3WYGA

Crystal structure of xpo1p-pki-gsp1p-gtp complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
VPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae awri796
molecule tags Gtp-binding protein/gtp-binding protein inhibitor
molecule keywords Gsp1p
total genus 51
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3wygA00
2P3SA 1Z28A 2QORA 3OESA 3PEYA 1ZD9A 4TYWA 3LRPA 1E2MA 4B2IA 4O2LA 5FBQB 3KKQA 4W5JA 1SVMA 2DFKB 4IOLA 2YHSA 3M6AA 3CX6A 4Q9LA 4E22A 1GRNA 2QENA 2VP6A 3ADBA 1R4AA 2DPXA 5ELXA 3KQLA 3L0OA 3BK7A 1VHLA 1Z2CA 3ND9A 4U00A 1JJVA 1Z6GA 1ELOA 4Q1FA 1X6VA 4MDEA 4TLDA 5F2EA 5G3YA 2G1KA 4RD0A 5JHHB 3U3KA 3QG1A 1NRJB 4G1UC 1II8B 3LWNA 1CBUA 2FFQA 3IO3A 3WBJA 2H7VA 4ZIRA 2LWIA 1XEWY 2AXNA 3BC1A 1UKYA 2OM2A 2GESA 1FP6A 4JLJA 4QGAA 4B3DA 3THWA 1W7AA 1TAGA 4QRHA 4PX9A 2WJYA 1D2EA 4M9QA 1P2SA 2A5GA 2VTKA 1FNMA 2YZ2A 2VPPA 4OI4A 4CGZA 4X8LA 2WJHA 1EG7A 1NVWQ 2HJVA 2X1VA 3VU9A 1GIAA 4LJYA 4ZIRB 3I5YA 2WHXA 1ZRHA 3X1YA 1G3UA 1Z0FA 1FX0A 4DC9A 2HXYA 1Q1BA 4TMZA 4LBVA 4Q19A 1A4RA 4M1MA 5AK0A 4F38A 2LKDA 2RMKA 4MGIR 4AD8A 4X8MA 2H5EA 4A0RA 4OK3A 2KBEA 1DARA 1FX0B 4YONB 4DKXA 4KODA 3O8DA 3LXXA 3AP1A 1NG9A 5KTYA 2J0UA 2F43B 2FX3A 4CT4B 3U4QB 4L16A 2IUTA 2XJ4A 2WJVA 3KXIA 5JI3E 3SI7A 5LD2B 2SHKA 1XU4A 2XTMA 3EWAA 4TQUS 2C98A 4LPKA 2CJWA 4NU0A 4DCTA 2ZIAA 5JWOA 4QHTA 3T06B 4M9ZA 4HI0E 1T6NA 2ZS7A 1GDDA 4Q01A 1GNRA 4YMSA 3BD9A 3Q8XB 4JL8A 3CRMA 2QT0A 3IQWA 4KFUA 2GETA 5EE0A 1W36D 4JSYA 2GCPA 1P6XA 3DZ8A 3QG5A 1JALA 5CDFA 3AF1A 4JZKA 2NZJA 4BLOA 3AVYA 4LWZA 5TV2A 1E32A 2ZANA 2HT6A 1X86B 2VYFA 3VR4A 3RRYA 1JQJC 3OE7D 4XOIA 3FFBA 1M6NA 3T1VA 2KBFA 5DN6A 4PHHA 1TF5A 3OEEA 3U3JA 1QZXA 1VG9B 2W0MA 3GJ0A 3QNUA 5H68A 2Z43A 4S2EA 3C4JA 4H1UA 4ZI3A 1COWD 1SXJE 1XB2A 4N0DA 1ZAKA 2C9OA 4NYIQ 4Q4HA 2VSXA 3THXB 3ZLJA 2WWXA 3W5IA 2BCJQ 4B3BA 3WHKA 1SVWA 1LY1A 3PFIA 2EWWA 1NSFA 4OHYA 1M1YE 4Z8XA 1TTTA 1R0YA 3GMTA 1TEXA 3CUEF 3K09A 3A4MA 1JECA 3NVAA 4YQFA 3OF5A 1E0AA 2JDID 5FI1B 2FSIA 3B1WA 1J8YF 2FGJA 4M1KA 4LV6A 4TTQA 4JYCA 5FTMA 3ZZTA 4IDOA 5L3SB 1DE0A 1ZNZA 1OFTA 2WTUA 1N3BA 2WWGA 4JBWA 3ADDA 4NYMQ 4PQYA 1D6JA 2QNRA 2XJ9A 1KDTA 3CRRA 2X77A 2IWRA 1MO4A 1Q1ZA 4IFBA 3DMNA 4CEJA 2OSBA 1P61B 3QF7A 4B33A 5C4MA 3GLFB 4HUTA 2ZRCA 4JIMA 3Q7PA 5JJIA 3OEED 3RAPR 1Z0JA 3B1VA 5HCNA 3PUZA 1JPNA 2FFBA 4HAUA 3MSXA 4LYHA 1W4AA 2MSEB 1G1MA 2A5YB 5CJPA 1DAKA 2O0KA 1QBKC 1DAIA 2CL7X 2QMEA 2VP9A 4OQMA 4B47A 3O47A 2D74A 3TK1A 4D80A 4BFYA 4OQLA 1R0WA 5TMPA 1NF3A 2EU8A 4R7ZA 3LVRE 3DMDA 5K8TA 2QEQA 3A1UA 2ZUCA 2GA8A 3KUDA 1H8EA 4DRZA 1DVRA 1WDTA 3A4LA 2FFHA 4C0HA 2CNWD 2ZS9A 1E9EA 2GAOA 4C3ZA 5TDHA 4B71A 1NNEA 2OCPA 2BEKA 1R6BX 5FUYA 3AP2A 3CX8A 3Q9LA 1HA3A 4C0AC 1E2QA 1IM2A 3THWB 1LFDB 3CZQA 1OB2A 1S0UA 2CVHA 2FGKA 4JLAA 3MLEA 5D3MB 2CNWA 2IBMA 1GL6A 1QHNA 4TLEA 1C1YA 3A1TA 2GHIA 1Q12A 3KUCA 1JAHA 3FWYA 2XXAB 4CDGA 4QXAA 3SYLA 3TJZA 1DG1G 5FPTA 5J4VA 1BMFA 1K5DA 3QKSB 3TW8B 2CE2X 4HZIA 4I99A 3IGFA 3SQWA 4BZQA 2HYIC 2ERYA 1E2KA 4W7SA 5EQTA 4BEJA 2OBNA 5FOXA 4N0EA 3IILA 2E87A 4URYR 2QG6A 2QRZA 4WIAA 4EFLA 1OXTA 2OT3B 2ODBA 2V7QD 2GJ9A 3NIBA 5EXPA 1CR2A 4A15A 4FWTA 3THYA 2Q9BA 1GKIA 2VHTA 1AGRA 3KQNA 1RPZA 1M8PA 3AF3A 5KSPA 1X8LA 3T61A 2F1JA 4DDVA 4CEIB 2O8DA 4OJKA 2CE7A 3DKPA 4FINA 5J4KA 5B57C 4WVFA 3PUWA 4Q9KA 5HCIA 1SVOA 4OK6A 4JL5A 3TRFA 3B82A 5CM8B 721PA 1T3HA 3LLMA 1T3LA 4MUAA 2EFDB 4D6PA 4DCUA 1R5NA 3IHWA 1KO4A 2QPOA 4BFVA 4M1WA 5TXGA 2O5VA 4RCZA 4XVQA 2OFWA 1UEJA 3VNVA 1FL9A 2DHRA 2WM9B 2J5XA 5K8UA 4BZXA 1V43A 3A4NA 1CJVC 1T0HB 4P4TA 3K1JA 2BMJA 2OCAA 1K8RA 1T3SA 3IIKA 4R2IA 3VQTA 4PC2A 2DR3A 3RABA 3SN6A 2FEMA 4Q4JB 3B9QA 4C2TA 2VQSA 3RNLA 1PLLA 2F3TA 4HB2A 3RANA 3H84A 2Y8EA 4JVSB 4OQXA 2ZRPA 4C2UA 1Z06A 3NBZC 2FV8A 4DHEA 3M4YA 3LY5A 4ZCMA 1BOFA 1IJFA 3OAAD 5TB5A 3P20A 4Q4JA 3U7FB 3ADKA 1E4VA 4Q4LA 4YMVA 1Q57A 3KL4A 5KU1A 2FDCA 5AUOB 2YJTD 3K0AA 3RWOA 2OLJA 4US0R 1G7TA 1UEIA 1H65A 2BBWA 2BKUA 2C9CA 3ASYA 3AVQA 5HZHA 2JDIA 3FKQA 2OFOA 2W00A 4BQSA 4BRWA 3HWSA 4ZDKA 2IUUA 4C0BA 5B58C 1R8QA 1YZNA 5FOTA 1G20E 1YR8A 2E1RA 1I2DA 4I1UA 2J0UB 3OFNA 3U4QA 3QI2A 2CDNA 3P32A 3QEOA 4ZV4A 1RC8A 2PX0A 4LYFA 3F0TA 2Q3MA 3U60B 4UNSA 1FQJA 2QZ4A 2YVUA 3LX8A 3QF4B 3KKNA 2ORIA 1Y63A 1KK0A 1CU1A 2D2EA 5LBIA 1XMJA 4OQFA 5F9HA 1P73A 3KFVA 3LO5A 2ZSFA 4TMKA 4ZO4A 1ZD8A 3CRW1 1P5ZB 3P4XA 1FMJA 3AVWA 3T5GA 1Z07A 2P6RA 4LV8B 4FWIB 1UKZA 4Z8YA 2KI5A 5IHPA 4EJSC 3I8XA 4PSKA 5HR5A 2Q3HA 4Q1DA 4XTRA 1G3MA 3BORA 3KXLA 3D31A 2P67A 2F43A 4IDQA 4PFSA 2ZITA 4TL7A 5FOWA 4KLNA 1AK2A 2YKGA 4FCTA 3X1WA 2XITA 2NOAA 2QTFA 3R7WA 1EFCA 4NYMR 4PPFA 4PHTA 4Z54A 3WYGA 2WAXA 1GAJA 5KPJA 1QHIA 3CR8A 4B6FA 1FTNA 1XDBA 1EGAA 1XD9A 4GMDA 1QVRA 3T5DA 4AG5A 2OE2A 4TN1A 5EE5B 1AZSC 3MWJA 3GEIA 4JVMA 1W4BA 4V03A 2JIZA 4MKIA 1FP7A 2ZRGA 2R6FA 1ZCAA 1ZM3A 3TSOA 1GM5A 3NKVA 1N5LA 2D3WA 2ZUDA 4OHVA 4JJZA 5F3WB 1QHGA 3MWKA 4PO8A 2ZSAA 1OH6A 4NCJA 1R5BA 1XD2B 5FPHA 1KK2A 5FPKA 2GJKA 3VHXA 1G7RA 2IYLD 3CWZA 3TQCA 1MO5A 2NO7A 1J70A 3C7KA 4H1VA 4PPGA 1KOFA 4Q18A 1E99A 5EZ5A 1M7GA 5GADl 1HV8A 4JYBA 