R 1CR0A 1TU3A 2W6JD 4DDVA 2IYVA 3AF4A 3A1VA 1QG2A 1COWD 4HB4A 4UNNA 1II0A 2GXSA 2ZJAA 2ZRFA 4RFVA 4GMXA 3CPEA 3QBTA 4GPTA 4AYXA 2JLQA 3MD0A 4MKHA 4BRWA 2V1UA 2XJ4A 1KI6A 2ZYVX 3KFXA 5KSZA 1N5KA 4D0NA 2RGNA 3KJEA 3OF5A 3AF1A 3EIHA 2WBLC 3TUZC 1S3SA 1OB5A 1S0UA 4UXJA 4IVQA 1VCMA 4M53A 3FYHA 1GNQA 2ZPTX 4KYIB 2G3YA 1Q57A 1P72A 4WBSA 2F1IA 2AK3A 2VP4A 2WSSD 4PC6A 2IHYA 3WRYC 3ZGXA 5JS8A 3HPQA 1U94A 4OHYA 1J7KA 3W3AA 2QT0A 4QBIA 2NPIA 2F1JA 2A30A 1FX0B 3U44A 4PC1A 2GVDC 2FPMA 1HA3A 1R0XA 2WICA 3U7FB 4FWIB 1QG4A 2ZRAA 5TARA 3WBJA 2GAAA 4TL7A 3WRXC 4JBWA 3ZD6A 1U8ZA 3BD9A 3CF0A 3QF7A 1M6NA 3QQ5A 1T6NA 4DLUA 5L3SA 3IBYA 4YDHB 3W9YA 3Q5EA 5L3SB 3Q3JB 4B2IA 1KI9A 2H18A 1CR2A 1DBSA 3I92A 4C30A 2WIBA 1I2MA 2JEOA 5LB4A 3VQTA 2O8FB 5FTMA 1E4VA 4C0SA 4NH0A 2J59A 4CVNA 5DNYB 4WAUA 3RS2A 1BMFD 3SEAA 2ZRCA 5HCIA 4CEIA 3B2EA 3BRWD 5TB5A 2FX3A 3RHFA 3CUEF 1R7RA 1NF3A 4C3ZA 4EUNA 2ZRJA 3AVUA 1E2FA 1JR3E 2JJ1A 4JLVA 3QSYA 5FBQB 1R5NA 3CPHA 2V54A 1TTTA 2QM7A 1Q44A 1XMJA 4NYJR 2CLSA 1Z0KA 3IEVA 2BKEA 5BN3A 1WQ1R 5HE9A 1MRNA 4OQMA 3EWSA 2WJIA 1SHKA 2ATVA 2IYXA 1RW4A 2Z6VA 3NHAA 1Z06A 2GKSA 2XOKA 1W5SA 4B32A 1OH5A 4RZUA 2JASA 4M1MA 1TL7C 2QBYA 4A4DA 2IX3A 2J0SA 4KVAA 1Z63A 3MCAA 1TUEA 2J7PA 3RC8A 5G3YA 2ZVQX 1QHHB 5KDOA 4EFNA 2O5VA 1NJGA 3BFXA 1KI1A 1ZP6A 2QMOA 4TMVA 1Z6YA 3OIYA 2XTNA 3C15C 3W5JA 1I4LD 3AKDA 2O8CB 2GRJA 2RCNA 2F1HA 1N0WA 1OLOA 4B33A 3EPHA 2VP2A 1ZIOA 1M7BA 3QUSA 4W9MC 2KE5A 3BH7A 4MRPA 5JI3E 1E9EA 1A82A 4OI0A 4JLPA 1XCMA 1DAGA 5FI1B 1Z29A 2FMXA 2NQ2C 2XTMA 4YXWD 1DAMA 2ZS7A 4OK5A 1FNMA 2C2HA 1QF9A 1E2GA 5BYKA 1WA5A 3U2QA 1XTJA 2IYRA 1E2IA 1YZQA 3KJIA 1S9HA 4D80A 1F60A 3ND9A 4LY6A 3TMKA 1FFHA 1G5RA 1Q21A 1N0UA 5KOYA 5B64A 2W2TA 4R2HA 4P3YA 2XITA 3RRYA 3TVDA 3LQQA 3RRZA 2XNDA 4A6PA 1E94E 2EW1A 1LF0A 3L8ZA 2PT5A 3OESA 1OFUX 2VP0A 2PEYA 1GITA 4HZUA 1OIVA 1P60A 1G5TA 1N6OA 4CIDA 1EFRA 3OIWA 2G9NA 1WBBA 4CEHB 2HCJB 2R44A 1CR1A 2F9MA 3EIQA 4F7WA 2Q9BA 3SI7A 3WMFA 1G291 3GFOA 4WZBE 4ASUA 3GFTA 1M34E 3MWLA 3ZZTA 2FDCA 3RDPA 1JEEA 4ZIRB 3QF4B 4MUAA 4IRUB 2PLRA 5AUPB 1CF4A 2PL3A 4D4LA 3AKYA 2QAGB 1JQJC 4Q00A 2P65A 2EFCB 4IOKA 4WVFA 5DIFA 4NHOA 2VH5R 4OJQA 1EFHA 3E1SA 3GJ5A 1TQDA 1ZINA 4BFTA 3GLFE 2OAP1 2E87A 4Q19A 3R9IA 5G53C 2P5TB 4KITB 2YWGA 3BAFA 5FPYA 2C04A 3U4QB 3GP8A 1CIPA 3LV8A 4TTQA 1JPNA 4KV9A 2FV8A 5JCZA 4O0MA 4LV6A 4FWTA 1G4AE 1JR3A 1LB1B 3WNDA 3NEJA 4QBGB 1M2OB 3VU9B 3BE4A 4IOLA 1FTNA 2Z4RA 3DMNA 3AV0B 621PA 3FB4A 3FDIA 5E7IA 1Z3IX 5JECA 3RSOA 1HE1C 5LPNA 2ONJA 3W8NA 1Q1QA 3F3YA 3U6BA 4A0FA 2J7KA 5G41A 4EQ6A 3MWYW 5CDFA 4GDFA 1FNNA 1R0WA 2DR3A 3KXLA 4NYIR 2IUSA 4FMCB 3QEJA 2OXRA 3HR7A 5JJIA 4M22A 1HY3A 1IXSB 5CB6A 2XSZA 1W46A 1XZQA 3RS4A 5C2JB 4LX0A 2VO1A 2JLZA 5AUQA 2H57A 2V8OA 1OHHA 3EG5A 1T4GA 3LLMA 2JDIA 3EW9A 3NBFA 4HAWA 4URXR 2IEYA 2ZI3A 4DVGA 3K0FB 4JJZA 2ZYTX 2GCNA 2JDID 1Z07A 2A5GA 1TUIA 2XEXA 3FMIA 3B6EA 3TRFA 4L5BA 4TLAA 5H1YA 1JB1A 1W0JA 1RRFA 2ZI4A 5A4JA 1RJ9B 3MWKA 1CBUA 1JR3D 1XB2A 4QRHA 3WNCA 4A82A 3K0EA 4ILEA 2IXFA 4M9QA 4PPNA 3AUXA 3QENA 1CU1A 5DYGA 5CJ2A 1E4YA 5SZKB 2P6UA 3WHKA 3LRPA 4UXHA 3ZLJA 1ESMA 3QXCA 4WZAE 1Q20A 3EX7C 1G8PA 3CH4B 2HXYA 2FOLA 1IBRA 3CRVA 2QN6A 3CKLA 4EJSA 4OHZA 5C18A 1KZ7B 3WY9A 4M9XA 3JVVA 4GI7A 1X6VA 1XNJA 3KJHA 1ZBDA 1A5TA 1EK0A 3AUYA 1UJ2A 2BMDA 1OIXA 3C7KA 3GJ6A 2PLFA 2FH5B 4NCNA 4IEEA 1RYFA 2H92A 1TF5A 2ZROA 4GT1A 4S35A 3TIFA 5CLQA 4LJ8A 3GMTA 3M1IA 2G88A 4PPGA 4W5WA 5IHPA 4TYNA 1ESNA 2BMFA 2WMOB 4C0AC 2VEDA 4UNPA 4OBEA 4JS0A 4BFSA 1XEFA 1YRAA 3Q8XB 1FMJA 4DLVA 4OQNA 4Z1MA 3P1JA 2O0HA 4NE2A 2JLYA 1W49A 3TUJC 2C77A 5IRCD 1LTQA 3QXXA 3A4MA 1CKEA 3LW8A 4QC2A 4G5OA 3RLFA 1N6RA 2ZU6A 4US2R 1WRBA 3IHLA 2F9LA 2W00A 1TF2A 3PEUA 4M1TA 4DRZA 1K6MA 4IJMA 3AH8A 4NL4H 1NP6A 3EA0A 2UZIR 4ZIRA 1HURA 2XXAA 2YC4C 5EXXA 3VTKA 3CRMA 4LPSA 1SHZA 1G41A 2ZI9A 2WV9A 4XIGS 4MRSA 1NBMA 4K81B 3HYRA 5CLLA 1IOZA 2ZRKA 1IN4A 4Q66C 1XEWY 1E2MA 1AM4D 2FFBA 4TSFD 1OSNA 4PTLA 4ZV4A 1GM5A 1VCNA 1Z6XA 3LBIA 4PANA 1SXJB 4ZO4A 3B78A 2YWEA 3TJZA 2VPPA 2XB4A 3T35A 2NO1A 2W6JA 2WKPA 3EA5A 1NG9A 3UXMA 3CX7A 5KU1A 1G6HA 1KDPA 2BBOA 5CK4A 3ZZUA 5KSPA 2C9OA 4IFEA 5FPHA 3UG7A 2CHQA 3GFPA 1FL9A 3KKOA 2DFNA 4LBZA 2GWHA 5BWMA 2GHIA 1Q0UA 2OUKA 3MMPA 4EFLA 3BFKA 2QNRA 3SFZA 3QI2A 4B3XA 2JATA 3LXRA 4OL0A 3PEYA 1KMHB 2J0QA 3ECCA 4BASA 2O8EA 4PQRA 2WM9B 3DHWC 3LDAA 4R7ZA 3W6NA 1P3JA 4OQLA 4B3BA 2WOOA 2DB3A 1E2PA 4OQFA 1X8LA 2AFIE 1PUJA 4GRAA 1XJ0A 4P33A 4C2TA 2B8TA 1ZM4A 3K9LA 3GEEA 4HLCA 1WF3A 4TL6A 2XGJA 1LS6A 4DSNA 2ZR7A 3W8RA 1OYYA 2WHXA 1KMQA 2JJ8A 3IIJA 2QGNA 1G18A 4YDSA 5C4GB 2BWJA 1T5LA 1TU4A 4MYUA 521PA 1VYVA 1XPOA 1T3SA 1DADA 1LF5A 3BOSA 3AM1A 4JL8A 2PZFA 4NDZA 2QMHA 2VBCA 3VR6A 4JZKA 2DFTA 5E3HA 3WYGA 1GL6A 1M7HA 2Q9CA 3D8BA 2J0VA 1Q12A 3PQCA 5F2EA 4TQUS 4U02A 3AKCA 2IF2A 1VDZA 3FKQA 4YMWA 4QM7A 4TMTA 2JIZA 2JLSA 2XZOA 5EUQB 5IDVA 3VKHA 2IEZA 3DL0A 1MABB 4TMWA 4Y0AA 3AP3A 3THOA 1OH7A 2KJQA 4EQ6B 1N6PA 4NKRA 2CHVA 1B23P 1QDEA 2VHCA 3A1TA 