3WYNA

Structure of calcium bound cutinase est119 from thermobifida alba.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
260
Chain Sequence
QAANPYERGPNPTESMLEARSGPFSVSEERASRFGADGFGGGTIYYPRENNTYGAIAISPGYTGTQSSIAWLGERIASHGFVVIAIDTNTTLDQPDSRARQLNAALDYMLTDASSAVRNRIDASRLAVMGHSMGGGGTLRLASQRPDLKAAIPLTPWHLNKSWRDITVPTLIIGAEYDTIASVTLHSKPFYNSIPSPTDKAYLELDGASHFAPNITNKTIGMYSVAWLKRFVDEDTRYTQFLCPGPRTSDVEEYRSTCPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of calcium bound cutinase Est119 from Thermobifida alba.
rcsb
source organism Thermobifida alba
molecule tags Hydrolase
molecule keywords Esterase
total genus 89
structure length 260
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12740 Chlorophyllase2 Chlorophyllase enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wynA00
1CFJA 4J0CA 5DTIA 2ES4A 1P0IA 5DYYA 2VT7A 3C70A 5AKHA 3I2KA 1JJFA 2GZSA 2QM0A 4IH4A 4DMCA 2PSHA 3E1GA 2ZSHA 4UHDA 4U2DA 2D5LA 2AJDA 4ARBA 4OD0A 3A6ZA 1XZFA 1CUIA 4QDUA 2ZJ6A 2HA3A 1CUWA 1F0NA 2C7BA 1P0MA 2VTVA 1LPNA 1QO7A 5E4TA 3S8YA 1A8SA 1HPLA 4JYPA 3A2NA 3I6ZA 4WFIA 4PW0A 1XLUA 5K3AA 1KU0A 1VJ5A 5ALOA 3K2IA 1J2EA 1GPKA 5CRIA 2ACKA 5HKBA 2XI4A 7YASA 1DT5A 3FSGD 4RPCA 5HF5A 1ODCA 1W76A 4CG1A 1XKTA 2WUEA 1CUXA 5LKAA 1JU4A 5HQ3B 5ALXA 3IURA 5T4FA 1ZJ5A 4W1SA 2WFZA 3EQ9A 2XLBA 4Y2JA 4AO7A 2J4FA 3SK0A 1PV1A 4UPDA 2OCLA 4JNCA 3VJLA 3W9BA 5ALRA 2WUDA 1SOMA 2RONA 5LZ7A 3HRHA 4K2AA 1NU6A 4KJXA 5AIBA 2XMBA 1CRLA 4TVKA 2AJCA 3H19A 3D5EA 5JANA 2EDCA 2XUHA 1TK3A 1CUFA 5IKXA 4M0FA 4X00A 1QTRA 4UHEA 4AMYA 3OTQA 4X97A 1Z68A 1CIJA 1CUEA 4DIUA 5DJ5A 3E3AA 5AOBA 3C87A 3I2HA 2O7VA 2OPHA 2WFLA 4WFKA 3RARA 1XZIA 2OGSA 3RK4A 5AH0A 2PVSA 3I6YA 3Q8WA 4BBZA 4CIBA 1H23A 2O2HA 1XQWA 5CURA 1VZ3A 3E0XA 2HIHA 1Y37A 1DT3A 3NUZA 3K6KA 3WWCA 1UK9A 3STWA 1W4LA 2HADA 1J07A 3YASA 1THGA 1EVQA 1L7RA 1EK2A 4H0CA 1LLFA 3ZI7A 4Y2UA 3HZOA 4A5SA 2PX6A 1N5MA 1BCSA 4W1RA 3GROA 3IA2A 3FLBA 2HL6A 4J0JA 1W6RA 3X3HA 5FOQA 2B4KA 5ALGA 3QPAA 4A16A 5ALPA 1UKAA 1SCKA 3QMVA 2WUFA 1O6FA 3DL7A 4FNMA 2FJPA 2WJ4A 2X5XA 4BCCA 4MEAA 2Y1KA 2PSJA 4ZI5A 1ISPA 5AM1A 1LPSA 2XUQA 2Q0XA 2WHRA 5CT9A 1BEZA 1X2EA 3I2FA 5K5EA 3FCYA 4J0GA 4JEIA 2WJ6A 5AM5A 4N8EA 5IVKA 4B6GA 1YAJA 4MYSA 3O0DA 1XRNA 4EUSA 1DQYA 3F96A 3QITA 2WG2A 4B0OA 5H3HA 4E11A 4QLOA 2XUOA 4B84A 2V98A 5AO9A 1SCIA 4P9NA 3PE6A 4G8DA 5AOAA 2QJWA 2H7XA 4MEBA 2NW6A 4UBIA 4UFNA 4G5XA 3HYSA 3V1LA 3H2IA 4UBJA 5ALEA 3VISA 2YH2A 1D07A 5KBYA 4G9EA 5BOVA 5E4YA 1WPRA 4Q3KA 3R0VA 1Y7HA 2G5PA 1UOOA 3VXKA 2WILA 3OG9A 1CUDA 2XMSA 3I2GA 1TQHA 3O4HA 1XFDA 1WOMA 2PSFA 2JEZA 3N2ZB 4W1QA 3BWXA 2H7CA 1R9NA 4K5QA 1JFRA 1FFBA 2HU8A 1UK7A 4C89A 3HACA 3SC2A 2RHTA 4GWLA 1Q84A 4UUQA 2PPLA 3F98A 4OB8A 2PUHA 1XZMA 5AK6A 2PSDA 3O95A 1UK6A 1R3DA 2JGMA 3FYUA 2GBGA 4UBKA 3C6YA 3HEAA 4AO8A 5KWJA 1EI9A 5AK3A 1FJ2A 1K63A 1YASA 2GBCA 2Y2UA 1BROA 3WK4A 5ALJA 5JZ9A 3OC0A 1ZICA 1HLGA 4FNGA 5DLPA 1SC9A 1ZGCA 5E2IA 3VKFA 3HC7A 4J3JA 2ZYSA 4YASA 3G9XA 1YB6A 2JBWA 1R88A 3GUUA 5CXUA 4ZWNA 5ALSA 3C6ZA 3DYVA 5EFZA 2XE4A 1OILA 4WY8A 2X8BA 3RLIA 4FWBA 3O9VA 4ETWA 2WHQA 4BDSA 2ZJ7A 1WHTA 5DYWA 3QBJA 5ALVA 4BAZA 2BKLA 1CVLA 1RWQA 4OYYA 4C88A 4IH9A 3PFCA 1GGVA 3ZWQA 3BF8A 4DNOA 3FNBA 3BDIA 4DMHA 5AI5A 1MX5A 2W6CX 5C81A 4BC1A 2ROQA 3H1AA 2QTBA 5AJHA 4EBBA 5HK9A 2OGTA 5KREA 2WU3A 1ZD4A 4EY8A 5EHZA 1QZ3A 5K3BA 3QM1A 3I28A 1WB4A 4BB0A 2BUAA 5HFNA 1UXOA 1XZAA 3WZLA 1THTA 4QNNA 4C01A 4B83A 4BC0A 1LPAB 3L1JA 4G4IA 1BCRA 2QRUA 3DOHA 3QZUA 2WSLA 3BXPA 4OU4A 1K8QA 2Z3ZA 1QONA 4I19A 1CR6A 4U2FA 1IMJA 3STYA 5EIEA 2IITA 5ALHA 3T52A 1E8NA 5AKGA 5ALZA 4X6XA 2CEKA 4TPKA 1Q83A 3KWFA 2XT0A 3TGLA 2PBLA 2RI6A 2RIPA 4UHCA 1TCBA 2WIKA 5AI0A 3NWOA 3KOOA 2PU7A 4EA6A 1MAAA 4C4XA 1XZCA 3BF7A 2GYWA 2WQZA 1K5PA 5EI5A 1BEEA 1IUPA 1N5RA 4K6GA 5K3FA 5ALTA 4K6HA 5LZ8A 4C6HA 1MN6A 5HZGA 3V1KA 1E89A 5JAUA 1S8OA 1G5FA 2HU7A 5D3KA 3R3ZA 2PKYX 5IVIA 3C8DA 4KE7A 2VJDA 1G66A 3ZLTA 4C87A 2VF2A 3V1MA 1IUOA 3V1NA 2Z3WA 2QR5A 1JKMA 2UZ0A 4BE9A 1XZGA 4PSUA 2OCIA 2DCMA 4L3WA 4XWGA 2XMRA 2QS9A 1CUGA 2K2QB 4B82A 2ECFA 2OQVA 2EDAA 4U2BA 1CUJA 3O4IA 4HXFB 1ODSA 5BWCA 5CT8A 5JARA 2C5FA 4B80A 5T4BA 5JD6A 1EDEA 1ZIYA 3GBSA 3DKRA 1EHYA 3W06A 4HXGA 2JEYA 3W05A 1KU6A 1LGYA 4JUIA 1UOPA 2O7RA 3BE8A 1KEZA 2XUPA 5JAOA 1F0PA 3C8HA 2AJ8A 2WM2A 4H7DA 3QPDA 4AB1A 2OQIA 1UWCA 2HM7A 3AZPA 1U2EA 3LS2A 4QWMA 1ODTC 3UMJA 3ZV7A 1IUNA 1E8MA 2CB9A 3I2JA 3PF9A 1SFRA 3ZLUA 1CQZA 5J3JA 2GBIA 4F21A 2WIDA 5DTJA 5D6OA 4Y2YA 4BAGA 1W1IA 1H2XA 1LNSA 4EZIA 1PFQA 1VZ2A 3PI6A 5ALWA 3ANTA 2XMGA 1AKNA 1VLQA 4DNPA 5AIAA 5D3ZA 4BP9A 2HA4A 1F6WA 2BGRA 3IB3A 3WYNA 4RE6A 2ZYRA 5JALA 5CTAA 5AKLA 1LZKA 1AUOA 3W9UA 2QXTA 3H1BA 4X93A 1QIDA 3HLKA 2YXPX 4BP8A 1DWPA 2CUTA 4QA9A 3WL8A 2XQKA 4X6YA 3STTA 3OM8A 1E66A 2DHCA 3E4DA 5FPQA 3NGMA 4UFOA 2V96A 4GDMA 2XUDA 1XZJA 4D9JA 2JGJA 1XZBA 2FJ0A 5FXMA 4H35A 4DTCA 2WIJA 2E3JA 3O4GA 3FLAA 1R4ZA 3H2GA 2QMQA 1XZLA 5K3EA 4FLEA 1ZI9A 1H2WA 4YPVA 1P0PA 1EDBA 1UKCA 1JT2A 3AIOA 5JZSA 1GT6A 2O2GA 3KDAA 2XQGA 1MNQA 1GXSA 3UUFA 1TAHA 2QXUA 1ACJA 3WA6A 1HDEA 3ANSA 4FLMA 3M3DA 2OAGA 5JYCA 4CG2A 4H7FA 