1IN5A 2DYKA 2RGNA 3QXCA 1W2HA 2PEYA 1ZC3A 4Y0VA 2O8BB 1OKKA 4A9AA 3VR5A 4Q03A 1SGWA 5AUNB 3GLIA 5EXTA 2Q3FA 4Q9IA 4IVPA 2BOVA 4QHYA 2NPIA 1RJ9A 1XTRA 1DAEA 1LF5A 1VG1A 1HY3A 4B48A 2XNDA 1Z29A 1KDOA 1P3JA 3EC1A 4PC1A 3W9YA 4MKFA 4R98A 4KXFB 3OE7A 4KVAA 2QPTA 1JJ7A 1VG0B 2CHVA 1VCOA 4HSEA 1KMHA 4QHSA 1G6OA 2REBA 3ZIAA 1Z83A 1E2DA 2CMKA 1FUKA 2ZI7A 2VHJA 3VR3A 1N6HA 3NEYA 3EPKA 1W4CA 5DH9A 1Q21A 3W3AA 1QHHA 4L4UA 1F2TB 2PL3A 1XZPA 1OYWA 2PMKA 5LB4A 4DZZA 4Q7LA 3KKMA 1KMQA 4NCHA 4U02A 5KOYA 5J40A 2QA5A 3IPYA 3KB2A 1XEWX 1D2NA 4QBFA 2ZR7A 3AQ4A 2VHUA 1VCNA 5C46F 4RVCA 5FTKA 1KJWA 2GAAA 2OILA 2OLKA 2RGDA 4RKEA 3TNFA 5L3SA 3AVUA 5KO2A 4EJSA 4TMXA 1Q44A 3B6EA 2HLDD 2RGCA 3V9PA 3C14C 1GVNB 3PVSA 2Q21A 1XEFA 2ZRKA 3IHLA 3QENA 1QVAA 3R7WB 1YRAA 1NBME 2FG5A 4WBSA 5ANRB 3L82B 1TNDA 4FCVA 3U7GA 3P26A 1Q22A 2R8RA 3S1AB 1SXJB 2J7KA 4P3YA 4TL8A 4A92A 1Q1EA 3I8SA 5DSZA 1XBTA 5CK5A 1YZKA 2C8VA 1OH8A 2KJQA 2HLDA 3D6TB 1G21E 2EVWX 4Q47A 4IDNA 1N6PA 2QGZA 4B44A 2W0SA 1YR9A 2IW3A 2R6CA 4HLUA 3AUXA 1BIFA 1XMIA 1WRBA 1IN8A 1NN0A 2QTVB 1JAIA 4G5RA 4HZUB 3UMSA 2EFHB 2ZRLA 3FHTA 3SDZA 4E5UA 5FBWB 3GJ7A 2ZSBA 2CLDX 4LY6A 2CVFA 3I61A 2PCJA 2CK3D 4ZDIA 5L8VA 3NTUA 3BERA 2GXQA 2J46A 1M7BA 1KSHA 1SXJD 4PSAA 1KO7A 2BKEA 2RCNA 1MO6A 3CF2A 2PZEA 1OHHA 3F3YA 4OK5A 1KIMA 2O0HA 3FHOA 4RCYA 3UWKA 1DOAA 2O8BA 1C4OA 4BLRA 4DUGA 3MD0A 4KYIB 3N2EA 2DWOA 1ZM2A 1E4YA 3U3RA 1PLKA 1AS2A 1MH1A 2ZRAA 2XNDD 2DFLA 1G6HA 3GLFE 2JLQA 1GTVA 2EW1A 3WY9A 1IN7A 1I4LD 2UZ3A 3DPUA 4BFSA 3I4LA 2J7PD 1VTKA 2O52A 3BWDD 3WMEA 1YZQA 2D2FA 3EX7C 4R71A 3IIMA 3EAQA 1KSGA 3WYAA 1YZLA 1KI7A 3EZ2A 2QT1A 4RSGA 5HTKA 2FJUA 2YOFA 1PLJA 1A7JA 3AKDA 4DB4A 2OCYC 5K8LA 1CEEA 1DAFA 1HEIA 3LD9A 4G5SA 4JLMA 4JLKA 5FR2A 1XJ0A 2ERXA 4AG6A 3K70C 5LDDC 2JLYA 4MUBA 3IIJA 2QPAA 1MO3A 1BYUA 3K0AB 2ODEA 4IOJA 2G3YA 3KJGA 2HEIA 4RZ3A 1U0LA 1KHTA 2ZJ2A 1XXHE 2QGNA 2XNSA 2V6IA 3BS4A 4EQ6B 5TVKA 5KSZA 3NEJA 1ZM9A 3EIHA 4JKYA 3D7MA 3DL0A 1OH5A 3BGWA 1PVOA 3RLFA 5IK2A 3ND8A 1F60A 2QAJA 4Q9JA 2P0EA 4DLUA 1T9HA 2W2XA 3KTAA 5HE9A 4QNRA 3K0SA 4WOPA 3T1TA 4YDSA 4Q4AB 1XPRA 1Z0IA 3BB4A 4PHFA 3LBHA 5DLQC 4G5OA 1A5TA 3BE4A 1YZTA 4IHQA 3SZRA 2W6JA 1E1RA 3DOEA 2WKRA 5B30A 2VLIA 1G8FA 2YOHA 5LPNA 2HCJB 3DHWC 4YLGA 3UMRA 2R44A 5FOVA 5AUPB 4LC0A 3GLIB 5LD2C 4D2IA 4A0FA 3ONWA 3AV0B 4OKSA 2VH5R 4LHZA 2QAGC 1RVDA 2V9PA 5KNDA 2UKDA 2ONKA 2RHMA 2G77B 2IA5A 2IYQA 2R6AA 3UXMA 4HUQA 1Z08A 1WBDA 1SZPA 1ZUIA 1H8ED 2IF0A 2VIIA 2D4HA 3OZXA 4D4KA 3HU3A 1LW7A 2OBMA 2BWJA 4YMUA 2Q6TA 2V7QA 4XD7D 2OUKA 1XD2A 1OLOA 2AFIE 3MJHA 2A3RA 3THYB 4DSUA 3JVVA 1W47A 2PZGA 1A2KC 2EFCB 4HYYA 1U81A 1CJMA 3EPHA 5FTLA 3EZ9A 3LA6A 5EP3A 1TU3A 2V54A 1S96A 3EW9A 4JL6A 1G8PA 3QPWA 1LS6A 4TYPA 4M0LA 5KDOA 5TY0A 3BIFA 2GEVA 5BN5A 4TTPA 2V1UA 5E95A 5H8WA 4NONA 4DLSA 3MG9A 4Q1BA 4IEIA 1E2LA 1TL7C 3GLGB 3LQRA 2RHDA 3EXAA 4ERNA 4NMMA 4ABYA 5EXXA 3REFA 4O0MA 3EZ7A 1QHYA 4LV5B 4GRAA 2H18A 1U2RA 5DYGA 2NPFA 1VHTA 5A0FA 2IHYA 5DHAA 3VHLB 4AK9A 2BJWA 5E7JA 1Q3HA 2GEUA 2ZU6A 4C0SA 1XCPA 3CM0A 3DM9B 1FPMA 4QJ3A 3ZS8A 1YHNA 1UBEA 4FCWA 4Q7KA 5JWRA 4DEYA 2UVQA 2JLSA 4IOKA 2EWVA 2I1VB 2G9NA 4AKIA 4LHWA 4XWKA 5JSZB 1VPLA 3UG7A 1XXHA 4DCVA 4B32A 1AIPA 2JAQA 3G5UA 2WJIA 2F1HA 2CL0X 1L2TA 1IOZA 2CCGA 3CZPA 4QKQA 1E2EA 2OO7A 1WCV1 4UNNA 4URVR 1GRQA 3N2IA 2JJ2A 3PENA 2WPDD 2I4IA 1J8MF 3QIAA 5K8IA 1A1VA 3MRSA 1ANKA 4MA4A 2IXGA 1G64A 1P9RA 3GJ4A 4ACAA 2J41A 2AD5A 3U6KA 4AY2A 1G8YA 1GL7A 1OXXK 1Z47A 1A2BA 3OEHD 4QNMA 2FFAA 5KNCA 5FR1A 1OT3A 1H8HD 1KO5A 3HYTA 2PLFA 3L0SA 1G9XA 4TYQA 3LLUA 1YU9A 3TGPA 5JJKA 1IXSB 2DFTA 4QG7A 4IVQA 5EP1A 1OV4A 4MRNA 3CKLA 2ODWA 1HH4A 4V0KA 3CNNA 2CLSA 4N3NA 2IEZA 4Q5IA 5FUXA 4OI0A 2PT5A 4C0QC 1PV4A 4DDWA 1MT0A 3CWQA 1N5JA 1N6OA 5JS8A 3EPLA 3MJRA 4HLQB 4DLWA 1WF3A 3ZDQA 2HF9A 1LB1B 5CYPA 1WXQA 2IYTA 4KFTA 4BLSA 5HPYB 1UJ2A 2DFNA 4IXMA 4US2R 1EWRA 2BDTA 2IK8A 3Q3JB 3B2EA 4II7A 2PCLA 3C5HA 4IDHA 5BW8A 5C1BA 1C9KA 4M9SA 4GPTA 1E1RD 4MH0R 3CX7A 3L0PA 2LCFA 5HE8A 2VP4A 5FTNA 1E0JA 4RD6A 1RW4A 4AURA 4FMCF 1LTQA 3O8CA 4AYWA 4ARZA 1E0KA 2QM7A 2ZTSA 1JB1A 2FH5B 3I73A 2F6RA 2QL6A 1N5IA 3L0IB 1DO2A 3WP0A 3WBKA 2JA1A 4DT1B 4QJ5A 2J59A 3CO5A 1S8FA 1F48A 1B23P 3IO5A 2OCBA 3O8BA 4O3MA 2AFHE 3SHFA 2GF0A 2AXPA 1N0WA 3GLGE 1P2VA 2GKSA 1Z6AA 2QM8A 4ITRC 4A1FA 2C78A 4XD7A 4GZLA 3U2QA 3N70A 4RD2A 1P75A 2A5FA 4UXHA 5JZVA 3GFOA 2G1JA 2WJGA 4EPWA 4W5HA 5AJZA 3ZJYA 2JLWA 4GMXA 1DPFA 2HF8A 2JLVA 1GNQA 4Q00A 1EFTA 1XJCA 1XPOA 2C9YA 5DO9A 4DSOA 4Q4AA 5HZKA 3R9XA 4JVNA 2VSFA 1F3OA 4A2QA 2GEDA 1HQCA 4C4PA 1YZGA 2WJJA 2ZRBA 2ZJOA 4GOJA 3WYFA 2OEPA 1KKMA 4CEIA 2FF7A 4HB0A 3H0KA 5CJ2A 1XF9A 5G40A 2VL7A 1SXJC 3QJYA 5E3HA 2IL1A 1SQ5A 2N42A 1XP8A 2CXXA 3T1QA 3KJHA 4KLZA 2HT1A 1P2UA 1G5TA 4Q9HA 3Q7QA 3E5HA 5GVRA 2AHOA 4ZKDA 3NBFA 2GZAA 3QBVA 3P1JA 3QKSA 1AGPA 3A58B 4YXWA 5JWHA 2KB0A 2ZYVX 3QEJA 4E07A 3NC1C 2Q0HA 4IRUB 3NBYC 4JBYA 4LJ4A 1XTSA 1ZYUA 4ZKEA 1NG1A 1JI0A 2O8EB 5HKKA 2XZPA 3ZVRA 1G3RA 1W48A 1W5SA 3I3SR 3T35A 3Q85A 4CW7A 1CRQA 2WPDA 3HP1A 3Q72A 2JJ8A 5FUWA 1E9BA 4NCKA 