4BFXA 1DAFA 2QI9C 5DHFA 3U3JA 1J90A 2ECKA 2GVZC 4V03A 2EFEB 1S1MA 3A4LA 3O8BA 4OYHA 3TLXA 2XAUA 1P7CA 1JJVA 2BOVA 3WNBA 5LD2C 1UBFA 4JL5A 3UMFA 3HU2A 3TUIC 1T91A 4HZIA 1KZGB 1AQYA 1J2JA 3WMEA 5DH9A 1PLKA 3L0SA 4JKYA 3UMSA 5KHOC 3IKJA 2REBA 4GL2A 2QTHA 2BC9A 1R2QA 1W47A 5SZJA 3NDBB 1PUIA 1N5LA 2V7QD 3W90A 3NVAA 4I1VA 5JEEA 5TV2A 1GNPA 1J8YF 2D74A 2WJGA 3NKVA 3ZIAD 3FOZA 4PZYA 5A5GA 3G0HA 2B21A 1KYIA 3PUWA 3EZ9A 4CT5A 4LHWA 1D2EA 1E2LA 3QF4A 2BBWA 1F2TA 4EPXA 4XH9B 3NWJA 2AXPA 3A1WA 2QPTA 5E7JA 3B1ZA 2BJWA 3JZMA 4PC7A 3CNNA 1DAKA 4Q1AA 4Q4LA 4R2IA 2J45A 1ZCBA 3NC1C 3UPUA 3CR7A 3SYLA 3CO5A 3FMPB 3E2IA 3LQRA 2I3BA 3U5ZB 5JWOA 1DOAA 3IQXA 2QORA 2OCBA 1W0JD 3PEVA 2GZAA 2PZEA 4WIAA 3KKPA 2A5JA 4QHYA 4OHXA 1JALA 1WCV1 4ABYA 3AVWA 1NIPA 4MGIR 4Q9HA 2WJJA 4G0NA 3K09C 3QPWA 1YRBA 3VR1A 4PR0A 2FEOA 3UIEA 4P4SB 3I8XA 4JL6A 4Q03A 2XZPA 2H17A 1L2TA 4M0LA 2ONKA 2YNMA 1KO5A 4E09A 3AVTA 4LRWA 4Q01A 1E0AA 2RGCA 5B2ZA 4JLDA 1E2NA 2CL6X 1OV4A 2P5SA 5BN5A 3T5GA 5L3QB 1HQCA 4A2WA 3SYNA 1G3MA 1GKUB 2XNSA 2C9YA 2JLRA 1XFAA 2WWIA 5KNDA 1OPXA 2WIAA 3NDPA 4DT1B 2E1RA 4IVPA 4G5QA 3K1JA 4KBFA 4ZCMA 2QSZA 4MGKR 4Q4AB 5G40A 1EESA 4MA4A 3LD9A 4WOPA 4B48A 2DBYA 4LJAA 4HYYA 4LDJA 1DELA 1E9DA 4R71A 2F6RA 3GLIA 1E1RD 4JLAA 1Z8FA 4EPRA 2H1LA 3OAAD 3VMFA 4ZI2A 2BJVA 5IK2A 2R9VA 2IUUA 2WJVA 5KUTA 4UKDA 2J0UB 3NG1A 3NTUA 2GJAA 3AVYA 1SKYB 4F38A 3KQNA 4C0LA 3ZQJA 1XXHE 2YKGA 1EFTA 1D6JA 1MABA 3C8UA 2CE2X 1CRQA 3K70B 1NRJB 3GCGA 1DPFA 2CE7A 2ZTSA 3AVVA 1KJZA 1J70A 1XD8A 2OFOA 1XMVA 1C9KA 4PO9A 1NSTA 5FI0B 1TQ2A 3PFIA 2IWRA 3U3OA 2O8DB 4EPTA 1W36D 4FCVA 3JZAA 4LV8B 5F3WB 2P6RA 4QJ3A 3CH5A 2I4IA 2WSSA 4RD1A 1RIFA 3UWKA 2VA8A 3SR0A 3QKRA 1GOTA 421PA 4D25A 4DZZA 4URVR 4WXRA 1ANKA 1KHTA 3MUFA 3Q72A 2DPXA 2QTVB 2IYUA 4M2LA 3ZQ6A 4RFSB 4MITA 5KDLA 3CLVA 3NXSA 4HAZA 3SJBA 1JQLB 1RRCA 4KVGA 5FOWA 3RWOA 1M1YE 2ZREA 4BZQA 3FFBA 4TL9A 4AY2A 3THYA 1NIJA 1NN0A 5DISB 1CJKC 2H16A 3L82B 2DYKA 1XXHA 4TLCA 3BB4A 4EJSB 1CLUA 1XPUA 2BHRA 4Q1FA 1R5BA 2AKAB 4V0OA 4UQOA 1LY1A 1OB2A 3FVQA 4FCTA 3LVQE 1XDBA 4GP6A 1JNYA 1G8YA 1IY1A 2H5EA 2LKDA 1X3SA 4V0MA 3NH6A 1US8A 2F1RA 3N70A 2P6NA 3KKNA 4FMCF 3C14C 1YU9A 4HUTA 3W3ZB 1CEEA 1T3HA 2FFAA 1G21E 4M1OA 4G5GA 2IS2A 1W4BA 1QHHA 2W2XA 1K5GA 2B7CA 4QJ5A 1U0HC 1S9DA 1U0LA 5FPKA 2GK7A 2QGZA 1QBKC 1AS2A 2OCPA 4BEJA 2NO0A 3RS0A 1SZPA 3KFVA 2QROA 3TR5A 4IEIA 2IS1A 2RH5A 1U9IA 4B35A 4DLYA 4MRRA 2QEQA 1R5OA 2XOKD 1R8QA 1QVAA 3BFVA 4U00A 3K0CA 3THXA 3IEUA 1ZIPA 3CONA 2RHDA 3PJRA 3QVUA 3KZ1E 2YZ2A 2IBMA 8OHMA 1CRPA 2BCGY 2LCFA 1G3QA 1SVWA 4MKIA 4L9WA 4BEBA 2VP5A 3QE0A 2BIFA 2YYZA 3QXJA 3W6OA 3EWAA 3L43A 5KPDA 4RSGA 1Z6GA 5TXGA 3CRW1 3R7WB 2IS4A 5FUXA 1XEXA 5CK5A 3M6AA 1VPLA 1KSFX 5B58C 1DS6A 4GNKA 5F9FA 3SYKA 1XD2A 3OEHA 1P62B 1I4DD 4KFRA 4RKFA 3X1WA 3TK1A 5HR5A 1XRJA 3ASZA 3EPKA 1QHGA 1GTVA 4EAQA 2CCKA 2JIZD 4UJ5A 1ZU5A 4OI4A 4TZ0A 3ZDQA 3Q7QA 2OBNA 2PZGA 4Q7KA 3AF0A 4QGGA 4RVCA 5G3ZA 4BWYA 4DB4A 4Z8YA 2CCGA 3GQBA 5L8VA 3T61A 4ZCLA 1TQ6A 2OILA 2GJSA 2E9SA 2IXGA 2GJ8A 2AWOA 3TSWA 3N2IA 1XTRA 2YOGA 5TMPA 5KSOA 5B30A 4DKXA 3OHMA 1T8TA 1YZKA 1EFCA 2IYLD 3DKPA 1G1MA 4RD3A 1UKZA 5FOTA 4EKDA 2ZRPA 3T12A 5EJEA 1Z0JA 3H2YA 2I1VB 2VHQA 5H68A 2IK8A 4KI0A 1W4RA 1KKLA 1VHLA 2ZANA 5C4MA 2ORWA 5EQTA 4RCYA 2L0XA 2WAYA 4JMPA 1XTQA 5HPYB 5K8UA 3GLGA 2GCOA 5SZIA 3T1QA 1IN6A 3EZ6A 1E2DA 2WJYA 4HDOB 4PZLA 2RGNC 1S4QA 3KKMA 3O8CA 2DWOA 2ZJOA 3LH5A 5F98A 3I32A 4WA7A 1ZVQA 4DSOA 5FR2A 2ZSAA 2RGGA 2VYFA 4RD2A 2K5UA 3K0FA 1NKSA 2IHBA 4NZYA 4AC9A 3KQLA 2ANBA 4W5JA 2ATXA 3TAHA 4LBYA 4PAMA 4A0RA 4LHYA 4OQXA 1KOFA 1UKVY 3FFAA 4NTZA 4MYHA 3R7WA 4LK2A 4I81A 4URWR 3H4MA 3PEWA 4X8LA 1SVIA 2ZJ5A 4FD2A 1TADA 4RZXA 2CXXA 1N25A 1NKTA 1M8PA 4ZI3A 3AQ4A 3TKLA 3A1UA 4OK6A 1BKDR 3R20A 3DKVA 5K8TA 4JLNA 4UJ3A 4PPFA 1GSIA 2OV2A 1E79D 4CW7A 1L7VC 3OFNA 1CJVC 3W6PA 4LBVA 4B2PA 5HCNA 3JVUA 3LWNA 3AKEA 1G3UA 2NGRA 4H1UA 1P61B 1XCGB 1UBGA 2V4ZA 2O8FA 5FBLB 4QG7A 1VCOA 3H0KA 4PC2A 3PXGA 4IW3B 2JJ2A 1JI0A 4KAXA 2REOA 4HDQB 2Q9AA 2QE7A 1KK1A 3BS4A 4AYWA 2ZI6A 1KY3A 3C5CA 3RRNA 1II8A 4TQ9A 3AF2A 4IDQA 4B47A 4IHQA 3VHXA 3W34A 5FTKA 3IGFA 2D4HA 4OJKA 4CRWB 2XB2A 1ZM3A 1KTVA 3NBZC 2D7CA 1IHUA 1AS0A 4TYPA 2HJVA 3WYAA 4B3FX 1P75A 1W48A 4KO8A 4DIDA 1ZU4A 2PMDA 3KUDA 3RVBA 4UXIA 1VYUA 2HT6A 1ZM9A 3NHBA 4MRVA 2GZHA 1KSHA 2QAGA 2FSGA 3F5FA 3SQWA 2ZRLA 3VFDA 1E9RA 1GKYA 4DSTA 1E1QD 4URUR 2CLCX 3K0AA 1AA9A 1WDTA 4KLNA 2QRNA 5J40A 1GAJA 1BOFA 4PQYA 1TX4B 4DEYA 2ODBA 2CMKA 4POAA 4B76A 4DHEA 1KO8A 2OESA 4BECA 1QHXA 2IYTA 3L0OA 2FSHA 4LYFA 4OI1A 2HXSA 1N5JA 2QAJA 3UWOA 2GJKA 2RGDA 4C4PA 2N42A 2PJZA 1G8FA 1UAAA 1ZNYA 3KUCA 4EPVA 4CT4B 3CZQA 3SBDA 1P9WA 5KDDA 4F4IA 5KTYA 2R6GA 3EZ7A 3VR5A 4BUJA 1EX6A 4LZZA 4TYWA 721PA 2H7VA 4PSAA 5EUMA 4P4UA 2QENA 2A5DA 3BJIC 3HP1A 4I1UA 1U0JA 2A3RA 1O87A 4YMTA 1T8UA 3EAQA 3ETLA 3LO5A 1IN7A 4PAQA 1U81A 4LHZA 1XCPA 2C5LA 4TTRA 4TWZA 1U9IC 1UEIA 5CDFE 1AGPA 2R6DA 4RD4A 1GP2A 1KY2A 4MGZR 4JSTA 4Q48A 3ZYCA 2X19A 