1UOQA 4PSCA 5ALLA 5AICA 4OU5A 4X71A 4B81A 2O2IA 1GKLA 2WHPA 1T4MA 4H77A 3G0IA 1VA4A 3QVMA 4PQEA 5DNUA 3C43A 1YS1X 2VA9A 4YK7A 1TRHA 5K3CA 1BS9A 2RHWA 3CN7A 3WKBA 3TJMA 3H0CA 2VJBA 2PM8A 5FUMA 5LLSA 2QT9A 3IDAA 1H2ZA 2VJCA 4K6KA 1WHSA 1ZI8A 4Y7DA 2I3ZA 4HS9A 2YYSA 4GECA 4JYMA 4P93A 4M0MA 4B9AA 2Y2VA 4IHAA 3WWOA 3MUOA 3DL4A 4KRXA 5CH5A 4MQMA 5HF9A 4IH1A 5EHNA 4CCYB 2JGKA 4H18A 1GPNA 3EF3A 3IIIA 5ALKA 2W22A 4HXEB 2Y6VA 4AMZA 2XDWA 4ITVA 1E3QA 1FFDA 3GFFA 2C58A 4BZZA 4P08A 4QWWA 1XRQA 2XMCA 4NMWA 4PF1A 3BDVA 1BN7A 3AZOA 4DM7A 1NU8A 3IUMA 1MX1A 4GHWA 1C7IA 2HA7A 1MT3A 4KE8A 3FYUC 5AKIA 2B61A 4J0KA 1CUAA 2GBFA 2AXEA 4Y2TA 1CUYA 5ALNA 2H1IA 1QIMA 4WY5A 3H2JA 1MO2A 5K3DA 1YCDA 2AJLI 3IVMA 5LP1A 1CV2A 1EB9A 3D7RA 4Y2VA 1XROA 1UKBA 1VXRA 5I7UA 4H7IA 4J0DA 1N1MA 2XUJA 4ZXFA 5AOCA 1DTEA 3H2KA 4DLNA 1ETHA 3STUA 1BRTA 1AGYA 2HDWA 4OB7A 1DX4A 1XZKA 4I4CA 2FUKA 2DQYA 1DINA 5LZ9A 1IVYA 4L9AA 5T4EA 3VDXA 2OG1A 2WFMA 1OCEA 4LXHA 4NVRA 4Q3OA 2Y6UA 4FLFA 3I6MA 1HQDA 1CUCA 3Q0TA 5AKKA 5SYNA 3UUEA 3FYUB 4FBMA 1QIJA 4UBLA 3WKEA 1NX9A 1EB8A 3ESBA 2C0PA 3VJMA 1UZAA 1U65A 1GKKA 1YA8A 1EK1A 3A70A 1VE7A 2OXEA 2HU5A 2ZYHA 2PUJA 5LYYA 3AILA 4HVTA 2G5TA 4FTWA 4X92A 3D4LA 5AI4A 4WDRA 3G8YA 4V2IA 1I6WA 4J0IA 4P92A 2VJAA 1XRRA 3C6XA 4AN0A 5CMLA 4GLBA 1QIEA 2JGLA 3LCRA 1CUBA 3ESAA 2WG0A 2CBGA 3OURA 2WUGA 1CLEA 1QIIA 3OPMA 3KSRA 3TEJA 5ALMA 4PNZA 3HJUA 4F5ZA 5F4ZA 1K6EA 1VXOA 4KE9A 3T4UA 3TRDA 3FCXA 2XUGA 4AX4A 5I8PA 2C5GA 2JGIA 4MWTA 2JGEA 2JF0A 1N8SA 4WCVA 1G42A 1U8EA 3IUJA 5JADA 1VE6A 1MJ5A 4BAUA 1L7QA 2WIFA 5JAPA 4NS4A 4AXBA 3F67A 1XKLA 2JGFA 1QIFA 4GI1A 4DSAA 1PJAA 3G9TA 3VVLA 2HHAA 2BFNA 4BRSA 4GXNA 3STXA 1MU0A 2QOEA 1XQVA 4UFPA 4DMFA 3K9BA 5AI8A 2H9YA 4BCDA 1O6GA 3LLCA 4LIPD 4OCZA 4Q3LA 5EGNA 3G0DA 5ALYA 4BVJA 1EXWA 1MTZA 3IULA 1CUZA 3G0GA 4H7JA 4J7AA 1DWQA 3WJ1A 2OGZA 2Z5GA 3EIOA 2H7YA 3WWPA 1ACLA 4ZGBA 3L1IA 2C0QA 3JWEA 2P8SA 4X3CA 3QYJA 4E14A 2XB6A 1GZ7A 2J4CA 2HA2A 4UHFA 2HA5A 1LPBB 5FKJA 4CIAA 2BUBA 3FAKA 1QIGA 4AO6A 1CUHA 5AM3A 2QZPA 2VATA 4X95A 1DQZA 1QE3A 1TCCA 1TIBA 3WKCA 4BCBA 5A7HA 2QUBA 4MJ3A 3CCBA 2RGUA 4KAAA 4C4YA 2XQIA 3KWJA 3O9MA 1LBTA 5C8VA 1X2BA 3R3VA 3G9ZA 1RYYA 3BIXA 4LKOA 4Y2SA 3MUNA 5CT6A 4ARAA 4H7EA 4CI9A 4GW3A 5EHQA 4JH0A 5I9IA 1Q0RA 2B20A 3JW8A 5HF6A 3LIIA 2WU4A 1UFOA 5A7FA 1FFAA 2G4LA 1AC5A 2QKYA 2FX5A 1CUVA 4G8CA 5CT5A 1QFMA 3QMWA 2QJRA 2B9VA 4QDTA 5JIBA 1ZD2P 4MXDA 2CMFA 4AQDA 1YSCA 4MWSA 3CXUA 4UBNA 2WTNA 4BATA 3I1YA 2DHEA 4OSEA 3DS8A 2WG1A 2ZJFA 3ICWA 2ZVDA 5SYMA 3PDCA 3C6BA 1OXMA 3QMMA 4XIIA 1LPMA 5LZ5A 3D2CA 5AK5A 3MVEA 3R41A 2LIPA 3DYIA 1B6GA 2CZQA 2WFLB 4FBLA 1XLVA 3A2MA 1JJBA 3IBTA 3WL6A 1YAHA 4PV7A 5JD4A 1MX9A 3GZJA 1VA5A 1BN6A 4KEAA 5LKRA 4FFWA 1Y7IA 1QJ4A 3WK6A 2X76A 3LIPA 1X70A 3AFIA 5ALFA 3WL5A 4LXIA 5ESRA 3QPCA 4G9GA 2BCEA 1J06A 4J03A 2BJHA 3U1TA 3AUKA 5HF8A 4UBMA 5C7YA 1WB6A 2EEPA 4PSDA 2BUCA 3HXKA 1LZLA 2PL5A 2DR0A 1AZWA 3ZPXA 5IH7A 5ALUA 1QFSA 2OCKA 3P2MA 3PICA 1HL7A 3EQ8A 1IZ7A 2R8BA 3DNMA 4X6UA 5CH8A 1A8UA 2HA6A 4Y9SA 3ZLVA 1ZD5A 1CUUA 5AM0A 1QIHA 5KWIA 4CCWA 3WLAA 4I3FA 3W2TA 4GEGA 2HRQA 4KAJA 3WZMA 2RAUA 3BJMA 3R3YA 3WMRA 3M81A 1BU8A 4YX9A 3C5VA 1JJIA 4ZRDA 3BIWA 2XQJA 2HA0A 3DLTA 4LYDA 4BRZA 4QDZA 4WDQA 4Q82A 2HRRA 4CG3A 5ALDA 1HKHA 4EY6A 1JMKC 3DKKA 4KYVA 1DX6A 5C8XA 4H7KA 1A88A 2QVBA 4X91A 1CPYA 1ZIXA 1AX9A 3N0TA 2XMDA 1T2NA 4AZ3A 1WB5A 3C5WP 3ESCA 3ILSA 1FFEA 2GZRA 3U0VA 4W9RA 3STVA 2VQ6A 3D2AA 4BTVA 4LXGA 1JI3A 5HCUA 4Y2RA 4U2GA 3O4JA 3JYHA 2PU5A 1CEXA 5LIPA 1JMYA 3FVRA 4S0XA 2ONCA 3G7NA 4NZZA 4C4ZA 1ZI6A 1YA4A 5EIAA 5A62A 2WJ3A 3DOIA 1QGED 4DYHA 4IO0A 3H17A 2V97A 2XUFA 3WIBA 4H7HA 1R50A 4OB6A 3WWDA 1BE0A 5FLKA 1RP1A 4AN1A 2VAXA 3S2ZA 4U2CA 1YS2X 5AK4A 3V9AA 2OLEA 1YB7A 1MNAA 1GPLA 3NOXA 1C7JA 1XRPA 5D7BA 1DWOA 4G4JA 1VKHA 1MPXA 5A71A 2DFPA 2DSNA 1EA5A 2I03A 3I2IA 4KAFA 4HRXA 4DMKA 4BE4A 2WLSA 3D0KA 1B41A 3DEAA 5YASA 4G8BA 1Q0ZA 1QIKA 2QUAA 4UBOA 3FLEA 2CJPA 5ALQA 4E46A 1AURA 3KXPA 4BVLA 1USWA 4BYMA 2VT6A 1MAHA 2HFJA 5ALIA 4E15A 3D3NA 3FVTA 5HKAA 1EH5A 5JAHA 3PF8A 3F8SA 5FRDA 3WK9A 3R3UA 1IZ8A 2WIGA 4IQ4A 2XMQA 4EY4A 1XRLA 1E5TA 3DJYA 5LZ2A 2ZSIA 3M82A 4LHEA 1ORWA 4XVCA 5JD5A 3EBLA 1DU4A 1F8UA 2JIDA 3G9UA 4G1FA 4N8DA 2V9ZA 3WK7A 1UK8A 3W04A 4Z49A 1M33A 3WIOA 3HABA 5AKXA 4CFSA 2Z8XA 1EX9A 2HFKA 3WI7A 1ORVA 5ISMA 4B7ZA 1TKRA 3FOBA 2AJBA 1EVEA 2C4HA 2I3DA 3D2BA 1QTIA 2IIVA 4FMPA 4FKBA 3WK8A 1YR2A 4EHBA 4Q34A 3FWHA 1ZD3A 5AM2A 5IVDA 5AM4A 5HK8A 5AKZA 1XZEA 1TCAA 1A7UA 4N8SA 5DNWA 4OYLA 4QDOA 5AKYA 3ICVA 4X90A 3G02A 5HFAA 3F9CA 5BV7A 4L0CA 4EY5A 4HRYA 5BWBA 4Y2XA 2D0DA 3CCCA 4WJLA 4O08A 5FP0A 4HTAA 3GELA 3G0BA 3PUHA 2DHDA 2DQZA 2ACEA 1K4YA 3L1HA 3IUQA 4Q05A 5LZ4A 4B0PA 1HBJA 3R40A 1VOTA 1LPOA 3FBWA 5AI6A 1QO9A 5CT4A 3M83A 2VAVA 3AZQA 3IUNA 4QEKA 1LBSA 1XRMA 4EB0A 4QE3A 4W63A 1XZHA 4BVKA 3HI4A 1EDDA 4U2EA 4L72A 5AHXA 3ESDA 1FFCA 1GQRA 4RGYA 1ZJ4A 1WPXA 4QLAA 4GBGA 4B85A 1H2YA 3H04A 4X85A 4N5HX 2IX9A 3AINA 4Y2QA 3KD2A 2ORYA 4FFVA 1EINA 5HQ3A 4M0EA 2XUAA 5FDFA 4KR0A 4LYEA 4KACA 2PSEA 1ZOIA 5EIHA 3DQZA 4DNFA 4FDMA 1FSSA 4F0JA 1W75A 4KE6A 1G4HA 3WWEA 