4I1OA 4GI7A 421PA 5SZHB 2ZJ5A 1ZNWA 1EFRA 1J90A 3PCRB 2YOGA 2YINC 1KGDA 2NIPA 5C18A 4B6EA 3BOSA 3G0HA 1KTVA 5JSZA 2QBYB 2B92A 4IFEA 2J0SA 3SJZA 2PT7A 2R62A 1GNPA 5JFGA 5JLJA 4PAMA 2ZSDA 2O8FA 3FHCB 1L7VC 3D3QA 2PBRA 5CIQA 5EP2A 4EPXA 2W83A 1KZGB 1L4UA 4CEJB 4FIDA 1ZCBA 4TMWA 1S3SA 1WQ1R 3RS5A 3TR5A 1F2TA 2MMCA 3CH5A 5E7MA 3SEAA 4FMDF 2QY9A 2ZUBA 4NH0A 2XX3A 3K0FA 5EE3A 3OAAA 2G0TA 1NBMD 2ZAOA 1AQYA 3TAHA 4M4SA 1GRRA 3GPLA 3QKTA 1DADA 2B7CA 1CRPA 2WWFA 3QKRA 2WKPA 2F1RA 1J7KA 1R0ZA 3CPHA 1PJRA 4BWYA 3VTKA 1NP6A 2REOA 4HAXA 2HCBA 3IKJA 5FH9A 1KSFX 3SHWA 4TMVA 5G3ZA 4A6PA 4HLDA 5SZKB 2AL7A 2JGNA 3AVOA 2YYZA 1PZNA 3KDSE 4C30A 3AKEA 3R8FA 3GLHE 1KKLA 3S1AA 3T15A 3U3MA 4M9XA 1TQ4A 4JLNA 2YWGA 4LDJA 2FZLA 3W8NA 2RGBA 2BBTA 1J2JA 3GP8A 3MMPA 2FSHA 4D81A 1Z22A 4M21A 1SKYB 4C7OA 4KO8A 4QGGA 1CULC 2XOKD 2PX3A 1CKEA 3EA0A 1X8KA 4XVUA 4F91B 2DCUA 2N46A 1E2GA 2JLUA 1ZMXA 2V4ZA 4LBZA 3SE0A 3NXSA 3C15C 3K0FB 4G3XA 3PIRA 4L9WA 2BM1A 1T8TA 2QU8A 5CB6A 4JLPA 1ODFA 4IJMA 1S9HA 4PR0A 4I81A 2IS1A 4POAA 3RS7A 4BE7B 1KNQA 3B13B 3DM5A 4LBYA 1W4RA 2VF7A 4TMTA 2V55B 2QAGA 3PQCA 2ZAMA 4B3GA 1XTKA 4GL2A 1RE0A 2F3RA 3EG5A 5KNBA 2VP2A 4G5GA 3U3OA 2ODNA 4FMBB 1II0A 1RRPA 5J47A 3JZMA 3VFDA 1WMSA 4BFUA 3BJIC 4I1SA 1MABA 2GJSA 4DSTA 1Q3TA 3GJ8A 3AF4A 1P62B 4Z1MD 4BLTA 2ZQ5A 4PZZA 1OF1A 2VF8A 5G53C 1VKJA 4K46A 1SULA 1JNYA 2XOKA 3I92A 2HDNB 4TYNA 4EJSB 4LBWA 4EDHA 2FNAA 5CLQA 3HJNA 5H1YA 3R9IA 3AF0A 3ASZA 1U94A 4RFSA 1VMAA 3VR1A 3ZH9B 4EFMA 3IEUA 1NN5A 4AYTA 2C95A 2V1XA 1KNXA 4Z51A 2P6NA 1HURA 5DI9A 4Q7MB 5JRJA 3PEWA 1LF0A 1N6RA 1US8A 1WE2A 2GCNA 3PUYA 2JJ1D 1SVSA 4B35A 1IXZA 3ZVLA 4URWR 2TMKA 3E70C 3B1YA 4UNQA 2F55A 5DN6D 1SXJA 3WNCA 1NJFA 2L0XA 4B34A 4EFNA 3KTAB 4EPRA 2Z4SA 1LS1A 2AKAB 1F2UA 5E7IA 3CIOA 2A2ZA 3EIEA 3TUJC 2P6UA 3FMIA 4RKFA 3FB4A 1LNZA 121PA 1XXHB 2G83A 1UDXA 4HAVA 3MUFA 3V00A 1D2MA 1DEKA 4MRPA 2ZYTX 2CL6X 4DBLC 5DYIA 2RKOA 3HR7A 4URUR 3ADCA 1PUIA 1JR3A 4CEHA 1ZM7A 1E94E 2IYUA 2OAQ1 2ZI3A 2WWWA 3LW7A 5JCZA 1OXUA 2C96A 2OAP1 3NHBA 3LNCA 3I1FA 3AVTA 4MRSA 3DOFA 5C4GB 4GT1A 1FQKA 2IYVA 4BFTA 5C2JB 5CIWA 1XPUA 1E96A 1U0JA 4QBHA 1BMFD 3CNOA 2J3EA 3RS4A 1JR3E 4ASUA 1QHHB 2ZS8A 3FFAA 3DO6A 4TWZA 3FPAA 3WP1B 1YR6A 2ZJYA 4JT2A 1RRCA 2R9VA 5FOSA 1UFQA 1GSIA 2RGEA 2J9RA 4PQFA 2R65A 1MOZA 1XNJA 1M7HA 2XSZA 5L3QA 4LC1A 1G4AE 1R10A 2REXB 4PQRA 4F92B 2O8EA 1P4SA 2W6JD 2NO0A 3WMFA 4LJ5A 1S9DA 4LJ8A 4ASUD 2C99A 2ZVQX 1I4DD 4LJ6A 5CITA 5JI2E 2R6GA 1ZD1A 3OIYA 3UMFA 4FXPA 5AWFC 2WOOA 2JLZA 3IBGA 1IN4A 4NDZA 2FPMA 2QROA 1L4YA 1CIPA 2Z0MA 3J81k 3A1SA 3BBPA 2BBOA 3TBKA 3GJ3A 1TUIA 1OXVA 2AKYA 3VR6A 2FZ4A 1R0XA 1SVLA 4MGYR 3R9WA 3SQXA 3FVQA 1OXSC 2RGXA 1TF2A 2CEAA 1KMHB 1P2TA 5JEDA 2GXAA 4F4JA 3QXXA 2JJ1A 5BYJA 5KDLA 2DBYA 4ARZB 2P5SA 4GNKA 4M1SA 2IS2A 4BASA 2QN6A 2QUZA 2YWEA 3VMFA 1TPZA 2FOLA 2BIFA 3E1SA 5A5GA 1OIVA 3QXHA 4MKGA 1KI3A 3HR8A 1T4GA 2EYQA 1E9RA 1TUEA 3GEHA 3U44A 3U61B 4Q21A 3W5JA 2WZQA 2ZSEA 4GOKA 4AI6A 2ZRNA 3AVPA 4JKIA 2ATVA 1OPXA 1Y3AA 3SJCA 1TADA 1GL9B 4CVNA 1WB9A 2DB3A 1BS1A 1Z0AA 4R2HA 5DISB 4DLVA 2ZRMA 3OFND 1KZ7B 3SFZA 1U99A 2PH1A 4ON9A 3NG1A 4PPQA 1G7CA 2ZI5A 4KI0A 1G41A 1W0JA 2R2AA 4QM7A 4N1AA 4NHOA 3PJRA 1DG3A 1U90A 3CPJB 4JSTA 1RRGA 5J4HA 4A0GA 3O8RA 2FE4A 4XH9B 1UBFA 1RYFA 5FI0B 1TX4B 1OB5A 1NN1A 1RZ3A 4R9UC 5CM9C 1EX7A 4BEBA 1XTIA 3AF2A 2H8KA 3B60A 4M1TA 4TZ0A 2VEDA 1GWNA 4B73A 1KY2A 3B7GA 2GJAA 3CH4B 3K9HA 3ZVMA 3LV8A 3PXGA 2DY1A 1NLZA 1P9WA 2FN4A 3W6PA 2X19A 1N0UA 3A36A 3AKCA 4FMDB 3TR0A 5KSYA 2O8DB 3QXSA 2ZYWX 3HU2A 2ZRHA 2FA9A 2JEOA 3UATA 2ZU0C 2RGNC 1HE1C 4LYAA 5D3MA 4AYXA 1QHXA 4OL0A 1MKYA 2H1LA 1VIAA 1Z3IX 2B7BA 1IN6A 3VU9B 3U44B 4D0LB 2ZRDA 2ZE6A 3CNLA 4EUNA 1P9NA 1COWA 2EFGA 2ZJBA 4Q1CA 2IS6A 4F93B 1G291 2BCGY 2QSYA 3TE6A 1SHKA 2A5DA 3H4MA 5DI3B 3BB1A 5AJWA 4DUGD 3FOZA 1AKYA 3I62A 4OBEA 4MDFA 4BZPA 3X2SA 4E03A 2W58A 1IY2A 3M1IA 4M2LA 4LYJA 4A6XA 1BYIA 2QBYA 3H86A 1GFIA 3DEFA 4PZLA 4IKEA 2J0VA 3AKYA 2J7PA 3ZS9A 1UADA 4B76A 3IPXA 2CBZA 4ZCIA 3LFUA 4MYHA 1S3GA 2HJGA 3E2IA 3MGCA 3C5CA 3KKOA 4ESHA 4LJAA 1KI8A 1G19A 1G18A 4ZI2A 3ZZUA 2F9MA 1M34E 5AUQA 2GDJA 1SVKA 2AK3A 3QSYA 4EKDA 4RD1A 2WMOB 5JECA 4ZDWA 4B3CA 1T5LA 3W90A 2CLCX 1CTQA 4WZ6A 3PEUA 1UKVY 1N6KA 1XCGB 2V8OA 2VP0A 3C8UA 5FL3A 1UKEA 1ZP6A 4MKHA 4NYIR 3W3ZB 4B3FX 4RD3A 1W0JD 1W46A 3A1WA 1Q20A 1K5GA 3CF6R 4L8GA 4D0GA 4TT3D 4V0NA 1KDPA 2VHQA 4W5WA 4AKHA 2X8AA 3ICEA 1IY1A 4A82A 2WWIA 1OJLA 1DO0A 2LKCA 4AWXA 2O0JA 3EARA 5CDFE 1E9DA 4HDQB 1E0SA 4V0ME 4J0QA 4IW3B 221PA 4OHZA 2YV5A 1RFLA 1KDRA 3G82C 1TQ6A 2ZR9A 3LW8A 2QAGB 4HAZA 4BECA 2B8TA 1Q1QA 1E79D 1SKYE 4LSGA 2NO6A 4DXAA 2W6IA 1ZNXA 2NGRA 4OYHA 4OI2A 3HU1A 4NCNA 4K81B 3U7EB 1NLFA 4KBFA 5KHOC 2QE7A 5KYKA 4HUQB 4KAXA 2B8WA 4HZUA 1G5PA 5FPYA 1UBCA 1X1RA 1N5KA 1JEDA 1N25A 3V4FA 3HPQA 3L8ZA 3I5XA 4CRWB 4BGDA 4I1VA 1TQ2A 3RSLA 2JATA 1E2IA 4NP6A 5EJEA 1OH7A 3AH8A 1OIWA 3GJ6A 1A82A 1YE8A 2J45A 1Z6YA 3ZZ0A 3KQKA 2CJWB 2QI9C 2WWYA 2WBLC 2E9SA 4YMWA 2QMUA 4QGHA 3TMKA 3IBYA 5KPDA 4GFDA 1Z5ZA 2ANCA 4OQNA 2B21A 1W44A 4MYUA 