2RHMA 2W6ID 3AF3A 4D0GA 5F9HA 4C2UA 5CIQA 1VG9B 4BGDA 5HKKA 4D2IA 3X1YA 1BYUA 4BFUA 5DN6D 5HZKA 1F2UA 4HB2A 4H9GA 2GEVA 1L4UA 2QM8A 3GLHE 3MAAC 2IC5A 1JXOA 3QPVA 1AK2A 2O0KA 4NPHA 2O8CA 2J1LA 4IFBA 2RB4A 4F4CA 1XJCA 1JECA 1NLYA 2OCYC 3SNHA 1YE8A 4IXMA 4HUQA 2BKUA 3PUXA 821PA 1EXMA 1F5NA 2OT3B 3V00A 4CEHA 3NH9A 1A7JA 2OEPA 3N2EA 1VCIA 4PXAA 5FOXA 2GJ9A 5L3RA 2F3RA 2XZLA 4DLTA 3TW4A 1DVRA 2O0JA 4C9BA 2QBYB 5J5CA 4Q1EA 3E5HA 3GEHA 3RS3A 3KB1A 3MGCA 121PA 3AGQA 4ACBA 5IT5A 3TE6A 3UKDA 2PCJA 1E2HA 4V0LA 3AVXA 2B92A 1E2QA 4PC3A 1W4AA 3IPXA 5CYPA 1G8GA 4ZDIA 4NYMQ 2A5FA 1ZUIA 2FF7A 2JGNA 4IXNA 1YZUA 2ZSDA 1ZD9A 2CBZA 4BRUA 4KJZA 3L0IB 3QOFA 4D82A 4D0LB 1RPZA 3GLHA 1BH2A 2HLDA 3B85A 2VSFA 2WZQA 4OK3A 2C98A 2WJHA 1BS1A 5KNBA 3D31A 2AWNA 2CJWB 3KXKA 3Q7PA 2WPDD 3LW7A 1ETUA 1OXSC 1W2HA 2AX4A 2V3CC 2IYWA 1Z5ZA 1KK3A 1NY6A 2PX0A 1GRQA 1TPZA 1UDXA 2AD5A 4PO8A 5AJZA 2A5YB 4YXWA 5LBIA 1G7TA 2N1BA 2ODWA 5DI3A 1Z0FA 5DO9A 2RMKA 5EE3A 4DLSA 4DBLC 1AJEA 3DPUA 2BMJA 2QZ4A 5CM8B 2KB0A 4Q7JB 1SVSA 2C96A 2EFGA 2XNDD 1U2RA 2NTYC 1ZCAA 2PT7A 4L9SA 3VAAA 1KDTA 1DEKA 3DMDA 3DZ8A 1HT2E 1JR6A 1G64A 2D3WA 3PCRB 3SHWA 4Q5IA 3WP0A 2WWGA 5DHAA 1HYQA 2CJWA 3CRQA 1E79A 1HT1E 1AQUA 2MMGA 5FOUA 3P4YA 1CJUC 3QBVA 4Q9IA 3QXHA 1NVXQ 5FUYA 1VIAA 2GK6A 3LNCA 2X8AA 2WWXA 1LV7A 2ZYUX 2OCAA 1COWA 1S96A 2CL0X 3REFA 1R4AA 3DO6A 1QHNA 3CPJB 1KI4A 4FMBB 2B6HA 4EIWA 3ZVRA 2PBRA 4MH0R 3SZRA 4V0ME 5IF9A 4E03A 4NONA 1TF7A 4H1VA 1GKIA 2VSOA 2V55B 1T0HB 2WWFA 1E2KA 1Z0IA 2R6FA 2HJGA 1TEVA 1OXTA 3B1XA 1OE0A 3A58B 4L15A 4Q7MB 4U5XA 4DDTA 3BB1A 3QJYA 1WMSA 4K8OA 4ARZB 2G83A 5J4LA 4B75A 2D62A 5JMTA 4O3MA 2YC2C 2QQEA 3I5XA 1E1QA 3MFYA 2EFDB 3PVSA 1Q3TA 5AUNB 2NIPA 2ODNA 4NBSA 4PHGA 1OXVA 1RYHA 4HI0E 1PJRA 4IVRA 4LHVA 2Q3FA 2ZUBA 3K9NA 3TGPA 2OBLA 2CLDX 3CRRA 1F2UB 1KO4A 4HEJA 5JJLA 2O8BB 1GRNA 3ZVLA 4XWKA 2BM0A 3KQKA 2YOHA 3EPJA 1VHTA 4LOAA 3OIVA 4MKGA 4DCTA 2BDTA 2H8KA 4HAVA 1NVUQ 3DDCA 3U4QA 1SKQA 4M4SA 2GCOB 1OF1A 1VYTA 2VHTA 5TY0A 4F4JA 1RRPA 1YJ5A 1IY0A 2G1JA 2HUPA 3FHTA 3WBKA 1CXZA 1U90A 1ZAKA 5DSZA 1AN0A 1UBEA 3AVOA 1HUQA 2Q6TA 1NMXA 3LX8A 1E9SA 2AD1A 1BYIA 3V4FA 1II9A 3TBKA 1E99A 1YR6A 2OBMA 3RRMA 4A9AA 1HEIA 1C4OA 1H8ED 5AJYA 1QHSA 4JVMA 3I8SA 4AKIA 1KI8A 1P9NA 2J87A 4MGYR 5E7MA 5AR1A 2OLJA 1YR8A 2ZJYA 4HUQB 1SKYE 3UMRA 4B6EA 1JBKA 1GIAA 1XWIA 5FBRB 4ZDJA 4A36A 1UPTA 1UKYA 3O47A 1EGAA 3LAWA 3X1ZA 4PFSA 2ZSFA 1IAQA 1OH6A 1DAIA 2KBEA 1KI2A 1ODFA 4RJLA 3T06B 4ITRC 2V1XA 2XTZA 4RZ3A 4TLDA 2EQBA 3I73A 5BYJA 4PQFA 1P9RA 3TSZA 2Q3MA 3FTQA 4C7OB 2IT1A 4GMDA 4ESVA 1N3BA 2ZRMA 1MOZA 4XOIA 1RVDA 3CBQA 3G82C 2B8WA 5EP2A 1P2UA 3AP2A 1TAGA 2CCJA 4II7A 1WBDA 3B5JA 2ZSBA 1XBTA 1YVDA 4ZPXA 2ZE5A 3V9PA 2ZJ2A 3T34A 5D3MA 3K53A 1U8YA 1ZRHA 2GCPA 1H8EA 2MMCA 1W5TA 2ZITA 3RS5A 2ERXA 1N6KA 4Q4AA 4D4KA 4D6PA 1T5IA 5EP4A 2C95A 1S8FA 4A1FA 2OFWA 1MO5A 4TL8A 3FHCB 4LJYA 4MRNA 4BZXA 5KYKA 2HF9A 2HV8A 3ICEA 5FUVA 4A2QA 3U7EB 4JVSB 3GPLA 1N6NA 3RABA 3FMOB 4M8NE 2FGJA 3OEEA 1MKYA 1P6XA 3RSLA 3VX3A 3VNVA 1XTKA 3ZH9B 4ZCIA 2IS6A 2ZR0A 3SE0A 4XTCS 5H8WA 3L8YA 1OH8A 3MSXA 1GL9B 1KDOA 3IO5A 4Q02A 3L0PA 5FTNA 2HYDA 2P67A 2TMKA 1Q1BA 3FPAA 3IO3A 4DLXA 3I72A 5GJBA 4O25A 4GFDA 4FMDF 4FXPA 3HR8A 2ZJBA 2CVFA 3PENA 3R8FA 3QIAA 1FQJA 1F6BA 2ZR9A 4LSGA 2Z43A 1GRRA 5HE8A 4M9ZA 1GZSA 3REGA 1QHYA 2D2FA 3TSOA 4I1SA 1RC8A 1UF9A 2A9KA 3OEHD 1II8B 4MYCA 2R2AA 3SHFA 1SVKA 5FL7D 1G8HA 1DAHA 4XWAA 4BLTA 2KWIA 1OXUA 4HLUC 1Z22A 1OJLA 1V43A 5SZHB 2UZ3A 4A8JA 1RJ9A 4B3DA 1MT0A 2QTFA 4D26A 3IBGA 3GEIA 2ZRGA 4I1OA 2O8EB 1UBCA 2IYYA 4XD7D 3DEFA 3GJ4A 1IM2A 4BLRA 2J5XA 1NN3A 2IW3A 4CEIB 2YINC 3PG5A 4W7SA 1P2TA 2G0NA 4FCWA 2GBLC 3THYB 1H65A 1OT3A 4QBFA 1EFUA 1DE0A 2J46A 2PH1A 1V5WA 3AP1A 4DEXA 1B0UA 3BB3A 1E9BA 4JJKA 3RS7A 3J81k 4DB2A 2QAGC 2FJUA 2NMVA 4PHFA 3UK6A 1NN5A 3PUZA 3IHWA 3R9XA 3X2SA 2Q3HA 2QRZA 3DM5A 4KYUA 1EWQA 3VKGA 2ZRHA 4KSCA 1KSGA 5JFGA 3CIOA 1WXQA 2AL7A 3DOEA 4JT2A 2DCUA 3ADKA 1W0KA 3AVPA 2QPOA 3ZIAA 4DJTA 1MO3A 1I4TD 4G5RA 1SQ5A 2ZQ5A 2F7SA 4EDHA 2YV5A 4C0KA 1HTWA 5J4KA 3LY5A 3EASA 4FN5A 1L4YA 4AI6A 3Q85A 4XSGA 5GVSA 5BN4A 4NYIQ 1E96A 1SVMA 1KI6B 2GEUA 4W5HA 1UKEA 4IOJA 1U8AA 4FMDB 4NCKA 4DDUA 4D81A 1GL7A 1ZM7A 4C0QC 3I3SR 2OZEA 3ZVNA 4KXFB 1MRSA 1FP7A 3GLIB 3U7HB 3I62A 2F43B 2ORVA 2HT1A 2EU8A 3U6KA 3WYFA 2A7QA 3HU1A 4ZDKA 5C46F 2WTUA 5FFMA 2ZE6A 4ZKEA 4AIIA 2PJRA 4JVNA 5FH9A 1O3YA 4Z54A 1GWNA 1E98A 2CVHA 4O2RA 1MV5A 4JBYA 3TNFA 2NG1A 2JCSA 2UVQA 2YOFA 3P20A 1TEXA 1OFHA 5EZ6B 4QGAA 4LV5B 1FQKA 3I4LA 4ERNA 5DYIA 3ZS9A 1H8HD 1VG0B 1SXJD 2BM1A 4B71A 4BE7B 1NI3A 1DO0A 4JLJA 3GLGE 4XD7A 5CITA 4P0TA 4CF7A 2IYZA 1HQYE 3RNLA 3U60B 3IPYA 3LBNA 4X8HA 5JRJA 3S1AB 4HAYA 3D7MA 2IL1A 4PPQA 2ZRNA 2ZUDA 4NYJQ 1RZ3A 2CNWA 1VECA 2W6IA 2P3SA 2BMEA 3TAUA 3QXSA 4G5SA 5DN6A 1E2JA 4TMKA 5EE0A 1G3RA 4HB0A 5EP1A 3TR0A 4KU4A 4Y0VA 2ZE8A 1XJQA 3H86A 1AZTA 5CJPA 4CEJA 4RCZA 5FOVA 1MO4A 3LX5A 4I99A 4LC0A 2CL7X 2GZDA 3QY0A 4BFVA 4B6FA 3QKSB 5BQ5A 1KK2A 2IF0A 