3WYGA

Crystal structure of xpo1p-pki-gsp1p-gtp complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
b'VPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gsp1p
publication title Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae awri796
molecule tags Gtp-binding protein/gtp-binding protein inhibitor
total genus 51
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wygA00
2F1HA 5KPDA 4HEJA 4NMMA 2QEQA 1E2MA 4D0GA 4XWAA 3P1JA 3PITA 2CLSA 3EZ2A 2FFBA 1WMSA 2J46A 4NCKA 3M4YA 1J8MF 4P4UA 4V0OA 1PJRA 5DI3B 1Z0DA 2QQ0A 2QPTA 2CE2X 4N0DA 4KLZA 2ZSAA 4TL8A 1DAIA 1VKJA 3HU1A 4A1FA 4YMTA 1SQ5A 4AD8A 1G8FA 1A2KC 1KI9A 4HLUC 4DT1A 4Q1DA 4A0FA 3K09C 4W9MC 1T3LA 3AKYA 1SVSA 3KUCA 3B7GA 4IRUB 4FWTA 4DCTA 4QBGB 1XPRA 5KPJA 2D3WA 2GWHA 2MSDB 2IS6A 4Q9IA 4B32A 1HUQA 4PAQA 5ELXA 4GOKA 1C4OA 4GBMA 4HAZA 4ITRC 5KU1A 1UDWA 1XTKA 2GJ9A 4HZUB 3B60A 3BFVA 2V3CC 1JXOA 1XFAA 1LFDB 4MKGA 2QAJA 4MH0R 4OHVA 4PC3A 3H0KA 1KY2A 1P6XA 1KMHB 1XJCA 1R2QA 2P67A 4PHGA 3SR0A 3GLIE 4DUGD 1FX0A 3UWOA 3TIFA 4IDHA 2D4HA 3IUYA 5JWRA 3BRWD 3L2OB 1NL3A 1OYYA 3HDTA 3JVVA 1N6PA 4TLDA 2CVHA 3SN6A 3BS4A 4C4PA 1NRJB 2OCYC 5FTMA 4BZQA 2ZPTX 5FBLB 2REBA 1GKUB 2GZAA 4GPTA 4E03A 4OHYA 1II8B 2BM1A 2ZYWX 2ZI9A 3OIYA 1ZRHA 3BH6A 4TL9A 2YWGA 5K8LA 3TAUA 3TR5A 1FNNA 1GTVA 1K5GA 1SVIA 1RC8A 1KO5A 1QG2A 1UBEA 3EC1A 2J87A 2ODBA 2GRJA 4BLPA 3PUZA 1U9IC 4TYNA 2VQSA 4Q1CA 3HYTA 1JR6A 2GVZC 3H4MA 1DG3A 1HT2E 1N5IA 1TQDA 4Q19A 4YQFA 3C7KA 2PZGA 2RGXA 3MWLA 1JEEA 1KI7A 1BS1A 2J7KA 4H9GA 1GL9B 3FE2A 3LX5A 4G0NA 2YJTD 4AI6A 4TT3D 3AP3A 3W5JA 5CDFE 4HZIA 5JWOA 3LFUA 2E87A 2MMCA 5A0FA 1NF3A 2FSHA 2NIPA 1BYUA 2XOKA 4LK2A 3HPQA 3WRXC 1P73A 1G4UR 2XB2A 3I4LA 4AWXA 2RGDA 5JI2E 2ASEA 4KFRA 5AUOB 3CIOA 1GM5A 2BCJQ 3ZDQA 1L4UA 2F1IA 3QOFA 2Z5FA 2ZRCA 3F5FA 1V5WA 1W0JA 1Z6AA 4HLQB 2F1JA 3W90A 1S4QA 1T8UA 2ZRDA 4DBLC 5A4JA 2PCLA 4XVQA 3MFYA 5H1YA 2EYQA 3VR2A 2F43A 1SXJD 3I61A 3A1SA 4WVFA 2O8FA 3W3AA 5B30A 1IN8A 4EQ6A 3RS5A 5GVRA 1FUUA 2OILA 4LYHA 3QKSB 2GJSA 1E9EA 3OE7A 4NE2A 5KSOA 4HAUA 3QKTA 4EJSB 3SJAA 3SJCA 3AH8A 4XH9B 1E4VA 4M1OA 3ZIAA 4MGIR 3AVYA 2A2ZA 2OE2A 4EPVA 2IYYA 1RIFA 2GVDC 4HAYA 3RSLA 4PSVA 3WNBA 1BMFA 2XSZA 1ZM4A 3W6PA 3THYA 2DCUA 2WJGA 3A1UA 3I73A 5GJCA 4QM6A 4EPYA 1YRBA 4RVCA 5CIQA 5L3SA 1KDPA 3RC8A 1J90A 1RJ9B 2F6RA 1FQJA 3L0PA 2QP3A 1RE0A 5FL3A 1G64A 3CNOA 4TLCA 1YR9A 5HCIA 2OAQ1 3TUZC 4QGHA 3PEUA 3QXXA 2IYQA 4TWZA 4LHVA 2JLWA 4M1TA 3RRYA 3AF2A 1D2NA 4IKEA 5FL7D 2NZ8A 2WIAA 2ZE6A 3D6TB 2VYFA 4C0QC 2VTKA 4BRWA 2BKEA 2I1QA 2Q6TA 1BOFA 3M6AA 4JBXA 4C0KA 4LGMA 1KZ7B 3P26A 3Q72A 4B71A 1I4LD 1R0YA 3NC0C 5HZKA 2WSMA 4Q18A 4A6XA 2DHRA 5F3WB 3AGQA 2W6ID 3K9LA 2IF2A 3KFXA 4ARZA 3ZVNA 2PT5A 4L4UA 2R6DA 4DLYA 4DWJA 2CLDX 3TSZA 1Z0KA 2V8OA 4M1MA 4M53A 5EXXA 3EG5A 4V0NA 3W8NA 2V54A 3FYHA 4FN5A 1Z29A 2O8CA 1ZUNB 2C9CA 3U3MA 2WOJA 1Z6TA 3N5CA 1ZIOA 4HAVA 4B3XA 4DLTA 4JLDA 1W46A 2ZSFA 5EUQB 1XEFA 4P31A 1YZGA 1YKSA 2WV9A 4HYYA 2LKDA 4C7OB 1TUIA 5FBWB 2IW3A 2ZVPX 1PLJA 2FSFA 4NDZA 2N42A 5JS7A 2YINC 4BQSA 1D9ZA 1J70A 1X8JA 4M9ZA 3LQRA 4BWYA 2G6BA 4S2EA 4UNPA 2QBYA 2H8KA 4AIIA 2Z83A 4G1UC 2OLKA 4JLNA 4BEBA 4URXR 2HV8A 3IIMA 2KWIA 4QHSA 1CR2A 3LBIA 5CM8B 2FH5B 5KUTA 1LF0A 1DAHA 1XB2A 3CZQA 4DXAA 1NVXQ 1CR1A 5C4MA 1ZBDA 4Q48A 4AK9A 1W47A 1L2TA 1X1RA 1PVOA 5L3QA 1KI3A 3BOSA 5KDLA 3UMSA 5GJBA 4DT1B 5B58C 1RFLA 3FHTA 5KSYA 721PA 1KI6A 2EFDB 2VHJA 3H1TA 4O25A 4B3CA 3T1VA 4TTPA 3SHFA 2Z43A 3VMFA 2P3SA 2WM9B 2FFAA 2XNSA 4BUJA 1I4DD 3GFOA 4FW9A 5DGXA 2DWPA 1QF9A 4LBVA 1IONA 1F2TA 1TEXA 2NO0A 2GBLC 3QPUA 3QVVA 1QHGA 2DPXA 5IT5A 2F55A 4EFLA 2N46A 3B13B 1DAGA 3OAAD 4C2UA 3Q7QA 3W6NA 1HH4A 1P2UA 4UXHA 2IC5A 2ZS7A 2NPFA 1Q3HA 4KV9A 1ZD8A 4UQOA 1U8YA 1HY3A 2B92A 2ZJ2A 1A1VA 4OI0A 1FX0B 1TQ4A 3A8TA 3C5CA 4D4MA 5K8UA 3AQ4A 3FHOA 4FINA 5DHFA 1XRJA 3MWKA 1GRQA 4JZKA 4RZXA 3Q3JB 2QI9C 3G82C 3LBHA 4I1UA 2PT7A 2C9OA 1GITA 3QXSA 4URVR 3GLIB 1CXZA 4WBSA 1NBMD 4LHWA 1NVWQ 1ZNXA 4DCNA 2AFHE 4JSTA 4NCNA 1YZNA 3SE0A 4AURA 1T5IA 1GG2A 4KODA 4Q9JA 1KK0A 1GRNA 2J0QA 2BEKA 5FUXA 4MDFA 2VF8A 2ZUCA 1P9WA 4Q4JA 4DZZA 1GDDA 4DHEA 3LRPA 1LVGA 1QBKC 1P60A 2H1LA 3CF2A 3G5UA 3A1WA 5EE0A 3RS0A 2O8EA 1F3OA 4PZYA 2D62A 2VPPA 4US2R 1ZW6A 2Q21A 2Y8EA 4TLAA 1J2JA 2YC4C 4PFSA 5JI3E 1OH6A 1VECA 3I62A 3LLUA 3VNUA 1COWD 2WWGA 4IVQA 3WHLA 3AVQA 3X1YA 3NBFA 1GL6A 4CZ2A 1L4YA 2LCFA 4AYWA 1OHHA 1E2PA 2IEZA 5J40A 4OYHA 5DYGA 1NNEA 4CEHA 3Q9LA 4DSNA 3A1VA 2BJWA 3BXZA 2BIFA 3RYTC 4ZCIA 2EVWX 2WWHA 3FMIA 4B48A 4JVLA 4LV8B 4X8HA 5JLJA 2EFCB 2CJWA 2IA5A 4RCYA 2QAGC 2OO7A 4PHHA 4UNNA 4XSHA 5FUVA 3CONA 3LO5A 3W6OA 1AKYA 2W0SA 1UEJA 1J99A 2J9RA 3FMFA 4JT4A 3T34A 1HT1E 4RSGA 4XIGS 2WZQA 3E1SA 3ZS8A 4AYTA 4MRPA 1HV8A 2F43B 5TV2A 1JR3E 5HPYB 1NLFA 3BIFA 5HKKD 4EQ6B 5K8TA 2AXPA 1N25A 5EE5B 2FE4A 4KHZA 1R5OA 2A5DA 2OHFA 5M04A 3AVUA 3GJ6A 1N5JA 1NKTA 1JR3A 1SKQA 1KOFA 2REXB 2HEIA 1P5ZB 1EFRA 2ZR7A 3K9HA 1M7BA 2HF9A 1H8ED 2VP4A 2CNWA 1ZAKA 1U2RA 2W2XA 1HA3A 2UVQA 3SYNA 3C15C 3ZQJA 2WJJA 2ZSEA 3MJRA 5H8WA 3MWJA 3G0HA 2CCJA 3VX4A 1F5NA 4RZUA 1LNZA 