5AKEA 3RM3A 1AMNA 3WYDA 5CW2A 5T4HA 1R1DA 4PO3X 3AIMA 2XMZA 3PFBA 3B5EA 5DYTA 2VSQA 4UHHA 1SCQA 4INZA 4W1PA 1W52X 1XZDA 2BGNA 1XLWA 2I78A 4F60A 4G4GA 3R3WA 2Z8ZA 3VJKA 2CKMA 2VEOA 1AQLA 5C8ZA 4ZV9A 3WKAA 1J1IA 3I1IA 1R9MA 1CUSA 4DSZA 3D59A 3SX4A 1JU3A 6YASA 5EHXA 2ZYIA 3WA7A 5DNVA 3WL7A 3DCNA 1QOZA 4Q1VA 5CXXA 2OCGA 3RKSA 3OOSA 2WTMA 4XX1A 1XQXA 3ED1A 3C45A 1ZGBA 1WCYA 2YASA 1C4XA 3WKDA 2GYVA 3FYTA 3CN9A 2G63A 3GA7A 3H18A 2XUIA 3B3QA 3G0CA 4XJVA 4X94A 1CQWA 4RNCA 4B9EA 3R3XA 4N5IX 4ZV7A 2GYUA 5A6VA 3EQ7A 4X7BA 1U4NA 1UT6A 5JASA 3H2HA 4AZ0A 3MGAA 3A2LA 2J3DA 4OUKX 3DDUA 4MQLA 3VVMA 1XQYA 4BZWA 1A8QA 5E4JA 4BDTA 4DNQA 2XUKA 4FOLA 3QH4A 4RE5A 5CBKA 3WQHA 4J0HA 3AJAA 4BTLA 2XQFA 5DWDA 5CH3A 4QZVA 2WKWA 3FSGA 2XLCA 4HZGA 4FHZA 5FPPA 3HSSA 5JATA 4CCYA 4ROTA 3AIKA 4TGLA 4A23A 3B12A 5A7GA 3BJRA 4WFJA 5A2GA 5AP9A 3LP5A 5FV4A 2OAEA 5JZBA 3DD5A 1E8DA 4QDXA 4OPMA 5IVHA 4Y2PA 1QLWA 4UHBA 2J3QA 1WM1A 3SWWA 1L7AA 2WHPB 4EY7A 5K3FB 3BL8A 1P0QA 5AI9A 3WK5A 4KRYA 3PUIA 2BAGA 1GQSA 5AKJA 4DGQA 1H22A 3WJ2A 2R11A 4HAIA 4MYDA 3F97A 4ZREA 3V48A 1LPPA
chains in the Genus database with same CATH superfamily
3ZXYA 4OYHA 1T36A 3WBKA 5IULC 2HBYA 5IZCA 4RF2A 2H48A 2FPPB 4WESB 2VT7A 3D6FA 1IEVA 1X94A 3IP9A 1YBVA 3LO5A 1T6BY 3OQVA 2J09A 1LX7A 2JC3A 4XPIB 5JE8A 3V1UA 2ODPA 3CKKA 3SF8A 3TXYA 3IAXA 2PGNA 2QM0A 3BXOA 4DCPA 2CSXA 1AQUA 3EY4A 1UDBA 4KYUA 3LBFA 2G1JA 2ZPUA 4O2LA 1T10A 2OORA 4YT8A 2HV8A 4DANA 5HX7A 1PD0A 2CYBA 3G5AA 4R9RA 1P7VA 3ZV3A 2GCPA 2ZUDA 3UG7A 4M1WA 1JEYB 1TT5A 4U2DA 1WCWA 4HPXB 5G1PA 3SX0A 3WDSA 2G6TA 2Q9AA 3JR3A 5E38A 4H7PA 1APBA 3SJCA 3B2QA 3ER9A 1COWA 3H2ZA 4DIFA 3OD5A 1IJFA 3TQHA 1R5BA 3QPUA 4DV3B 1M1UA 2BZ1A 1T2AA 2XZTA 5E2BA 3ENZA 1YQUA 1ZM9A 2VRNA 8GPBA 1C4KA 1GAJA 4PC1A 4TWJA 2ZANA 4YMLA 3KK0A 1KI7A 2HDOA 3P4YA 3RJTA 2YYZA 4NK5A 1U0JA 2ORED 3MELA 5BQFA 2FMHA 1S2NA 6ABPA 1S7GA 1L6IA 2E48A 1EVYA 3TLKA 1ODJA 3ORYA 3KP1A 3DOUA 1N4AA 2H1FA 5BV0A 5G0WA 1IJBA 4M1TA 1VIVA 1SPXA 1ARZA 1KSHA 2BTOA 4FILA 5CA1A 3S99A 5JY6A 2P5TB 4IDCA 4RENA 3CEMA 4NE9A 1G9TA 3WB9A 2ZBRA 2RHBA 3TZCA 1GTRA 5EZSA 1TJYA 2EWVA 5BNTA 1PSZA 1KRWA 3EXHC 1UPUA 4J2HA 1EK0A 1H4QA 3GLFA 1P62B 2A9VA 2BTQA 2PLWA 3WIDA 3K0SA 1NVVR 1PSDA 2C9MA 4IDBA 2G36A 4QAJA 4DV0B 4JC8A 1GPKA 2J9ZB 4H27A 3W4IA 2ZJ2A 3HBNA 2HT1A 6PFKA 2IP1A 1OYWA 2AG1A 1GNPA 2IHKA 2RKOA 5DBOA 5TPZA 2B25A 4ECEA 3CUUA 3RC8A 1GQQA 3W3AA 4TROA 3FSGD 1Q1ZA 2BELA 1AZSC 1W8IA 4HH3C 4RPCA 3UJ8A 4PLTA 5JV5A 1YZQA 5TQ0A 4EW1A 4MW6A 4Z0HO 1QO0D 1R4MA 5BSMA 1XKTA 2F8MA 1GTL1 1VC2A 4LCBA 4X60A 1RRGA 5LKAA 1HX7A 4OFWA 4D9EA 1O1YA 4LHSA 5HM6A 1LBIA 3TVTA 4BFXA 2Q41A 2VF8A 2X9NA 2WF7A 1DUIA 2XIJA 1T1GA 4BMCA 3RFTA 1SKYE 3GAFA 4PRLA 1D1QA 2WQ6A 1DLJA 4GLFA 2VXBA 4FU0A 5T4FA 1ZJ5A 3W9YA 1GYRA 3D7NA 4O4JF 3C97A 1VE3A 3EQ9A 2ICAA 2XLBA 4QOJA 4P5EA 4AO7A 3PHIA 4TXNA 1H1LB 2YXEA 3RYFB 4J16A 4UMDA 1K9VF 5GWXA 3OETA 5E6UA 2GZ2A 3OZWA 2B0JA 1KKMA 2ZYWX 3B53X 3CH6A 4FFRA 3TM4A 5A5DA 3R0QA 4IMPA 4ICIA 2I4IA 4ENTA 2IPLA 4N3GA 1Z0SA 2QX4A 1VHTA 5LZ7A 4K9LA 2VWQA 4K2AA 2CNWD 4K2HA 3QX8A 5AIBA 5HTKA 3U1VA 2UVQA 3BQNB 1MAWA 3NHSA 1KSGA 2X3UA 3UJAA 1SCDA 1WXEA 4C07A 1II0A 2AJCA 4BGEA 1ZJWA 2FEPA 2OWDA 3KJEA 3AHHA 2NO9A 1EUYA 4II2A 3LNCA 2AFHE 2XUHA 1W36B 2JFZA 3HKCB 1P80A 1G9XA 2ILVA 1JE0A 3H42B 4JC0A 5KTTA 4AMYA 3OZIA 3B6IA 5J5VA 3DHNA 3RKUA 4NR0A 3COJA 1WOYA 2R4TA 2LUOA 3TNYA 3AVOA 3GWGA 3K9FC 2GVZC 1OR8A 3OY2A 5FNVA 4DDTA 4I5GA 2Q1XA 2I8AA 1AV7A 3VZDA 4PYMA 3U3ZA 4Q9AA 3KCNA 3B13B 1SUWA 3DLIA 3B7WA 2L17A 4MUFA 4NZYA 1R6BX 1ECFA 3OPYI 5DMHA 5AOBA 4UUMA 1INLA 1ZNQO 5JW6A 2JH3A 1AA9A 2X2OA 3OQHA 5HZHA 3RARA 2EG5A 1SJ9A 1CP2A 3OZSA 1XZIA 3H65A 1QZUA 3INTA 3G68A 2QTVB 3R3JA 5B2ZA 2OGSA 2PVSA 4M9CA 1G7RA 5BRJA 1X7XA 3Q8WA 4BBZA 4DQVA 5HTOA 4HL6A 2XRZA 4F38A 1AK2A 5LD2C 2PGIA 4LF6B 2O2HA 1UM9B 4YAOA 4EMBA 1VZ3A 2HIHA 4YJ3B 3OKPA 1X14A 3K6KA 3R6TA 4IDPA 5EJ7A 4LGVA 2JA1A 3H5LA 1KWKA 4NL4H 4YJGB 2GJ9A 1EE9A 4RZ2A 3I61A 3MWEA 3ZVMA 1RQLA 1FDWA 3N70A 3O8BA 2JPDA 1HYGA 1O95A 4KWIA 2ENWA 2F43B 2QZ4A 4IEIA 5EJFA 4B4UA 5DCLA 4BO0A 3YASA 2A58A 1XPOA 1THGA 1YCFA 1T8SA 1EVQA 3K0FA 5DTEA 7REQA 1EK2A 1U9JA 2EXXA 2FFAA 3FGOA 3NBYC 3X1XA 5FD8A 3UMGA 3H5TA 3R76A 4A5SA 4HFRA 3W5HA 4JBIA 2PX6A 3UK1A 3QYFA 3RKRA 1HRKA 1JR4A 1BCSA 4X8LA 5HILA 5FBZA 4OSPA 2XADA 4L5YA 4PAGA 2Q3BA 3J80A 2MJLA 2H4WA 1PS8A 4WY2A 4ZQEA 3K73O 4EO4A 5FOQA 1E2QA 5KDDA 2XNJA 5I4BA 3EOBI 1SU8A 2ANBA 3GJXC 3I92A 5HRCA 2WT4A 4CKWA 2B37A 4LJ4A 1JLKA 5JJIA 1RC8A 4CL3A 1WZCA 3GPCA 1PZEA 1UKAA 1QYVA 1SCKA 2G08A 2QZZA 3RS7A 3HR8A 3MMPA 1Y48E 1O6FA 2CNDA 4RO0A 4BNVA 5JISA 3DL7A 4LJSA 4V02A 3D31A 4M0LA 4FNMA 4JSRA 2NTNA 2WJ4A 3CJQA 2RHRA 2X5XA 2P7IA 3JRWA 3PNOA 1DJPA 1FPMA 3PC2A 3DCIA 3LX6A 3E9YA 5KOYA 1ZNXA 3D3EA 4HB4A 5KQLA 1XJ5A 2JRCA 4RA9A 2QYTA 4XGKA 1MJGM 5AM1A 2ZATA 1YRLA 1LPSA 2OV1A 3ZV6A 2GN8A 1DAEA 3CEJA 3PDWA 4HDCA 3FD8A 2V1XA 4JV5B 1NBMA 2DUUA 3I2FA 1YJXA 4I6GA 3CZMA 4V0SA 3FCYA 3CMMA 3J7AC 4K9NA 5AM5A 1HQKA 1TOAA 3P2OA 5IVKA 1GPYA 1Q21A 1L4MA 1XSEA 4EUSA 1JQ3A 3L8CA 1RE0A 2JHFA 5TVKA 2JBAB 2YHIB 5KTRA 4LKRA 5J2UB 4GM1A 