2IUTA 1JAHA 5KSYA 1S3GA 3DVLA 4G3XA 4OI2A 4AK9A 5LDDC 1SGWA 4DCUA 4A2PA 4UNQA 3EC2A 4N1AA 3AEZA 2A78A 1H8HA 3P4XA 1E69A 3PUVA 1AGRA 5K8IA 2WWYA 1YKSA 4HAUA 4OHVA 4F91B 1D8TA 4TLEA 3VHLB 2CNWD 2CHGA 2ZYWX 3QKUA 4FW9A 1JAIA 1GFIA 3QG5A 3F8TA 3SBEA 1J99A 2Z5FA 1OHHD 4BZPA 3BORA 1IJFA 1X1SA 4KFTA 3MJRA 5TDHA 3U7GA 1IY2A 3MRSA 1W4CA 2DFKB 1W36C 4LCBA 1UDWA 3MLEA 1KNQA 2IWHA 1PVOA 1NL3A 1W2GA 3L2OB 3B13B 4LJ6A 1E9CA 1IQPA 2HYIC 2A2ZA 5GJCA 4AYTA 3SJCA 4UNSA 4AWXA 1AIPA 4XVUA 5GVRA 4XWOA 3K70C 2XX3A 4QHSA 1G4UR 4QL3A 4M1WA 5JRZA 2RKOA 4KLZA 4QXAA 4LWZA 3PR1A 2NO9A 3TVTA 1G16A 1GILA 3CX8A 4E5UA 1BO6A 3A4NA 1SXJC 2QMEA 3OEED 1XTSA 1CULC 5E95A 2NOAA 5DI9A 4DCNA 2ZXUA 3K8YA 2O8DA 4KFSA 3ICQB 1UEJA 3MG9A 2YVUA 1A2BA 1CJTC 3IIKA 3PITA 5FBVB 4M9SA 4IDNA 4V02A 1PZNA 1Z2AA 2QA5A 1UADA 4CGZA 2Q0HA 4QM6A 2GDJA 2F55A 2OM2A 4PO1A 3QKSA 1G7RA 3B8HA 2ERYA 2B7BA 4A0GA 1OW3B 5J4VA 1OFIA 3T1OA 1HE8B 2VP9A 3B1VA 3KXIA 1NVVR 2NPFA 4DSUA 4EPYA 2YWHA 4MUBA 1P2VA 2X77A 2R62A 3OFND 4XTRA 2PCLA 3FWYA 3X1XA 3N5CA 3NEYA 3FHOA 4ASUD 4I4LA 1EG7A 4TLBA 3I61A 1T3LA 1QVRA 1G6OA 1ZJ6A 2GA8A 4QBHA 4GZLA 4BFZA 3FMFA 1W7AA 1P5ZB 2VIIA 4HLUA 5D3QA 4ON9A 2ZETA 3GJ0A 3PUYA 2EWWA 3NC0C 1RRGA 3OIUA 4QGFA 4RZ2A 3WHLA 2DY1A 4G1UC 2VSXA 4C0HA 4QOSA 4DCSA 3VR4A 2J0UA 4HLQB 3OE7A 3LXXA 3KTAA 2F3TA 3BGWA 4TT3A 2QP4A 2Z4SA 2V9PA 3NBYC 4DUGA 2GXUA 3B1YA 2DFLA 2BVNA 4P4SA 1FW6A 3SFVA 1ZUNB 2LWIA 4AKEA 4AD8A 3RANA 3WMGA 1E1RA 2VLIA 4AG5A 2YWFA 3O8DA 4BPBA 2HDNB 4WW0A 1A2KC 5JHHB 4Q9JA 1A4RA 1GNRA 3H84A 1KNXA 1U98A 1XD2B 4O2LA 2WVJA 2LKCA 4EFMA 2G6BA 3U3RA 4IDPA 4ZKDA 5L3QA 1G7SA 1PLJA 1XZPA 3P27A 5EE1A 5KO2A 1KAGA 2GILA 3K9HA 4DIEA 4EJSC 1XPRA 1ZYUA 1E32A 4GSYA 2X1VA 2VQSA 1R6BX 2GESA 2OHFA 4C0BA 3ZVMA 1WE2A 4TZ6A 4DCVA 2GBLA 3A1SA 1IONA 1AZSC 4A15A 2J7PD 1P4SA 1ZC3A 5EXSA 3A6PC 1CTQA 3VR2A 2C03A 2NZ8A 2JLVA 4FIDA 3SC3A 4LUCA 3HDTA 2KSQA 2WAXA 1YZTA 5JWRA 2BCJQ 5EXTA 3GJ8A 1Z0AA 4JLOA 5JLJA 2X2FA 1G3IA 5J4HA 1PV4A 4A6XA 2D06A 3W5IA 1Z6AA 1K5DA 2QY9A 4D4JA 4B2LA 5KNCA 1MO6A 2RGXA 3QPUA 4CEJB 2KBFA 2NO7A 3FGNA 2JA1A 1E9AA 4JLMA 3P26A 4AURA 2EWVA 3SQXA 1X8JA 1FPMA 4XVQA 1Y63A 2ZIAA 3GLIE 3BK7A 2VTKA 2FE4A 1IN5A 4HSEA 1N2CE 2DHRA 4JVLA 1NJFA 1DARA 5TVKA 4TN1A 2BV3A 4P4TA 1U99A 5FBWB 2QE7D 2XXAB 3EZFA 3SN6A 2D2EA 2G77B 3K0SA 3BH6A 4DXAA 3B82A 3G5UA 4D4MA 5HTKA 1ELOA 5B57C 1I2DA 2FN4A 3WP1B 3CR8A 4PX9A 4U7DA 3P32A 2BEJA 4GOXA 2OXCA 1G20E 2FU5C 2ZVPX 3BC1A 1YZGA 4A8JB 1VG1A 3UANA 1KDRA 2AN9A 2ZI7A 3ZZ0A 2Z0MA 4DLZA 2IYQA 5FTLA 1KAOA 1VIYA 3CNLA 5AJWA 4Z8XA 3VR3A 2OFXA 3AGPA 4JT4A 1RFLA 1XX6A 5JI2E 2F43A 3F0TA 3BXZA 1RKBA 2FFHA 3KTAB 3RWMB 4TYYA 1FP6A 4KFUA 4LGMA 4X8OA 5GADl 2IA5A 4TMZA 4NCHA 2QQ0A 5EXPA 3V4RA 2EFHB 3C5HA 2FZ4A 2OLKA 3RAPR 1UM8A 3I5YA 1KJWA 1NLZA 1CS4C 2FPLA 4A8JC 4Q7LA 5FTJA 3CB4A 3IIMA 2HCBA 3SJAA 4GBMA 3CF2A 4LYJA 5JZVA 1GUAA 2EYQA 1F3OA 2AK2A 1XF9A 5K8LA 3KQHA 2RGAA 3GD7A 1FUKA 1Q1EA 1LNZA 2VRWA 3MJHA 2W2VA 1E0KA 4LJ7A 1XMSA 3K9GA 4YMVA 2CEAA 3VX4A 3M0EA 1FMLA 2OSBA 3DM9B 4HZUB 4NCJA 1ZUHA 1NLFA 1W36B 3BWDD 1N6HA 3A37A 3VU9A 1E6CA 2RGEA 1TMKA 1E2EA 4N0EA 1XU4A 3ADDA 5EP3A 1XMIA 1S2MA 2JLWA 4KCGA 2QT1A 2YJTD 5EE9A 3EARA 4Q1DA 3CWQA 1QRAA 1G17A 4LJ4A 3GLHB 4LPKA 1Q3HA 1ZD8A 3LFUA 1HH4A 1CP2A 2CDNA 3ONWA 4BFYA 3ZS8A 1Y3AA 1KKMA 3GJ3A 2FA9A 3HWSA 1DO2A 2WWHA 2CK3A 2ZJZA 3IUYA 5HZHA 1GDDA 1N0VC 2YHSA 4DDWA 5FL3A 3HJNA 3ASYA 3HYTA 3UG6A 4C7OA 4RY2A 3CX6A 4NU0A 3D6TB 3H1TA 4R9UC 4GP7A 4BFWA 1Z6TA 3KL4A 1ZMXA 2V6IA 1TNDA 1X86B 4J0QA 2ZRBA 4QGHA 2EVWX 3PV0A 3RC3A 2BEKA 1Z08A 3IDQA 3M4YA 5FPTA 3EC1A 1DG3A 1C1YA 2V6JA 3OAAA 1ZD1A 1ZNXA 2MSCB 3GLFA 3SOPA 3S1AA 4JLKA 2EYUA 4JIMA 4B74A 1YR9A 4MYTA 2ZEJA 1M7GA 2C9CA 2R65A 3BIFA 4AG6A 1ZW6A 1R0ZA 1FX0A 2QUZA 3KJGA 2N46A 1IJEA 3CWZA 3ADBA 2GTPA 1SVLA 1NNEA 1LVGA 1K8RA 4KSBA 5FUWA 4MDFA 1SXJE 1R0YA 1YQTA 1NBMD 2AKYA 5JBQA 4TMXA 5DGXA 3SDZA 4V0KA 5P21A 1OIWA 3ND8A 1E0SA 3EIEA 3T1TA 4Q1CA 4AKHA 1KIMA 4HDCA 3HPRA 4L8GA 2IXEA 2XJ9A 3FKSD 1Z83A 5AK0A 3U3MA 4ACAA 2PMKA 4JYCA 2NZJA 1EWRA 3BH0A 4LJ9A 1GVNB 2GF0A 1N6IA 1D2MA 3BERA 2ZU0C 3A8TA 1ZNZA 4LBWA 2QP3A 5J47A 1AKYA 2VP6A 4PSVA 3I1FA 1LS1A 1OKKA 4M1KA 5M04A 2JLXA 4S2EA 3B7GA 4NYMR 4A92A 2DWPA 2ZAOA 2ZM5A 1T0JB 4LYHA 4RD6A 4URYR 4LHXA 3LVRE 5JCPA 2WSMA 4Q18A 1J8MF 2ZRIA 3GJXC 1VTKA 2Q21A 4HLDA 1KMHA 4B44A 4V0NA 2OAQ1 2SHKA 4HAXA 2G0TA 4KBGA 3RYTC 5JS7A 4XJXA 2ZE7A 3E70C 2FWRA 3C41J 1VKJA 3C16C 2G1KA 3BBPA 5EE5B 4NCIA 1HV8A 4US0R 3QG1A 3FKSA 1OXXK 4L16A 3TQCA 2I1QA 4LJ5A 2VHJA 5KPJA 4OHWA 1KO7A 3KQUA 4TQAA 5AJVB 4Q9KA 2BBTA 1NG1A 4Z51A 3SS8A 4B43A 4CZ2A 1KJYA 3QKRB 1X8KA 4A0HA 4YMUA 1A1VA 1ZC4A 1S1CA 1WP9A 2R8RA 3D3QA 3KKQA 4XVRA 2QL6A 4WZ6A 3DOFA 5JSZB 2XSZD 1D5CA 2GNOA 1JEDA 2FFQA 1NMYA 2FG5A 5LB2A 3EPLA 3WXMA 2CK3D 1D9XA 2HF8A 4Q4HA 4PHTA 2FNAA 1NY5A 4X8MA 5DI3B 3ZJYA 1NVVQ 3B9PA 2P2LA 5H70A 5HKKD 4F92B 1AS3A 1Z2CA 1SULA 4JKIA 2W58A 2QP9X 1YZLA 4DUGD 5FOSA 4Q21A 1YR7A 3NIBA 2D7DA 1GG2A 2ORIA 2ANCA 2VF7A 