5EE9A 3REGA 4US1R 2X2FA 1N6NA 4ACBA 3HPRA 2IWHA 2QP9X 1EFRD 1ZC4A 4O25A 3RRZA 4PTLA 4TL9A 1D8TA 1KJZA 1VYUA 3TAUA 2AK2A 1GKYA 3BFXA 1T91A 3T12A 3VAAA 4JLBA 2IYSA 2WICA 3ZGXA 1MR3F 3U7HB 3FGNA 3DVLA 5BQ5A 2YC4C 3TLXA 3PG5A 4A8JA 1KYIA 4M1YA 4OJQA 2RH5A 4DVGA 4P4UA 4UXJA 4BPBA 3RRMA 4XWOA 2PJRA 2GBLA 2ZREA 2GVDC 2FU5C 3DZDA 1U8ZA 1EK0A 2K5UA 1DS6A 3F8TA 1QG2A 2OXCA 2WMNB 4WXPA 1NBMA 1W1WA 3LQQA 3AEZA 3B5JA 1HQYE 2BJVA 4B2PA 2WOJA 3IDQA 1QG4A 3BAFA 4HEJA 3RWMB 3SFVA 2FSGA 4DT1A 1MRNA 3K8YA 1E2NA 2J0QA 1NI3A 3M0EA 1CF4A 4C0JA 2JLXA 4Q1AA 1CXZA 2EYUA 1EESA 2C77A 4RZXA 1MV5A 4WA7A 5JBQA 1J99A 1IY0A 3IUYA 2FPKA 2G88A 2QTHA 2XTNA 4KHZA 3THXA 4GBMA 1KJYA 4BUJA 3GD7A 4PAOA 3IQXA 2AWOA 4A8JB 4OHXA 1R2QA 2ZI9A 5FL7D 3V4RA 3CONA 4HLCA 3RHFA 1II9A 2WSSD 3PUVA 3TQFA 2FEOA 1TEVA 3BRWD 3W6NA 4HB3A 4OI1A 1W0KD 3X1XA 4RFSB 2V3CC 2HXSA 4GDFA 4QC2A 2IS4A 1E9AA 4CZ2A 2CK3A 4D4LA 1XTJA 3ZQJA 4HLUC 3RRNA 1ZVQA 4LK2A 1GITA 4Q02A 1HE8B 1Z8FA 3QF4A 4TL6A 2KWIA 2GK7A 3GEEA 2ZRJA 3AVVA 3EA5A 4M8NE 4E09A 4L9SA 5GJBA 1DTSA 4ZCLA 3GFPA 2J1LA 4KBGA 2XEXA 4PC6A 3B1XA 5JRZA 5JHGB 3FTQA 3ZD7A 2P2LA 4L5BA 1KAGA 2QQ0A 2ZVPX 1QHSA 4U5XA 3GLFA 1NY6A 3B85A 1CP2A 3OHMA 2NO1A 4DWJA 2GK6A 3ZYCA 1ZUNB 3WRYC 3H1TA 4KU4A 3F5FA 4M53A 3ECCA 3GJXC 3RC3A 3ZVNA 2QP4A 4DLTA 5GJWC 1WBBA 1AKEA 1GP2A 4F4IA 2OESA 2QE7D 1CJTC 5FPSA 4A36A 5BXQC 2IF2A 3MWLA 4V02A 1BKDR 1OYYA 3P27A 2IYRA 1T0JB 2JJ2D 1SHZA 4KSCA 4XIGS 2JIZD 2QP3A 2GTPA 1EFUA 2Q9CA 3QBTA 3BH0A 1F2UB 1KI9A 1OW3B 2YNMA 2F1IA 1W49A 1X8JA 4V0MA 4YXWD 3SYNA 2DWPA 1YVDA 2GVZC 4KITB 2ZJ8A 3UKDA 3FKSD 1KI2A 3GLIE 3UK6A 3H2YA 1JR3D 4G0NA 4MGZR 3WMGA 5JCPA 2GNOA 1PUJA 4IXNA 3CRVA 2ZJZA 2HV8A 4JJKA 2BMDA 3NDBB 3U6BA 3VNUA 3QUSA 4NBSA 3RC8A 1U98A 2O8CB 5D3QA 3NH9A 1QF9A 1FFHA 4P4SB 4NYJQ 4CF7A 1O3YA 2ANBA 2IXFA 4EPVA 3UWOA 3PUXA 2XSZD 3JZAA 3QVVA 1VYVA 1T8UA 2Z5FA 3T1OA 2V6JA 3UG6A 1JPJA 3EZ6A 2QRNA 1UBGA 4IVRA 4GP6A 4NE2A 3AUYA 4PHGA 3QKUA 1Z6TA 4C9BA 3KJEA 3EWSA 4QJ4A 3W8RA 3GLHA 4YC7A 1IXRC 4ZDJA 1V5WA 1XFAA 3SC3A 2CHQA 5FUVA 2VHCA 5AJVB 1L8QA 2ZE5A 5L3RA 5AR1A 4B43A 1P60A 3TSZA 1US8B 5UKDA 1VYTA 4PAQA 4XVRA 4ESVA 3FMFA 4EIWA 3BH6A 2O8FB 2C03A 3WHLA 2J87A 4D4JA 2FWRA 4S35A 2W2TA 1DELA 3BFKA 1IONA 3FMOB 3WNBA 4JBXA 2D7CA 1G7SA 4MYCA 4TZ6A 1YKSA 4RZ2A 1N0VC 3LH5A 3QVUA 3W6OA 1ZU5A 3UIEA 2ORVA 4JLDA 3NHAA 1KAOA 3FYHA 3K70B 4PPNA 1FZQA 1M2OB 1RRFA 1E6CA 1RKBA 3ICQB 1GG2A 5F9FA 1NLYA 3T34A 2R6DA 8OHMA 3RVBA 3VX4A 1S1CA 1E2HA 3K9NA 3TH5A 3LXRA 2IEYA 4LI0A 4D26A 5CB8A 4P0TA 4DLXA 2ZROA 1Q0UA 1WP9A 4JLOA 4TYYA 4P31A 1NVVR 1CS4C 3THOA 1GKUB 2YC2C 3QPVA 1Z6XA 1AS0A 1GILA 2PMDA 3B78A 3SYKA 3ZD6A 3TW4A 4AC9A 2IHBA 2XTZA 5CYOA 3X1DA 4IEEA 3GLGA 3ETLA 3TVDA 1CR4A 1UF9A 2PJZA 3WRXC 3DDCA 4KSBA 2NMVA 1P7CA 1FW6A 2GCOA 1DBSA 1UDWA 2H57A 1XZQA 4YMTA 3UANA 1AM4D 1G8GA 5EE1A 2QMHA 1M74A 5E4FA 3OIWA 4PSVA 4D25A 4LUCA 2IT1A 2CHGA 4D0NA 4DCNA 1HTWA 4X8OA 5EP4A 1N2CE 4BLQA 4A4DA 1KI1A 2F9LA 5HKKD 2WVJA 3AGPA 4QGFA 2OZEA 4FW9A 2JASA 2PEZA 3VKWA 2VO1A 3MFYA 5B2ZA 2VP5A 1KO8A 2KE5A 3B9PA 3A8TA 4Q48A 4FI3C 4BRUA 2CCKA 1CLUA 5GJVC 3PEVA 5BWMA 5TARA 2FMXA 4TLBA 2WAYA 1MABB 2OFXA 1EXMA 2Z83A 3GQBA 3LAWA 1G8HA 3CLVA 1G3IA 4Z1MA 4QM6A 1GOTA 1NMXA 4EAQA 4UNRA 3TIFA 4NPHA 1Z2AA 1FTSA 1BO6A 4JLVA 1XX6A 3TSWA 4LHYA 2XAUA 2GCOB 2P5TB 2BVNA 3AGQA 4WZAE 2MMGA 4DDTA 1E1QD 4WAUA 4C0KA 3A6PC 4TSFD 4XJXA 4B2LA 4PZYA 2H92A 4MGKR 2P65A 1UPTA 3QY0A 1O87A 1ZIOA 4JT4A 4CT5A 4EQ6A 6Q21A 4FN5A 2QQEA 5JEEA 4BFWA 2IXEA 3KKPA 4OHWA 4DJTA 3RS2A 4Q1EA 4D4MA 4QOSA 3EPJA 3I72A 2NO9A 3LBIA 1IBRA 3CF0A 3LDAA 4WW0A 5KSOA 4Q4HB 5FBLB 4MQBA 4TTRA 4QFMA 3KXKA 1Z63A 2H17A 2ORWA 1TQDA 1NY5A 2B6HA 4KV9A 4URZR 1VECA 4DIEA 3MCAA 3NDPA 1VDZA 4GOXA 2KSQA 3JVUA 2NTYC 2IYYA 5AJXA 5GJCA 1DAMA 2XB2A 3EZFA 1U9IC 1E9SA 1KI4A 1N6IA 2XB4A 4LCBA 4DCSA 2I1QA 5IK2D 3DKVA 4GP7A 4RZUA 3KQHA 1NKTA 3TUIC 1S1MA 3PITA 521PA 2VA8A 4NL4H 1IHUA 4TT3A 1LV7A 1R8SA 4XSHA 2C5LA 2C2HA 2ZI6A 5EZ6B 1NIPA 2HUPA 5IF9A 3SBDA 3SOPA 4AKGA 1TU4A 4TQ9A 5CLLA 4EPTA 3C16C 3Q5EA 1E69A 1AA9A 2WIAA 2MSDB 3K0EA 4KCGA 4QBIA 1IQPA 1XRJA 1ZIPA 5AJYA 2OBLA 3RSOA 5M04A 2PZFA 1RYHA 3SR0A 3GCGA 4DIDA 2WV9A 2GZDA 2IYXA 4UJ5A 1G3QA 3SJBA 3AB3A 4KYUA 4MRVA 4PC7A 2XGJA 3K09C 1TF7A 4X8HA 1UM8A 5FBRB 1FUUA 2PLRA 1II8A 1NN3A 3L8YA 4XSGA 1E2PA 5EUMA 2Q9AA 5CK4A 1KSJA 1KO1A 3QPUA 2GBLC 4TQAA 1WA5A 3D8BA 2GRJA 4JS0A 5G41A 3R8CA 4A8JC 4PC3A 1E1QA 2C04A 2DWQA 1HUQA 4HAWA 4IDPA 2QMOA 2ZE8A 2IYZA 1FOEB 4TSFA 4CIDA 1X1SA 4A0HA 5DNYB 1QRAA 3FMPB 2I3BA 5LB2A 2NG1A 4JVLA 1JXOA 1GUAA 1S4QA 5FTJA 1VCMA 3CW2A 1AN0A 3RYTC 3TVTA 1KY3A 1NKSA 1ESMA 5L3QB 4G5QA 3U5ZB 2ZYUX 1JBKA 2ZR0A 2BEJA 3QOFA 2A9KA 4LGMA 3EC2A 2O8CA 4LHXA 821PA 3SS8A 4B74A 1D5CA 3WXMA 3K9LA 2YWFA 2D62A 3EASA 5IDVA 4M1OA 1I4TD 1ONBA 1G4UR 3NBXX 3KJIA 3BFVA 4LZZA 1W36C 2JLRA 3QE0A 4TLCA 3VR2A 3SJAA 1NSTA 4LPSA 3AM1A 2JCSA 1OFHA 3KB1A 2AN9A 2IYWA 1ZBDA 4NTZA 3C41J 4NZYA 5B64A 1ZM4A 1XCMA 2GXUA 3ZQ6A 4NCIA 1NVXQ 4HAYA 5IT5A 3B8HA 2XZLA 4BLPA 2ZETA 1X3SA 3KZ1E 5EUQB 1NMYA 2WSMA 3W34A 