5IJWA 4GQBA 4H60A 2UUAB 3VU8A 4CLOA 3PPWA 4MX8A 4IX1A 1JDJA 2NNLD 1SCIA 2OFWA 4P9NA 3NHAA 5BSTA 2CD7A 2DT5A 2H18A 2JIRA 4FP9A 3PQFA 5TQ0B 5GONA 3SC2B 4H08A 2PRKA 4ZDJA 5ADHA 4MEBA 3BIFA 2C9ZA 1N2CE 4RMJA 3CVWA 3FRHA 3IA7A 3TJZA 1C50A 1L5RA 3IB6A 2DWOA 3U39A 2R79A 3PNLA 4ZT2A 3WO1A 4F8EA 2VK2A 4W5OA 4GYYA 3SQNA 4Q7KA 3VH1A 3DZHA 4LJLA 2SBTA 1NRWA 3QWAA 1PZMA 4U5XA 4URUR 1KMQA 3N8IA 3WYEA 5KSYA 2FYTA 1QWOA 2CVZA 4UBJA 5GMOA 3V55A 4UM7A 2ZXEA 4O59O 2YH2A 3L0OA 1D07A 1EJ2A 2P0AA 2DXIA 1FDUA 4F1JA 1W4CA 1Z13A 2BI7A 2ZTHA 1ID8A 2HQSA 1Z0UA 2VOJA 5KBYA 4O3MA 5ARBA 5BOVA 2OCAA 1WPRA 4Q3KA 4Y3UA 4MKZA 1VJGA 1Y7HA 4NE7A 1H93A 3DO8A 1U3CA 3ZDZB 2A9JA 5AJTA 1E63A 2NYRA 4O25A 2IYTA 4PZZA 3TZ6A 3FFBA 1UXKA 3M0EA 1CUDA 3QEBZ 1FMLA 4B6OA 4BOYA 2QA5A 4MLZA 1NT4A 2IHVA 3DJFA 3I2GA 3IAUA 3PWKA 3V1TC 3RF7A 3BOSA 4FR5A 1EP9A 3E0QA 4M7RA 1WOMA 3UGTA 1P75A 1SZPA 2EZ8A 2VZEA 3WLFA 5LLTA 2JAPA 4RJJA 1G18A 5EXEA 4W1QA 1W87A 3WGNA 5B7NA 1TK2A 3OMXA 4ZPXA 2H7CA 3EVNA 1WETA 3L41A 1KJWA 3FNHA 4PQYA 1X19A 1BRMA 2R6R1 4F7WA 5J23A 4I36A 2HU8A 4GEKA 1BMTA 3BD9A 4QVKA 2XSZA 3HACA 1SM4A 1U5CA 1ZRHA 2B2XA 2ZJ3A 2YWJA 3VR4D 4JBYA 2BH2A 2GK4A 1PQ4A 1V1RB 1XJWA 4HG2A 4DW8A 5FFNA 2C4UA 3OIUA 3MF4A 3JQBC 4IGIA 4Y9UA 5EP3A 1GCUA 1V71A 3IJ5A 3ECCA 4Z4CA 5TQ2B 2PUHA 3KV1A 4M8NE 4DIEA 4OHVA 5IXJA 3L8YA 4MVJP 1JEJA 3MJCA 5AK6A 4G0WA 2Q7XA 1KMMA 5MGBA 1LI7A 4QTUB 2NP6A 2HJVA 2OESA 1EMDA 1QGYA 1UXIA 4HR7A 3T9DA 4EUFA 3U16A 4DLXA 2JGMA 3RRFA 1MZPA 1J09A 1M6HA 2F59A 1WNFA 2X1MA 4F97A 4ZGGA 3ZU5A 1I2BA 4JLPA 4LOIA 3DPIA 3PGJA 3ELYA 1DG1G 5HGJA 2ONJA 3L1VA 3UCXA 3VYTB 1DJOA 4AO8A 1Y3IA 2DU8A 2BMDA 4NOLA 1IJEA 2Q1YA 1NKVA 3HP7A 5H9WA 2V5AA 1MIOA 1Q15A 3RG2A 1YASA 2NZ8A 2GBCA 2V55B 3F6BX 4YGXB 4HMPA 4MV6A 1XN1A 4CXMA 4E33A 3TMYA 3T1YB 1O0SA 1QE5A 3LDGA 4LAFA 3RSLA 1XCMA 2OUIA 1CY6A 2IW1A 3FN4A 1KERA 4TL9A 3S28A 3Q2KA 3JYNA 1HLGA 4RVNA 3FB1A 3N7UA 4TYQA 3AU9A 4J07A 3VKFA 1OXUA 4LJ6A 4RW0A 3IEVA 1CLUA 3HC7A 2N1BA 3PD0A 1GRNA 4WZAE 5AVRA 2ZYSA 4YASA 3TNFA 4PSAA 5HDQA 5F1YA 3CNLA 3G9XA 1U3WA 1ISHA 2VBFA 1TTHA 4TT8A 1F8YA 1W85B 3D7MA 4DJTA 1ONBA 5CXUA 1U7WA 4PYNA 1Y5MA 5ALSA 3DYVA 2WJYA 4HNUA 5JH7B 2NO6A 3E3OA 2V6GA 2HCFA 1F0YA 2XE4A 4RVHA 1C7QA 1E59A 1VI5A 3E5NA 3QXGA 3WL3A 1MKYA 2X8BA 3HRKA 3LFUA 1CK4A 2AOXA 5ADUS 3RLIA 1NQAO 3NASA 3RYHA 1E1KA 2N46A 3K15A 4KX3A 5LR6A 1WCXA 3GDHA 5BSRA 3GNLA 2BL4A 4BDSA 2IDJA 3TSWA 2PPVA 4QQNA 3GN1A 4ZEWA 4ND3A 4QATA 1J2UA 3OQ6A 1RM4A 1Y34E 1Z4PX 2PZMA 4J4TA 3N86A 3LL4A 4MKHA 2IYLD 4HN4B 4M8KA 2PH5A 3E2PA 3TW4A 1U2RA 5IBQA 5IDVA 4B4VA 1RWQA 4M22A 3PYLA 3RUHA 8AT1A 3K70C 4ENSA 3U7QA 5K0BA 3HRIA 3ILXA 5CX4A 5HR5A 4IH9A 1BW9A 1CKEA 1FS5A 3AK4A 1H0RA 1FPQA 2IVZA 2YUTA 4GPIB 3W78A 2JK1A 3B70A 3ET5A 3OIGA 4QPJC 4GLJA 4BFYA 4PLCA 5C3MA 3LPNA 4CBVA 2FG5A 2FRDA 1SCJA 3IR7A 3HDVA 2PH3A 3FNBA 4MGEA 4AJOA 3OT5A 1D7OA 2QMYA 1WABA 3BDIA 4Z99A 3UW3A 5IM4F 3SFTA 3ETLA 5AI5A 1MX5A 4JLUA 2Q3DA 3IEMA 1WDWB 5C81A 4Z1MD 3M8KA 1A0OA 4OHKA 1XGKA 3FZGA 4BC1A 1W49A 1N1GA 5BVGB 1P6UA 1QYXA 3EJWA 4NX2A 4EFLA 1OQAA 3HB1A 3EX7C 5HK9A 4MKFA 4XTRA 3KOMA 1Z0KA 4ZCIA 2YXLA 4YLEA 3DV9A 4MRMA 4G0UA 3IP1A 2OHGA 1QZ3A 1MB0A 4QAQA 4CV0A 1D4AA 1I5OA 2CV2A 1PCXA 1Z06A 2GBLC 2P78A 2R86A 2P2NA 3JYPA 3NONA 1UXOA 4KODA 4B76A 5K4GA 4EGFA 3V3KA 4HUQB 1W5BA 4XX0B 4C01A 1V6CA 4GMHA 2H0AA 3I64A 1LPAB 3PSHA 2ZWOA 2JASA 3AFNA 3FHOA 3L1JA 2Z2XA 1FXWA 2P62A 2ILTA 3NCHA 5C8YF 1R27A 3BN3A 3TLBA 2WSLA 4DIDA 1K8QA 4I19A 1CR6A 1D2NA 3U48A 4GLOA 4EJSC 1LC3A 1T4CB 1O94A 3WGMA 2P75A 3MZ0A 2ZRLA 1CY1A 1X3SA 4INAA 1UZUA 1OZHA 5ALZA 3TUZC 1ZCZA 3PCTA 5HJ5A 3BWYA 1H2FA 4PAWA 3GLIE 1VIDA 3RNOA 4QU5A 2ZSDA 2QXYA 3D6TB 4MUJA 2R8OA 4B6RA 5FBVB 1HT0A 3SYNA 3D6JA 2Q6TA 3CINA 3W6NA 1Q83A 4QOGA 1W5EA 3ISTA 2XBLA 4XCQA 4HQLA 2RI6A 4JK3A 4JI8B 4DDHA 3GJSA 2HJ9A 2WIKA 2X1VA 2CJFA 1E9CA 3QY0A 4ZKEA 5F3WB 3KSBC 3ND6A 1NMXA 4JJZA 1NN1A 1XZCA 4XDZA 1PT9A 2O3QA 3BF7A 3DFZA 1PEYA 3MJ4A 1C0LA 2IC5A 3RSHA 1CS0A 2X9QA 3JQCA 4IIHA 5COBA 2FN9A 1ZPDA 5EI5A 3TVDA 4COKA 4K9MA 1U6KA 3EY9A 1CYEA 4FYKA 1Z34A 4MCIA 5ALTA 4EYQA 2H52A 4QO7A 1KO4A 3MJFA 1WY5A 4BQEA 3UGJA 5BSVA 3I6BA 4AY5A 1MN6A 4DXDA 3V1KA 4A0HA 1SH7A 4HNTA 2VSXA 4U1RA 2FK7A 1RQRA 3VUEA 2YV1A 2XUZA 3GXBA 5JAUA 4JZKA 3WLLA 1XD9A 4WNCA 2VZ8A 3G89A 1G5FA 3TDNA 4CIYA 5FAXA 3GLHE 4DDMA 2BI4A 3Q7RA 1UMKA 4NJEA 1DKQA 2HU7A 2YHAA 3OBIA 3B3FA 4LZWA 2XZPA 3SXUB 1ZQ1A 5HG0A 2C8VA 4A26A 3O74A 3MLAA 3AI2A 1C80A 2YR0A 3OCCA 3DMGA 5COQA 4XWWA 3R3ZA 3O8OB 3VU1A 3K1JA 1PG5A 2ATXA 2YNMD 4YCNA 2WAXA 4EHAA 1BDHA 1C2YA 4ZTBA 1G63A 2OB2A 1G66A 1XQ1A 2BFDA 4HGZA 3RK0A 4C87A 3LHFA 1YVEI 5JCJA 1JG6A 3O92A 6ADHA 2INGX 4NESA 1O97C 4EHNA 2BV3A 5L6LB 1G2PA 1C9KA 2MWMA 4INPA 1Q5PA 1Q1QA 1RRPA 4G0YA 2YIJA 1UMCA 2WMDA 3FMOB 3WR5A 4I8IA 2JLVA 1CRPA 2FDRA 2C99A 4ZU1X 5KPJA 4BE9A 1K27A 4DHWA 1EFPA 2YXNA 3HY6A 4KFTA 5F5LA 5LXTF 1GCGA 2DCMA 1SPBS 2AMYA 4A8PA 1QKKA 3QFTA 2OXCA 1HEIA 1YA6A 4L3WA 3FGNA 3OFND 3U4QB 2CLKB 1IBRA 4XWGA 2XMRA 5JNWA 3RIMA 2QS9A 1HDCA 1M54A 3QVGB 5HPYB 5DGTA 5L45A 4X8HA 1C8VB 2CNKA 4EJSA 3HDGA 4UASA 2EDAA 4B3MB 3PNPA 4IQGA 4AMGA 