2ZRDA 4ZDWA 2GXQA 1W44A 3HU3A 5JWHA 4Q9LA 1NBME 5JEDA 1N6LA 5CIWA 2FSIA 5CYOA 4PSKA 4US1R 4QFMA 1M74A 2FPKA 4DLRA 2JJ1D 4KODA 1NN1A 1VG8A 5D3MB 1RE0A 2BBSA 2WOJA 1E0JA 2ZJ8A 2ZUCA 1UFQA 5FL7A 2QG6A 1G19A 5AWFC 5JSZA 4ARZA 2RAPA 1SXJA 4LI0A 4LYAA 3DZDA 4RFSA 4DWJA 3OE7D 4IOMA 1EX7A 3KB2A 5ANRB 1IXZA 4DT1A 4Q47A 3K09A 4TT3D 3LBHA 2W0MA 3TH5A 3C4JA 4CDGA 1OYWA 4DLWA 4MDEA 2C8VA 2FGKA 4JLBA 4HATA 2X2EA 3U61B 1CR4A 3SU8A 4TTPA 1BMFA 2MSEB 1DG1G 4P31A 4UNRA 4GOKA 1QZXA 4DC9A 4BLQA 2QU8A 3Q5DA 2FEMA 1NVWQ 3CNOA 2C99A 3T1VA 5DE3A 4M1SA 1OFTA 4CYMA 1QHIA 1DAEA 2R6AA 2WMNB 2GAOA 4Z1MD 4YMSA 2FSFA 3CZPA 2JLUA 1E3MA 4P32A 5JJKA 4G01B 4AKGA 2W83A 4HB3A 1IXRC 1KO1A 3QVVA 2WPDA 3KX2A 3THWA 4F93B 1JXMA 2QSYA 1F48A 2V7QA 2J3EA 2PEZA 4E07A 3B1WA 2VHUA 4YC7A 2PX3A 4MKFA 5EZ5A 4GZMA 3QKTA 4WXPA 3K70D 3T5DA 1MR3F 1ZNWA 4PAOA 1MH1A 3GLGB 3K0CC 1R10A 1W0KD 2JAQA 4B73A 2VL7A 1Q1ZA 2J41A 4Q1BA 3T15A 3KDSE 3IILA 4B3CA 4KHZA 5GJVC 2OG2A 3EZ2A 1FUUA 2O52A 2WKQA 3GJ7A 3MWJA 1P2SA 4E22A 3THXB 3ADCA 4OKSA 4PZZA 1NSFA 3CW2A 2REXB 4YLGA 3U44B 2HLDD 3AVQA 1E9FA 2NO6A 3LA6A 2JJ2D 2P0EA 2ASEA 1NMZA 4IKEA 4RKEA 4QHTA 2AXNA 1XD9A 4BLPA 1FZQA 2MSDB 2RGBA 1DTSA 3TQFA 3VKWA 4M1YA 1KI3A 4Q4JB 1OKKD 4M21A 2KI5A 2WWWA 4K46A 5LD2B 2OE2A 2ODEA 1EFRD 1X1RA 5CB8A 2C78A 4YQFA 1AKEA 3K0AB 1KGDA 5IK2D 2QMUA 4JSYA 1FTSA 4IDHA 4Q4HB 2ZAMA 3ZD7A 4C0JA 3PIRA 1TQ4A 4RD0A 4MQBA 4BQSA 4GOJA 4QNRA 1FOEB 2GETA 1KSJA 3A36A 4ESHA 4BLSA 4L4UA 3TW8B 1KI7A 5FPSA 5ELXA 1JJ7A 2Y8EA 4QKQA 2AR7A 5A0FA 2O8BA 2IYSA 3X1DA 221PA 5UKDA 2ZS9A 3THWB 1T9HA 2UKDA 2ZS8A 1XEXB 2ZI5A 1R8SA 1G5PA 2GXAA 2AHOA 1XXHB 3GLFB 1Z28A 4JBXA 1XTIA 1IN8A 4EPWA 5BW8A 1KK0A 1Z0DA 3QNUA 1YHNA 3AB3A 3CM0A 1ZM2A 3SJZA 3OZXA 4QNMA 2ZSEA 5C1BA 5FR1A 3FE2A 3Q9LA 5L3VA 3R8CA 1G9XA 3B9QA 2GEDA 5E4FA 1F2TB 2R6CA 3LLUA 6Q21A 4IDOA 4XSHA 3U3KA 3O8RA 4FINA 1PLLA 2VF8A 1BIFA 3UATA 3B60A 1XEWX 1D9ZA 4B34A 5AUOB 1L8QA 4URZR 2HEIA 1ONBA 2QPAA 3R9WA 4R98A 1N5IA 1G7CA 1VMAA 2W0SA 4PHHA 1Q22A 3NBXX 4B3GA 1CJMA 1D2NA 2GF9A 1JPJA 2AFHE 3IQWA 3QEOA 4YONB 1US8B 1YZNA
chains in the Genus database with same CATH superfamily
1ZH4A 2YMQA 2BR5A 4FI3C 1T8WA 1JEYB 2XV1A 2VJPA 4YDQA 2XMSA 4N0DA 1XAJA 5F52A 4KXXA 2DWQA 5JHGB 2Z98A 2AF3C 3NETA 5GJWC 3ZDAA 4AJ4A 4QVKA 1MEJA 4PYOA 5J23A 1LFDB 2H85A 3C3EA 5CM9C 3WL7A 3C8MA 2PZLA 4EL5A 3R5XA 3WGIA 4NMMA 1W1WA 4CQMD 1NYLA 2UXBB 1QHEA 4LC1A 1KDZA 4WN3A 1XP8A 1JTFA 4FSHA 2D00A 3Q0TA 3KKEA 3T3GA 5KYYA 5FLXA 2FI1A 2IFTA 3QMPA 5F5XA 1ONOA 2F8LA 3Q2IA 3MLBA 2ZBRA 3PK0A 2O59A 2EEZA 3CY6A 2AMFA 1V1RB 2IYOA 1Z2DA 4DDVA 3QX3A 3D3JA 4PBTA 1I7DA 1ZXXA 1T8PA 1UDBA 3A4IA 5E0OA 3S8MA 3A1VA 4R2MA 2EXXA 2JGFA 4UNNA 1II0A 3NHZA 4K88A 2OHJA 3VC2A 4EUSA 1B3BA 2GXSA 3ELYA 1KVRA 2GSWA 4MW5A 5ERGB 2C5FA 4GKBA 6REQA 4AYXA 6ADHA 4DE5A 3NUGA 1KU6A 2JLQA 2ZB4A 4MKHA 1JGTA 3V1NA 2GS9A 2ZYVX 5K0LA 1LDGA 4HVLA 4AT1A 2VSNA 4COKA 3VR4D 2X0DA 3O4JA 2FZEA 2HA0A 5JD5A 3TUZC 2BJHA 1Z7YA 1QKJA 1Y3CE 4IVQA 4UXJA 2B78A 2H65A 3FYHA 4OXQA 4MAAA 1IEVA 1U7DA 1OC4A 3EPRA 3U7QA 3E9DA 3B53X 2QT9A 3W5UA 2WSSD 3PU6A 3W6ZA 3PT9A 4I6GA 5D85A 1SRQA 3U26A 4F9FA 1N2IA 3CMCO 4RVSA 4OHYA 3SEFA 1U94A 2BRUC 2W2MA 3VR3D 2NPOA 3N8HA 3WB0A 4X65B 3TDNA 3JASA 1A4XA 1FX0B 3UJHA 3JS5A 4PC1A 1RABA 1K75A 3U7FB 5EUCA 1G9SA 4MVJI 4R68A 4FWIB 4B3IA 4YRZA 2ZRAA 5TARA 4ONEA 5B1SA 1C1HA 1SUDA 1MTZA 1VOTA 2FW1A 2UYOA 1Q0HA 3HM2A 1U8ZA 1M2GA 1E5TA 2FUG6 1NNI1 2O4CA 3CF0A 2GEFA 2A0UA 1T6NA 3QQ5A 1SPXA 4R9SA 5L3SA 4TLMB 2Z8YM 4UASA 2J9FA 4JB3A 3W9YA 4B0PA 3GNQA 2CBGA 3LK6A 4J6EA 5L3SB 4U6NA 3Q3JB 1IY9A 2B1GA 5AK6A 5M7EA 1DBSA 2Z1NA 4C30A 5IC5A 3EXEB 2JGKA 5K4GA 4TKUA 2H54A 1TCUA 3GJYA 4IS2A 5E6UB 5FTMA 1E4VA 3OBIA 4C0SA 2BFDB 7GPBA 1ISPA 3ROXA 4WAUA 2WYOA 3SEAA 1DTEA 2B8JA 2IP1A 2ZRCA 3HB1A 2HCTA 3B2EA 3KOZA 2C97A 2Z3VA 3VOTA 1Y1PA 4CEIA 3LUFA 1C7IA 2EKLA 3V7FA 3PFCA 2A59A 1K0FA 2PUVA 3CF4A 1NF3A 5HF9A 4C3ZA 4HL6A 1E2FA 1JR3E 2EOAA 3AI1A 2VT6A 2W7TA 2Z8YA 3QSYA 2C1ZA 2VDUE 4QXQA 5FBQB 1E58A 1TTTA 2OYCA 1HFWA 2QN8A 1Q44A 2JFPA 1JG6A 1Z4LA 2O2CA 3F5SA 3I0MA 4S1TA 5L95A 3E0QA 4NYJR 1K8YB 1Z0KA 1IIRA 1ZJ5A 2BKEA 5BN3A 1FDUA 4PRYA 1UFRA 2OBYA 1MRNA 1GYRA 4OLAA 2OORA 1I8TA 2A86A 3EWSA 2YBDA 2BGIA 2Z6VA 3NHAA 1RW4A 1NV9A 5DNWA 1H0RA 5KTKA 2I78A 4QFDA 4BB6A 2JASA 3EUWA 2FMTA 1IM8A 4C22A 2HX1A 5F78A 1Q0TA 3DMTA 4BN5A 1TUEA 1CG6A 2OB1A 9MHTA 2PLWA 2ZVQX 3SIWA 4ZZ3A 3FX2A 3WIVA 4EFNA 2GDZA 3L8HA 4O4LA 5JO9A 4YAUA 3Q5GA 1W8DA 2IGTA 1M6YA 2ACVA 4HGZA 1ZP6A 4IXTA 4BTVA 1FYXA 3C15C 3W5JA 2CUTA 1J09A 4H1HA 4Q3KA 5IULC 1BDMA 5ALQA 1N0WA 1OLOA 1RLIA 4YUZA 4S1OA 1Y8CA 3QMVA 1ZIOA 3O4IA 4W9MC 2KE5A 1SD2A 1CEXA 1ORRA 2B4QA 4IDGA 1E9EA 2FWMX 4OI0A 1XCMA 2JKZA 1DAGA 1EVEA 5DEOA 2MINA 5FI1B 1QBGA 2FMXA 4YHHB 1RZRA 2B6NA 2JFOA 1K63A 2C2HA 5SICE 3PGVA 1E2GA 2NVOA 3DW1X 4OFZA 3ANSA 3STTA 3UTCA 3V1TC 2Q5HA 1E2IA 3H87A 1T1GA 3IUQA 4KPGA 4BJ5A 1F60A 3U9TA 2VA9A 4MV9A 5K45A 3OF2A 1LZLA 1G5RA 1GTZA 2EZ9A 4GMHA 5JAZA 3S55A 