1OW3B 2AN9A 1KZGB 2RHMA 4BE7B 3THYB 2ZM5A 2ZEJA 5AWFC 4I1SA 1JJVA 1W36D 2J41A 2ZRLA 3FMPB 5L3SB 2H18A 2Q3HA 1Q3TA 1UEIA 4Q4HA 2BEJA 3IPXA 1AIPA 2JJ1A 3REFA 1RRFA 3SYKA 3OEHD 1XJQA 1RRGA 2QTFA 1NY6A 1YZKA 5P21A 4OI1A 4DDVA 1S8FA 4DDUA 2P5SA 2XAUA 4DLVA 1KK3A 5E4FA 5FPHA 1JECA 1KMQA 5GVSA 3PR1A 3U6KA 1G7SA 3QI2A 2FN4A 4LY6A 4ZIRA 3KJGA 4LYAA 4OQNA 2VF7A 1DBSA 1FFHA 1IXSB 2ANCA 2AXNA 2IYTA 4B33A 4EPTA 4P33A 1W2GA 3B1WA 3U6BA 1LTQA 1HYQA 5JS8A 1EG7A 1UBFA 1ZM3A 2X2EA 2GXSA 2R44A 4U02A 4GZLA 1PZNA 3QPVA 2BBSA 1UF9A 2RGCA 2FA9A 3Q85A 3CNNA 2F7SA 1KI2A 2QM7A 4M4SA 5AK0A 4ZV4A 1E0KA 4L9WA 3OEEA 1IY0A 3EZFA 1Z3IX 1U98A 3I92A 4DLRA 3CX7A 1JQLB 4OK6A 4TMXA 1VG8A 5C1BA 2O8CB 1UBGA 4NH0A 4QFMA 1MO4A 4HUTA 4DSTA 3AB3A 1NN0A 2O0HA 1E9SA 4G5QA 1E3MA 4O0MA 5GADl 2QN6A 3CX8A 4N3NA 4A6PA 3BB4A 1S1CA 4QGAA 1HURA 3QF7A 3ADBA 4AYXA 2OFWA 4DSOA 3CO5A 4B44A 1M7HA 5LD2B 2PJZA 2IHBA 1XCPA 1ZCBA 2GCOB 3WRYC 3L43A 4OQMA 1UM8A 2NGRA 3M1IA 4DDWA 3U44A 3THXA 1G8YA 2X1VA 3QEJA 1KJZA 2CE7A 1UAAA 3HJNA 1XTJA 1S0UA 2FFQA 3HPRA 3R20A 1GNQA 4RD0A 1Q1BA 2BWJA 4OQFA 4US1R 5FBVB 3GPLA 2WKPA 3KKPA 3MLEA 4KSCA 1T5LA 4B76A 2ZU0C 5L3QB 1KO7A 1OB2A 4DIEA 2GK6A 2CL6X 2J7PD 4HB2A 5F98A 4E5UA 1KI6B 3NBZC 5EZ6B 4G01B 3UKDA 4D4KA 4M8NE 4XWOA 3TH5A 2JLZA 2C04A 5J4LA 4CEIA 1MH1A 2FPKA 3ONWA 3EZ7A 2XZPA 2G77B 3VR1A 5EXTA 4HLCA 2LKCA 4OQLA 3BK7A 1Z63A 5CJPA 621PA 5EE3A 1FOEB 1F2TB 3SOPA 2V9PA 4FI3C 5KOYA 2V1UA 2YOHA 1YZUA 5FUWA 4MYHA 3LV8A 3NH9A 3CPEA 4D81A 2B7BA 2FG5A 3KXKA 3ICQB 5HE8A 2YV5A 2HXSA 4Q7KA 5FI1B 1UFQA 3QXCA 3RS2A 5JJLA 2FV8A 1XX6A 2JLXA 2ONKA 4IDQA 1VCNA 4M9SA 4HDQB 1YZQA 4YMSA 2W00A 3PUYA 1RRCA 4C3ZA 2W6JA 5G3ZA 3T5GA 3TR0A 2ZE7A 2OUKA 4O2LA 4N1AA 2B8WA 3CW2A 1XCMA 1IXRC 4Q66C 4KSBA 1N5LA 1F2UA 1R4AA 2QAGB 5L3VA 821PA 5E7IA 1Z07A 3BJIC 3TW4A 4I1OA 4Q4JB 2GTPA 2FEMA 2ZRJA 2FNAA 4PSKA 4A92A 1RZ3A 1TQ6A 4IEEA 2VHTA 3GEHA 4D26A 4GP7A 4TMKA 3OESA 2O8EB 3TMKA 3QEOA 2YWHA 3E2IA 1EFCA 1X3SA 5TARA 5IK2D 3KTAA 3ICEA 4OI2A 2PL3A 2MSCB 3NXSA 1Z2CA 3C5HA 4DRZA 4HDCA 5FOXA 1E9BA 4LHXA 1LW7A 4M9QA 3DKVA 4PQYA 1OXXK 3ZVRA 4TSFA 4GRAA 2FSIA 3OFNA 3BWDD 1X8LA 1FNMA 1AK2A 3SFZA 3EX7C 1ANKA 1E2LA 4IFEA 3NG1A 4Q7LA 4CEHB 2VBCA 2ZUDA 1GILA 1UKEA 4HLUA 3GFTA 4GFDA 3K09A 4LI0A 4JIMA 4B6FA 2QMOA 2ZITA 3Q7PA 4LJ9A 2CJWB 1JJ7A 4XOIA 4HUQB 4LJ8A 2SHKA 3DHWC 5JMTA 1VCOA 3UPUA 4LZZA 4B2LA 4B6EA 1NIJA 2ANBA 4XD7A 4QKQA 4ESVA 2HCJB 4PO1A 3PCRB 1OIVA 1WCV1 2ODWA 2P6NA 1TAGA 1F60A 3FMOB 1YR7A 1CJKC 4E07A 1ESMA 3FB4A 4KYUA 4RD3A 1UPTA 2QM8A 4EPWA 3TLXA 2P2LA 2BKUA 3FTQA 5L3RA 1E2FA 1Z2AA 2QT1A 4Z1MD 1U99A 5EP1A 3B1VA 1SVWA 3P4YA 3SU8A 5IF9A 2O8BA 1EGAA 2PZFA 1E2IA 4KYIB 1NP6A 3CF6R 3ZZUA 4TL6A 2OEPA 1XMIA 4BFXA 1C1YA 1OV4A 4KO8A 4UXJA 3T1QA 3N70A 2FOLA 2XJ4A 4LJAA 1RVDA 3TVDA 5FTJA 4Z51A 4TZ6A 2RHDA 2Q9AA 3SJZA 3WYAA 5JBQA 3CUEF 1AS3A 2GAOA 4Q4HB 2AK3A 3AV0B 2D7DA 4PC2A 2VSFA 121PA 1KAGA 2VP9A 3EA5A 4QC2A 2R8RA 3ZGXA 2W2TA 2PCJA 1KSHA 3UWKA 5DH9A 3VR4A 1U9IA 5SZKB 1GIAA 1GSIA 1OH5A 1VHTA 5FTLA 4TQ9A 2YHSA 3U7EB 3ZZTA 4ZIRB 2HT1A 2GF9A 2WAXA 2IHYA 2ORWA 2D7CA 3LWNA 2GNOA 2J5XA 5JJKA 1PUJA 1ZD1A 2C77A 3KB2A 3L0IB 1SVMA 2DFKB 2RGAA 3LH5A 5LB4A 2ODEA 3X1XA 2P6UA 3GLIA 1EWRA 1S1MA 5EUMA 1CKEA 2GF0A 3MRSA 1E9CA 4YDHB 1KSFX 4B2IA 2C96A 4Q01A 1CP2A 1SKYE 1W5TA 3SBEA 1UBCA 2NOAA 3B78A 4MRVA 4PAOA 4Q1FA 3RANA 3FOZA 4DLUA 3CB4A 3TQFA 3EIEA 2QMHA 1Z6XA 3B9QA 1V43A 3PQCA 4JL8A 4A2WA 5KDOA 3TSWA 1DARA 3BORA 2EYUA 3CKLA 5JWHA 3U3KA 3X2SA 2HLDD 1Q1ZA 2R65A 1QVAA 3RABA 3AF1A 1VMAA 2VHCA 3GLHE 4R7ZA 1XD8A 3RSOA 2IF0A 3U4QB 3K70B 3TJZA 2DBYA 3U2QA 3SS8A 3KQNA 3V4RA 1E9DA 3C16C 4ON9A 1KI4A 3IKJA 3GLHA 4OJQA 1Z06A 1NKSA 3EZ9A 4DSUA 4QM7A 3U44B 4KITB 3THXB 2ZIAA 2Z4RA 1IHUA 3EIHA 1CBUA 4KFSA 2OZEA 1W48A 3V00A 1SXJE 3C41J 4YMWA 5F9FA 3I5YA 4BRUA 1NG9A 5H68A 4B2PA 5AJXA 2V6IA 4UKDA 2RGBA 1T0JB 1IN6A 1R10A 2O52A 2FGKA 3VHLB 1IQPA 1VYTA 3DOFA 4WIAA 1Q22A 1DAMA 2K5UA 3FKSA 5CDFA 3AVPA 4M2LA 1I2MA 2XNDA 2UZIR 2WKRA 3CPJB 4A0HA 4ZDWA 4HB4A 2JJ8A 2KI5A 3B6EA 1DEKA 1GZSA 2ZREA 1KSGA 2W0MA 1XXHE 1UDXA 4B35A 3DDCA 4NYIR 3TSOA 4CEIB 3BB3A 3THOA 3CWQA 1R7RA 4A2QA 1S3GA 1MO3A 1T91A 4NU0A 4K8OA 1XXHA 3QXJA 1MRSA 3IO5A 3FWYA 3IILA 5BYKA 2ZRMA 5GJVC 4A2PA 2JJ2D 2ZI6A 5KO2A 4MA4A 4W5WA 3A6PC 1CJTC 2FPLA 2IYZA 4IJMA 3RWOA 2ZRGA 3BGWA 1N6RA 2XOKD 1QDEA 1ZUHA 3FDIA 5SZJA 3AKCA 2D2EA 2XITA 4OKSA 1FMLA 2BDTA 2CEAA 3BH0A 4GMDA 4RCZA 3U3JA 1Z6GA 2OM2A 2ZJ5A 4LSGA 421PA 3MCAA 2Z4SA 2QT0A 1SXJC 2ZRBA 5CM9C 5DNYB 3EPHA 1VYVA 1GRRA 3VR6A 1VG1A 3CH4B 1P3JA 3SQWA 4XSGA 4JMPA 4M22A 4PHTA 4MDEA 2YVUA 2A5FA 1F2UB 3HU2A 3PEVA 1YJ5A 3TK1A 2KJQA 5K8IA 4PPQA 3ZZ0A 2GEVA 4A82A 1HTWA 3ZS9A 2QENA 1AN0A 4A8JC 3A37A 3L0OA 4GP6A 2DY1A 3UG6A 3NHAA 5F2EA 8OHMA 2JLRA 3OE7D 1G8PA 2J45A 4KVAA 5EQTA 2FWRA 4EPRA 1D2MA 1OH7A 2Q3MA 2V4ZA 4ZDIA 1WXQA 2PX0A 3ZIAD 3WBKA 5E7JA 2C2HA 4GNKA 5KSZA 3KTAB 221PA 1UKYA 2BJVA 1RYHA 2GZDA 1U8ZA 3IHWA 4GI7A 2XSZD 1G3QA 1NN3A 3BBPA 2OFXA 1G16A 1Y3AA 2ZI5A 3KKMA 2V7QA 3TVTA 2VP6A 3K0EA 1ZD9A 4ABYA 1Z08A 2OBLA 1T4GA 4X8LA 