3UEOA 4HDNB 3ETNA 3Q7TA 4PZUA 4CLDA 3T95A 4HJRA 3UKOA 3Q98A 5JARA 3TPFA 3RNLA 5L3QB 2C5FA 3H5RA 3DZKA 2R62A 4GVPA 1GGJA 2PYDA 5AW5A 2NUPA 1HFJA 3IE1A 4DAOA 1EDEA 3H3JA 5JD6A 4DQLA 4DYVA 3VTFA 5CPBA 1M2OA 4O4JA 1UBTS 2UYYA 4L5IA 4OQ4A 4HB2A 5EE5B 4REQB 1WXXA 3RVDA 2VH5R 2O3RA 3MTDA 9GPBA 5DI3B 1YQ9A 3DXZA 4D8XA 4QVGA 1ZHHA 4FGKA 1IFXA 5FCDA 1KI3A 1ZVKA 3D5QA 5EIBD 3RO7A 1GT91 1UWVA 1JHRA 4R4JA 1G0NA 1KU6A 2ETXA 1PZGA 2UZIR 1JG3A 4WZBA 3UHPA 3ZEIA 4PG7A 5B58T 4JI1B 4PZYA 2QI9F 5CFLA 3BWCA 2OBYA 3GEHA 1H6DA 3P19A 3IR5A 2XUPA 3E7WA 3NXSA 4QASA 5EUMA 2IYPA 1ST2A 3H5AA 2COKA 1NXVA 3MIIA 2IOQA 1F0PA 1SKBA 3W7VA 3C3XA 4OGKA 2RI0A 5DNDA 2IV3A 3ETDA 2LDBA 1RVV1 4OA8A 4TS4A 1IB0A 4EB6B 1G6Q1 2VF7A 4K7JA 2P9FA 4KIUA 3WBJA 4MJXA 2NWQA 1Q0HA 4XDGA 2W0MA 3WHPA 3ZU2A 2BZGA 2EZUA 3NI2A 3D3WB 5F3RA 4AB1A 3T12A 1M67A 1XO1A 4ZDWA 2VH2A 4V38A 1U2EA 1SQ5A 1T5TA 1LX6A 3E22A 3KPJA 2WBLC 2NU6A 4IHKA 1G3RA 4O4LF 5D7NA 2VZLA 3E2IA 4MJ7A 5JSYA 2KBEA 2PUFA 1CZHA 4N3NA 4IYRA 6GPBA 2JIMA 1OC2A 1SFRA 3LC1O 4DYDA 1U2ZA 3ONVA 1I7DA 3ICEA 1CQZA 3QX7A 2GBIA 3TLMA 3QUTA 2BHRA 1ESNA 2B3DA 4F21A 5HSGA 1NMZA 5AW7A 3GEEA 3CPHA 3LUFA 1J23A 1MGPA 4Y2YA 4BY9E 1W1IA 3R44A 4QL3A 2V7TA 2XKJE 1OBFO 2OQ2A 3GU3A 1MXFA 3ISJA 3MIZA 4EZIA 5DBFA 5HUHA 3KTAA 1FLVA 1GN8A 1T1SA 2Q4OA 1A8PA 2BBWA 4J7UA 4X7MA 4FEEA 2QP4A 2XMGA 4WH0A 2D3TA 3WFJA 4TM8A 4AF8A 3MGCA 2DPMA 2QUIA 4DABA 3LYAA 5B1HA 1PE0A 1F6WA 2BGRA 1SN7A 4FIZA 3WYNA 3GUYA 1MQ8B 5JALA 1G8GA 5CTAA 2AH5A 1C30A 1YQWA 3UAXA 4D96A 4HMOA 2QIOA 1AUOA 3TTXA 2EJUA 4IDHA 1CRWG 3O1IC 2EFDB 2WF6A 2C2YA 1H0SA 1SXGA 1YDMA 2QXTA 2I6QA 3N7TA 5B3JA 4UHKA 2YICA 1RXVA 1IN1A 5H70A 5C1BA 3RVSA 2ZI4A 1AY0A 1GV1A 4I1PA 4U8HA 1DWPA 3RAGA 3O03A 4QA9A 5ENVA 2CLEB 2NUPB 4UNIA 2XQKA 3STTA 2VAMA 3HJBA 1WUKS 2Q5LA 4QHTA 2QLTA 3HCBA 1D2RA 3BUSA 4LHZA 4NV0A 3WDMA 4YYEA 3E4DA 2Y1GA 3NGMA 3R6GA 3IGFA 4M9RA 2V96A 2D8AA 2NU8B 3ST7A 3NM5A 2C9BA 4ND7A 4ZOAA 2IGTA 4FKMA 3WQQA 4GRIA 4WD3A 3VYVA 3SSAA 3W0LB 2XB4A 1U98A 2YVLA 4XA8A 5FXMA 3PJFA 5F5XA 4CM7A 2WNIA 3FLAA 2HPHA 2BTEA 5KKNB 3NKFA 1FYFA 1P7CA 1QHYA 2W2LA 3P9QA 4YMVA 2PO7A 1Q0TA 4QYMA 5CFRA 2EBWA 2WKRA 3LKDA 4PFKA 4U63A 1KE1A 1UKCA 2G9NA 1L4EA 2XEXA 3SBDA 3TQSA 5JZSA 5KNBH 1W94A 1IM5A 4OHPA 4GC9A 3EFOA 1KEVA 4JLSA 4W5NA 1B93A 4U7HA 2AUTA 3CO0S 2BF7A 4N12A 1Z3IX 3PUZA 1N6HA 5DBEX 5AW3A 2C4KA 1G59A 3HO1A 4DLLA 5CA1F 3CEHA 2CSUA 3DVQX 1A98A 2FWMX 2P4UA 3QI2A 2X5JO 3HE3A 3MGBA 4OGWA 3ZDYB 2PKQO 1B4DA 1J39A 1FE8A 2VR1A 4JP8A 1XYYA 4HNAA 3WA6A 3GJ3A 2BKVA 5G41A 1PR9A 3W2IA 1NURA 2QAGB 2QDKA 4GF5A 2PAAA 3FOFC 2JEOA 2BM8A 3UOAB 2IIPA 2H08A 4L8FA 2QZSA 3DKVA 5G53C 1Y6GA 4OU5A 3MGKA 4Q3AA 4J2TA 2WAAA 1QMGA 3C48A 1XA0A 2HBQA 3EIUA 4QYTA 2WWFA 3QIAA 4B81A 4MVWA 3QF4B 4G26A 4F3KA 4AI6A 3GGJA 1WW8A 5LQMA 1Q19A 1KH2A 2DH6A 1OLUB 2NZXA 3PDJA 2I55A 3RDPA 1Y5IA 4R16A 3RC9A 1DMSA 1GAEO 1T4MA 2ZR9A 4H77A 1U2QA 4K6FA 4F4FA 2X13A 1D0IA 4KREA 2A1TR 5E7QA 1ONOA 1AZLA 1YMQA 1ZY2A 1T5HX 3N59A 4BLQA 5DNUA 5CFOA 1U7ZA 2VA9A 4J91A 2KX7A 2Z1DA 3DNFA 1ZSVA 5JHGB 2QN3A 3SZGA 2F00A 1C3OB 3I04M 1A5ZA 3DAGA 4J3NA 2BP7A 1E4YA 1V8FA 3EZYA 2HMYB 4HAYA 4NH0A 1WF6A 2QT9A 4B79A 2DWPA 3IDAA 1O6BA 5HIKA 4C2BA 1QZZA 4P7GA 1UBOS 1WHSA 5JBNA 4ZAYA 4MA0A 2HD4A 4IQ0A 4Y7DA 5EWJB 1E2EA 1NVWQ 3QBEA 4HS9A 5EJGA 1IM8A 3OA2A 4XRRA 3UW1A 1JZTA 3ZQ6A 4DCMA 3OFJA 1G291 4U7WA 5AXDA 1KJ8A 4C7OB 5EQTA 2G0TA 5DT9A 1I3LA 1XTJA 1VYTA 4HDSA 1VE9A 3KQPA 2D4HA 5FF9A 2IYNA 5C4IA 1RQNA 1NPYA 2G09A 1KDVA 1P39A 3MTIA 4G1MB 4DPKA 1IY0A 1YNSA 2BDUA 2Y6VA 3F2VA 2XDWA 3FDJA 3QFSA 2WPNA 1E3QA 3GK3A 2XJ9A 1DL5A 1VCOA 2VQ3A 1XTVA 4I2VA 4OAPA 1EJ6A 3R5SA 4AT1A 1D09A 2QQ0A 3ZUPA 1VPLA 4CM1A 2ETVA 5EYPB 1OLXB 2CJWA 4TKZA 3ZEAA 1TFUA 1KO7A 4NMWA 1DGQA 2FUNB 1GUYA 5K2MA 5ECDA 3PWSA 4FMCF 4MR9B 1J5PA 2BGMA 4YRQA 1PUXA 2CEAA 4KVFA 5ENDA 5I9LA 3K31A 3DL2A 4F92B 2B1IA 4GP7A 1PQYA 2QPOA 2NUAB 1WV0A 4MH0R 1XMIA 1NFRA 2AMLA 2DGDA 2IYEA 4UTVA 4M3NA 821PA 1K7CA 1E6LA 3AC0A 4MUAA 2I4LA 1MT3A 4KE8A 3UAVA 4DS3A 2UXCB 1YV9A 4ZCPA 4GVXA 4CQLB 4HNSA 2B61A 5IAJA 3VNBA 4BO9A 1QQBA 2Q5IA 5LSAA 2YJGA 1LH0A 3Q3IA 4P0TA 5DW0A 2O3UA 3ZCXA 2H11A 2H1IA 3SHQA 5EMJA 1X9HA 3EJ6A 3ETHA 2V0CA 2XYGA 4WY5A 3ZLJA 1MO2A 3GJ6A 1IVNA 5LP1A 4NYIR 3I01M 2BFFA 1CV2A 2IODA 4G4SO 3IIMA 5AWFC 4NMHA 5EZYB 1GLNA 1LNQA 1X1BA 2WP8J 3GEGA 4Z9XA 1OX6A 3DAPA 3KB6A 1Z37A 4PRKA 1SR8A 1QRRA 2FE4A 4RK7A 4EGSA 4B35A 1EM8B 2B7CA 4RKEA 4BJHB 1GL3A 2O7NA 2RGCA 4LMBA 3GVPA 5KMGA 5J63A 5CGQB 3NG1A 3VPSA 2XNDD 2JCXA 3D1JA 3O47A 2DLNA 2PUVA 4JLBA 1Z4QA 1JDSA 1DTEA 4PO9A 5JYEA 2VKQA 2YFQA 1YB5A 5A4KA 2QW8A 2R2AA 3I52A 1Q2XA 3HZRA 4YNBA 1SXJD 4DLNA 5TGDA 1P2VA 3SJBA 5D1HA 3GV0A 1JBEA 3WJ7A 2GHTA 1NBWB 2DBVO 2WM3A 1BWSA 5MN5A 1Y9AA 1G19A 2J31A 3R7LA 2XWSA 4KGDA 1GFIA 4TTSA 1GG9A 5DLEA 9ABPA 2W42A 4TYWA 3CNNA 1W9MA 2XODA 3A6EA 5D5PA 3FBTA 5CB4B 3NM6B 2IUTA 5AT1A 2QX7A 4M7WA 1KVUA 1S2GA 5C35A 1IVYA 1TZKA 3LKVA 3QFFA 4GS5A 3DUFA 3ZZUA 4K03A 3R3HA 3RB8A 4F5DA 5LQKA 4KPEC 1WVMA 3ZVKA 2X8JA 5B64A 1YTLA 2IT1A 2YIMA 5C0OE 2V6IA 2H9AA 4GXTA 1KQ3A 1PYGA 1OCEA 4RTQA 4L08A 3WMXA 4EI2A 5EEGA 