1CRWG 5HTOA 3KQMA 1J0DA 2W2TA 3B52X 4HJXA 4O0LA 1YRYE 4GR9A 3RRYA 4O2AB 2WVAA 3N2KB 5IJ9A 1U3WA 1C4XA 4J90A 3OM1A 3RRZA 2XNDA 3G5MA 3I34X 4K6CA 4QREA 2EW1A 3G2PA 4XR9A 1FYWA 1LF0A 2P5YA 2PUJA 2Z6UA 4IR7A 3K6KA 1OFUX 2FUEA 4O4HA 2GCGA 2VP0A 4KWCA 5FIUA 2WUDA 5CIYA 3AKZA 1P60A 3M2TA 4D8XA 1G5TA 1N6OA 3ITKA 4WGFA 4CIDA 4EAAA 3HDQA 4M0KA 2WB4A 1WBBA 1YS2X 2QLTA 4E13A 2I91A 1TPYA 2NAPA 1A95A 3CW9A 2L2QA 3G7NA 1WCXA 4QXRA 1G291 1XTTA 4WK4B 2W98A 4ASUA 3F1KA 3FSGD 1WZNA 2YXEA 3GFTA 1ISIA 1M34E 1RFGE 3FBTA 3HYSA 1WPQA 3MWLA 4K87A 1MVOA 3AR4A 4PCAA 3ZN2A 1Y3BE 5EMHA 5BOVA 1K5HA 1VFPA 3RDPA 3ENWA 5LZ5A 1HZZA 2CYAA 2CYCA 4WV3A 2WU0A 4IRUB 2XNCA 5AUPB 1LD3A 3SKVA 3GCDA 3WLQA 2QVXX 1JQJC 3IJEB 4FGZA 3UGKA 4GL4A 1L8XA 1MQ9A 4WVFA 4IVNA 4HOYA 1V26A 1VSBA 1EFHA 4WK6A 1TQDA 1UPAA 4NECA 3GLFE 4MUEA 3TNYA 3LQ1A 4RAQA 5I51A 1F6DA 4Q19A 3R9IA 3FNQA 1CDZA 2XVXA 3VZRA 4JOBA 1JU9A 4JA2A 4GIBA 1OBHA 2CXSA 4W8OA 1M2KA 1QYCA 1CIPA 2P9EA 1H4VB 2HHAA 3T4XA 3FSEA 4CV0A 4X71A 4JN6B 4G4JA 3PC3A 4LV6A 1G4AE 1JR3A 3GAZA 1U2EA 3WNDA 4YP5A 4Y2SA 3VU9B 5HSGA 1I94B 1FTNA 1Z5VA 2Z4RA 1WR8A 4ZAFA 4DV7B 3RTBA 3JQAD 1KPIA 5CM2Z 4YI5A 4D3XA 2DP4E 3ZWBA 2DR2A 1KRHA 3F3YA 4ZCSA 2AJLI 4JP1A 2J7KA 3DMTC 5G41A 5AICA 3MWYW 5EKSA 4GDFA 1XE3A 1YQXA 3TOSA 3ILXA 2TRSB 4MI1A 1RQXA 3RVRA 3H1FA 4W5QA 5HQ3A 4UTPA 1T1JA 5CB6A 2D0IA 2ILTA 4A73A 1SOMA 3CGGA 4F1KA 3HGQA 4LOKA 2OZVA 3KDAA 1KOLA 3QLVC 3R7AA 1F0NA 4DMKA 4ZVRA 5CVDA 4R41A 3ZV6A 4PLYA 1JVBA 2JDIA 1BEEA 3KYCB 1CX9B 4KMRA 3EW9A 2IPMA 4XYGA 1XQ6A 4H2DA 3D7RA 3HUTA 5I4CA 1QFXA 3WIEA 3NT5A 4Q39A 4HNAB 2FP3A 3LHIA 2AW3A 2IEBA 5DOVA 2JIDA 3ZLUA 2OHGA 2R8EA 3JQ7B 4X45A 4GXRA 4W8HA 4L5BA 4XE5A 3TRFA 3J80A 3DC7A 4DMFA 4MVJD 5E9AA 4JQOA 3BCUA 1CBUA 1LSJA 1XB2A 4J76A 4HQ0A 3CNBA 3TCXB 5BN3B 4FFPA 4L73A 2JFXA 3KAJA 3PGLA 4J1SA 2RH4A 3AUXA 4M9QA 5AMXA 1WWKA 5HIIA 3QENA 3SZGA 5DYGA 2OTCA 1BD3A 2P7IA 2O07A 2P6UA 3COWA 1ZSYA 2HN9A 1E5QA 3LRPA 3ZY6A 3U48A 3I04M 4IPTA 1RWKA 4Z3OA 1JFFA 5SY4A 3HGMA 3EX7C 4Y30A 3A06A 1T35A 3AM5A 3EFOA 2FOLA 1IBRA 2QKYA 2QN6A 3LP8A 3H5TA 3O92A 1C2YA 3W6UA 1AH2A 3BFPA 4M9XA 1X6VA 1XNJA 4GLOA 3HY6A 1A5TA 2YIMA 4MS1A 3W4IA 3C3DA 1WPRA 3HUDA 1ZOOA 5HIKA 3CVYA 3EG9B 3F6YA 4X6UA 2AN3A 3GJ6A 3DO5A 3G0OA 4CIWA 4IEEA 1VJRA 4HEQA 1TZBA 1Y3IA 4GT1A 5PNTA 3TIFA 1JDTA 3O9MA 5EQJB 4E2ZA 3MWEB 2JVIA 4LJ8A 3GMTA 4W4TA 4UHDA 3RJTA 1ESNA 2C1EA 2BMFA 2WMOB 3KV3O 3FOWA 3QA3E 2X3UA 4MJ3A 4OBEA 4JS0A 4BFSA 2CMGA 4CMBA 4RA6B 4OQNA 4BVBA 3P1JA 5FWXA 2JLYA 1R64A 1W49A 2XWSA 4IAOA 4RY8A 3TUJC 1V8PA 3AERB 1GT91 2BEWB 1JLLB 2J3QA 3QXXA 5EQFA 3WQBA 3O74A 4US2R 3HV2A 1WRBA 5F7XA 1XVUA 1TF2A 3OLZA 1RZRD 1Y4UA 2HMVA 4JB2A 4ZC1A 1NP6A 1WVGA 2KQUA 1V8OA 4ZIRA 1HURA 3Q10A 5JZOA 4HYQA 1IBMB 5DCYA 4P7KA 2YC4C 4R83A 5I7OA 2Y1KA 2HFJA 4X20A 5KQGA 1E6WA 4BVJA 3R77A 2R79A 3IXMA 4HDKA 3MT8A 3O94A 2AJBA 4YJFA 4K81B 4HVTA 2B4TO 4WZAB 5CLLA 3RSGA 3O82A 2ZRKA 1WQ3A 2VSYA 4HWOA 1QO7A 3BUSA 3I9LA 4PTYA 3Q0EA 4JQYA 2X0JA 1E2MA 1AM4D 4PIMA 3ZU5A 4EL0A 5D00A 3EB9A 5FNVF 3OIGA 3RVJA 1VCNA 1Z6XA 1GM5A 2R4UA 2XNKA 3AWIA 4DR1B 5L7WA 4Z9BA 1BHO1 2E4ZA 4BNYA 3EA5A 3B7PA 4TWIA 3QPDA 5C8VA 3I2YX 3AHIA 4HS9A 3CN9A 3FLMA 4ZV7A 1AHPA 1WAMA 1X14A 2IZ1A 1S2OA 3ELDA 2YXPX 4UAUA 1DEXA 1NVKA 2XKKA 2GWHA 2VT3A 1U4NA 1YSCA 2GHIA 2BKLA 2OUKA 2H5JA 1GCAA 3BXXA 3NRJA 4PO3X 5A4FS 2Y9PB 4C4AA 5K99A 2PDAA 3DE7X 4LY0A 5I8WA 2HQSA 3ZGNA 1TTQB 3ZI7A 2CHFA 1IATA 3R3UA 2PYIA 3H99A 3PD7A 3GEBA 3D43A 2CLEB 3LDAA 3CE6A 3O1HB 3GJQA 2QK4A 2AHRA 4TVOA 1VJDA 1L4LA 1DJLA 1E2PA 1V7QA 2JHAA 2Q1WA 2WT9A 2E5FA 1X8LA 4B87A 1XJ0A 2FG6C 1A97A 2I3GA 3AJRA 3E9MA 3LZ6A 4TL6A 1QDUA 4J9VA 2XGJA 1E6MA 4YO7A 2G40A 2BFFA 1PT9A 2JJ8A 5GINE 3BZBA 3IIJA 5JQGF 5LYJF 4YDSA 5M3BA 5C4GB 1TU4A 4MYUA 2OG1A 1OYVA 4G9BA 3KPWA 1O8BA 3R6WA 4N9QA 4O1MA 5IABA 5EIAA 4ER3A 5HMLA 3BOSA 4NENA 2X9VA 5AI6A 3AM1A 1VLQA 1A7AA 3GYBA 2BTQB 5M34A 2QMHA 2OYSA 4GGMX 4O4IA 3N2GA 5E8RA 1QQ6A 2BE7A 4DRXA 5B1EA 2YFYA 1GL6A 4G63A 2YH2A 1JI3A 3WB9A 3GZ4A 1HTTA 3HWWA 2XMBA 2GK3A 4Z4FA 2FPIB 5KJ6A 3FKQA 3T3NA 4YMWA 3QQPA 3E05A 3UYKA 1T0UA 4Q9NA 2JLSA 4OATA 4QRDA 4RABA 2BP7A 3AUJB 1D04A 2XZOA 4HAIA 3GZJA 1SY7A 3S7ZA 2BTOA 2JGJA 3AP3A 4NIMA 1KJIA 1UWLA 2I9PA 4EQ6B 3N2NA 4ZHSA 2CHVA 2J5BA 2VHCA 5JYEA 3EFOB 2E5LB 1DAFA 4J0KA 4E15A 1J90A 2I76A 4L3VA 2EFEB 1S1MA 5ALJA 4JZYA 1JAYA 1JJVA 4UAGA 5LD2C 3UMFA 3I05A 3HU2A 1QQBA 1HT0A 5H81A 4N5LA 1T91A 1GUFA 3F8WA 5EZYB 1J23A 4GBGA 3WMEA 2CYBA 1PLKA 3DT9A 3L0SA 5AI9A 4MLZA 5KHOC 4IJQA 2REBA 4E94A 2A92A 2NUPB 2QTHA 5F1PA 2WY2D 1AD2A 1QR6A 1NXOA 1E7SA 2RIRA 1Z35A 1WLYA 1R2QA 4R9RA 2FUCA 1PUIA 5D01A 3REOA 5K8CA 3BRQA 2JGDB 1PQ4A 4HF7A 4OUDA 1N5LA 2ZPAA 1MPTA 1RYMA 1T9CA 1G5HA 2YXNA 2FQQA 2YICA 3E3MA 5ER6A 3JQ9C 1ZGGA 3CZ5A 3O1JC 3ZXSA 4I1VA 5EWJA 3KZNA 4MICA 4U7WA 1EU1A 1IRXA 3UZUA 4DZRA 5JEEA 2WV7A 4KK3A 5K8VA 1TLFA 2APJA 1MGPA 5TS3A 2BGJA 3GH3A 1ZONA 3G2IA 4MR7B 1C0KA 3ZEIA 3Q1KA 4PZYA 2B21A 1DG9A 1KYIA 3HNPA 2Q1SA 3MRVA 2EATA 