4OK3A 1OXUA 1YE8A 2GESA 4QNRA 3NWJA 1G20E 5CK4A 1G6OA 3OF5A 2WTUA 3NVAA 4BASA 3ND8A 3QG5A 3PJRA 3IQWA 5HCNA 3CZPA 3KKNA 4QHYA 3B1ZA 1LF5A 1DOAA 2NQ2C 4MRNA 1TL7C 1Q12A 4DIDA 1G7TA 1II9A 1OIWA 1VCIA 1XZQA 2RGEA 2ZANA 1E98A 5FOSA 2ZSDA 1HQYE 1GVNB 1TX4B 2Z6VA 3LQQA 4IW3B 4URWR 5G41A 3MAAC 2QNRA 4CW7A 4E09A 3EPLA 2ZVQX 4KVGA 4QJ4A 1SHKA 1W0KA 2GBLA 2PLFA 2VH5R 2VEDA 1QHHA 2JLVA 2GCOA 4DLXA 1ZVQA 2QMEA 3VFDA 1O87A 2G0NA 2IBMA 4PSAA 5FPKA 4ZCMA 4Y0AA 1JNYA 1W1WA 1CLUA 2WBLC 4JLPA 1TTTA 2KE5A 3TAHA 2RMKA 2QGZA 1IOZA 1N6HA 2R6AA 2DWQA 1XMJA 3PENA 1SULA 2JDIA 5D3MA 2O0KA 2R6FA 4CIDA 4TYWA 5FBQB 2O8BB 1GNPA 1ETUA 2CHVA 4BFYA 2QROA 2Z0MA 4WA7A 5JFGA 4M0LA 5JHHB 1XEXA 2J3EA 2PX3A 4PC7A 4RZ2A 2IS4A 4NZYA 4PQFA 2VL7A 2BCGY 1G5PA 3UK6A 2IYRA 4Q02A 1ZM7A 2CK3A 4BFSA 1E69A 2D74A 2G1KA 3IHLA 1OFTA 3DO6A 5DSZA 5BQ5A 2QGNA 4BFTA 4JLJA 4Z54A 2ZQ5A 3CLVA 4LBYA 1E9FA 3OAAA 2GA8A 2ZE8A 1MRNA 4OJKA 3C8UA 5FUYA 5SZIA 1XD2B 1NBME 1G7CA 3QENA 1R5NA 1ZM9A 2A5YB 1S2MA 3GJ7A 1XNJA 3TNFA 3ND9A 3GLFE 1Z0FA 4KJZA 4JBWA 4ACBA 4JYBA 1F48A 4AKIA 2MMGA 3DOEA 2NO1A 4QJ3A 3X1ZA 5J4YA 4US0R 3A58B 3GLFA 2VHUA 1YR8A 1Z28A 1R0XA 2AFIE 3PUWA 1G1MA 5DI9A 1Z5ZA 2XB4A 4O3MA 4NBSA 4PANA 2FU5C 4QGFA 3QPWA 3X1DA 3H2YA 2BOVA 3LBNA 4B3FX 2A30A 4FXPA 1TU4A 1R8SA 2EQBA 3AUYA 4C0HA 4B47A 4EPXA 3HYRA 3IIKA 1ZYUA 2EU8A 2RGNC 2ZAOA 4NCIA 1CJMA 1JI0A 4Q5IA 3FFBA 3B85A 1VTKA 4A0GA 2QAGA 1AS2A 4JJZA 3KQHA 1CS4C 1E79D 3W5IA 1KK2A 5DLQC 3QKRA 4Q4LA 5G3YA 5EP4A 3VQTA 2C03A 1U81A 4JSYA 4EAQA 5D3QA 3KXIA 1SKYB 4R98A 2ORIA 4U5XA 5CIWA 3KZ1E 1AQUA 1BKDR 1TADA 4KCGA 4CT5A 1L7VC 1M2OB 1XJ0A 4TLBA 1XTIA 1LS6A 1T3SA 2CXXA 2ZYUX 3UXMA 2YYZA 1Z8FA 1H8HD 1T8TA 2QE7A 3WHKA 4B73A 3GLHB 4LJ4A 1AA9A 2BM0A 2P6RA 1VG9B 2GJAA 3KQKA 2RGGA 4CDGA 2VRWA 3QBTA 5SZHB 4NKRA 4ZDJA 1MT0A 3CRRA 4RKEA 1ODFA 1N3BA 1VG0B 2O8DA 2WWFA 4C9BA 4BGDA 1SXJB 1NSFA 3CH5A 3F3YA 2XZOA 1NVVR 4HUQA 5HKKA 3EAQA 4BFVA 2AD5A 1NMYA 3DVLA 4PPNA 2FPMA 5B2ZA 1NI3A 1Q21A 3EZ6A 1S9DA 4DEYA 1E2EA 1TUEA 1OKKD 3VU9A 4JS0A 4YLGA 1DO2A 1M8PA 3TGPA 4LOAA 3J81k 3R8CA 4DLSA 4NCHA 1VCMA 3GFPA 1H8EA 1Z0JA 1DE0A 1OIXA 2WICA 1WA5A 3VHXA 1EK0A 2IYXA 1XXHB 4MGYR 2WKQA 1G3UA 1E2DA 1NVUQ 2WMOB 2O5VA 2OCAA 3HR8A 1C9KA 3B82A 2CL0X 1OHHD 2DWOA 2ZETA 3F8TA 4J0QA 4QJ5A 1A5TA 5FPSA 2VHQA 4D80A 3U5ZB 5KNDA 1JAHA 1P4SA 2WPDA 3KX2A 4EUNA 5AJWA 2OSBA 1G3MA 4Y0VA 1E4YA 1U8AA 2GJ8A 1NY5A 1N6IA 2OT3B 4PC6A 1NG1A 3DPUA 1SVKA 1IY1A 2DYKA 4KFUA 2VO1A 2RAPA 1D8TA 2HYDA 3KB1A 3NH6A 4FD2A 4LC0A 4Q1AA 4F4CA 1OPXA 5KNCA 1VPLA 1UKZA 2PEYA 3RVBA 1E1QA 2VP2A 4ASUA 1ZCAA 2BMEA 5KNBA 2WWYA 4DB4A 1WBBA 4PPGA 3A4MA 5EE9A 1AZTA 4Q00A 4QBHA 1JPJA 1BIFA 3K9GA 3T5DA 2JAQA 3ASYA 3CBQA 1OFUX 1IAQA 4MGZR 3TUIC 4NHOA 3RRMA 5J4HA 4GDFA 1KKMA 4K46A 1EFRD 4K81B 1KNQA 2CNWD 4OL0A 2ZRAA 4KBFA 3WMGA 3B1XA 5FPTA 1GOTA 1EESA 2QSYA 3LDAA 3NIBA 1W36C 4B3DA 2ZR9A 2OAP1 4IXNA 4TN1A 2JCSA 3K1JA 1TQ2A 2JIZA 3GCGA 3LNCA 5JEDA 1M34E 4KAXA 4A4DA 2XTNA 3D8BA 5DN6D 2JLUA 3HP1A 4ZCLA 2WSSA 4G5GA 5FOWA 4D4JA 2H92A 3N2IA 1KDOA 3NBYC 2I3BA 2GCPA 4MYTA 4TMZA 1VHLA 1FMJA 2CCKA 1FPMA 2QMUA 1GUAA 3T35A 4V0KA 3EPKA 4WW0A 2JJ1D 1OB5A 3LA6A 4AKHA 4YXWA 1EFTA 1OH8A 2GDJA 4DC9A 4IVPA 3GJXC 4LWZA 4TTRA 3R9XA 2BMJA 2ZJBA 1GKIA 1XTRA 1G41A 1PUIA 4GOJA 3WBJA 3U4QA 1QG4A 2R2AA 4Q21A 3B2EA 2CL7X 5BWMA 1KDRA 1KNXA 1QHHB 4X8MA 4XVUA 3EXAA 4R2IA 2XEXA 3R9IA 3UIEA 2H57A 1W7AA 2B21A 1S9HA 4KU4A 5JZVA 1PV4A 1WB9A 1HE1C 2J7PA 1ZM2A 4JL5A 1XWIA 1AM4D 2BBTA 4PZZA 4ZKDA 2IXEA 1WQ1R 2C99A 2IYWA 3EPJA 1OSNA 2VP5A 1R8QA 4NTZA 5D3MB 4Q1EA 1YQTA 3GJ4A 2VSOA 1E1RD 2G88A 4KFTA 2Q9CA 4BLQA 4QHTA 2L0XA 1XEXB 2D2FA 4G3XA 5FI0B 3UMFA 1KO4A 4D2IA 5H70A 1IBRA 5CYOA 2GEDA 3VX3A 3PUVA 2OXRA 3AM1A 2VIIA 1FP6A 1U90A 1E94E 2A78A 3MG9A 2GJKA 2A9KA 4D82A 3K70D 3LD9A 5DO9A 5FH9A 2XXAA 3KJHA 3LY5A 1MABA 3TQCA 2UZ3A 4ZDKA 1FTNA 3B1YA 4WZBE 2KSQA 2WHXA 1U94A 5F9HA 2A5JA 2E9SA 4A15A 2CHGA 4QGGA 2JLSA 4W5HA 2HDNB 5IRCD 1E2HA 1GL7A 1XEWY 2EFEB 4WXRA 1AQYA 1QHIA 4B74A 5TMPA 2GAAA 1AGRA 4LYJA 1OYWA 5KTYA 2ZJAA 2NO6A 4IOLA 1G5RA 4LYFA 3ADDA 4B3GA 1N6KA 4RFVA 1P2VA 1KK1A 3GLFB 1E32A 2B8TA 2Q0HA 4LC1A 4I99A 2OESA 3U3OA 1JAIA 3RLFA 2C5LA 1IY2A 1GAJA 1KY3A 3ZH9B 4KXFB 1LS1A 1GFIA 3DKPA 5TB5A 4G5OA 3Q8XB 4R71A 1II0A 5IDVA 2GXQA 1KI8A 4FMCF 4DLZA 4KBGA 4DEXA 4QOSA 4NYJR 4FCWA 1R5BA 2GK7A 3NTUA 2ZAMA 1J8YF 1OXSC 2DFNA 3ADKA 3QKRB 4EDHA 3T12A 2P5TB 4DCSA 4EIWA 2ZRIA 1X86B 4H1UA 3RS7A 1QHYA 3SBDA 2H7VA 5BN4A 1W49A 3O8CA 2QORA 1DPFA 2WJIA 4POAA 4DKXA 4IDNA 3UG7A 4JVNA 1R6BX 1U0LA 1P61B 5CK5A 4C0AC 1S96A 1QHNA 2J0UA 4Q03A 3MD0A 1ESNA 3T06B 1N0UA 4JLKA 1KSJA 4FMDB 1QHXA 2X2FA 4LCBA 1M74A 2AR7A 2HYIC 2F9MA 3I1FA 2FX3A 2GHIA 3RRZA 5DYIA 3PEWA 4A36A 3BFKA 4RFSA 2QP9X 2W6JD 2FZLA 4U00A 2FZ4A 3VKGA 2IWHA 2FDCA 3DMDA 4KLNA 4JVMA 2ZI3A 5J4KA 2J0SA 4WZ6A 1TPZA 1AZSC 2C98A 1VIYA 3D31A 2IX3A 3IDQA 2O8DB 1G3RA 1FQKA 4MGKR 4V0ME 5FTNA 4V03A 4EJSC 1NLZA 2FFHA 2NMVA 2ATXA 3PVSA 2ERYA 4YC7A 1KIMA 3I32A 3A4LA 4LV5B 3NBXX 2R6GA 1ZU5A 1E0JA 1T3HA 2F9LA 3VU9B 4GMXA 3WMEA 3AEZA 4EFMA 1HEIA 