3RVJA 2UXDB 5GY7A 4FLFA 1N2HA 2VNIA 4LV5B 4UVEA 3NNSA 4PICA 3UK0A 4ZK2A 2IOFK 1MB3A 1RTTA 4PPFA 4NYJQ 4AKSA 1HQDA 3DCJA 4CZ2A 3F8TA 2Z04A 2VZ9A 1AS0A 3LNTA 4GMFA 2BEUA 4JASB 2FZCA 4L4RA 1DEKA 3HB0A 3HR4A 4Q00A 4M8IA 1VPVA 5DLDA 3UT6A 1AGXA 1RKBA 2DTXA 5B58C 2ZYAA 1QIJA 2FR0A 2GSDA 4EMSA 2IBTA 2UUOA 4P33A 4C22A 1T2EA 1VMEA 3K6SA 1NX9A 1GZ3A 1KVRA 1TK9A 1Z0FA 2W37A 3IR6A 3OZVA 1JEAA 3RQIA 3ESBA 1SBYA 4AKHA 2C0PA 4X65B 4YV1A 3T5MA 1WR8A 1AKVA 1OV6A 2RBKA 4UEQA 4C4AA 1ZAYA 2I9KA 2QL7A 4CHTA 3AVPA 2G17A 2A84A 1YA8A 4I4TA 3TR6A 1JHQA 2VPTA 3K4PA 4HH1A 3ZD9A 4JHXA 1HOXA 1NC1A 5KYNA 2OFPA 1I3OA 4IX9A 1T2VA 4LOJA 1L1RA 4RHUA 1XTPA 2ZYHA 5DPMA 2B6HA 1PW5A 1D3AA 1JDBC 2Z5FA 3AIIA 1OUMA 5ECWA 4MRSA 2RGAA 4KXUA 3T9BA 3KKQA 4AJPA 4BIMA 4DZZA 5L3VA 1PF7E 4HVTA 4IF4A 4UVIA 3W90A 3MQ2A 4EEZA 3IRUA 1LF0A 4CF6A 3LP6A 5BUSA 5JI2E 3MLBA 4E3ZA 4KWTA 2WSSD 3BAFA 3EZFA 4DA9A 1I6WA 1W19A 3E4CA 2WHYA 1AMUA 4N18A 2ZB2A 4OUDB 3V4FA 4AKGA 4GSLA 1PGJA 3OICA 4LYYA 4BMVA 4P92A 4RZQA 3ITEA 5U1PA 2OD7A 3K20A 3KR1A 5CNMA 5JWRA 2XDYA 4YMHA 2D00A 3HP1A 4MDFA 5L3RA 4OYRA 4AN0A 5CMLA 2QLBA 4GNKA 3EHDA 3SBOA 2EG9A 3QXHA 3IDSA 1P4SA 1N9ZA 4GLBA 3W4KA 1KIAA 5DCWA 5KTSA 5L95A 1Z6YA 4E70A 1SCUB 3GGPA 5B57C 1IZ9A 5BT9A 3CZCA 1FL9A 2WMNB 4EG4A 2R3SA 1CLEA 3OPMA 4JI6B 3IEIA 5C32A 2HPZA 3TEJA 2KBFA 2SKCA 3IBGA 5ALMA 2R1UA 1G21A 3PHLA 3L4SO 2GJ8A 1GVHA 3V42A 5FBQB 4DIBA 3OTHA 1KZ4A 1TEZA 3OZFA 1VXOA 4UM8B 4GX5A 4KE9A 3EUFA 3T4UA 1U0TA 3OT4A 3TRDA 2PGDA 4EX7A 3NH9A 1T43A 5I9BA 3W8NA 4AX4A 1HFKA 2ORVA 2WZQA 1KS9A 2PWPA 4R98A 1T3HA 3DHEA 4AYWA 4ECAA 2P40A 1RM5A 3DE7X 2C4TA 1G42A 4WCVA 2IV2X 3WYCA 1H42A 2GFHA 1NSYA 3HCNA 5AJUA 2ZM5A 1BVYF 5AUPB 5EPOA 4MYHA 2LZ0A 4D57A 3CUYA 5LCXA 1OOEA 3OZAA 5JADA 1G7SA 4Q37A 4XD2A 2VQEB 4ALLA 3S2GA 1O96A 2GASA 1SKYB 1EGMB 2RGNC 1QSGA 1MA3A 5CK5A 4ML3A 3EF0A 4BWGA 5ECYA 5KU1A 3G2OA 2Z9CA 3NXKA 3SHWA 4Z6KA 5ED4A 4CKBB 2GM3A 3DTVA 3IPLA 3QWIA 2JGFA 1Z25A 2J3JA 3JTEA 2IH2A 4QU8A 2D5BA 3P0EA 2O7SA 2D2EA 3QWBA 3KTDA 4XUGB 5BURA 3WBBA 2I8LA 1G98A 3PEUA 3G9TA 1X9IA 4CEIB 1IAVA 1CJTC 4ZT6A 1RWMA 1X13A 3AFMA 3NIBA 4UDNA 2X5NA 2WF8A 4KC0A 4GXNA 3PWTA 5ERGB 5EJAA 1MW8X 3BRCA 1UP4A 2P9JA 4YREA 1U1CA 3UV6A 3H9EO 1FK8A 3A9TA 2J30A 3QMPA 2V3VA 5BW5A 1VBMA 1ULUA 4AC9A 3MCUA 1KFBB 3UF0A 3OTOB 3ZCVA 3FMFA 2WWVD 1CP3A 4OCZA 1PBNA 4Q3LA 4FI3C 1UKYA 4BVEA 4BVJA 3U6KA 1OH5A 4HDSB 1RHMA 1XPJA 2DMRA 1CCWA 3OLVA 4LZZA 4NF2A 1UAYA 3GJ8A 2RAPA 4D1YA 1CUZA 4ZYVA 1R6UA 3GRRA 1GAWA 5JPIA 2OPBA 5K0NA 5CDSA 1QH9A 3JS5A 4J7AA 4Q4LA 3HY4A 1DWQA 4EG6A 1S1CA 2JIZA 1ODKA 3H7AA 3TSYA 1VLLA 2Z5GA 1LDMA 4WCFC 1E79D 4LZPA 2DTDA 2BRUC 2BSAA 4K9OA 4TS9A 3ZDBA 3T3MB 2B1QA 3FFXA 3DFUA 3HUDA 4OY3A 4Q1AA 1I2CA 1MV5A 2ZWIA 3H8JA 1A2BA 5GJWC 1L5SA 1XAJA 1C2TA 3BYZA 4MKGA 3RTEA 4ZGBA 4ZU6X 1L5GB 3R5FA 4WBNB 3C8ZA 2P8SA 2ZIUB 1HTWA 2W93A 3B20A 3UVEA 2VCEA 3BMNA 3OZGA 2XOXA 3QYJA 4IDOA 4E14A 4KIJA 2XB6A 3OF5A 2FPOA 3PD7A 5FWAA 3SSOA 4CLXA 4KYIB 4CL2A 2ZUFA 4WGGA 1YJCA 2LR0A 3MD9A 2W58A 3ANNA 5FUYA 3TNDA 3N8GA 1YONA 4ZYLA 1Z0JA 1JZQA 1Z28A 2D1TA 2A1IA 2BDTA 2GCNA 3KHSA 3QV1A 1QB7A 3ZD8A 4EG0A 4ALJA 1DJQA 1N7JA 4MZDA 2F3QA 1JW9B 3PX3A 4YRJA 2YWBA 2BUBA 4RK1A 3C7AA 4AULA 2X58A 5JO0A 1XMOB 1J9EA 1GU0A 1LTQA 4BZQA 2V9CA 2OVBA 4YRKA 1P4JA 4O63O 3E9EA 3KQKA 3LDAA 4E5DA 2H1SA 3D0OA 3R7FA 4IF6A 3GOHA 2XKKA 4YAIA 2VATA 5HCIA 3T7IA 4BCBA 2Z83A 3BMOA 3ENVA 3OZTA 4FFNA 3UG6A 1ADBA 3INGA 4TQAA 1DQSA 4C3OB 2UAGA 4BGDA 4OVKA 2VO1A 3MD0A 5L4SA 4RORA 4RK6A 4TX1A 1KAEA 2NSHA 2XA2A 2HXSA 3GXOA 4JLKA 1A7AA 3CCBA 1FP6A 4G23A 3DBLB 4JU8A 3IJRA 1XEFA 3FFTA 4KAAA 4QYSA 3WVNA 4BNIA 3AVUA 4WXEA 1YVPA 4CEHB 1ZGJA 4YP1A 1PHRA 3CISA 2JAWA 2JFHA 3EGXB 4JSTA 3K0EA 2WK1A 3L18A 3GGOA 5FTWA 4P0QB 1PNQA 1A3CA 3KFLA 3HKCA 3LY7A 3QK7A 3U7JA 3O83A 5FTLA 4MVJH 1K7EB 1US8B 1LBTA 5KVAA 2RGRA 3A4IA 4GQAA 1ST3A 2Y1LA 3UZUA 4WV3A 3C6MA 3H5NA 3JV7A 4LVUA 3VPAA 4E32A 5CD9A 3OQNA 5H82A 5LD2B 1B8PA 2V58A 3BIXA 1W5TA 3AVVA 4LG1A 1N8TA 4Z3KA 4Y2SA 1L8AA 2FWPA 3TZBA 3TBHA 3LG2A 3P5SA 4R0MA 1SZJG 2YIVX 4XD7A 4JSYA 1V4NA 5EHQA 3JD0A 3S4YA 3I4LA 3NPAA 4GO1A 2VRCA 4JY7A 3O8QA 1TKAA 2B20A 4NIMA 4P8RA 4UTXA 5K9ZA 4Z4IA 5DM1A 3QJ5A 1RNLA 3QVXA 4J7CA 2Z43A 5A7FA 1XD2B 1GGMA 2QKYA 1PYDA 3COPA 3V4VB 5JOQA 3ZOZA 5JYBA 1TVMA 4P80A 2XECA 3K7EA 2XCSB 1CJKC 2RJ3A 3NJ8A 2V7PA 4XPZA 4G8CA 4MARA 4OREX 5GVSA 3QMWA 2GOYA 2QJRA 3DBHB 3L92A 4OJYA 4ZYUA 4RH0A 2WTXA 5JIBA 1WB9A 3W3AD 4R2XA 5HE8A 4MXDA 4U9UA 5CLHA 5GZ1A 1N8KA 3BRWA 2CMFA 5JC1A 1O94C 1V7PC 1FQWA 3WSTA 5BMVA 2BSQA 1O97D 2OFFA 1OAAA 2X1LA 4DCJA 3EEBA 4Z2AA 1AGNA 4FGLA 4G3XA 6REQB 1U0FA 3SYTA 5KDOA 3CXUA 2AMJA 2WAOA 1TM5E 1ZN8A 3L0SA 3KJZA 4MI6A 2KS6A 3K0AA 4UBNA 3RAJA 3KSAC 4IOLA 5JAQA 1PJ2A 3BERA 4DR1B 2DHEA 3DS8A 2HK9A 3FOCA 4OSEA 3ZE9A 2ZJFA 2YV3A 2CVPA 4LNUA 2G1AA 4OGFA 1RQ2A 1RQ7A 2ZVDA 3ICWA 3TSOA 1TZBA 2FLKA 3PDCA 4BUZA 1XDZA 1K75A 2G77B 1QV7A 1RE1A 3IQXA 2IYAA 4F2GA 4MRRA 3EGDB 1DOAA 3S8EA 5T8KC 1XRSB 2YC2C 1IC6A 1N6IA 2ZBFA 1VYVA 1LPMA 1ORDA 2HSJA 4GX1A 4K9DA 4XIIA 5JNSA 1PGQA 2WZBA 1R2QA 4TKVB 4E51A 1JQKA 4CEJB 4N7JA 1Y3HA 1AD2A 4PYLA 