2OXRA 1YZUA 5EXSA 1OKKD 1FNNA 3B1ZA 4IOMA 4Q66C 2BHRA 1G17A 4UKDA 4KJZA 2BM0A 4C7OB 3L2OB 4P32A 2OHFA 4RY2A 3P4YA 1T5IA 4KFSA 4UJ3A 3L43A 4BFZA 1E3MA 1W0KA 4LOAA 1SKQA 1AS3A 3QXJA 2H16A 4PO9A 2ZE7A 4DLYA 4V0LA 2OV2A 1P72A 1U0HC 5FL7A 3CBQA 4FMCB 3FKSA 1ZW6A 4LRWA 3LX5A 4YDHB 2GILA 1BH2A 1K6MA 4HDOB 4NKRA 5A4JA 2RGGA 5FBVB 5DGXA 2AD1A 4B75A 1ZINA 4LHVA 1YRBA 1IJEA 3QQ5A 5IRCD 2D7DA 1KI6B 2AWNA 3GFTA 3TUZC 3OEHA 5KUTA 3OIUA 2ZJAA 4KFRA 3CRQA 3IEVA 1OIXA 3PR1A 1YJ5A 1VG8A 2ZRIA 3KFXA 1Z0DA 1CR1A 4RJLA 5FFMA 2RGAA 4MYTA 4PO1A 3SU8A 3MAAC 1ZUHA 2A7QA 1SVIA 2FSFA 4RFVA 4ZPXA 3BB3A 2RAPA 3KQUA 5F98A 4C0LA 2EQBA 5DHFA 3ZIAD 1XTQA 3CPEA 2YWHA 1D9ZA 5DI3A 4A2PA 2A30A 1E2JA 1W5TA 5DE3A 5JMTA 1TMKA 4Q7JB 1OE0A 4H9GA 2NZ8A 4G01B 4V0OA 2ZEJA 2CCJA 4A2WA 2VSOA 2ZXUA 1GZSA 1E98A 1ZJ6A 3OIVA 3UPUA 4WXRA 3KX2A 1R7RA 2BC9A 1NJGA 4AKEA 3VKGA 1ESNA 1HT2E 5SZJA 2N1BA 4MITA 3K70D 4I4LA 2RB4A 2Z6VA 3RDPA 4B3XA 4Y0AA 4DDUA 3SNHA 4EPYA 1OFIA 2MSCB 1B0UA 1KK3A 4QL3A 3PV0A 3HYRA 3BXZA 4NYJR 2WKQA 4M22A 2GZHA 2W6ID 1XMVA 1HT1E 1E79A 2VBCA 3X1ZA 1NIJA 4UQOA 3R20A 2BV3A 1CR0A 1MRSA 2BMFA 1ETUA 2QSZA 4CEHB 4ILEA 4URXR 1XJQA 1YQTA 2A78A 2F7SA 1XD8A 2ASEA 1XEXB 4TLAA 3TKLA 3GLHB 4HATA 3A1VA 1OSNA 4UXIA 4XWAA 4CYMA 2G0NA 4AIIA 1D9XA 2ZI4A 4HDCA 1RIFA 1QDEA 1U8AA 4LX0A 4DLZA 2GF9A 1CJKC 5DIFA 3NC0C 1LVGA 1E9CA 2HYDA 4JMPA 2IX3A 2ZM5A 1OHHD 3I32A 1DAHA 3SBEA 4XTCS 1VIYA 1E9FA 1H8HA 1XEXA 2WIBA 4P4SA 5L3VA 3A37A 1Z0KA 4D82A 4PANA 1G5RA 4U7DA 1S2MA 3GJ5A 4GZMA 4RD4A 1NL3A 2D06A 5GVSA 1U9IA 1AQUA 3RS3A 1EX6A 1FMLA 1RJ9B 3VKHA 3K0CC 5J5CA 1ZNYA 3K53A 1CJUC 4DSNA 1KK1A 3CB4A 5JJLA 2GJ8A 1W36B 2A5JA 3EIQA 1AJEA 2NQ2C 1G16A 1N6LA 4MRRA 2XXAA 1JQLB 2ZRFA 5J4LA 3AVXA 4KVGA 4FD2A 2FPLA 3HDTA 3LBNA 3QKRB 3CR7A 4L15A 2EFEB 4O2RA 4P33A 4QBGB 5P21A 3FDIA 2ONJA 4F4CA 2GXSA 4UNPA 3NWJA 4LJ9A 4W9MC 1KI6A 2AR7A 2GWHA 2W2VA 3Q5DA 1VCIA 4HB4A 1EWQA 1NVVQ 3VX3A 5SZIA 2IUSA 4LJ7A 4DLRA 3K9GA 1F5NA 2IC5A 4PXAA 2X2EA 1U8YA 1HYQA 2BBSA 3BH7A 1JR6A 1JXMA 3WNDA 2BMEA 2G6BA 3AP3A 1ZU4A 1IAQA 3MWYW 1W2GA 1F6BA 2VRWA 1R5OA 1E2FA 2ZPTX 1NVUQ 3NH6A 3RS0A 4BFXA 2XZOA 4K8OA 1OFUX 5J4YA 1JEEA 1I2MA 3LVQE 5H70A 4DB2A 2AX4A 1EFHA 2WWHA 4WZBE 4F7WA 5BYKA 5BN4A 2ECKA 621PA 1UAAA 2ATXA 3K0CA 1NMZA 5JS7A 1XMSA 1YR7A 3N5CA 4DEXA 1XWIA 5FOUA 5KDDA 3FE2A 2WSSA 2UZIR 1DAGA 2Z4RA 2OG2A 5BN3A 1AZTA 4GSYA
chains in the Genus database with same CATH superfamily
3FNEA 1V7ZA 2QORA 1N7IA 1VKRA 4Y9TA 1XRMA 2VDRB 1M1NB 2JGFA 3LRPA 3OQBA 4BB6A 4CUZA 3DJFA 4TYWA 4O2LA 5DTEA 1RSZA 1UJCA 1S3FA 1SVMA 4BU1A 4P2BA 1L7NA 4WXMA 4Q3BA 3MBOA 5IBPA 5ELXA 2X22A 3A6JA 4WBNB 1RMQA 1U7PA 5DGTA 5HMLA 2Q46A 2O2ZA 1M5UA 2WHPA 3NWEA 4RS4A 4QUKA 2JGKA 2R5FA 2Q1TA 4Q1FA 1ELOA 4H2DA 1X6VA 3UH1A 4TLDA 4MUYA 3L7YA 5F2EA 4CM5A 1TZCA 5JHHB 4G1UC 1NRJB 1II8B 3CKKA 4IIJA 3O5AA 2DUNA 2J9FA 1FRZA 1AHNA 3IO3A 3MT0A 4ZIRA 5BR1A 3QWHA 2AXNA 3Q7RA 1FP6A 4QGAA 2QJOA 5F76A 4B3DA 4D6XA 4QRHA 2CDAA 3VI3B 4B6OA 4PX9A 1NONA 3QVJA 3VNRA 2J5QA 1D2EA 4Q24A 5A9RA 4CGZA 4LDAA 4FGZA 1NVWQ 4X61A 3JV7A 1XGKA 3MW8A 4HNQA 3VVBA 3IUBA 4X90A 3UB2A 4LJYA 3DJYA 2IE0A 1TW2A 1F1JA 1Y8RB 3L7OA 4ZC1A 3AO0B 3WKBA 2C2WA 3H05A 3R3JA 4TMZA 3AUAA 3W05A 4Q19A 4DJFC 4AP9A 1PJQA 2CF6A 2I8AA 3BILA 4YPFA 3HO1A 4J1QA 1JMYA 2VNAA 1DG9A 2JFNA 3OJOA 4A0RA 1AZWA 1WUHS 2H5EA 4KWTA 3RUPA 4FBLA 2X1MA 1MGOA 1OAKA 2EX1A 2VOJA 2YWCA 3E7FA 4KE8A 4RGBA 4EG6A 3VUEA 4DKXA 1KXJA 3O8DA 3LXXA 4Y2XA 3AP1A 5JSKA 3RF6A 2M6LA 1ORRA 3TL3A 5LP6A 1B42A 3OCCA 3R3UA 3H19A 4U8GA 4O1IA 2PS1A 1IQUA 2PVPA 1E1YA 1FDWA 3NWPA 3QEMA 3KR0A 4NU0A 2ZIAA 4I55F 4GLJA 2HWWA 5ICFA 5LNK6 5JWOA 4PG4A 4QHTA 3R5JA 5CFRA 1U1IA 1JS1X 3VPAA 1LZKA 1KVQA 1GDDA 1T6NA 1VMEA 4G97A 5GQSA 4F4FA 1D4AA 2C84A 1UIMA 3E23A 2BFOA 3GG2A 4BLWA 3CRMA 1EWKA 2QT0A 5E4JA 1W36D 1F5SA 4WZZA 1L7DA 3BD8A 1JDPA 4J7AA 4LWZA 4D9EA 2AHRA 3AVYA 3F3MA 1IK6A 1IHOA 4KW7A 3VR4A 1A50B 4HQNA 3ZCRA 3SCZA 4BXOB 2O3RA 3OE7D 1G20B 2HRZA 3WIDA 3T1VA 2KBFA 1V41E 5IABA 5K0CA 5JARA 4MW0A 5EJ2A 5DN6A 3VPBA 4HQOA 4BV2A 4Y6PA 3IL2A 1TF5A 3RHTA 1VG9B 4DAEA 3GJ0A 3HWX1 3R7FA 3DUFA 5H68A 4S2EA 1OZHA 3C4JA 5ILOA 3V8RA 4F3NA 4ZI3A 1COWD 1RM4A 4NYIQ 3U09A 3ZLJA 2C9OA 4Q4HA 2JAXA 2VSXA 2VJMB 3EXHA 5FHRA 3W5IA 3M6LA 2IQIA 1CE8A 2VWHA 1J0XO 2XVAA 2HXGA 3WHKA 3BHIA 5EC8A 1NSFA 2V98A 3E61A 4TKVB 5K01A 2WV7A 4TN5A 3AFHA 5BSRA 4AKTA 4U7FA 1UBOS 1K66A 2B0JA 1RHRA 3DB1A 3GMTA 4H3SA 3UT0A 3CUEF 1FYVA 1GADO 1YDGA 1PAUA 1RHMA 2J9YB 4EWLA 1ZKMA 4KX5A 4HFRA 5DHUA 4RPJA 5EFOA 1N2HA 1GN9A 1M83A 4HDNA 2FSIA 3B1WA 5FI1B 3O0DA 3MK31 4FOOA 4LV6A 5IAKA 4TTQA 3ZW7A 4JYCA 5BNTA 2WTUA 1BU5A 2PK3A 1DE0A 2P6OA 2HJWA 2XMCA 3KB6A 3QVWA 3UW3A 2BKXA 2OZLA 3WL4A 1D6JA 1CUAA 1E1KA 1KDTA 3E3OA 2X77A 4D9IA 1MO4A 4IFBA 3GRFA 2OSBA 3OKFA 3QF7A 2ZRCA 3O03A 4JIMA 3HXOA 4DV6B 3EGIA 3OEED 1Z0JA 1LVUA 3B1VA 3UHFA 4NCBA 3FLBA 4TMYA 4AX4A 1W87A 1JPNA 1NBHA 1XU7A 2FFBA 4HAUA 3SM3A 4L76A 3TW8A 1W4AA 3UAZA 1NW3A 1G1MA 2FR1A 4TTTS 2BTQB 1A9ZA 3MTQA 4HWGA 4DCCA 4IQ4A 2YHBA 2BTOA 2WMYA 2CV0A 1M2VA 2D1YA 4G86A 