5HZHA 1W44A 3CRW1 3SJBA 1EWQA 3QF4A 5C18A 1ZNZA 2AKAB 4P32A 4LDJA 4RKFA 3RS4A 2QU8A 2KBFA 4NCJA 4FWIB 1BYIA 4IOMA 4Z8YA 3DL0A 3WXMA 3Q5DA 4II7A 3SDZA 1A4RA 4GOXA 3KQLA 3OFND 1QHSA 4O2RA 3DEFA 1JALA 3RNLA 1D5CA 3EC2A 2XGJA 1W36B 2PMKA 5DISB 1VYUA 3REGA 3NDBB 2VP0A 2P65A 2ERXA 4IXMA 4JYCA 2ZU6A 1XF9A 1FTSA 1GWNA 1P7CA 3NC1C 4M1YA 4TL7A 4D25A 2ORVA 2R62A 4DCUA 1GP2A 5DE3A 3EW9A 5E95A 3AF0A 1KGDA 4RD4A 4XD7D 1NN5A 1FZQA 1BO6A 2H16A 4IEIA 1TF7A 2HUPA 1E2JA 3SYLA 2J1LA 2WMNB 2YWEA 2IWRA 3ASZA 2W83A 3AVVA 4DUGA 1XD2A 3L82B 1QVRA 4URUR 5FR2A 2ZS8A 3DM5A 1EXMA 1ZIPA 2OBNA 1Q20A 4LJYA 4OHXA 1TEVA 5KDDA 1CRPA 1X1SA 5CLQA 3CWZA 1YRAA 2GZHA 3BERA 3EIQA 3VTKA 5G53C 4ZPXA 3AKEA 1KJYA 4F91B 2AWNA 4LBZA 1DAEA 4GT1A 1W4RA 3QIAA 3QUSA 4ILEA 2IYUA 3W9YA 1W4CA 2WVJA 3FHCB 4F7WA 2YKGA 4Q4AA 4V0LA 4URYR 3JZAA 5AUPB 3GQBA 3ETLA 521PA 3SFVA 2F3TA 1NLYA 2DR3A 3TUJC 4DDTA 2HLDA 3VKWA 4QBIA 4PO9A 1Y63A 4TMVA 3RHFA 3AP2A 2ZRKA 2XJ9A 3RRNA 2CDNA 2B6HA 4P0TA 4C2TA 3SZRA 4KI0A 2PBRA 2NZJA 2CMKA 3PEYA 5JCZA 1ZUIA 2FJUA 2OCBA 3KXLA 1KDTA 3DZ8A 2JLQA 3B5JA 3SC3A 5DHAA 4TT3A 5AJVB 3LVQE 5E7MA 4DVGA 1EFUA 2PMDA 5TDHA 3S1AB 1N0VC 6Q21A 1NVVQ 4TMTA 2BV3A 2FGJA 3GJ5A 5EZ5A 3QE0A 3X1WA 4TZ0A 3LXXA 1DAKA 3ZLJA 2X8AA 4X8OA 4QL3A 1AGPA 2H17A 1G5TA 5JCPA 1K5DA 3R8FA 1N2CE 4F38A 1SVLA 3A1TA 1WBDA 3DMNA 5EP2A 2AX4A 3IIJA 3K53A 3A4NA 3SQXA 2YWFA 3AUXA 3PUXA 4WAUA 2OCPA 2ZI4A 1SXJA 4HDOB 1DO0A 2QPOA 1CF4A 3K8YA 4R2HA 4JKIA 3AVTA 1M7GA 1IJFA 3MJHA 1D9XA 3U3RA 3NEJA 3JVUA 2VA8A 1UKVY 2O0JA 2ZJZA 4C0LA 1W4AA 4HATA 2JJ2A 4PXAA 1S3SA 5EXSA 5HE9A 2W58A 2WWWA 4CEJA 2HF8A 1I2DA 2XXAB 4A8JA 1MKYA 2IUUA 1MABB 2YZ2A 5E3HA 5FFMA 3AVWA 1UJ2A 4DB2A 1G6HA 2ZYVX 4S35A 3R7WA 5AUNB 2ZXUA 1CJVC 1NJFA 2GKSA 2G1JA 1TU3A 1YHNA 3D3QA 4L16A 4NYMR 4TLEA 5AJZA 1KYIA 2ZROA 2JEOA 3FVQA 1OFHA 4M1KA 2ZYTX 3O8RA 3CX6A 1E2KA 1ZNWA 4MITA 5GJWC 4JVSB 2BMDA 2IXGA 3FKSD 2QZ4A 3C14C 1IXZA 3QVUA 1QRAA 5CJ2A 2A5GA 2FF7A 2DFLA 2XNDD 1B0UA 4MRSA 5CB8A 1W2HA 2IS1A 4ESHA 1W0JD 2XTZA 1LV7A 4ZKEA 2VSXA 3K0FA 4HB3A 4LPKA 5FL7A 3U7FB 3IO3A 4JKYA 4GL2A 5UKDA 3PG5A 1AS0A 1A82A 4AG5A 2ZRHA 1G21E 2V55B 2QSZA 3D7MA 3K0CA 2ZR0A 3LX8A 1KHTA 4D4LA 2C9YA 4D6PA 2LWIA 4L9SA 5BYJA 1T0HB 4PO8A 4OHWA 4JLOA 4HAXA 1PLKA 1FW6A 4LRWA 2F1RA 5JJIA 2IK8A 4LJ5A 5JRJA 4BLTA 5C4GB 2C8VA 4Q7JB 2YOFA 2W6IA 4I1VA 2NG1A 4MYCA 1CR4A 2J0UB 4M21A 1JB1A 2YOGA 1BMFD 4WXPA 1DAFA 2X77A 1NIPA 2OXCA 2IYSA 2A7QA 3ZVLA 2ZJOA 4HSEA 4IHQA 2AHOA 3CM0A 3IEVA 1Z22A 4TYQA 4RFSB 2Q3FA 3TRFA 1OXVA 1VDZA 3NEYA 5FBRB 1Q1QA 1EFHA 1CR0A 1SZPA 1ELOA 1ZINA 1E2NA 4MUAA 4Z8XA 1ZC3A 1P9NA 4Q9KA 3W34A 3QKUA 1SGWA 1KKLA 5J47A 4HB0A 4IDPA 4I4LA 4QNMA 1G19A 3F0TA 1E9AA 2X19A 1Z47A 4DCVA 2DB3A 4PTLA 3VR3A 4FIDA 3K0CC 4HLDA 2HJGA 1B23P 3BE4A 1CTQA 1VIAA 3ZJYA 4ACAA 5BN3A 2E1RA 4QG7A 3QJYA 3LLMA 1Z83A 3KKOA 2IUSA 3WYFA 4MKHA 3IBYA 1XD9A 3QF4B 2ZRNA 4CYMA 4ERNA 2G83A 2AL7A 5AR1A 1TF2A 1W5SA 1RKBA 2BHRA 3K9NA 1CJUC 1JEDA 4JL6A 2KBEA 1E6CA 1EX6A 2PEZA 5C46F 4B75A 5J4VA 4P4TA 4YONB 2UKDA 3GP8A 2QY9A 2V7QD 2ZS9A 3AGPA 5TVKA 1WDTA 2YNMA 2C95A 3CR7A 3E70C 5FOVA 2BBWA 4UNRA 2JGNA 3KFVA 3QNUA 2NO7A 1T9HA 4CRWB 3C4JA 2IS2A 5AJYA 5KHOC 4QRHA 4FMBB 2ZRPA 2J59A 4HI0E 2DFTA 1N6OA 1G4AE 1IJEA 4HAWA 4LX0A 3UANA 2CHQA 1RPZA 3EWAA 2RGNA 3GJ8A 3ZVMA 1NMZA 3AVXA 3ZD6A 1N6NA 4UNSA 1XMVA 2RCNA 1E96A 1DTSA 4GSYA 3SEAA 5KYKA 2XX3A 1W0KD 1IN4A 2OV2A 1ZC4A 2I4IA 1P2TA 3RDPA 3V9PA 2NO9A 5C2JB 1N6LA 1XP8A 4LBWA 3WP1B 2MSEB 1TNDA 3M0EA 5LBIA 3OIUA 4C0SA 1UADA 3WNDA 2W2VA 2NTYC 5FR1A 4JLVA 4NYJQ 1WP9A 1OJLA 3QG1A 1NBMA 4PX9A 2HCBA 2JDID 3GLGE 4P4SA 3K0AA 4UXIA 1F6BA 3H86A 2G9NA 2YC2C 3MUFA 2QG6A 3CR8A 3U61B 4TYYA 4Q4AB 1E79A 3GLGA 3K0SA 4M1WA 2CK3D 1A2BA 2R6CA 2IEYA 5LD2C 4MUBA 4UJ5A 3V4FA 1MO5A 1G291 3QY0A 1OT3A 4LJ7A 3LW7A 3NKVA 1H8HA 4OQXA 3L0SA 1OF1A 1WE2A 2HJVA 1R0WA 3PIRA 1COWA 1Z6YA 2GILA 4BZXA 3EASA 1FP7A 3T1OA 1K6MA 4EKDA 1NJGA 2IXFA 1N5KA 2IYVA 2OLJA 2QA5A 2IT1A 4BLRA 1E9RA 3WY9A 2AWOA 4D0LB 4W7SA 1X8KA 1L8QA 1TMKA 1CEEA 1DELA 1E2GA 1E0SA 4TYPA 2GCNA 4PAMA 3ZD7A 4QXAA 3CRMA 3VAAA 3AP1A 4FCVA 5G40A 4B34A 5A5GA 4N0EA 3PFIA 4Q9LA 1OKKA 2PLRA 2JA1A 2TMKA 3MSXA 1IN7A 2R9VA 4V02A 1I4TD 4C0JA 1SHZA 1US8A 4UJ3A 4L5BA 4IOJA 2QP4A 3RWMB 5CB6A 4AC9A 3WMFA 4MRRA 4P3YA 2BC9A 2N1BA 3THWA 1Z0AA 5ANRB 1FUKA 4YDSA 3FKQA 2OFOA 2VLIA 1ZNYA 5EXPA 3BH7A 3KL4A 2JATA 4RY2A 4W5JA 1OLOA 4AKEA 4CEJB 2ZTSA 4A8JB 4I81A 3AVOA 2WAYA 3SNHA 2QE7D 4MKIA 4XTCS 4LJ6A 1R0ZA 4PPFA 3R9WA 2QTHA 3IEUA 2IUTA 2ATVA 3R7WB 5LPNA 3GEEA 4G5RA 4L8GA 1Q57A 4MQBA 3O47A 5JSZA 4BFZA 2NPIA 4F93B 4CT4B 3U60B 1DVRA 4JT2A 4B43A 1MR3F 2QRZA 2V6JA 3NHBA 3T61A 1HE8B 1U0HC 3OIWA 1P62B 4U7DA 3EARA 3PV0A 3OEHA 2O8FB 1XBTA 3CPHA 3WYGA 1OFIA 3BB1A 3TE6A 2GEUA 3I8SA 3E5HA 2CCGA 3OIVA 4H1VA 3K0FB 3U7GA 4FCTA 2WWIA 1U0JA 3FPAA 3GJ3A 3IPYA 4GZMA 5CLLA 4C30A 3GEIA 4TQAA 5DI3A 1E0AA 1BH2A 3LW8A 4F4JA 1JPNA 5EP3A 4D0NA 3SHWA 3KKQA 4EFNA 4XJXA 3GJ0A 4LV6A 4YMUA 3RS3A 4LUCA 3AKDA 3KUDA 4LHZA 2IYLD 1JR3D 4IVRA 2QQEA 2RH5A 3P32A 5CITA 5DN6A 1P75A 5JHGB 1D2EA 