2CE7A 3CZ5A 4WUTA 1FTSA 1Y5NA 4MIYA 4UXJA 2IYFA 2WFLB 2SCUB 5C46F 4DDKA 4K88A 1C0KA 1MGOA 1Z2NX 1DAGA 2QUKA 4A1FA 4LZAA 4YAFA 4YN3A 1I94B 1T3SA 1FUKA 3DV0A 2HMVA 1NJ6A 1T6XA 1VJDA 1MX9A 2WPDD 4KK4A 1K5HA 4E2XA 3GZJA 3U5ZB 1VA5A 3UMVA 4JKYA 3V97A 1Q11A 4HADA 3DR5A 2VJLA 4HKTA 4LGYA 2XA9A 2PJRA 4J0EA 1KQPA 4TQUS 1Y7IA 1QJ4A 4ND5A 5C1OA 4Y9DA 3O31A 2IXBA 2X22A 4ZT4A 4CMGA 1GY8A 2EGUA 1RJ9A 1TECE 3AH8A 3AFIA 3KVRA 3QFCA 5ALFA 4AFNA 1GZVA 1SA0A 1JHAA 4IFIA 3JD3A 4O4JB 3LU1A 2QD1A 1OFUX 1H66A 3VU3A 3PJDA 1KVQA 4BUJA 2ZRQA 3BTUA 4E7OA 5HUQA 1K2VN 5TS3A 3PGLA 2JJ8A 3NC0C 4ZRMA 2CFOA 1FZTA 2F1IA 4FE7A 4S05A 3I3SR 2J3EA 1YRWA 1JG4A 3WLEA 2BJHA 4KQEA 2LKDA 5HIAA 2V8OA 5FADA 3H9GA 4BNLA 1NQOA 4DJAA 3LPDA 4PHFA 3F78A 2RHDA 1BCRB 2GD6A 4QJIA 4IJQA 1JDPA 3HXKA 3D0QA 3AYXB 4N03A 1ZBQA 4Q5IA 2XCOA 2Y05A 5HNKA 2ARKA 4OLBA 5HXAA 3Q5GA 3ADBA 2PXXA 1JSLA 2QQ5A 1G2IA 2JIPA 5AW4A 3CVUA 2IIQA 3OU2A 4N5DA 5IH7A 1W0KA 5ALUA 2YYYA 2OCKA 3I5YA 2VA8A 3N2LA 5I7EA 1SOUA 3EB9A 4EJFA 1FLDA 4TLMB 3HYRA 1Z4JA 5DZSA 2IYWA 2WDPA 3F5SA 1E7QA 4LYHA 5KQGA 3EQ8A 1GNQA 1W93A 4KO4S 1U8UA 2QSZA 3TXAA 3UANA 1V16B 2E9SA 2IUSA 3FPLA 1C7ZA 1IWPB 1YR9A 1XNHA 3DMDA 3U4IA 4XQCA 4EW2A 4XRGA 3EBPA 2ZEJA 2ZJ4A 1E1NA 4F1WA 4FFSA 2IZZA 2W6ID 1Z6TA 4Q93A 4KQHA 4IMJB 2LBPA 1OH8A 1X77A 2ZI5A 1HG1A 1LBHA 1L3IA 3AQ4A 3KZNA 3NHMA 3QLUA 4R9VA 4QQ8A 3VYSB 1GEEA 4RHEA 5CEEA 3P9ZA 1KMHB 5J5CA 1V48A 1S3IA 1BWQA 2LP4Y 3JWGA 3CY6A 4JWTA 3CRVA 4WBNF 5AVYA 3UOGA 3NTVA 4D99A 1YGYA 2QRNA 2RAUA 1BE8A 3BJMA 4IKPA 3B1VA 3K1ZA 1AIPA 3M4XA 4KFUA 4NJEB 1FNMA 5EGSA 3GFVA 4YMTA 5T7BA 4MHOA 1MQAA 4HWPA 4D4LA 3L6UA 1E2PA 4FS3A 1Y8RA 4YX9A 2Y0PA 3C5VA 3SI7A 4ZOEA 1PEDA 4EA8A 5JRZA 2C7QA 1JJIA 1IHPA 1E6CA 2YJZA 2I71A 4KO8A 1JAHA 1R66A 3BIWA 4MLPA 1WXDA 3UATA 4AMUA 1UR5A 2HA0A 1IZ0A 4HWSA 5TLSA 4HYTA 3IDZA 1I1HA 2P5SA 1K1EA 1YQQA 2JW5A 4QDZA 4WDQA 1YK0A 2IKSA 3G59A 2O4CA 2ZI7A 3A06A 4O1MA 5F1OA 2HRRA 3VKUA 5ALDA 4CG3A 2PZJA 4OO3A 1MVOA 3Q7SA 2I34A 5LDGA 4AZ3B 2LKCA 4CF4A 3QBVA 2BCGY 2RGDA 4JJ6A 2P6UA 2PA0A 4E94A 2ZWMA 1M0EA 4REOA 1M2HA 4X44A 3TLJA 3K94A 3EXHB 3F4BA 4FQ8A 5GP1A 5A1TA 3JQ9A 4RV4A 3O1LA 4JKIA 4ENPA 5C7IO 1WEKA 3A05A 4V0ME 5KYVA 1LRJA 1U1FA 5J58A 5FX2A 3ZD7A 1Q44A 2QVBA 3NBAA 1STOA 4PZLA 1NQTA 3OM0A 5A9TA 1KYTA 1V0JA 1H1DA 1Z4LA 1O5OA 5J2TB 1CPYA 4IPTA 3VI3B 1XZNA 4KITB 1R12A 2V8BA 3O3MB 3N0TA 3BFVA 2D5IA 3WRXC 3CLKA 2IY8A 1I4EB 1WXFA 5A5EA 1NR7A 1WB5A 1W2WB 3AFGA 3C5WP 3G3EA 3L06A 4P4TA 3T0FA 3EHEA 4JUAA 4DBLC 5LYJF 1MAVA 1O87A 5CDUA 3T1HB 4W9RA 4BPRA 5IC6A 1WZ2A 4ZA2A 1ZRMA 2A5GA 2CFRA 1E7MA 2WYUA 4GR4A 4LXGA 2OV4A 4N6NA 1ZGHA 2I66A 2OHXA 3CCFA 3UCEA 5CB8A 4Y2RA 3TRHA 4QUIA 4QKQA 1KOGA 3JR7A 1RSZA 3FKSA 4OMFG 1RJEA 1V35A 1YR1A 3IE0A 3AVQA 1TYAE 2R4UA 1M1NB 5CEFA 2QE7D 3FPEA 3JD1A 4E5MA 2ZZMA 3S0JA 4Q66C 3QJGA 4N48A 4ETIA 1R15A 2R68A 1P1IA 3FVRA 1PV4A 5K01A 1L4LA 1W0JD 1BX1A 1LLQA 3WV4A 4C4ZA 1ZMTA 1XVIA 3A32A 5KOHB 1UDXA 5K4AA 5IMBA 5MN4A 1M0SA 3H83A 3ZZ0A 2VK1A 1X87A 4PINA 2B83A 4B7AA 4M98A 4E22A 3HKDB 3ZYCA 3IT2A 2PXAA 3DOIA 1QHNA 4YDQA 4U6SA 1P74A 5EUCA 3ZHQA 4DYHA 3TFOA 2V97A 2OOSA 4MV4A 5CJJA 2FFRA 4P6VF 1LVGA 5BN5B 4GH5A 4U7PB 1M2VB 1KYWA 3WIBA 3KHUA 2BSXA 3Q0EA 2DECA 3G49A 4YRRA 1IN5A 3TK1A 2AWOA 4C9BA 1XZQA 1OH7A 1WZEA 1YL6A 4RXMA 2PS9A 4N7RA 5SY6A 4R1SA 5UKDA 1OXSC 3LQ2A 1I7SB 3PFWO 1QS0B 2NO4A 2VUSA 3ASUA 2RHGB 1ZK2A 4JL8A 4LHVA 1NVMB 4BQRA 3M6MD 3C5HA 3E3MA 1ENYA 3HVIA 4AN1A 3S2ZA 3D8UA 2OOKA 3U7FB 1GUFA 4B32A 4UM9B 5AK4A 2UZ4A 3T1TA 4KN9S 3LY9A 4Z7JA 3C39A 4EKDA 5BWLA 9MHTA 2OLEA 2XRFA 2JI7A 4BNTA 3ASVA 1UC4B 4JEMA 4ABYA 1OREA 1KR5A 3NOXA 2WNSA 4L95C 1IOLA 1U5AA 5J4LA 1TU4A 1UBRS 1A9XA 1HKUA 2XTZA 1H4VB 2CCJA 1LS1A 3E5RA 1AU9A 4G4JA 4Y0AA 4TMWA 3W3ZB 3OJEA 4YYZA 2IDMA 2DSNA 1ENPA 1RBZA 4KI0A 4Q4CA 5IFKA 2QY9A 1QXSA 3GRKA 1OXXK 1V5FA 1W581 4IKEA 4NH4A 4NEHB 1JB9A 4TV8F 2CZCA 1IULA 3I2IA 3M4NA 3T5BA 2P9ZA 5F2KA 4HRXA 3R74A 1F9EA 4DMKA 1S2MA 2HMAA 4KPGA 3AWIA 3EVDA 5CVJA 3WQRA 4EHDA 3N74A 4HHEA 1NOIA 3A1SA 1GGHA 4I4TB 1A76A 3D0KA 3P45A 1AQYA 3GD7A 1XMVA 3ZQUA 3LCVB 2QRPA 4A92A 3RUDA 1QIKA 1YCGA 1T5DX 2JLUA 1ZXXA 2QUAA 2ACWA 1L5FA 2P6OA 3AHEA 3ZX5A 5DF1A 4ONEA 5BQXA 4MB6A 5LYJB 2A0FA 4R2HA 4YCBA 5B3AA 4BVLA 1SB9A 2ZBGA 4H0NA 1Y4ZA 1A1VA 1E3SA 1TM2A 2W70A 3GZ4A 4X63A 4EGQA 2GFIA 3G88A 3ERCA 1TW3A 3R5XA 1NT2A 1FNDA 1NP6A 1P4RA 1T24A 2GVDC 2ZYTX 1Z5UA 1R18A 2JJ1A 3NHRA 4P81A 1SXJA 4PX5A 4A6DA 2X0IA 5KNCD 2HFJA 3OCZA 4F71A 2PLAA 5FBKA 3AEYA 4RABA 3QHPA 2GJKA 3ZHSA 5A5VA 3RUAA 1QZTA 1CRQA 1E2GA 1D2AA 3DDNA 2GXQA 4P36A 1D1SA 1FDVA 2P5YA 3FVTA 4BLSA 4GOXA 1FU7A 3G5MA 4JITA 1NIJA 3RIXA 1XAGA 2O1WA 3F8SA 1D2GA 3IQFA 1C9MA 3EVZA 1CR2A 4YO7A 5IK2D 4KQWA 2WOOA 4KH0A 1IWOA 3L6DA 4LA4A 1J21A 4GUAA 4TMVA 5AYVA 3RSSA 1IZ8A 4C78A 3PXGA 1KP3A 2CE2X 1Y1RA 2OCBA 4PAOA 3FA2A 1ZUHA 4M37A 3M6WA 3ACBA 1IUKA 3M34A 5IXYA 3DJYA 3SLRA 4BVHA 5BORA 3ORSA 2IU6A 3GFBA 3AHJA 1XT6A 2GEUA 1C7RA 3NKVA 4LZNA 3W7BA 1Z82A 4YGYA 4BNWA 2OB1A 4WOJA 2W6PA 1KR2A 1HC7A 3ILVA 4OXNA 4NOKA 1PP4A 2FP3A 5ULLA 2C77A 2OO5A 2Z3VA 4N8DA 2QR2A 4IEFB 1YMUA 4G0PA 3PTAA 5JS1A 