4B0PA 4U5QA 2NU9B 3DMYA 1EVEA 1HLFA 3I83A 3TZKA 2E7ZA 3TK1A 3GJRA 3TNLA 4D80A 2TRSB 1CERA 3ST7A 1NZFA 2WUFA 4R7ZA 3SWWA 2ATCA 1YA8A 2VCHA 1TGYA 2P7HA 3F6RA 5DNAA 4AL4A 2CUTA 4ER6A 1P3DA 4YV7A 3A1UA 2ZUCA 1F7UA 5JVDB 5ALZA 2GA8A 3R77A 1WDTA 5J63A 2CNWD 2C4HA 3FVTA 5L45A 5LZ9A 1PD0A 1SVUA 3AY3A 3FVRA 3CLSC 5TDHA 2JVIA 4IX9A 3RVKA 1SG0A 1ZHHA 3R7DA 3V42A 4B71A 4OP3A 1C9NA 5LJLA 5H9WA 3UAXA 3G3EA 1L5WA 4GLBA 3ZHZA 3WXBA 2FN9A 1R6BX 3OCYA 3CX8A 3HSYA 2XMZA 5KNDD 2W8BA 5CVEA 1HL7A 5BT9A 1IZZA 1E2QA 1H1DA 1RXUA 4C0AC 3GWGA 2FGKA 4GQAA 1Y4UA 4OXQA 4G4JA 3ZD8A 1K68A 1E2UA 1HZZC 2CNWA 5FA8A 2PGDA 3O2JA 4HLNA 2A35A 3IKMB 1VRCA 2Q8NA 5I4BA 4CDGA 2RGRA 4JI4B 5JASA 1MVNA 1ENPA 3JALB 3Q0TA 5M3BA 3ND6A 1DG1G 2QN9A 3RTAA 4YAKA 3TW8B 1MIHA 3QKSB 4B3SB 4PE5B 2R8OA 2ZW9A 2NZ2A 4JU8A 5GM2A 2GD0A 2RHOA 4BX9A 2ERYA 4L78A 3RTEA 4BEJA 4QAJA 1ZHOA 4KO2S 3K20A 1Z9BA 1C0EA 2QRZA 4EFLA 2J6HA 5EXPA 1J42A 1QANA 2ODBA 3NIBA 4F2HA 2VJBA 4A15A 4UAUA 3THYA 2Q9BA 3S2UA 2VHTA 1C4XA 4HVAA 2GN8A 1RPZA 3O7MA 3ZJTA 3T1YB 1XMOB 4JROA 1X8LA 3T61A 1QLWA 2GM4A 5IC6A 5HIMA 3IUPA 3ZWKA 3DDZX 4MEAA 4R1UA 2EF1A 3DKPA 3GRPA 3OKPA 5DPMA 5J4KA 1USGA 4F1KA 3HEMA 1TVKB 3LQ2A 4NEHB 4MLPA 1Y82A 2E2WA 3KUUA 3ROPA 3TM4A 3ZW8A 4HPJB 4MUAA 4WOBA 1PI3A 4LZAA 4D6PA 1R5NA 3U40A 1OYVA 2BPOA 4OEHA 3S4YA 5JISA 2N75A 3L41A 4M1WA 5FWYB 4ZARA 4RCZA 2C61A 4KQ9A 4MA0A 3UJPA 2J3JA 4MO9A 3NNNA 4AG3A 4J7CA 3V2HA 3K1JA 1UKCA 1T5DX 5CTAA 3NHRA 3RFXA 5HZGA 3WL7A 1MVLA 2D5AA 3NDIA 2MYUA 3SN6A 2V03A 3REOA 4AJOA 4NJMB 4P36A 5TGDA 2Q1WA 3LK6A 2BMAA 1PLLA 2F3TA 3MM4A 2XDWA 2EHJA 3H84A 3RANA 4KAAA 1PL7A 4J9VA 4WKNA 3ITEA 4OQXA 4G0OA 4JUAA 1R0CA 3M4YA 4JOQA 3H0CA 1PUXA 5CNKA 1NQWA 3P20A 2FPPA 3BT7A 2JA2A 1E4VA 3KT6A 1SUPA 2H2AA 2R1UA 1GPJA 2W37A 3IVAA 1L7PA 4NMLA 5AUOB 2UVPA 3DE1X 4LMRA 4XAQA 4I19A 1K7EB 1Z0ZA 2BKUA 2C9CA 2H2GA 2WR8A 3I6IA 4G36A 1SHTX 4LNUB 1CRLA 3FKQA 4X1OA 3UHOA 1SQSA 3O95A 4BQSA 2JRCA 2WVHA 3CW8X 1D2CA 3WL5A 3CUUA 3O3CA 4C2BA 1SJ9A 1YZNA 5B58C 1G20E 4K2HA 3C87A 2ZTLA 4IIGA 3WAJA 2JCYA 1BWSA 1K8ZB 2FVXA 3AG5A 3BTOA 3L18A 4H7FA 4WRRA 4YP5A 2CDNA 2Q62A 5JE8A 5TQJA 4Z99A 5FA5A 4ISCA 1RC8A 1I7DA 2CLOB 4XJSA 2PX0A 1KYYA 5ALRA 2H1SA 3CLKA 4EX6A 3JD3A 2Q3MA 1U0EA 2R84A 1FQJA 2D1RA 4J91A 4X5OA 3U60B 3L4BA 1Y63A 2DTDA 4JAVC 1KK0A 1IOVA 3GOQA 3DHEA 4MYSA 2QMQA 4HV4A 1RD4A 4KQCA 3P9NA 4EAAA 2B0CA 2VNJA 4GOND 1DRKA 1VGVA 4PRZA 3O92A 1FMJA 2VYND 3A2MA 5C7LO 2R00A 1Z07A 2ILVA 3MIIA 4FWIB 4YCBA 4I3HA 2YV3A 4ZALA 3L0ZA 1IBSA 1W5EA 1DC6A 2B37A 1XVUA 1FTGA 3V55A 1L4FA 4S12A 3B48A 3U3DA 2Q3HA 3NT4A 2I6GA 1G3MA 2I2BA 3GL9A 4LWPA 4WZBA 4TL7A 2ZITA 3M1LA 2PGIA 1PR3A 4MVWA 2GCGA 3ZXXA 2D2VA 1LDMA 2XTJA 1P3Y1 2XVMA 3A6HA 3HUFA 3BXEA 3I9V6 3KU1A 3X1WA 5KHLB 1RXWA 2QTFA 2FPGA 2OAGA 1YI0A 2HADA 3O9ZA 1NPDA 3OPXA 4B6FA 3C0KA 5HMMA 1XDBA 1QQAA 1GQSA 3ZCPA 7GPBA 1LI4A 3DS8A 3ZGNA 4HN4B 5A06A 3LCRA 3IR7A 3PD0A 2W8BB 1EZ1A 2OE2A 3OQOA 3B2NA 2Q3CA 3TE7A 4LXIA 1O57A 1WZNA 3R5XA 2ZRGA 4NU6A 4DR6B 1ZM3A 5KNBH 4DZRA 3SEQA 4JC0A 3VU8A 5IZCC 2C31A 2O8NA 3SGLA 4F5EA 2ZUDA 3N3BC 4RMJA 4XX0A 3D4OA 1P7YA 5BY2A 4OHVA 3KOYA 2Y0DA 1PJ8A 2QJFA 2RH4A 1A7KA 2FKAA 1U6JA 1PFGA 3MWKA 4GH5A 1ZK4A 4DNFA 2ZSAA 1NUUA 2J07A 4C87A 4NCJA 1H6AA 3E3LA 5F4BA 2AJ8A 3O4VA 1KK2A 5FPHA 4JU9A 5FPKA 1G7RA 4ZAFA 4BB0A 3PL1A 1MO5A 3I6QA 2Z1NA 2BLLA 5KQRA 3NV9A 5I9IA 2AVNA 1QLHA 4ESEA 5I6DA 1XZBA 1TAUA 1GV1A 3CVOA 1X0VA 4F85A 5LU8A 1IAVA 1MAUA 1A7AA 1QWSA 5GADl 1E99A 3GP3A 1M7GA 3M33A 3ABZA 5EZ5A 3IUNA 3SP1A 1NNLA 3HA2A 4JYBA 5AOCA 1NJSA 1IN5A 1HDYA 2P2ZA 1Q7CA 1UOPA 3AB7A 3WGJA 1OKKA 1NI4B 4MQ6A 4Q03A 1N32B 2O8BB 3RVPA 3ANYB 4IVPA 1J21A 1ULHA 1U0RA 1TEZA 4OLJA 3NOVA 4DIOA 5LN1A 1DAEA 4KMOA 1C9YA 1ZI8A 3K32A 3OUZA 1Z29A 2PFSA 4UBMA 3SF8B 3OTGA 2OZLB 3WGTA 3DE6X 4QWMA 1GUDA 1G2OA 2A57A 3NYWA 2PMFA 1AUPA 4OY3A 4KXFB 4NNJA 4R98A 1Z34A 2CXQA 5IZCA 2OWDA 4PLYA 4HDKA 1Y7LA 2AQKA 3BMCA 2BHNA 4GEGA 1WETA 2CHVA 5L95A 1AKQA 2R8XA 3DEIA 4PS1A 3OM9A 1G6OA 2YXEA 2W2NA 1JG1A 2GYVA 3ZIAA 4FEYA 1XYGA 1E2DA 1WD5A 1Z83A 2YY5A 4Y2UA 5JH7F 1IPEA 3BSSA 2P0AA 1YIAA 1VFPA 3QEKA 6ADHA 2HQ1A 2VHJA 3VR3A 3I0MA 1O0SA 3T5BA 1UMBA 1L5RA 3ZU6A 4F1WA 3P0RA 3H97A 3W3AA 3IBTA 1H2HA 1GNVA 4JB0A 1F2TB 4DARA 5MN5A 1M6HA 3B8EA 2ID4A 2PMKA 3B6JA 4DZZA 1DTEA 4II3A 3KELA 2QA5A 1E61A 2DLDA 4UM9B 4ZU6X 1XEWX 3JQ9C 2P9HA 3N6RA 1VE6A 2NTJA 2FSSA 2OD2A 1MVOA 1O03A 3AQ4A 1FJGB 1XK7A 1LDBA 4DN6A 1UMBB 2OILA 2OLKA 4RKEA 4E4RA 5ICMA 5HJ5A 5KZMB 5L3SA 3H42B 4CG1A 1T1JA 2JAWA 1RHQA 3AVUA 4TMXA 1WL8A 3I1IA 3N58A 3HFGA 1TB4A 2HLDD 3D2BA 3OM1A 4UM9D 5BW5A 1FNBA 4P6VF 2DSTA 2WNIA 1JMKC 4NX2A 4ZMBA 2PUAA 1Y6RA 3PVSA 4P35A 1CS0B 1CWUA 3OTIA 3IHLA 1SC4A 1GLGA 2FG5A 3ETDA 2CVOA 2Q3DA 3NOXA 1TA4A 3P26A 3S1AB 4O0LA 4A92A 3ZWPA 5HA5A 4N49A 4N6NA 2A0XA 5NULA 2EJBA 3CNQS 3HCWA 2B8EA 2OXEA 2VJLA 3KUXA 1U04A 2HLDA 2A84A 3D6TB 1PFWA 2ZSKA 2EVWX 3A3PA 3DTVA 3N2YA 2VBGA 1N6PA 2QGZA 4IF6A 2W0SA 3CCBA 4B44A 4XCQA 4FKZA 2IW3A 3AW9A 4HLUA 4CU5A 1YSCA 2GVNA 1BIFA 3AUXA 4HNGA 1NUTA 1IN8A 1NN0A 2QTVB 3D6AA 2EFHB 