5B57C 1LY1A 1J7KA 5TXGA 4RD2A 1YZLA 1ZP6A 4BFUA 5IHPA 2WPDD 2BBOA 2I1VB 2WOOA 3GD7A 1XPUA 4L15A 3WP0A 4AY2A 2P0EA 1LB1B 1H65A 2HT6A 2QTVB 4HZUA 3W3ZB 3IQXA 1WF3A 2XZLA 2ZJ8A 1DADA 3I72A 3LXRA 3EWSA 5HTKA 2BMFA 3A36A 3DZDA 1KMHA 2EWWA 1XU4A 2AD1A 2CLCX 1E1QD 4ASUD 3P27A 3DM9B 4BZPA 2ECKA 1G9XA 3P20A 2B7CA 1M6NA 3LAWA 4IOKA 2EW1A 1E2QA 4BEJA 3B8HA 1IN5A 2AK2A 1G8GA 2WJYA 2EFHB 4PC1A 4PR0A 4CF7A 5L8VA 1G18A 4BECA 2ZJYA 1MOZA 3S1AA 4ARZB 1CRQA 3UMRA 1II8A 3PXGA 2BVNA 4RJLA 1AKEA 1OXTA 3JZMA 3KJEA 1E1RA 1RYFA 2JIZD 1RW4A 3BAFA 4NYIQ 2XTMA 1NMXA 1YR6A 4URZR 5LDDC 1G7RA 1XZPA 1KO1A 2WSSD 4JJKA 3O8DA 1KAOA 2J0VA 1P2SA 2QUZA 4Q7MB 2PZEA 4F92B 1FL9A 3OEED 5FPYA 1XEWX 3HR7A 4TMWA 3HWSA 1X6VA 3SI7A 2WJHA 4BPBA 1RRPA 1QZXA 4G5SA 4B3BA 4NL4H 4YXWD 4NYMQ 1NSTA 2ZE5A 3U7HB 2G0TA 1JXMA 3GMTA 4AG6A 4MYUA 4BLOA 3IBGA 2QBYB 3BD9A 5AUQA 4A9AA 5BN5A 1ONBA 5KSPA 2GXAA 2ZI7A 4OHZA 1XCGB 4WZAE 3RAPR 4FMCB 3AF3A 1GKYA 1W4BA 3QQ5A 3VR5A 2RKOA 1Q44A 1WRBA 1NN1A 2IL1A 3CRVA 4LHYA 3N2EA 3CNLA 3QBVA 2ODNA 2ZSBA 3RC3A 5EJEA 3Q5EA 1IM2A 1KJWA 4WOPA 4A0RA 4UNQA 2FSGA 2WIBA 1YVDA 3K0AB 3KDSE 1Q1EA 4P4SB 2FEOA 3MWYW 4XWKA 4DJTA 1TF5A 3ZYCA 2C78A 3TKLA 1G17A 3K70C 4TTQA 2WJVA 3TW8B 5FOTA 3GLGB 3OHMA 3FGNA 3AF4A 4MKFA 3TBKA 3QKSA 1ZJ6A 2A3RA 2G3YA 1HQCA 1P9RA 4EJSA 4JLAA 3KJIA 4NP6A 1XDBA 2OBMA 2Q9BA 2F3RA 2QL6A 3EA0A 3P4XA 5TY0A 3BC1A 2KB0A 1JBKA 5B64A 2CBZA 5IK2A 1XMSA 3ECCA 3NDPA 3KQUA 3I3SR 2ZRFA 3CRQA 4ZO4A 2D06A 4PQRA 4YMVA 1MV5A 1G8HA 1DS6A 4M9XA 3T1TA 1XTQA 1N0WA 1Z0IA 4RD1A 4Q9HA 5CYPA 1K8RA 2FMXA 5DIFA 5FOUA 3LVRE 2HXYA 2AKYA 3HU3A 1YU9A 1D6JA 1RJ9A 1T6NA 4NONA 1CU1A 1YZTA 4ZI3A 2GXUA 4DLWA 3B9PA 1O3YA 3BFXA 4XVRA 3ADCA 3QSYA 4ZI2A 2OG2A 1DG1G 1MO6A 4Q47A 1M1YE 1ZMXA 1OE0A 3MGCA 2ONJA 1CULC 1US8B 3W8RA 2GETA 1JQJC 1CIPA 3OZXA 3I8XA 1ZU4A 5JRZA 5J5CA 1A7JA 3THWB 4PZLA 2PJRA 4OK5A 1XPOA 4CVNA 1E99A 2H5EA 4V0MA 4LPSA 2JASA 4CGZA 3T15A 5BW8A 2EFGA 2QRNA 2QPAA 4NPHA 4Z1MA 4AKGA 1G3IA 1GNRA 4RZ3A 4QBFA 5JEEA 1KTVA 3H84A 5BXQC 4OBEA 5JECA 2CVFA 2EWVA 4E22A 4Q1BA 2JLYA 4XTRA 5FTKA 2ZUBA 3I5XA 4JLMA 5EE1A 3MMPA 3IGFA 3O8BA 4JBYA 4TSFD 4JLBA 5JSZB 3VKHA 4PHFA 1EX7A 3VNVA 1KO8A 1Q0UA 1SVOA 3WNCA 4BFWA 4BLSA 4F4IA 3L8ZA 5HR5A 2V1XA 4C0BA 3L8YA 4TQUS 1KI1A 2REOA 3UATA 4C7OA 2WWXA 1P72A 2PH1A 4M1SA 3QXHA 4IDOA 3ZQ6A 1XTSA 4FMDF 1PLLA 4R9UC 1AJEA 5LB2A 4IFBA 3FFAA 2RB4A 3CF0A 4OI4A 4RD6A
chains in the Genus database with same CATH superfamily
5KPDA 4HEJA 2QEQA 4D0GA 1Y48E 3P1JA 4IFIA 5DYWA 2A59A 2X76A 4JYPA 4FE7A 1NQVA 1NQUA 2J46A 1IRXA 1DC6A 2O50A 3M4YA 4YA6A 5G4KB 4P4UA 2H0QA 1T24A 1A3CA 1M6YA 1ZKMA 2P2YA 2R8BA 4OXXA 4YMTA 5HUQA 5JAZA 4IVNA 1MW9X 1QWOA 2PANA 3ZBQA 1Z5VA 4O0LA 5CXSA 2M2IA 3H65A 1FYDA 2R8EA 2O2XA 4D3YA 5JCOA 5GZ1A 4Q1DA 1H6BA 4DRXB 3M5PA 3GFGA 4NULA 4RETA 5E6UA 1SVSA 4C7BA 4FWTA 2WYIA 4QBGB 3FRJA 2DPGA 5KPJA 2GWHA 4X20B 1XZIA 2QJTA 3A3YA 1DCTA 2IS6A 4L5CA 2VYQA 4B32A 1O54A 4L5IA 5JMOA 4GOKA 4UU0A 4YJKA 3IQIX 3LWDA 4HAZA 4ITRC 3WLFA 1PUXA 4IGFA 1JWLA 4PX2A 5JYDA 4O1MA 1Y1QA 3BQMB 4EJ0A 4BC1A 3H2KA 3LYAA 2VC2B 4E2ZA 1N2GA 1XFAA 1LFDB 3BFJA 2M6KA 3L8CA 4B81A 2JAUA 4OHVA 3TJRA 5DT2A 3H0KA 1KP9A 5EWJA 1XCLA 4WCFA 1P6XA 1S8AA 3PUJA 1LBQA 4UUPA 4B5KA 4P7KA 1LZKA 3G9ZA 3TNJA 1N4AA 1FX0A 3LUHA 5LQKA 2JVKA 3BRWD 1N8TA 1SB8A 1TK2A 4D9JA 1OYYA 4XLTA 1T4CB 5GZ3A 3INYA 1Y1PA 4CMAA 1QFJA 1Y8RA 2A9OA 1RWPA 4FYYA 3SN6A 1ZVJA 3BS4A 4HJRA 2OCYC 5FTMA 3AFOA 4ER7A 4MA5A 4YCLA 4YO8A 2VXBA 1WZCA 1DBRA 2HJSA 2REBA 3PRJA 1GKUB 4E03A 4QE3A 1II8B 2ZYWX 1TJ4A 3PJFA 4G2TA 2V5AA 4I19A 2YWGA 3HMKA 2GUWA 3QE2A 2O3SA 1GTVA 3V7FA 4CLOA 2A14A 4X1IA 4Y7CA 2I6GA 1Y5IA 4HEQA 3OJCA 2QV7A 1QG2A 2JRLA 2PA0A 3EC1A 2H3EA 1HPLA 2O2IA 2PIDA 4I6GA 4NZOA 4PGGA 5EJ4A 5I9MA 3G8AA 4K9SA 4ZREA 3WRWA 4TYNA 2Q9UA 3FI9A 3HYTA 4Q1CA 3R74A 4CTNA 2NVUA 2GVZC 3H4MA 4ZVQA 3V1YA 1A5BB 1N5IA 1L8AA 1G2IA 1F0YA 3NPMA 1OI3A 1Y9DA 2Y4OA 3C24A 2NSHA 5JS1A 4HXGA 1M3SA 1VL2A 5BWNA 1QGOA 3IJRA 4CF4A 1MJFA 5IWCA 4QVGA 3FE2A 5E2AA 4MPRA 1O58A 2PUCA 1QLHA 4G0NA 1GPJA 2JFNA 3AP3A 3V6LA 4CE6A 2P77A 2B4YA 5JWOA 3CKYA 2E87A 5JJBA 2G63A 1WF6A 2H9AA 1G8AA 2C5BA 3VSEA 2O4UX 3KOUA 3O38A 2ZAYA 3AUUA 4W8GA 5AW7A 4URFA 4MLCA 3ZQKA 5IZCA 1U7XA 1BX3A 3OC0A 4E6PA 4B6GA 1DQPA 1HYGA 2BCJQ 4IDAA 5DHQA 1KE1A 3QOFA 4YAGA 3PWZA 2CNNA 3MJCA 1Q83A 1WCXA 2BFPA 4WDQA 2H4ZA 1ML3A 3BIWA 5DGTA 5EJAA 2F1JA 4YCMA 5LZ2A 3W90A 3QKIA 1DIHA 1U1CA 2JIOA 3I5UA 5D5HA 1QH8A 4L85A 1DWPA 1W87A 4PNEA 2FW0A 3COPA 1FDOA 4XVQA 3MFYA 2EYQA 1SXJD 4WLOA 3I6ZA 1IBLB 1ZRSA 2FLVA 5B30A 1IN8A 4HK4A 4BNZA 3K6JA 3ZCVA 5CUQA 4GXNA 3OE7A 4TM7A 3DLHA 4FJ2A 4HAUA 4EJSB 1MX9A 3SJAA 1S3FA 1DAPA 1CIVA 4NHEA 4M1OA 1OBOA 1RQNA 5BOSB 2VNHA 3Q7IA 5CT8A 3ZIAA 3AVYA 1PG0A 1TAQA 1ODSA 1VLVA 2OE2A 2PX4A 5F5XA 4YWJA 1RIFA 4G2NA 3ZHRA 1RWXA 1HLFA 3QUQA 1PFYA 3K3PA 1XO1A 1BMFA 1M67A 3FGOA 3RD5A 3GA5A 1E3SA 1BX0A 3CMCO 1YUMA 3VC2A 2VUSA 1ZVKA 2RK4A 4DM3A 4KKVA 2VWGA 3PFKA 9LDTA 3TGLA 1JYEA 2YFQA 3I73A 5GJCA 3ABZA 4QM6A 4ES6A 1UQTA 3IAS1 1YRBA 4BN0A 5CIQA 4HQRA 3OZWA 1I3LA 3V4SA 