1XZPA 1T9HA 1VDZA 5TVGA 4WXHA 3ZY6A 5L3QA 1SURA 2GERA 3HABA 1MABB 3EC7A 4RYLA 3VC7A 2Z8XA 5KX5B 1NJSA 4UUNA 5C3UA 1ULTA 2VEDA 3OIVA 3I62A 1WKVA 2P79A 5EE3A 2XBUA 1X9GA 5G0TA 1GZ4A 2P3SA 1DO0A 1EVEA 1RWBA 2I3DA 4V03A 3VO9A 1SUCA 1PR6A 1IEXA 4NCNA 5BY2A 4M83A 2IIVA 1QH8A 3LECA 1MTOA 3K5PA 1VECA 1YXMA 1HDGO 4FKBA 4J75A 4EGAA 1E9EA 2AR9A 3TH5A 3OE1A 5EHIA 3G85A 5JLAA 4IY1A 2WSBA 1YR2A 3WK8A 2BEWA 1HNWB 4JZYA 3FMPB 1E62A 1WJGA 3C0KA 3ZC3A 3FWHA 3MT7A 1ZD3A 3IHTA 2SNIE 1AA6A 1VE1A 6CHYA 5LBIA 1XAIA 3DKIA 5AM2A 5FUBA 5I5EA 3TG2A 2B9EA 3GRCA 1DIHA 4L85A 3I4CA 1IMOA 2J41A 4BX9A 4AWAA 2I80A 4IJVA 5IVDA 1E77A 1TJPB 2C88A 1V11B 2P2GA 2QU7A 4MVYA 2B4YA 1RBYA 3FNRA 4UAGA 2IZOA 1YBHA 4GT1A 3F49S 3LRXA 3KOXA 1A7UA 3V1YA 3Q7IA 1GCOA 4EJ0A 3MERA 1NF9A 5THXA 5B2EA 1TC2A 3MHTA 1YHNA 2TECE 3RQSA 3CW8X 2XD9A 4CKZA 3IAHA 1ZOOA 5DH9A 5FYDA 3M9LA 2JA2A 1BGVA 4ND2A 3RFFA 5BSWA 2P27A 2WWRA 5HFAA 4L4UA 1U7HA 2QT0A 3U13A 1QF6A 4KUEA 3H7IA 5BV7A 1DKRA 4K6MA 3SMQA 2PZKA 2WV9A 5KHAA 4INJA 3TLGB 3G7SA 4HO1X 4LXQA 4BQNA 2QG6A 1WLYA 4WKPA 4CF5A 1AQNA 3CCCA 4JUCA 4RTJA 3GMSA 2F90A 4IHJA 4KLZA 3OBBA 4U00A 3B1YA 4PE5B 1E5DA 3PUHA 3UJPA 2X0EA 2HRDA 2YMPA 4ZOQI 1WBBA 4BV8A 2DQZA 1KQOA 2DPXA 2PYZA 3TOZA 4EPYA 1XCOA 2VHWA 1WD5A 1YVDA 4Q9LA 4HZUA 2C3UA 4PFSA 1QQ6A 4JCCA 4FZRA 2FSIA 3GWZA 1T8UA 5DNCA 2PEZA 4PZEA 5CG2A 3REOA 1N0UA 4HGRA 4PLGA 3GDOA 4M1MA 2HUNA 4RD1A 2J5RA 4EVQA 3KXIA 4D41A 3ZG6A 4WNIA 3JAKB 3O8NA 5J5AA 1MV8A 1Q17A 1R0LA 5B4VA 2JIOA 4XYGA 1AM4D 3RBAA 4N40A 2VC2B 2J67A 1I10A 2QHXA 5JVDB 1XELA 4NJOA 2OSBA 4LNAA 3AEKB 5FUQA 3EIHA 4FWIB 4NTZA 2XCRB 2C5HA 5E95A 5C4MA 4QE3A 5BUQA 2XTAA 4OJKA 4W63A 3HI4A 4V0MA 3WGIA 2Q3LA 2WWHA 2YZKA 3OF3A 4FT4A 4YR9A 3CBGA 3V4LA 1WULS 2GHQA 3DZCA 1P44A 1AN0A 4RQTA 4R9NA 4A15A 3EG5A 3ESDA 4L8YA 1Y4DE 3RU3A 1FFCA 4R71A 3BEOA 2P77A 1CQJA 2JBHA 1L4KA 1DAFA 3L77A 4EYOA 4F9TA 2PNFA 3IODA 4DEXA 1A8HA 2VWPA 3KLPX 2Z4SA 3A1TA 1BTOA 1TEHA 4YTEA 5DM60 4LDNA 5KYXA 5LL6P 3PITA 4B85A 1S2DA 1AB6A 2JVKA 3OFKA 1QM5A 3JQEA 1L7VC 5EL0A 1H2YA 5DNAA 1B14A 4UZSA 2J46A 4X85A 3VYWA 1FP7A 1L6RA 1KYVA 1PDVA 2VDJA 2IX9A 4JFAA 2PWBA 1Y1KE 4IQ8A 5CYPA 5DCUA 3H9CA 2HJRA 2OBNA 4X20B 3MTQA 1JUDA 2BGJA 4UD2A 1NKTA 4X1IA 1IY8A 2W4IA 4QTTB 1A27A 3VO2A 4R7GA 5HQ3A 3BTSA 1YHZA 1PD1A 3GW8A 3ND5A 2UYCA 4O5AA 5FDFA 4KR0A 4RANA 4UQLA 3P0RA 4YCLA 3HA3A 4LYEA 3P27A 4EUEA 5IVPA 4N76A 4PZPA 3BSYA 1F2TA 4RXUA 2PSEA 1Y3FE 1ZJYA 1ZOIA 2QPLA 3N6XA 1ZR4A 2YZMA 5EIHA 3H5WA 5B36A 1HQYE 3L40A 1VHQA 5ENZA 1JJVA 1ECBA 1HLFA 1HTBA 3BT7A 2H6EA 3ZY4A 1JSRA 1TVEA 3FTPA 4K1LA 3QU5A 5COAA 4CMEA 1G4HA 1JE1A 2JDID 4PTLA 5AKEA 1L5YA 5TT0A 4OQZA 4MUXA 5EY5B 2Z1MA 3UT5B 3ZJYA 1M83A 4QT0A 2D54A 2VK8A 3PFBA 2EHDA 3FKJA 3QEMA 4PYRA 3Q2OA 1YOVB 3B2NA 1TIKA 1SCQA 2HIAA 4WBSA 4Z51A 2C2ZA 1V11A 3FW1A 3SSMA 1Q2UA 2H2AA 4I14A 4RULA 3LPAA 4MS3B 2I78A 2CB0A 2UDPA 3B48A 4HWTA 4AKEA 4DCOA 5A6SB 1V5WA 4LN1A 4PBSA 4MGYR 3EDQA 4KXWA 1FVOA 2DWUA 1Q20A 2JCBA 5JCOA 5HVNA 3L7CA 2Q7DA 3MM4A 3N6VA 1R9JA 3ZWVA 3UWKA 4RH1A 1R8XA 2VS1A 1GPUA 2WAMA 3KO8A 4XVRA 3VJKA 4W9MC 5JXIA 2PANA 3KL2A 1N5DA 1QKIA 5EXTA 1VCMA 2CKMA 2RHHA 1PJ4A 1FNNA 4PEVA 3THYA 4DUYB 5C8ZA 1SKMA 3B1WA 2JHPA 3E7FA 4DSZA 4PTZA 2BGUA 3VX4A 1QNLA 3O2JA 4A6EA 1JU3A 4NCXA 3AT1A 1SUIA 4CT5A 5EHXA 1ZHFA 5KYXB 3O8CA 5CM8B 5F23A 4JQYA 3DCNA 5GZ3A 3L7AA 1QOZA 1P73A 4EY3A 1WUJS 3RKSA 1M8KA 4YCMA 2VDUE 2YFYA 1GL7A 3NHWA 1K3TA 1OHHA 1TUBB 1I2MA 1TZJA 1ZU4A 3I9KA 4M6WA 4MV8A 2EGGA 2F67A 3GPBA 1QUFA 1A69A 1F6BA 1XQXA 3ED1A 3WFIA 5H5JA 1I0ZA 2FETA 4LK2A 1V3QE 4Y6OA 1Q7BA 2Y27A 2FSGA 5JLJA 2FCAA 1UANA 1UWLA 1XTIA 3A1UA 4YACA 3ZY2A 2Q4EA 3PL1A 4JLOA 4WOPA 1J0BA 4YQEA 4CM4B 3KVYA 2CDAA 3AUAA 3GLIB 3WKDA 3KXDA 3LK6A 3AEXA 4WWHA 5ICSA 2J6BA 2C98A 2YV2A 3FYTA 3CN9A 2G63A 4WXMA 4O2BF 1HT1E 5CJPA 4ZCTA 5ELXA 3LLMA 3B3QA 1Y82A 4RZHA 4B73A 3K96A 2HWWA 2QD3A 3RHSA 1J33A 1N3YA 3BILA 1N2EA 1RQPA 2QY6A 4PWYA 3USZA 2GYUA 5A6VA 4IVNA 4KTTE 2CFCA 4OI1A 2J3MA 3I4FA 1T1EA 5ABPA 2PXHA 4X7BA 3RVPA 2OBLA 1QG0A 4U4AA 3ZHRA 3CUKA 4AZ0A 1R6XA 4JP1A 3MGAA 1DC5A 1JR3E 1AKTA 2J3DA 4LW8A 4EPVA 4I9FA 2GPAA 5KAMA 3AOEC 5FYQA 4NBUA 4XOUA 4MQLA 4DC9A 3U6BA 2JI9A 4BV2A 1NW9B 1E1RD 1T9DA 3OLQA 2F3UA 4MYUA 3VVMA 3AG6A 3VNVA 1GM5A 1YI0A 1O58A 1V25A 2HQ1A 1HORA 1KETA 2FW7A 1DRJA 3L8HA 4ILKA 3ZKWA 4BZWA 2HDHA 1KI9A 2AYXA 2P30A 4OXRA 1L7OA 1RM3A 1A8QA 4TL6A 3CF2A 4UEWA 4Z4EA 2F8TA 1L7BA 3GPDG 2XD4A 5E9AA 2PX0A 3V8QA 4BDTA 2XUKA 2H2HA 4B7UA 4FOLA 2BFWA 3QH4A 4MRAA 1B6SA 3PYXA 4RE5A 4J0HA 2GBLA 2A8YA 5TS2A 3ZJUA 2JHAA 5IDXA 1QAOA 1GFWA 5G0UA 4EKEA 2H8KA 4KN6A 5DULA 3HN7A 3FSGA 1CIVA 4OFZA 1GNRA 4C0LA 3FTEA 3GT4A 2WNHA 4NCAA 1UMCB 4Q1EA 1QO0A 3NTQA 3H3XA 4NBVA 3SVTA 3JQ7B 3Q40A 4H3VA 4PFJA 3UGQA 4DA6A 4FHZA 2O8VA 1YKGA 4L1KA 5ECGC 2AKYA 2FNAA 2UYHA 3ZBUA 4CMBA 5H3LA 5I3ZA 3S2YA 1SBIA 1KARA 2JKZA 4TVOA 3DB1A 4K9QA 1TAUA 4B46A 2R6ZA 1C1YA 1AXRA 1D1TA 3B12A 3SJUA 2AN4A 1BNCA 4WFJA 1E4EA 1U0GA 2NUAA 1RLJA 4F5YA 3AY7A 1PJRA 3KQVA 4YJHA 3DZGA 1A4UA 1PDWA 2QMOA 3LP5A 4CMCA 2Q6IA 5M5BA 2OAEA 2PL3A 5JZBA 2W2PA 3BXEA 1VHDA 3LQYA 1PG0A 2HNKA 3L0DA 3HDHA