2FWBA 1WMDA 2R8ZA 3FHTA 1DEAA 1RWNA 1E6MA 2H07A 4F71A 5JT1A 2YNMC 3CISA 4B45A 2ZBFA 2FN7A 2ZUVA 1OXMA 3OCZA 4FYPA 4IWNA 1T26A 5C1PA 4QT4A 3A31A 2CLDX 4CDMA 2R7NA 4ZDIA 5L8VA 3FTDA 3P2YA 1GAWA 2GA9A 1M7BA 2G7MC 1YMVA 4ZI7F 1XLVA 5KYTA 3W8EA 2Q5QA 5ECDA 3PQEA 3CF2A 3JD1A 3AL0C 1O9BA 1OHHA 3FH0A 3ABSB 1QC5A 1CF9A 4JWTA 1XXLA 3HB1A 3QA3E 4OK5A 3WRYA 4RCYA 1R9NA 3C7CB 1L1EA 4FUTA 1Y8AA 1KDZA 3PJEA 4X84A 3ZHQA 4FDLA 4M36A 1W7AA 4D3XA 1EHYA 1K8XB 4ND1A 5EIHA 2DFLA 5FYDA 4C3OB 1G6HA 1KY5A 1VPEA 4EEXA 1NOKA 2C0PA 3DLPX 4KXXA 4S1TA 4JC4A 1PVVA 1ENOA 1YR2A 1IN7A 2FLKA 2PS3A 2RK3A 3GIWA 3JQQA 4ME6A 3WY9A 3ZV6A 2BYTA 5TF0A 2F8SA 2Q5OA 2PDAA 2IP2A 2R11A 5TRTA 2Y1WA 3ACBA 3LPAA 5IU6A 1Y7HA 1Y5NA 2QTWB 3BWDD 5TT1A 5CR9A 1G60A 1N7JA 1FC0A 3OD5A 4MHOA 3EAQA 4DCGA 5LKRA 1BH6A 2EGGA 3DFZA 5T6MA 3EZ2A 2OK7A 4RSGA 5JALA 1GGEA 2PKXA 1PG0A 1KJIA 1PLJA 1H0SA 4YUYA 2XHEA 1BWQA 4R1LA 5DP1A 1A7JA 5EWMA 3BCHA 2OCYC 3EMBA 5K8LA 3L1JA 3LD9A 5T7BA 4G5SA 2PX8A 3IR5A 1MMFB 2Q7XA 1DRVA 2AYZA 2PSSA 3WLIA 4I50A 4BYGA 1OA0A 3AR2A 1X0XA 4CUJA 1KEEB 2G3YA 2VR1A 5EPOA 3IURA 4BMOB 5LQUA 4CODB 2CV2A 1N7HA 1PWYE 2HSDA 1Z4NA 4P54A 3LQ1A 4EQ6B 4LC9A 5K99A 2PZMA 3INGA 3N39C 4X7MA 1ODJA 1MF7A 3D7MA 3DL0A 4QULA 3BGWA 1OH5A 1DC8A 3QFFA 2F8TA 5EIBC 1LTKA 2VRNA 3EVBA 5FNVF 4TM8A 1K7CA 1BX0A 2PT9A 3FPFA 3KTAA 3LP6A 3ECSA 1XL1A 1T24A 1J2UA 2AJBA 2CXPA 2VWGA 4HF7A 2Q5CA 5JNVA 3UAWA 3K1AA 3OD1A 4PHFA 2MCFA 1PEAA 3OJEA 1P2DA 3BE4A 1YZTA 2G07A 3EQ2A 3SZRA 1SCNE 4LSMA 3MJDA 4MKZA 3HP4A 3OTQA 1WSWA 3DDSA 4OCZA 3MMZA 5EINA 2CNDA 2YOHA 1EB9A 3UMRA 2A92A 2R44A 3GLIB 4PSCA 4ND5A 2HGSA 5F78A 1PVDA 2PRKA 3T9AA 5LD2C 2XE8A 2ZYSA 1CZUA 1U8FO 2AC7A 2YW9A 5LNK1 4FYYA 3MJCA 4GI3A 3VKUA 3D3NA 3R44A 3WSTA 4Z5XA 4ARCA 2UKDA 2G77B 2G5GX 1B8VA 5AT1A 3UXMA 1WBDA 4CTOA 3P7MA 2H54A 3DHVA 3FRJA 3L7NA 1V3QE 3QVXA 5H0IA 3ZGOA 5DK6A 4MPPA 4YMUA 1OQAA 2Q6TA 3FCAA 2OUKA 2NU6A 2AFIE 3IJRA 1H3FA 4HYYA 4K6CA 4CWAA 1BG6A 1CJMA 1FJ2A 2C07A 2HRBA 1ZQ1A 3A1CA 5FTLA 1N77A 3F6PA 3LA6A 3G8DA 5EP3A 3RROA 4Z49A 5EN4A 5KINB 2V54A 1HKHA 3LHDA 5IARA 1CUSA 3G59A 5C3UA 4DR3B 2BGGA 4IMJB 3Q2OA 1N1GA 5EJ4A 4ZOLB 4G4IA 4Y1EA 1J24A 4TYPA 1YO6A 3FCOA 4YJ2F 5AP9A 4GO1A 1ZRMA 1UK8A 2O4CA 5J1SB 2PM8A 2IOFK 3Q12A 4G41A 1M3SA 3M6FA 2V1UA 1PS8A 5H8WA 4MULA 1KQPA 1XLTA 1A4XA 4BVFA 1TL7C 3H4TA 5AXAA 3LQRA 3TVYA 4AMBA 5DRTA 4YAGA 3GLGB 3UUWA 5EUBA 2VJKA 1P2GA 1PYOA 2VQ3A 4N9WA 1IK4A 1ZJWA 3CA8A 1JVNA 4GRAA 4O2BB 2HSZA 5DYGA 5FFNA 4YIHA 4MINA 2ZSJA 2ZWIA 3DCJA 4OKIA 3VHLB 2C7QA 3DWGA 1O6ZA 3BN3A 2GEUA 2ZU6A 1SU4A 1V8DA 4XVQA 4EDFA 1RHJA 1EFLA 1I1QB 4TXLA 4C6SA 1FPMA 4QJ3A 3NUGA 2B69A 3PHCA 3WTBA 4JJGA 2B4KA 4UE2A 2D0PB 3AEQA 1UBEA 4QOEA 4CM9A 1U0NA 5ALEA 4K9PA 5JWRA 3ICWA 4XDZA 3TRDA 3H5TA 2JLSA 4D8UA 2I1VB 2G9NA 3WHIA 3NBUA 4C4TA 4LHWA 4CLDA 1PYDA 5TGTA 5CB4F 1KH3A 1VPLA 4J2TA 3UG7A 4BX0A 1AIPA 2JAQA 5ESDA 2EBUA 3NRBA 3NIWA 4D7AA 4LECA 5DT2A 1L2TA 4AMVA 1IOZA 2CCGA 4ZJZA 3BWVA 2HK7A 1F4PA 5C35A 2OO7A 3WK8A 4OP1A 1WCV1 3MLAA 4DBVO 4URVR 1CUFA 1DDIA 1X2EA 3RIMA 1GAQA 1GRCA 2AA3A 1XQYA 1AA6A 1KHHA 4QLBA 1J8MF 1DCTA 5AVWA 5LLTA 3KSDO 3VH3A 4MA4A 1J1IA 3ITKA 2VNSA 2Z9BA 4IG9A 3NASA 1P9RA 4HGZA 2PNFA 3GFVA 2J41A 2AD5A 3QTLA 3O8NA 3U6KA 2P27A 2C4VA 1NR5A 3QELA 3ECAA 4QNMA 2FFAA 3VR4D 3UVEA 1H8HD 1P1BA 1EWYA 1G9XA 1TQ8A 4TYQA 3LLUA 2ODPA 3TGPA 1IXSB 1SN7A 3KQVA 2DFTA 4QG7A 4IVQA 5FLXA 1LQTA 1OV4A 4MRNA 5BNIA 1IYZA 3T7IA 1UBTS 1VLJA 1RJWA 4LXQA 3PNMA 1LV8A 1AGXA 2IEZA 4OI0A 3VR3D 4C0QC 1UT6A 2OENG 4O4HA 3QPCA 3PVZA 3KEOA 4CE6A 4CKYA 2NV2B 1M6YA 2ZAYA 3TJRA 5JS8A 1DRWA 4N0PA 3KE8A 3EPLA 1U7XA 2XBLA 3N2ZB 3O4JA 1ZDMA 4X20A 4DLWA 1Q19A 3AU9A 6PFKA 1IBLB 2AG6A 3NPAA 1WXQA 3HKCB 4IV0A 4KFTA 1ZXXA 3GGDA 4RF5A 2B5WA 2IK8A 3B2EA 1UXKA 3FCSB 3KKZA 4FFDA 4JBNA 3C5HA 2HA3A 3FPSA 2HA7A 4QOFA 4UZFA 1C9KA 1WPXA 2C4MA 1OJ7A 3GX1A 4PS0A 1E1RD 4XWYA 5DMXA 4JI1B 3RODA 5LQJA 5U9CA 3F4KA 2LCFA 4LZJA 2VFAA 3RASA 1LLDA 5AH0A 1DKUA 2O14A 3PA8A 1RW4A 4RD6A 4AURA 4FMCF 3OLZA 1VBMA 2W7TA 3O8CA 4QECA 4AYWA 3ZK7A 1GV0A 1E0KA 2X8JA 2REQA 2VNHA 3MTAA 2ZTSA 4KPUA 4LZPA 3VR4H 2QL6A 3L0IB 1DO2A 1XCBA 4PLPA 4R9SA 1MAWA 1QGUB 1RMYA 1DJPA 1K8QA 1Z45A 2FW7A 2HL6A 2O7SA 4OGKA 5T4BA 5KYWB 4QJ5A 1EVQA 4EW2A 3AL2A 1B23P 3IO5A 4QU9A 4R81A 4FVTA 4O3MA 5GGYA 4NHEA 3SHFA 1GFZA 2OBBA 4J0HA 1ST2A 4F11A 2IBSA 1BWRA 3PPYA 1QVVA 1Z6AA 3JWEA 1RWKA 4DA7A 1ORHA 3E1GA 4GZLA 2P2YA 3U2QA 1KFKB 2Q4OA 1V7CA 1JKMA 1MPTA 4Y2PA 5ALUA 5JZVA 4FOTA 5A5EA 3EXEB 3HDQA 2VK1A 3QJ5A 4FFBA 1PCXA 4E6PA 2JLWA 2QZJA 1OFGA 1GNQA 2C9YA 2P9QA 5DNDA 1JT2A 3WLMA 1CNEA 2I4NA 1Z18A 3R9XA 2VSFA 1F3OA 2BL4A 4JFRA 2GEDA 1HQCA 1SB8A 1GPBA 3DKRA 1P0QA 1JDJA 1PT8A 1TVEA 4JLSA 4C20A 4ZAYA 3WLRA 3D2CA 5EJ8A 3EJWA 1YC5A 1E6KA 1DUIA 1ZIYA 5IEJA 4HB0A 5CJ2A 3ABOB 1M67A 1XF1A 3BMCB 3A04A 3T5TA 2IL1A 4L5CA 3NP7A 2X14A 1C7FA 5F4ZA 1WG8A 1YAHA 3HYSA 4UD2A 1SQ5A 1IC6A 1XP8A 2N42A 2Q5LA 4RDCA 2ATIA 3RG2A 5IMSA 4TGLA 2QVLA 3VR5D 4AVYA 4DNOA 4I6GA 3NWBA 1T1GA 1POWA 1ZISA 4LQ4A 5AW0A 4LZOA 2HF2A 2JLBA 3M34A 3MJFA 5GVRA 2M32A 