5FYDA 1E2LA 1JIKA 1G98A 3QF4A 3UOGA 5C1PA 1QSGA 4XH9B 1DKNA 4D9CA 3WL6A 3A1WA 4K1LA 3MYRA 3B8EA 3AR3A 3IBTA 3B1ZA 1N1MA 2BJWA 4O2BA 4Q4LA 1DAKA 4DMGA 3GIWA 4M46A 4YVFA 1NJ6A 1EUYA 3RK1A 5IAEA 3SYLA 1X7GA 3KB8A 4XEUA 3DTNA 3WKDA 4RE5A 1Q6YA 1DOAA 2DBQA 3V1YA 3L9WA 2QORA 4H7FA 2QRKA 4JQSA 3H1BA 1Z75A 2OCBA 4LMBA 5ADHA 2PAFA 2NQTA 1OJ7A 2PZEA 3PEVA 5FD8A 1GPAA 4LYEA 1U1DA 1QO0D 4KR2A 3EDRA 2RJOA 2OAEA 2PMWB 3IBSA 1VKZA 1JALA 3IQZA 3AFGA 1QH9A 1RQLA 1G2QA 2X7HA 3BWEA 4BRSA 1Z73A 3EQZA 1L5YA 3P7MA 1JDUA 4UU8A 4RAOA 4CIVA 4O6VA 3QPWA 1P5RA 4IGEA 1U7XA 1YRBA 1GLNA 1PGNA 3I9FA 4J4TA 3VR1A 3ZHTA 4LXQA 4P4SB 2QM0A 1LLDA 2XZPA 4DJDC 5KOHA 3K5HA 4Q3EA 3G9UA 1A5BB 2PKCA 4LRWA 1QNFA 1UBOS 2A84A 1TGYA 4JLDA 2XUPA 3WDMA 3S2IA 3V34A 4QQFA 2HUNA 4G81A 3UAYA 2P5SA 3ZR4B 4C4XA 5CVUA 3E9EA 3EEYA 2O2ZA 1P19A 3NONA 2XRMA 2BFOA 2CY0A 4GUDA 5D5PA 4DV3B 1GKUB 5JXWA 2XA1A 4EHHA 1BHQ1 1N5MA 1OPXA 3GEPA 4GDMA 2IHTA 2E1RA 4HP8A 4MVJF 4IVPA 1FLAA 3D7KA 3EXHA 3MPUA 3B3JA 2VNJA 4KBFA 4TN5A 4KN8A 5T6BA 1MJFA 5CLFA 2GN4A 2WNIA 3C2QA 4MA4A 1Z15A 1DI0A 3LD9A 1ISRA 1D2RA 1CFJA 4TV9A 4B48A 4QDZA 2EZ4A 4B6SA 4HYYA 5ED4A 2ZDGA 4D57A 4JLAA 1Z8FA 4GBED 4RZIA 5GY7A 1PEYA 2QF7A 3OAAD 5DRTA 5IK2A 5LL6P 1V11A 2IEDA 2BKVA 4X85A 4E1BA 3IBCA 4BQRA 3TZLA 2QD2A 1M34B 4JXKA 4DYVA 3NG1A 4KWHA 3K0KA 5BSUA 3KQNA 3AWDA 4FR2A 1LKZA 5F64A 4ZEMA 1GTSA 3G88A 5F7JA 1JLRA 5SV2A 1MABA 2HHJA 2VHEA 2CE2X 4ZU6X 4BDSA 3INYA 3P9KA 2CE7A 1E2UA 4MYDA 1KJZA 3AYXB 4XCQA 4JI1B 2I6FA 2A4MA 2OV1A 3UUFA 4PO9A 1NSTA 1FQOA 5FI0B 5HHTA 3EGOA 5AESA 2C9MA 4RMNA 4EHKA 4QVIA 2M32A 1VB5A 4ZMSA 1W36D 5CFMA 4Y7CA 1J56A 1CUCA 1EFPB 2J08A 3EIFA 3DAHA 1LCIA 3GAFA 3OM8A 4FCVA 5AD1A 5F3WB 5K0EA 4PX2A 4RD1A 2AT1A 4LI3X 4WY8A 4N5IX 1SIWA 5CLIA 4QXOA 1KQ3A 1NP7A 4FNMA 3W5HA 1FJGB 3SR0A 4G0QA 1OAOA 2HK8A 1DKLA 1EFVB 1GOTA 1RRMA 3QKRA 4IDAA 5I4IA 4M60A 1QE5A 5C5DA 1F8FA 2J07A 3MUFA 4IIJA 4NCBA 2VF4X 5ER9A 3FVVA 3HKCA 2IYUA 4QX6A 5B1DA 1HNXB 2BAGA 2WSLA 3CMMA 3MILA 1PUXA 3ANXA 4L76A 3T9AA 3STHA 4MO9A 5ALHA 3P0IA 4MRAA 5H4HA 1PFKA 2RHWA 3LPCA 1DBIA 3ZCRA 4R9VA 4KREA 3LKDA 1NF2A 3AR8A 5F76A 1YK1A 4ZREA 3THYA 3QSGA 1V2GA 1JDBC 3LZDA 4UVDA 3DEAA 3V3KA 3T1HB 3CLTC 1F2DA 1XMOB 4URFA 3ONEA 1MOPA 1XXHA 1SOUA 1YASA 1HL7A 1HDCA 2C0CA 4QSHA 3BB4A 2C29D 1CLUA 4IWYA 3ER6A 1IHOA 4P3OA 4V0OA 4EJSB 5CDTA 1B1CA 1T5SA 3O2JA 4Y6GB 2VZ9A 4Q0MA 5C0OE 3FVQA 3VH1A 1DXOA 2GN8A 3LVQE 3FBWA 4CM3A 3JAWA 5MFPA 1IY1A 1LNQA 2H5EA 3NFYA 1AF7A 2X3YA 3HJTA 3ASVA 3MTDA 5FNZA 3V1UA 4L57A 3WWCA 2I99A 4IIUA 1E3WB 1O54A 2B36A 1QGUB 2XGSA 1SN7A 2J3KA 4DR2B 1E62A 2VYND 1H6BA 2R87A 2FQ1A 3RF6A 2RE8A 1B00A 4NEQA 3C14C 4RTOA 1RYDA 3M7IA 1XUOA 4J16A 1T3HA 3PL5A 5KS2A 2CLKB 1QHFA 2FZWA 3GA5A 4M1OA 5LWHA 1RQRA 5K0GA 3ROGA 1W4BA 3UW1A 1UBMS 4WKNA 3H9BA 4QJ5A 1U0LA 2GK7A 3FLBA 1TYBE 4RGVA 1QBKC 1AS2A 4DWVA 3RLIA 5C7IO 5AVVA 3KFVA 4IKPA 1SQ6A 3TR5A 4QZVA 2IXBA 3HMQA 5JOQA 2RH5A 3T7EA 1IVYA 4V3CA 2GAJA 4RQUA 1QQ7A 4MRRA 1E7MA 5B1IA 3QLVA 1R5OA 5ALNA 1H5QA 1R8QA 1QVAA 1PG0A 2RFLA 3HACA 1Y82A 2Y0PA 3W2GA 4UM7A 3THXA 4CNQA 3IEUA 1ZIPA 3UJDA 5C1DA 5LLDA 3D8NA 5C34B 4L4YA 5IF9A 3ETCA 4KGXA 4CM8A 2HWKA 8OHMA 2XBUA 2BCGY 2JIMA 3TTYA 3WJ2A 4AL4A 4BBZA 4COOA 2YYZA 2B25A 3QXJA 4O4LF 5JH7A 3EWAA 2YXDA 3L43A 5AVUA 3L4BC 4TVKA 1Z6GA 5TXGA 3CRW1 4BYGA 2JNWA 4OHKA 2RHGB 2NUBA 3GAAA 1P0IA 1KSFX 3JASB 2HBZA 1EB9A 2H2GA 2ZT6A 1PFGA 3LGSA 3QWFA 4WA8A 1MIOB 1XD2A 1GPMA 1P62B 4CCSA 1NVTA 1BCSB 2HBRA 3L07A 3NHJA 4JR0A 3EPKA 1GTVA 3ANNA 4K26A 4KAJA 4UJ5A 4TZ0A 1UJMA 3DC2A 3OCVA 3OKCA 3S8EA 2PZGA 4G0XA 5JCOC 3S2GA 1X7YB 3H4IA 1TJPB 5EY5B 3V7UA 3RTCA 4IG9A 3Q6IA 1ZHOA 4YAOA 4Z8YA 1YZ3A 3EXHC 3DQQA 2VQ3A 1KORA 3GQBA 4KXYA 4ZOLA 4QD3A 3T61A 1EXNA 3UKOA 4ETIA 1HYBA 3KD3A 1C14A 3QX9A 5AXAA 3OTQA 5IFLA 1ZOLA 2GJSA 2E9SA 2ZBUA 3EHDA 1GGHA 5F7ZA 1E66A 4ZT7A 3TSWA 2JJMA 5KSOA 4RPHA 5DCWA 1HDOA 5B30A 1T8TA 1NOKA 2JLCA 3E9YA 3ODPA 1EFCA 2IYLD 3Q0IA 4WZBA 5LQAA 3DKPA 3MGAA 3OLWA 4RD3A 5AHWA 3T12A 3CSUA 4RGYA 5DCLA 3C3AA 1UPUA 1Z0JA 4L1KA 4C01A 1NBIA 3LY7A 4YREA 2ZJ4A 3WC4A 2IK8A 1IJBA 1JDNA 1NX9A 3ORYA 3D6AA 2YQ4A 4UMEA 4D9KA 2GBFA 5JNWA 5FFNA 2Q49A 2ZR8A 5AM5A 2ORWA 2PX5A 4FYYA 5EQTA 3TBFA 1SELA 2GAFA 2V65A 1XTQA 2WAYA 2WHRA 5K8UA 7MHTA 2GCOA 4CM7A 1JIIA 3GT3A 5IBRA 1YV9A 1ETHA 4PYQA 1FDRA 3TF5A 3ONNA 4PZLA 2HQ1A 3RTGA 5F98A 3OO0A 3WQRA 3DT8A 3ER8A 5TGTA 5E6SB 1Z18A 4N3GA 3H4VA 2ROQA 4AJLA 2VYFA 1NKSA 1VP9A 2IHBA 2EX4A 4QU9A 5FFFA 4WD3A 1D3AA 1UT6A 2Y6VA 3D0QA 4AC9A 1YBVA 1P1RA 2ATXA 1JP7A 2ID9A 2JGLA 3QKIA 2OBXA 4JWKA 4PAMA 4A0RA 3UWSA 1KOFA 3FFAA 3GRUA 4XPZA 4NTZA 5IAKA 3G1UA 2FMFA 2ON6A 2PGAA 1VE5A 1ZN7A 2A7XA 3H4MA 4I81A 5EJAA 4UHKA 3E8SA 4Q3BA 2P7HA 4LXTA 1UZAA 5T4HA 1UP7A 2O3UA 4ZAVA 3SP1A 4CLDA 3ZWPA 4MMXB 4A27A 1UWCA 1UCFA 3OZTA 4JI8B 2HU5A 2VJOA 3DKVA 4Q16A 4CTOA 3GA7A 5ALDA 1D1TA 1N9KA 4MR7A 1VSVA 5ALMA 3SJ7A 4U2BA 3F78A 3NWPA 2KLHA 4IMIB 4MULA 5HCNA 1L7PA 1LPBB 1G3UA 1UBGA 1PT7A 1Z82A 3LUHA 1JQDA 2CF6A 