2HL6A 1FQJA 3L0PA 4E2WA 2DQSA 2P9GA 3EZNA 2NTNA 1G64A 5I7HA 5HCIA 4QGHA 1K6JA 2ZSHA 3NTRA 3OT5A 3R0VA 3R3ZA 4KO3S 4LHVA 4Q4DA 1C7IA 4TWZA 5AKXA 3AK4A 1NUQA 2AW3A 4PCVA 3G9QA 5HFJA 1UBUS 4LNUB 5EC8A 4TZKA 5I7UA 4IKEA 3E7XA 4ESEA 1YDFA 2G5PA 4BWGA 1WG8A 4HUJA 4B6RA 1JKJA 4U1RA 2JA2A 1PNTA 2I76A 4G41A 4JDPA 2AJ8A 1YL7A 3D6TB 3CNQS 3EGXB 1RQRA 4PW0A 2HWYA 4N6NA 2DRIA 4C0QC 2VTKA 1T8RA 1KZ4A 2ZW9A 3FHJA 4Q39A 3FX2A 1K8ZB 3UK7A 3MRTA 1YOVB 4RPLA 3I2IA 3TI7A 1TD1A 4UFPA 4GPIB 2O2CA 2G0AA 2CXPA 3EG9A 4MOWA 1FNSA 4JYMA 4ZXPA 1R0YA 3NC0C 4B8YA 5JQGA 4NFSA 3T41A 1OR8A 1QE5A 5HZMA 1B43A 2M32A 3BGVA 3RVJA 5KVQA 3ZVNA 3QWBA 4L4UA 2Q1XA 1RZRD 2CLDX 2CDRA 1QIGA 1CUSA 5EHNA 3ZUGA 4M8IA 1H5QA 4CUJA 3W8NA 1EDDA 2O8CA 4GM1A 3G59A 5A62A 2QUBA 2NXJA 1FXWA 1ZUNB 2WKSA 3WK7A 2CXTA 3R9KA 2WF7A 3B51X 4HNAA 3V46A 2OTCA 2H0RA 2UUCB 1Z6TA 1E77A 1ZIOA 2FUEA 3A4VA 4HAVA 5BR7A 5C3MA 1ISGA 1W46A 4PYIA 1W6UA 5G2OA 3RBXA 1YZGA 4HYYA 4X60A 1H4SA 1Y3IA 1GRCA 1SELA 2LKDA 1WJGA 3B1JA 3REQB 2P90A 3PL1A 3WWEA 2AC4A 3G5TA 2ZVPX 3PFCA 5K0JA 4OOFA 3OA2A 1TK3A 2FSFA 3BULA 4NDZA 4A8TA 4DY4A 4EABA 2GA9A 2N42A 3GW8A 5JS7A 3KR1A 2CBXA 1S02A 2O5RA 1Z82A 3QTTA 4UC0A 1ZA1A 4M9ZA 4RC9A 3LQRA 4S2EA 4G1FA 3EJ6A 4UNPA 1WZ2A 1QV6A 1YMQA 2DERA 2Z83A 3IFSA 3H2HA 4TXMA 2NSJA 3M9WA 3ZZMA 2YY7A 3TL6A 1LZLA 4KEAA 3LXUX 3RF7A 4POOA 2PUTA 5HCUA 3W04A 3SICE 3FGPA 2R00C 5C4MA 3COWA 4Y3UA 1FBTA 3PUIA 1C3OA 2BZSA 4UHKA 5LQAA 1L2TA 5JSFA 3UMSA 1ZOPA 2A9FA 3VKUA 4B4VA 1D2GA 1QX4A 1SBYA 3O84A 4D7AA 5KSYA 3ER8A 1KI6A 2VHJA 5E6UB 3VU0A 4IQGA 3QU4A 3QVLA 4CIVA 1KEUA 3B12A 3VH3A 2E82A 3SHFA 1T1GA 4LDAA 1XVAA 1VXOA 1B2LA 2G4VA 2QRMA 2WM9B 2IYOA 2H1IA 3EVDA 4OM8A 4FW9A 1UXGA 3ILYA 3UH1A 4J4BA 1IONA 1DIAA 1F2TA 1U0EA 4NU5A 4OBXA 2NO0A 4M46A 4F3CA 2HN9A 4DZRA 3QPUA 4KZKA 1T34A 4RSMA 2AF4C 1QHGA 2JCBA 5EWJB 1X1TA 1ZS9A 3Q7QA 3W6NA 1PGNA 2QZSA 2NPFA 2ZS7A 3LDFA 2NM0A 4TMFA 3LIPA 3EEFA 5IVIA 3VUEA 3HO8A 4F5EA 2XAAA 3A28A 5CXUA 1FX0B 1TQ4A 1HLGA 2ZG6A 3FLEA 3LUBA 4MYSA 3T5CA 5K8UA 3DC2A 5DHFA 4OIFA 1XRJA 4EX7A 2V4MA 4M83A 2O19A 3HB5X 4H0FA 1ZICA 1C7QA 1UK9A 2XB8A 2HQSA 2PT7A 3LBHA 1Y8RB 3MWGA 4KIGA 5LP1A 3GLIB 4MK4A 3URKA 3QPDA 2R4QA 1LXCA 1UPFA 2NSDA 3DLBA 1UCFA 4HDNA 1YZNA 3T0FA 1FFXA 2GKOA 1GG2A 1M5TA 3IVMA 4ZVSA 2J5QA 4N4AA 3KPWA 2J0QA 3TQQA 3I12A 4CLOB 4H4DA 1JUDA 2O8NA 2JF0A 2R7NA 2ZUCA 4BZZA 1ZGGA 1FE8A 6YASA 2E4VA 4Q6WA 4HRYA 4LEIA 1TEHA 1QG6A 3D2CA 4UUMA 4BEWA 2O20A 8ABPA 4TTSA 2J67A 2OV8A 1MXHA 2H1LA 3CF2A 1NJ1A 4PWYA 4R2XA 3GLSA 2HPHA 2YQ4A 2WUDA 1F3OA 3AM5A 4O4IB 5DGIA 2GPSA 2JVJA 2NVUB 3VHQA 1ZW6A 2GO1A 5THKA 4CM3A 5EPOA 4TLAA 5MGNA 3AJDA 4YJDA 4DANA 5ILOA 4PFSA 3KM0A 1UPXA 5CIYA 3I62A 3QX8A 4C4OA 3VNUA 3ZBUA 4C2AA 1QUFA 1COWD 4DIUA 3L18A 2AYZA 2CXRA 3NBFA 4U7JA 5IAGA 3C0KA 3ZY3A 4NSNA 2DHEA 2C3UA 2ZSKA 3OBIA 3LQYA 1J2RA 4RMGA 5J40A 4WKGA 1WPRA 3HCPA 3MERA 2FTKE 5KYNA 1BWSA 3V7NA 4Q82A 4DSNA 1NNEA 3QBJA 3REOA 2BJWA 1FF9A 1XA0A 2ACKA 4EHBA 3SFTA 4ZCIA 3L5OA 4FONA 3ZWDA 2EVWX 3FMIA 1QIIA 4B48A 3F8WA 4LV8B 4HL6A 1RRVA 4DCMA 2EFCB 2CJWA 3NZEA 1CQWA 5EQJB 3A9RA 2WHEA 1EB9A 4KMOA 4BNHA 1EI9A 2A88A 2GZ3A 4EGAA 3LO5A 2E5WA 1NVEA 1PEKE 3O3CA 2NU9A 2Q5IA 2W0SA 5EVCA 4KREA 2SKCA 1QH8B 2GERA 1DDIA 4ZT5A 2E21A 4AYTA 5FJJA 3MS2A 1SIUA 3AOEC 5TV2A 3PC2A 1JR3E 4QQFA 2MHCA 5BSTA 1E1KA 3T94A 1XNRB 1UQUA 3BF8A 4U7PB 3PQEA 3FTEA 3D7NA 5EL0A 5K8TA 1HDIA 3R09A 4RPIA 4YGXB 4MV8A 2FE4A 4KHZA 5KWVA 2OHFA 2WAMA 5M04A 4MI9A 1N2ZA 4ZO9A 2H4WA 5JROA 1KOFA 5FYDA 2B9VA 2NO5A 2WSIA 1UBKS 5ABPA 4EI7A 1M7BA 2BRUC 2EF0A 5CG1A 1HA3A 3SYNA 5DKFA 5GWXA 4YR7A 4V0RA 1D7AA 1BVYF 3MJRA 4OMUA 4PZPA 3NLLA 3CV3A 3MWJA 3EISA 3I9KA 4ENPA 1F5NA 4P36A 4RZUA 6CHYA 4RX1A 2AN9A 2RHMA 5PNTA 4BE7B 4EEXA 4M38A 5I9SA 2ZEJA 4MEAA 1ACMA 1NVTA 2VS1A 1JJVA 3TLAA 3HVHA 5GMOA 4EBFA 3FMPB 4ITUA 5KNDD 2Q3HA 1PSZA 4FX5A 4Y2VA 1UEIA 3IQEA 4Y18A 2BEJA 2Z3VA 2JJ1A 1NUSA 5HK9A 1UBRS 3MWDA 5H5JA 5BYAA 2JHPA 2NTJA 4BB9A 5MHTA 5P21A 3A2LA 4CFZA 2XAUA 4PBRA 4KX3A 4GH5A 5FPHA 1KMQA 2FN8A 5GVSA 1WMDA 3U6KA 2WMYA 2XLBA 5JR3A 1E5QA 1DDOA 2BZ1A 2JH8A 2C7BA 5EPEA 4DCOA 1NJ5A 4P35A 3BIOA 4X45A 4ENRA 5LQCA 4RTSA 3PGA1 1JKJB 3U7JA 1SBHA 1U6JA 2EGHA 1DKQA 2IZ7A 1IXSB 2AXNA 1O4WA 4EKNB 2IYTA 8ATCA 4JZYA 4O5OA 1W76A 3ZDCA 5EMJA 3PHLA 2L19A 2OO3A 2BSQA 5LM3A 1R64A 3GX1A 4C4AA 2X2EA 2V7BA 1E6WA 1Z35A 2HKIA 3EG9B 4GZLA 1J24A 1RYMA 1UF9A 1VGRA 2JB9A 4MS3A 5JQGB 3LGSA 4NG5A 3PSHA 4G0YA 3RHZA 3CNNA 1RZUA 4DMKA 3TTYA 3K6SA 4M4SA 4YLEA 1E0KA 2W4QA 4L9WA 4L78A 1QO7A 1IY0A 2LUOA 1YJXA 4GW3A 4OLJA 3UMGA 2WWTA 1J2EA 1R5JA 3PHJA 4TMXA 4PZAA 4E7PA 2O8CB 2I2BA 4HUTA 3ZCXA 1ZOSA 5BT9A 3RT1A 4CN9A 4HNAB 1NN0A 1E9SA 1JZTA 1OI7A 1TO6A 2GRAA 2VTVA 3Q12A 1G38A 4QUAA 1F3LA 2QN6A 2WDPA 3CX8A 3LC7O 4RPKA 4A6PA 3OQ1A 4I66A 2B1GA 5ICFA 3B9BA 3MCVA 2Q4BA 5TIIA 4DSOA 2OFWA 2PGIA 4B44A 3TD2A 4GGPA 3ZDYB 2J3LA 3NIGB 3RF6A 2QL7A 2IHBA 1YNOA 3M33A 1YRYE 2IOYA 3L4EA 3N7AA 3ZEAA 2NGRA 2OZPA 2DM6A 3W5BA 2COKA 3HKDA 4J0FA 3RTDA 2HPZA 1HL3A 4X7MA 4AUMA 2X1VA 1HLDA 1BXKA 3FZEA 3QEJA 3O4GA 4J3FA 4O4LA 