2R1ZA 3OX1A 2AI1A 1JZTA 4MI1A 5EAIA 4NU8X 2H2WA 3W4KA 2VRBA 4YXWA 4YCJA 1FFAA 1GGNA 3CLRC 2IGBA 2VLBA 2OYSA 2PRZA 4IRUB 4RO0A 1L9KA 3WLQA 4E5YA 4WBXC 4QPPA 3NBYC 3KBBA 3RC1A 1FDSA 3RTCA 1O94D 1NG1A 4MLCA 3T35A 4B8YA 5GPBA 3E3AA 2RH9B 5F7JA 2A9VA 3AM4A 3ELYA 3ICVA 1PTKA 4AUMA 4CW7A 1BWPA 5A5FA 5F35A 1ULZA 4QA9A 1K2WA 4GI7A 5SZHB 9LDTA 3LUAA 1EFRA 1J90A 1VL1A 1OZAA 2YOGA 3D6VA 3FYSA 5FNVB 2A9OA 5HZMA 3CINA 1IXKA 4BP8A 5CA0A 5DBFA 2QBYB 4IFEA 4PINA 4DA8A 2R62A 3EZNA 5LQMA 3FDZA 1JX6A 1VLHA 4IIBA 1O94A 5C5CA 2ZSDA 4CL2A 3W04A 4ZYVA 5IC4A 3VM6A 5IWCA 1CEQA 1KZGB 1L4UA 1JHZA 4FIDA 1UJ4A 3DGEC 4ND7A 1N2GA 2BR3A 3UC5A 1Q11A 1S3SA 3CB2A 3RS5A 1YKGA 1IOLA 4H1WA 5HGJA 2JLAA 4HHEA 2BHLA 1EVYA 2AJDA 3HVUA 3QV2A 1DWOA 1Y9EA 4DMGA 3CH5A 2JHGA 4B80A 4EECA 1UP6A 2C5SA 1P5HA 1RKVA 1T34A 1CUVA 2GBIA 1H0HA 7REQB 4UTZA 1AQYA 4FOLA 3CR3C 1GRRA 2FSPA 3GPLA 2B7CA 4L51A 3B70A 1OWNA 4FKBA 3UXEA 3QKRA 4PYJA 1RIIA 3SEZA 4KQMA 2Z2ZA 4N3BA 3RU9A 4PY2A 1T9DA 1FTYA 3JAWA 1JLLB 1NP6A 4XOUA 4HAXA 3UJHA 2PG3A 3LVBA 1DXQA 5FH9A 5TE9A 2JI8A 5G3ZA 3D6NB 3GFFA 3D4PA 1Q5PA 1TRKA 4UW9A 4IMRA 5KYGA 1YZYA 5A62A 1S2NA 2HJRA 5EGSA 5SZKB 4CQLA 2JGNA 3AVOA 1R9MA 4U9HS 5J23A 1PZNA 3KDSE 2H1CA 2ZM6B 3DXXA 3GLHE 1KKLA 1KWKA 1FRQA 2QGFA 1WOYA 2XQKA 2YWGA 1M0SA 4RKQA 2BBTA 1J2JA 1LTHR 2QR2A 4B3IA 1JYEA 4M21A 4PSDA 3KRTA 2VPIA 3PRJA 1H66A 4KO8A 4PQEA 1JIUA 1DC7A 1LX6A 5I48A 4PZUA 2Y0EA 3L4JA 4QQKA 5DULA 2FWIA 2V4ZA 3UFXA 4G26A 5CLIA 4V3BA 2B82A 3SE0A 3NXSA 1LW6E 2VDUE 3PIRA 2WU4A 2KQUA 2BM1A 1T8TA 4IM7A 4MUGA 2Q3BA 2Z8XA 4JLPA 5KOJA 1YE5A 4IJMA 1GA4A 1BGWA 1ICEA 1RPJA 2VJQA 3KSRA 3OTHA 3PXAA 3RS7A 3DTVD 1P1JA 4WFKA 3MPOA 1DFIA 1H1TA 2NZYA 4KMSA 1AY0A 1FS4A 3OCVA 4LNAA 4PICA 4TMTA 4XM1A 3T41A 3W7AA 1VLMA 2PRIA 1YRWA 4O4JF 2ZAMA 3E7WA 3L5KA 4RL6A 3GW8A 4GS5A 3V34A 2F3RA 3U16A 1UAYA 5B6JA 2VP2A 3LUDA 2AMJA 4EKIA 3EEBA 4FHEA 3EH1A 4S1OA 3LYUA 4L07A 3A6FA 2WU8A 4TV9F 5HG0A 1ENZA 1PGJA 4FMBB 1RRPA 4A0SA 3W2HA 2ZBPA 1UMDA 1WMSA 4L02A 4F56A 1ZGHA 4YUZA 3BJIC 1ID1A 2GJSA 4I1SA 3L0BA 3GJ8A 4Z1MD 3AF4A 5BQXA 4RSHA 3H13A 5AW8A 1DC3A 2P0YA 4O8ZA 3DAOA 3MJTA 4BZZA 3MJEA 3P2OA 2D0IA 3COWA 4D5GA 4NJMA 4YRDA 2Y1LA 4U7GA 5KC8A 3PQ8A 3AR8A 4TUYF 2A9JA 4GMGA 4IGIA 3ASZA 1U94A 3CEAA 4I9FA 2AG0A 2OO3A 1MXFA 1X7XA 2WAMA 3IEUA 4CHGA 3WBFA 2XT9A 3IOEA 5K05A 5KTTA 2UUCB 2AEFA 2C95A 2V1XA 3KPUA 4E88A 4Z51A 5C7YA 4BP3A 2FWNA 2O3JA 4R31A 2PUDA 1US8A 1NLUA 4MI9A 3SR3A 2HSWA 3VO9A 2XNKA 1SVSA 4RA9B 1ZGGA 2Y1DA 1PU2A 3ETJA 4URWR 3RVSA 3E70C 3ZVLA 2W9XA 4UNQA 1Y1TA 4EMTA 2F55A 5CB4B 1X7XB 1NJFA 2L0XA 3N0RA 4XJTA 3KTAB 3WNCA 4FILA 2Z4SA 4B34A 1LS1A 3EC7A 4HCJA 1NXSA 1OGIA 3R0QA 4PGFA 4EW1A 1SHUX 2DU8A 3UWSA 5JDIA 3FF1A 4QUGA 4B3HA 4HN9A 1Q7BA 4DY4A 4QICA 3HUEA 3EUEA 3I23A 3LVFO 3GLRA 3ZV3A 3HG7A 4D4GA 2CD9A 5LCXA 3K0KA 4MP8A 1DEKA 4JY7A 1SUSA 3L4SO 2IZ7A 4NAUA 5DYIA 4DBZA 1PUIA 4F9FA 4BNLA 1E94E 1YKFA 1YVRA 3EFOA 3NWOA 2P9BA 1S01A 1S8NA 2OAQ1 3MTBA 4LDZA 3FPCA 3UJBA 3LW7A 1OXUA 1MJ5A 1G8JA 1X1QA 2OAP1 5E8JA 3NHBA 4MRSA 3DOFA 5C4GB 4DQKA 2A1TR 1ECCA 2YR0A 2FRDC 3BK1A 4QRIA 1I2CA 4R16A 4ES6A 4DIEA 4M1ZA 1E96A 1SOWA 5JS2A 1SQFA 3SBXA 1QOZA 4KNWA 1JR3E 4RA6A 2OPHA 2B4TO 2PH3A 3DNFA 2PAFA 3FPAA 3GGOA 5T3UA 3WP1B 3G2JA 5BVHB 5JDCA 1Y6FA 2XYGA 1FLNA 5FOSA 2VTVA 4IZOA 3SDSA 1TK9A 1GSIA 2J9RA 3EY4A 3F5DA 4LRYA 1M7HA 1N4AA 2XWPA 4WN3A 2V7PA 4F92B 2VJYA 3GDGA 2WIDA 1UBSB 1YCGA 3BYZA 5ALLA 3A7DA 2WLSA 2NO0A 3P2KA 4LJ5A 3WSVA 3IOCA 2QS9A 3BG5A 2VPWA 4DUYB 2A3NA 1S9DA 4RZIA 4FB4A 4XVHA 2C99A 2ZVQX 3PNQA 3JWGA 5CITA 3WB2A 3OIYA 1DMSA 2NVOA 3R7NA 5CDHA 3VDXA 3O83A 1G5IA 2JFVA 1U0GA 3V8PA 3BIXA 1XRNA 3V4SA 2F1OA 5IM5A 2CFOA 4EVSA 2R751 1ZWKA 1IN4A 2NU6B 1EZZA 3OO1A 1U3CA 4UFOA 2HB6A 3D4BA 4IQGA 2D2XA 3DR5A 2W2MA 2IU0A 4BN4A 2OKCA 3J81k 2V0NA 4LXTA 1OXVA 1PT5A 2LP4Y 3AESB 5K3FB 5AIAA 1UWCA 1A27A 3R9WA 3SQXA 3ET5A 3FVQA 2IIVA 2RGXA 3MBKA 4OP2A 4QU8A 1HDRA 4Y2GA 5KAPA 3N8IA 3OKAA 3ZE0B 3HACA 5ALFA 3OPVA 2HA2A 2IIBA 2GXAA 4A27A 1BVRA 2CLKB 2DTEA 1HSOA 3EDOA 5KDLA 2DBYA 1RVV1 2I80A 1YTUA 1ZZGA 2D5IA 3GT0A 4N9QA 3E9CA 3WGGA 2P5SA 4FJ0A 4BASA 4NZ9A 4IZIA 4D3SA 1C3EA 1TPZA 2WYVA 1B15A 2X4LA 3E1SA 4LYEA 2EJVA 3GAFA 5A5GA 4DUZB 2LGJA 2GOYA 1T4GA 1ZKDA 2VF5X 4FFBB 1MAAA 4IUBS 5LYJA 4G5FA 1A3CA 4W7IA 3GEHA 4NIMA 4BO1A 3TN7A 3N59A 2WZQA 3U44A 2QM3A 1HE5A 3ZV5A 3B1FA 3D8UA 4JKIA 1SAYA 3Q2IA 1UOQA 1OPXA 2ATVA 2G0AA 4JQCA 4N47A 3RW9A 5HJEA 2QNIA 5GOZA 4CVNA 1MB3A 1E3WB 4AJNA 4EPWA 5DBIA 2FUNB 4PLZA 4O4JA 5DISB 4ZEXA 1GG8A 4QELA 3OFND 3AOEA 3QU5A 5JZBA 1ZBQA 4H7IA 3G9UA 4PPQA 2ZI5A 4J7UA 4AB1A 5JC8A 3LT5A 4R2LA 2EKQA 3VHQA 4QM7A 4ITVA 2BZ1A 1SUFA 2FMKA 3FOEC 1RRGA 4L3OA 2FE4A 3RKRA 5K8CA 1XZDA 4AJLA 4UC0A 1I24A 1Y1PA 5FI0B 1PGQA 1TX4B 3AQIA 1OASA 2BZSA 3WDSA 2FUEA 4RGQA 3I4FA 4X6YA 1EX7A 4BEBA 1XTIA 1MDBA 3BWEA 3E48A 5E2BA 1RYMA 3T5CA 4L73A 1WNFA 4X54A 3LCCA 1MOPA 1QKJA 3B7GA 4HX5A 4B73A 1L7RA 3FSEA 3ZVMA 4ANFA 2QRUA 1Y37A 4CLHA 5KSYA 5KB3A 3A36A 3AKCA 1F20A 4BKRA 3OY7A 2CLEB 2VUTA 2O07A 4XPZA 1AD2A 3GAMA 4BOYA 2O8DB 5HNKA