2CFOA 3H0KA 1C3OB 3MBOA 4IP0A 1RZUA 5FBLB 2W48A 3DBRA 4LCEA 2HPZA 2IQIA 4KAXA 4DM7A 5JROA 1NUHA 2REOA 3RT7A 4ZYLA 2IPAB 2QE7A 1YI0A 2XUJA 2NU6B 4B47A 1MC1A 5C53B 5FWDA 1Z8NA 1CC1S 3JSXA 3DWFA 2D4HA 3IGFA 2F3QA 4CRWB 1ZM3A 3DYVA 3QU4A 1WZCA 3OPVA 4MYRA 3NBZC 2XW6A 4RK7A 4D44A 1AS0A 4TYPA 4BFCA 4FEEA 1Y80A 3EUEA 4WH0A 3M1YA 1E7QA 1YAHA 4RFLA 3ZQUA 1B73A 2PMDA 2YV3A 2ZB3A 4FSXA 3RVBA 4UXIA 5FAXA 3B9BA 4ZI7B 3WLMA 3DV0B 3HY4A 3JYQA 3KTDA 4JP5A 4I6EA 1GTJ1 1O08A 4XGRA 4DY4A 3F9RA 3L18A 4U7TB 1GKYA 1U11A 5DK4A 2W2NA 2ZWMA 2WVHA 1LXCA 2CLCX 1K88A 1AA9A 2A1TS 4MKXA 1F3LA 5J40A 3C1AA 2CV1A 4PQYA 1TX4B 1Y6QA 2ODBA 4D45A 2HLHA 4DHEA 4BECA 3OH8A 4UVHA 5D8DA 1XNRB 2D0PB 1QLJA 5DB4A 3UWOA 4AFNA 3CLKA 2GJKA 1D4ZA 1NA5A 1QRRA 3ZHBA 2F9FA 2I66A 3IUJA 4C04A 1UAAA 2YS6A 2JFBA 2UXCB 2P5UA 3JYHA 3Q7IA 3CZQA 2QTVA 1P9WA 1PJTA 4RTSA 4F4IA 1QYRA 1TZCA 2NSYA 4UREA 3WTBA 4TVSA 1E6EA 4ND7A 5KTYA 3JU3A 3HCPA 1MVNA 3M6VA 4MR8B 3ZOZA 4NULA 2WP0A 3FFWA 1MHTA 4MHTA 3HNOA 2A5DA 4QUKA 3QVXA 2C4HA 4I1UA 2D2XA 5B12A 3TD6A 1I1OA 4XGKA 1YC5A 4YMTA 1T2DA 1K7EB 3OZGA 3FPSA 4BAUA 4Y2HA 2DUMA 2LBPA 1IN7A 4PAQA 2Q41A 3G6WA 4YFVA 3DXZA 1H05A 5E3JA 1EQ2A 5CDFE 4Y9TA 3H5LA 1JDBB 3LXUX 4M7OA 1ADJA 4E31A 4D0GA 2RHMA 2D1QA 2R47A 5DTIA 5HKKA 1VJCA 2IIQA 3JAKB 3ILYA 3SDBA 1IHPA 2QJRA 3TCNA 2GM3A 1CR6A 4H9GA 4IX1A 2HMAA 2GEVA 5TMBA 7YASA 3FYUB 1DHTA 1AQJA 4RMIA 2J3HA 3UXHA 4GUAA 2WM3A 2R66A 4TRJA 1NU8A 1Z7EA 2O8CA 3LNTA 2ZYIA 1OQAA 1MENA 1P2BA 4F2WA 1JECA 3E82A 4EUFA 4W1PA 3SNHA 4EUHA 5KQPA 3KETA 3QWAA 4ND8A 1X38A 2G8NA 4YDRA 1ZDMA 2RHCA 2WF5A 1YRLA 3MS2A 4PXAA 1A9QA 1T5DX 5ICEA 4DLTA 3GI1A 1XAHA 2CLHB 1CZOA 1VLHA 3PP8A 3ZCXA 4BU0A 1MB3A 1NR5A 2OXTA 1S2DA 2E4VA 3GEHA 4TSKA 5EYPB 1KEWA 3KB1A 5KIAA 3E5NA 3JQ6A 4NBWA 1W5BA 1JKFA 2V7WA 2PCJA 1YQ9A 4YIKA 1PIWA 4U6QA 4Y18A 1DDOA 2H31A 5ENZA 4K05A 4KQGA 1E2QA 2VDPB 3GBSA 5KC9A 1G8GA 4NYMQ 4DLPA 1F8UA 1GQ2A 2FF7A 2WFLA 1GZ7A 3ZCSA 1ZD9A 2CBZA 3FCAA 4FHDA 4BRUA 1UXKA 4KJZA 4DA0A 3A9VA 5JBIA 4GX1A 1KARA 1BA3A 3ELWA 1UC8A 3F6RA 3KSUA 4OK3A 3E48A 4HV4A 1XRNA 2WINI 2BI4A 3G13A 2I62A 3T41A 2II6A 5EJ7A 1Y3HA 3D31A 4F96A 2PX8A 5LYJA 2VHZA 3GEDA 1VL0A 4RA6A 5JAOA 2XRFA 1XZGA 2V58A 1IFXA 2FSPA 1OXSC 1USVA 2XMGA 1ACMA 2ODPA 3H5IA 5KNBH 2NYUA 2IYWA 2BGLA 2VAVA 1FLDA 3EVNA 1V5EA 3DZFA 2YMPA 2EBWA 4R3UC 1GGFA 2XUIA 4QIHA 1EVJA 5JAIA 3MMXA 2R6R1 4BMDA 5DI3A 4YV1A 1KAEA 1QAOA 4DBLC 3IAS6 4WKPA 3DE4X 3DPUA 3PHBE 2DPHA 2F2TA 3UAOA 3VAZA 2C96A 1O2DA 4Z2AA 2XNDD 5LC1A 4ZVKA 4CR7A 4ENQA 1ZCAA 2Y0EA 4LRYA 1KDTA 1ORHA 4XI9A 2QGFA 4NPCA 5ITZA 5KQSA 3X2EA 2D3WA 4DQKA 3AEKB 1V8DA 4LS3A 2WWGA 3CEMA 4Q5IA 3QE2A 4RIFA 5E7QA 2V3WA 3OCUA 5JDCA 3ELBA 4DJ5X 1HT1E 2RHTA 1AQUA 1RMTA 2WYVA 1M2WA 3EXG2 5FOUA 3RUCA 3TLZA 2ETVA 3QK7A 5K5EA 1CJUC 3QXHA 3I0NA 1M6VA 1TI7A 3E9CA 3SCZA 5AW7A 4TZKA 1TMOA 2X8AA 2WWXA 5BQXA 2OCAA 4J3NA 4CNBA 2I8AA 4DJFC 1RYYA 1YTUA 2BTEA 3IVCA 2HI0A 3ZWKA 1GV0A 3C3KA 1DJQA 3GPCA 1KIFA 4OIFA 3DO6A 2JANA 1QHNA 3I2KA 4FMBB 3I53A 1TFUA 5KREA 1O0BA 2DSNA 1KEZA 2AI3A 3E7WA 2DUUA 2PBRA 3GRFA 2RD2A 1ZJYA 4TXMA 4V0ME 1QGAA 3GUHA 4G24A 4LXIA 1GAWA 5DRYA 4E03A 5BWOA 2B1QA 2DQZA 4XGNA 3LPAA 5EMLA 3EOBI 2VSOA 1A9XB 2V55B 3FOAA 2WWFA 2QL5A 1RI3A 4X1IB 2HJGA 1SBZA 1OXTA 5ILGA 1NWHA 4X44A 1DIRA 4ARZB 4N65A 5J4LA 4Z4EA 2D62A 4BP9A 3BRWA 1Z62A 2EIXA 2YC2C 3IP8A 3QU2A 4QUAA 3NT2A 3WV5A 3H5WA 1RAHA 1E1QA 5CT5A 5FHQA 1N7GA 5DBEX 2V6MA 1PBTA 4O2BB 3ESAA 4N8SA 1M8FA 5AUNB 2ONZA 2PQ0A 4NBSA 4P9NA 3IT3A 4KMMA 2VJLA 5NLLA 2AOUB 4HI0E 3TLCA 1IZ7A 4DPKA 4E6EA 1QO0A 1YT5A 2Z1DA 3ETJA 4LHVA 4B4WA 2ZUBA 3K9NA 2PSHA 3WLFA 4X64B 2CLDX 2J32A 4P58A 1KO4A 2SCUA 3KSDO 2C8KA 5H7XA 3M49A 3KQKA 4XWKA 2YOHA 3VPFA 1E1CA 4LOAA 4ILKA 4RO0A 4FI3F 1K2VN 1UMKA 2COUA 2QUHA 3OIVA 5FI3A 4DCTA 4CLOA 1JEJA 1CUFA 1UODA 3CLTD 2FJ0A 3DDCA 3HBNA 1V71A 1EDBA 1OF1A 2EWMA 4GOLD 3A32A 4BB0A 2ODQA 5C7YA 5TY0A 4F4JA 2PHZA 2X0EA 4QOIA 4RHUA 1PFYA 4ND4A 1OBVA 5AVQA 2AQ8A 1U90A 3MJFA 4DA7A 3ECSA 2JIPA 1UBEA 3AVOA 3OSZA 1SUSA 1K27A 5IKPA 1QP0A 1E7WA 3LX8A 4R6XA 1E9SA 2AD1A 1U80A 3V4FA 4ND1A 3DB1A 2OCGA 2WQZA 4JBGA 1A8SA 3RRMA 4KZPA 4B81A 1H8ED 3S68A 1QHSA 4F71A 3D6FA 2VUUA 2PSJA 4HRVA 3OLVA 1S4MA 3L4BA 4HUQB 1QYVA 1SKYE 3UMRA 4B6EA 5LMZA 2G71A 4E70A 2FPOA 3F71A 4BN0A 4HQFA 3LRTA 5FBRB 4A36A 1FW8A 3O47A 4H59A 4EJ6A 1A9ZA 5LIRA 5DJ5A 2ZSFA 1E4OA 4OA5A 1IAQA 5K3FA 1B4DA 1ZXBA 1ODFA 3CX3A 1R15A 5FP0A 2DLCX 4O4HB 3DE5X 5L45A 2GQ0A 4ESOA 3F74A 4C7OB 3O38A 2BELA 2IT1A 4R1SA 4DRXB 4HNGA 1N3BA 1X3LA 4JWTA 1N9GB 1NHWA 2ZRMA 4W8GA 2AN4A 2XQJA 3RVOA 4P5PA 5EJ2A 3GL9A 1XROA 4ZVMA 1FSSA 1MO2A 3V2IA 2HADA 2XNJA 4II7A 5L53A 1WBDA 5DBIA 4YGXB 1AQNA 3N7UA 3S29A 3OE5A 5T4FA 1F4LA 1XK6A 2GCPA 2EHDA 3S2SA 2MMCA 2NV0A 3S8YA 5F1YA 3BHNA 2Z3ZA 1W5TA 3ZDEA 1O0CA 1CZHA 1TYEB 1N4DA 4E46A 4Q4AA 2O2HA 4D4KA 5JH7F 1KQNA 1U2QA 4D6PA 2O1EA 4P93A 4ZCQA 3OFSA 2WAOA 3PE6A 2OFWA 4RM2A 4BNNA 4I6JA 4RACA 3FHCB 4TL8A 1IUOA 1QPBA 2XI4A 4BZXA 5EIXA 3VDXA 2HV8A 3FGPA