4R0MA 1QQ5A 1S0UA 4B4KA 3E61A 1VP3A 1YB1A 4H6PA 4P3NA 3HJCA 1OY1A 1X77A 4M87A 4OQFA 3MJEA 1KOGA 1TJYA 4ZOLA 1WZUA 1ZUWA 3IQZA 4QJBA 4US1R 1EFVA 5FX2A 4F1KA 9MHTA 4JUFA 1C3OB 1P0FA 1OA0A 1ID8A 1T5LA 4BIIA 4JNKA 1KO7A 1ZW1A 2GK6A 2I67A 3G0DA 4MWZA 2PZAA 4WZAA 2EEZA 3IR6A 4J43A 1KI6B 3CISA 3NBZC 2NXCA 5F5LA 3UKDA 5CEEA 3T3PB 4D3FA 4UMFA 2VDMB 2I4NA 3NHMA 3JWHA 1DKPA 2Q07A 5J4LA 1JMVA 1IBCA 2NTVA 3FSJX 1UZMA 3U39A 3ONWA 3EZ7A 5KJ6A 1HFKA 3VR1A 1NLUA 3KUUA 1D4FA 5EMHA 2H2DA 4UHCA 4UZEA 2PRYA 2UYQA 2LKCA 5IJAA 1RM5A 621PA 3AJ8A 2ZCUA 1FOEB 4B8WA 2QMYA 1F2TB 2WK1A 2V9PA 4ZN6A 4E2XA 4RPCA 5KOYA 3NP7A 5CCXA 4Q3NA 3QRWA 1ZN2A 3NH9A 5DHPA 4AULA 4DKJA 4OSPA 2VZ8A 4YBZA 3KXKA 4IG4A 5A1TA 3LT4A 1LDNA 5HE8A 2HZ7A 1Z39A 4Q7KA 2HXSA 3RS2A 5EPUA 3ITKA 1PR3A 2FV8A 1KXJA 5IUNC 1GA1A 4BKUA 3GHHA 4W5RA 3ER9A 2IPNA 2WTEA 5C8YA 1UC9A 4FHCA 3QFSA 4HDQB 3D3KA 5LYJA 1FP2A 3PUYA 1DXOA 2PDAA 3GRKA 2AFRA 2DY0A 5HJ2A 5A2GA 5IABA 2WM2A 3T5GA 3OM9A 1PJ3A 4O2LA 4QZVA 2B8WA 3CW2A 5JY1A 4B80A 3K15A 2CWDA 3S5UA 4MVJI 2UZ0A 2O3UA 4EMSA 1FFXB 3K9WA 1JDSA 2R8OA 3R23A 1F2UA 4FDLA 3V8RA 2HR1A 1R4AA 5DB4A 3GFQA 5E7IA 1JTFA 3A9WA 1Z07A 3K32A 3AJAA 1RWNA 5B1IA 4PSKA 2ZRJA 3IUMA 1TUGA 2HTEA 3FGZA 1ONPA 4IEEA 2HMUA 3GEHA 2MSLA 5DBGA 5HVNA 3H18A 2IIPA 1GYQA 2X5OA 3OESA 5IAOA 1NDHA 5DTQA 1NUPA 1QJCA 1Q3KA 1IWOA 3TMKA 5J58A 3V32A 3ESBA 3T5TA 5IK2D 2IOFA 3RG2A 3T1YB 4PNHA 4ENWA 1ZHOA 4MTLA 4OI2A 3B6KA 2PL3A 1MNQA 1LLFA 2MSCB 4HXEB 4HDCA 4G07A 4ND3A 4YCNA 5A7HA 2PVPA 2C3OA 1L7NA 5I7WA 3CHYA 3ZVRA 1NHWA 3ZKWA 1BHO1 1X8LA 2HCTA 2GH1A 2OB1A 5DNAA 3EX7C 2OB2A 1ANKA 1E2LA 2PX8A 3OZGA 4IFEA 4QGBA 5I7FA 1HR0B 1GILA 2AMJA 1RSZA 5L7WA 5LQUA 4GFDA 2P9FA 4JIMA 4BCCA 1H2EA 1X42A 4B6FA 3A04A 2XXJA 4P5EA 3R6DA 4NQZA 2CJWB 3FZGA 4S0ZA 1NF2A 4XOIA 4HUQB 3QLVC 4UNIA 3TOVA 4CKYA 4DNFA 5HOQA 5HILA 1ADJA 2NU9B 4QELA 2LNDA 4EDFA 3CRZA 5LJIA 2X3UA 1QTQA 1C7JA 4ZGGA 1Y4AE 3E9CA 4QKQA 4YACA 4GOOD 4ARCA 2FVXA 4ZU3A 1MHPA 5A1JA 3F9CA 4GBGA 4JJ4A 3IVXA 4G67A 4WACA 4BQEA 2WU0A 1HQKA 3NNSA 4D0RA 1IJBA 3J80A 4JEIA 1ILEA 1ISIA 2GM3A 4GLFA 1T15A 1KIAA 4MX8A 2QM8A 3BHMA 5CVUA 3QEBZ 2H5LA 4O63O 1X1DA 1SG0A 2P2LA 5JAQA 3FTQA 3HY3A 5FORA 5KC9A 4W5QA 1T2NA 1U99A 1JSRA 2X4LA 4FHGA 3VNRA 4BGIA 4O59O 3P4YA 3LPLA 3P94A 4GI5A 1L7OA 5IMBA 1PF7E 3CF6R 3CJQA 3L7DA 1C0IA 4TL6A 2QD4A 3TZHA 5IJ9A 2ZIFA 4MVJM 3WZ2A 4PQYA 3OOEA 5ITZB 1XMIA 1JB9A 4LY0A 4M7PA 1YTUA 1C1YA 3FDZA 4G4GA 4KO8A 4L0QA 2WNSA 4X1KA 4HC4A 5FRDA 1SCNE 2OD9A 2FOLA 3TVDA 4D9MA 1JAXA 1MNAA 3QVTA 4X44A 3TRKA 3VA7A 1D1QA 3WYAA 5KQGA 3DZGA 3CUEF 3P0RA 2GAOA 4XB2A 1KJJA 2FR0A 5A4IS 1RHRA 2YX1A 121PA 2VP9A 3MWDB 2HMWA 4H60A 3VMMA 4L07A 2MYTA 5TNXA 2QLNA 3ZGXA 4DYDA 1QWSA 3UWKA 5AKZA 4EL0A 5DH9A 3QU9A 2JH9A 3VR4A 1CUVA 2N1MA 4QTXA 3P0JA 5FTLA 3SDBA 5KOHA 4UUAA 3TTUA 3U7EB 3ZZTA 3C8DA 1O77A 2HT1A 2VUHB 2GF9A 1IMOA 2QX9A 2WAXA 3U09A 1F17A 3LWNA 1BOOA 1HWYA 2X2PA 4FR0A 4PGMA 1M6HA 2IY9A 2MIIA 1KEZA 1JU9A 3L0IB 4R1TA 5LU9A 2IPLA 3WGVA 4JT8A 4ALLA 3LH5A 2C54A 3AEXA 2ODEA 4I9FA 2REQB 3FPFA 1CUEA 5FO1A 3NO4A 1NV9A 2GZ1A 4NE7A 4KR7A 1P5JA 4MS3B 1I6WA 4HQLA 2GF0A 4DV2B 4TXLA 3UT5B 3NAGA 3MOIA 3PGLA 4RLHA 1CNEA 4WFJA 3BSYA 3T99A 3WKDA 1OASA 5EKSA 1JDBB 1UBCA 2NOAA 4MRVA 4PAOA 4Q1FA 3TKYA 4QEKA 3FOZA 1MA0A 2G08A 4HDRA 5TF4A 2V7XA 3B9QA 1IBKB 3T95A 4ZVKA 4ZYYA 1Z16A 2K6GA 2QVZX 3CKLA 3DYVA 3X2SA 1CR6A 1KBZA 2CXHA 2R65A 1QOPB 3IJEB 1PV1A 1QVAA 1AUQA 1TB4A 1V8FA 1ZX1A 5FUBA 3RABA 3R9XB 4W63A 3GLHE 2VHCA 4R7ZA 4PSCA 3OT1B 3IBSA 4BGEA 1M2OA 4U2BA 3VR0A 2P3LA 4LXYA 4INOA 2VP3A 3M5WA 1YS2X 5A02A 4GICA 3E6AA 2ZYSA 4FOLA 1BVHA 4NCXA 1MRZA 1ZI6A 4KX5A 4RZQA 2YXDA 1SY7A 1XZFA 4GWGA 4EM6A 4P4GA 3HKDB 4HWGA 2JFVA 1GAQA 1MB4A 1O89A 4KH1A 3OSZA 4KFSA 4O4LB 1SXJE 1A9YA 4R1SA 2EKDA 2KYRA 5H68A 4B2PA 4F2WA 1CUFA 2C7PA 4HD8A 2RGBA 4ZOLB 3IJ5A 4PZ0A 1IN6A 1EFVB 3C7TA 4JJ6A 4EZBA 4J7XA 4G0MA 2K5UA 4YX9A 3DFIA 3AVPA 3GHYA 4M2LA 4EW2A 1PR9A 2F62A 2HU8A 1L7QA 2W71A 2XNDA 2PYZA 3CPJB 2Y1FA 3G0OA 3DDWA 4UDOA 4ZDWA 4KC0A 4BYGA 1GXSA 2H07A 2JJ8A 4JI5B 4FQ7A 4LXTA 5DW3A 3F96A 5BSVA 3TLEA 2ZREA 3DCIA 1C9NA 5ADUS 1FP4A 3EVTA 5TQ0A 2G80A 5KREA 1GKLA 3BB3A 3CWQA 3HXMA 3CVUA 1IBSA 2VF4X 4DCJA 2OK7A 4BVLA 4LF5B 3LZCA 4K8OA 4Z0NA 5LXTA 1VSUA 5ERXA 3QPAA 1J07A 1LQUA 3DFKA 3FWYA 3HFGA 3IILA 2VZ9A 4RY8A 1ZITA 1V47A 2O2JA 2BFBA 4KXLA 1IH8A 1H5NA 1CJTC 2GAFA 3FLBA 4M0FA 3G7UA 2IYZA 1FQWA 1M2VA 1NWHA 2J07A 3BGWA 4IJMA 2XOKD 1QCCA 3RWOA 3S2GA 3KWFA 1IB6A 1QYWA 4KN8A 4AS1A 2D2EA 4UW9A 2VQDA 2XITA 2Y1KA 2DH5A 4HAOA 4DCPA 1JVBA 5BSMA 4BLWA 4WOCA 2CEAA 1UIRA 2B1JA 5DYNA 4GXTA 4G0VA 1EGMB 1Z6GA 2OM2A 5C8YB 4M55A 4LSGA 1HTTA 1Z4LA 2N0SA 3HUTA 4QAJA 1CY6A 2Z1MA 2Z4SA 3RFVA 1YB6A 1SXJC 4F8EA 5DNYB 3EPHA 2CJPA 3GUCA 3U19A 1VG1A 1X7ZA 1YGYA 4L28A 2HJ9A 3WGGA 2PS3A 5BOVA 3HZZA 3NB0A 4QYXA 2SECE 2HRCA 2PSHA 1D0SA 3QXGA 2H51A 4JB3A 4TSRA 4XCQA 3VR2D 1F2UB 3PEVA 5JVDB 3VDRA 5COAA 2OYCA 4R1PA 1ZONA 3W3AD 3ONDA 2GEVA 2PWZA 1YUBA 4A8JC 3A37A 3L0OA 3UG6A 1QQAA 3N5KA 2NSLA 3W7AA 3W2EA 2JLRA 1WXDA 1G8PA 1XE3A 4TKVA 2POCA 3OPMA 2Q3MA 2V4ZA 2BE9A 2OZVA 3DVRX 1XZLA 3CY6A 3NYQA 4RV4A 2RHJA 4YP5A 4DLNA 3V1KA 2VBFA 4LVNA 3U3ZA 3GLGA 4RXUA 3IV7A 4LWQA 2UU9B 5KSZA 1V0JA 4Z4GA 1PL0A 1EHCA 4RQAA 2HA0A 1ECBA 1PEDA 1UKYA 2CLLB 1JEJA 3HK2A 4YAWA 5ICGA 4GX2A 1NN3A 2QTBA 5E6RA 2C31A 4TVBA 1LPPA 3TNYA 1R18A 4MS4A 4BE4A 2I99A 2QX6A 3JW8A 3ZKWB 1JG6A 1Z08A 2OBLA 2PKWA 1CPYA 2WE7A 3GMIA 3KKKA 4X8LA 2FEPA 5CT5A 3R1IA 4QNRA 5CB0A 4WK2B 5HIMA 2I62A 1LI7A 2JIQA 3NWJA 5DDIP 1P1KA 2WQZA 3IMGA 4Y8VA 4ZQBA 5C3UA 4A3SA 3EQ7A 2WTUA 1YR3A 1QYRA 3HBAA 1ATIA 1BHQ1 3L7YA 3GEBA 4QHYA 3B1ZA 1PL8A 4ZPJA 2PGDA 2VNIA 4JY7A 4REQB 2O7QA 2F4NA 2J3IA 5AVKA 2ZSDA 1ISFA 1EFAA 1HQYE 4WMLA 1Y3HA 3VPFA 2Z6VA 2XTJA 5G41A 4HQOA 1XR3A 4E09A 3JR3A 1G6KA 4QJ4A 3EPLA 3ED5A 1VB5A 3PNOA 1IB0A 1R4MA 1W0KA 4ND5A 2PLFA 4RL6A 2VEDA 2JLVA 2R1ZA 1N7GA 3VFDA 3KCQA 2G0NA 1JJIA 2IIQA 4LZWA 4FD3A 4Y0AA 3ZKAA 3R5HA 3RUAA 3TLJA 4NX2A 2WE8A 1FSPA 5B6JA 3TAHA 2JBWA 2RMKA 2XE7A 1M10A 1IOZA 3UJ8A 5AVRA 1IXYA 3U9LA 1GUFA 2ZIUB 3I2YX 2PNJA 1H2AS 5AM0A 5D3MA 3ZWPA 1RYZA 2R6FA 3IAM6 3O4FA 4CIDA 2CFRA 1EX1A 4CQMD 4JYZA 3JRXA 1ZISA 1JHPA 2QROA 4BFYA 5IJ9B 3OZCA 4MCIA 2Z0MA 2GFQA 3RIMA 1P3DA 2PJDA 5KTMA 1LX7A 1U8FO 2J3EA 1I33A 1HI9A 1QONA 2PGNA 3FDZB 4NZYA 4PQFA 5LN1A 3T52A 4P0PB 4X1KB 4QAQA 2CMHA 1UAYA 4GM0A 4AJJA 1NXSA 3IHLA 3IP9A 1OFTA 1S3IA 5KB3A 2E6UX 1W5BA 4MJ3A 2ZQ5A 1OGIA 3RREA 3OAAA 3F90A 1W94A 3WWCA 4ABTA 1MRNA 1D1SA 4I8XA 2XA2A 3JQGB 1P1RA 4Y7DA 3C8UA 3A6DA 3PHCA 1XD2B 1GUBA 1G7CA 2I22A 4ZJUA 1R5NA 1QORA 1WHSA 2C84A 4EP1A 1DEXA 2A5YB 5K2OA 4O4JA 4EO7A 3A2KA 1S2MA 3GJ7A 1MEEA 1XNJA 3JD0A 4LOIA 4QDUA 5KOHB 5IANA 4NV1A 3KSBC 1OAKA 1X87A 3BXEA 3GLFE 3TXXA 1DXHA 1DJQA 3A6PC 3OZAA 1H2BA 1IHPA 4QTYA 1D4AA 1CUZA 1F9EA 3U5TA 4O2AA 1MCZA 1U80A 1ZJJA 4RDXA 3M4JA 4UHHA 5MN6A 3HG7A 5J4YA 1M72A 3DL7A 2VHUA 4WADA 1UBHS 5LNK1 4UTZA 3PUWA 5G02A 2CT8A 4O3MA 1N7JA 4NBSA 2AQKA 5A4FS 4LDRA 3X1DA 3GL9A 2YXEA 3OCUA 2BOVA 3ID6C 4B3FX 1K0FA 3AUYA 2EQBA 4B47A 2HMYB 2AFIA 3IEKA 1G8MA 1ZYUA 2NYAA 2RGNC 2ZAOA 1KZ6A 3I2GA 3OU6A 1KEEA 4BNMA 1JI0A 2PZ8A 5HIKA 3OE5A 5F7JA 3JAWA 2AMVA 3N87A 3FWNA 4HDRB 4HY3A 3VGPA 1E79D 4LSWA 2EIHA 2XVAA 1KK2A 5DLQC 5G3YA 1R27A 2QN2A 3E48A 5D3QA 2BKXA 3HI6A 3KXIA 3FIUA 3OMXA 4G1BA 4LY3A 4WCDA 5GPBA 3GVHA 4AJ1A 1PIWA 3AOEA 1BKDR 1M2OB 1XJ0A 4ALJA 3UXMA 4G0WA 5DASA 1AT1A 2YYZA 1CEXA 2XGSA 3WHKA 2I3AA 2QE7A 3DAHA 1IOVA 4RVHA 5GM1A 3VYTB 4LRTB 1I1OA 3L1VA 1NYLA 5CVCA 5F3RA 4RGVA 5SV2A 2BRUA 4Y2QA 1I3OA 2OD7A 2BAGA 5F73A 3QBTA 3I9V6 4JA2A 5K1ZA 2ZZKA 5SZHB 1LQ2A 4RGQA 4XYLA 3BICA 4N76A 4DNOA 4JUIA 3TGWA 1LPBB 2CB9A 3WQRA 4C6HA 1GU0A 1SAYA 3LLCA 3JQAD 3AF6A 1GL3A 3LG2A 1VG0B 2X15A 2WWFA 4L74A 1P39A 1Z45A 3OTWA 4GEGA 4C9BA 3BUSA 3DOOA 1NSFA 3CH6A 4BGDA 2XZOA 4TRNA 1C3JA 3MGGA 1L4BA 4BFVA 5JZ9A 1C4WA 2BI7A 3DVLA 2GPBA 1GXSB 3M6VA 5FNVA 1U2SA 2G76A 3WX0A 2A1TS 1FP4B 4JS0A 2Q5HA 3OI7A 2RC6A 1GA4A 1Z33A 5TQ0B 1DJMA 3IUNA 3HLKA 1KRHA 1BWRA 1E1DA 1KAEA 5A6VA 3IAHA 3J81k 2C59A 2O57A 3EWNA 2QE6A 5ERGB 2WICA 3T5MA 4XIIA 2JD0A 5LXTB 4S05A 2PS0A 3TDKA 4JI7B 5IM4F 4MV1A 3GEGA 1JYSA 4ZAZA 2OCAA 3HR8A 2BFBB 4KFCA 3SX4A 2BHLA 2CL0X 1M2VB 3A31A 4GI1A 4UD6A 1IHXA 4J0QA 3LPCA 5HQ3A 4D80A 5AHRA 3KBOA 5COBA 4R9NA 4Z0TA 4NC9A 3AEUA 1P4SA 5DTJA 1Q0ZA 2CGEA 3RVMA 4EGQA 3JV7A 4IBOA 4CM8A 3OUUA 5AJWA 4CFSA 2FEWB 3FRIA 3LY7A 2XLCA 4KQHA 3VTZA 1PO7A 1NY5A 1SZJG 3MF4A 2BI8A 1K0UA 1VLJA 4BB6A 1DI0A 4PC6A 4UARA 4KMMA 3GY0A 1D04A 1SVKA 1IY1A 4GMHA 4K26A 3VO8A 3FPEA 1P19A 2ZKLA 3GJQA 2AXEA 3FPSA 1X7ZB 4FD2A 5A0TA 1YA8A 2QSUA 5KNCA 2UVPA 3WJ7A 5BT8A 1PWYE 4E12A 2J6HA 4YQZA 2HEGA 3RVBA 4LNAA 3HCFA 4ASUA 2C7RA 2HSEA 2WWYA 2QD5A 2QPLA 5E8RA 3SXPA 4M0PA 2B20A 1AZTA 4QBHA 3DF9A 2EJCA 1BIFA 2YL2A 3OZBA 1ZUD1 1SC3A 3T5DA 1ZCJA 2QX4A 1Z2OX 3I6IA 1K8YB 3PHIA 4TKVB 1D1PA 1V8BA 2IY8A 3L4JA 1B73A 3L8FA 3ZU4A 3ZLUA 3RRBA 3N2GA 1SXPA 1PT7A 3RRMA 1Q0SA 5J4HA 1AB6A 2RGRA 1KKMA 1QGUA 1KA9H 1YKGA 1CVLA 2FDRA 2GHTA 3CUKA 3H11A 4IUDS 3VDQA 1NW6A 3W2GA 3A0RB 4IZOA 2WZDA 4OL0A 2ZRAA 1JHDA 3B1XA 1KFEB 3ROMA 1H6CA 1SKBA 3A7EA 2NUBA 1BRTA 2BSXA 3NIBA 2ZIXA 4PZDA 2NO4A 2OAP1 3UAZA 2XYPA 3LGXA 4TN1A 5E6RB 5EKTA 1WTCA 2W6PA 3NGMA 3PC6A 3LNCA 4FEGA 5JEDA 4MS4B 4B3MB 2QM3A 1A8QA 1EA7A 2XTNA 4G36A 1JEQA 3HP1A 5EJ6A 3VZQA 5JNSA 2WSSA 5FOWA 4D4JA 1PGQA 4KQKA 2GCPA 3PXUA 3LUDA 1VHLA 1FMJA 1MB3A 3MOSA 3NHPA 4MYTA 4TMZA 3WKEA 5LMCA 1GUAA 1K8QA 3RU9A 4V0KA 4ZODA 3GCZA 1OB5A 3LA6A 3VAYA 3ZDZB 4AKHA 1OZAA 1R9JA 5K7SA 4H18A 3ZDFA 3SYMA 1HZZC 3O73A 4LWZA 1KQPA 3IQHX 5H3CA 3DE0X 2BISA 5I51A 3G2JA 1UBTS 1BD4A 1URPA 1I5RA 5GAJA 1U02A 1SQ6A 2WY2D 2C7OA 1XKQA 4AJEA 3U4QA 2R2AA 1JLMA 5PGMA 3FNIA 4FYHA 1LRJA 1J39A 3H5TA 5K6TA 5BWMA 3QHAA 3DV9A 4AY4A 3I9LA 1R4MB 4NS4A 3QE4A 3C48A 3ELWA 4X8MA 3UJNA 4OY3A 2XEXA 2ZUWA 3CEMA 4J6FA 1JHZA 4JNCA 4NLLA 1V4BA 3HCEA 2A1UA 4KU4A 5JZVA 3WQBA 1HE1C 5H81A 3ICVA 3C6ZA 1XWIA 3H2ZA 2BBTA 4UVEA 3FYCA 5MN5A 3V4OA 4YJ2A 1V9SA 1WQ1R 2JEYA 3IT3A 4J1TC 4CF3A 3T1NA 3Q7RA 5D3MB 4H1TA 4Q1EA 4JA0A 1YQTA 1N8NA 2VSOA 3JZIA 1E1RD 2VDNB 4CCSA 3KU4A 3L4KA 2JARA <