3WYPA

Crystal structure of wild-type core streptavidin in complex with d-biotin/biotin-d-sulfoxide at 1.3 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Crystal structure of streptavidin mutant with low immunogenicity
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin binding protein
total genus 26
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 3wypA00
3T6FA 2IZCB 1RXKA 1VWHB 2FHLA 1VWNB 2UYWA 1N9MA 2OF8A 4U46A 1LCWA 4BJ8A 3RE5A 3VHIA 1N4JA 4GGRA 2MF6A 2QCBA 1SRGA 1SWSA 2RTJA 1SWCA 1VWBB 2RTKA 3EW1A 4GJVA 3RDXA 1LELA 1MOYA 4GGZA 3RDOA 1RXJA 1STSB 1PTSA 5B5FA 4Z27A 1KFFA 1SWRA 4I60A 1VWMB 1SREA 4BX7B 3SZHA 3WYQA 1SWNA 2IZBA 1SWGA 5IRAA 1VWIB 1NBXA 5JD2A 4BX7A 2A5BA 2UZ2A 3VGWA 1VWEB 1MEPA 2BC3A 2RTAA 4GD9A 1SWDA 4GJSA 4Z2OA 1SRHA 3RDMA 1SWUA 2RTQB 5B5GA 3WZQA 4CPEA 2RTCB 4DNEA 1AVDA 1NC9A 5K68A 1N7YA 1LCVA 1SWQA 1HY2A 1VWGB 2Y3FA 2Y32A 3RY2A 4BCSA 4CPIA 1VYOA 1VWCB 1RSUB 1SLFB 2ZSCA 1LDQA 1SWHA 1I9HA 1SWPA 2IZAA 2RTLA 1DF8A 3MG5A 4GDAA 1VWKB 3RY1A 2FHNX 1SWJA 2RTPB 2IZIA 3MM0A 3WYPA 5CSEA 3T2WA 2IZLB 2C4IA 1NDJA 4CPFA 5L3YA 1STRB 4BX6B 1VWLB 4YVBA 1VWRB 2GH7A 2C1SA 4GGTA 4BBOA 1SWTA 1SWAA 2IZDB 2RTDB 4IRWA 4Y59A 4BX6A 1SRJA 1MK5A 5K67A 4JHQA 1SLGB 2RTBB 3EW2A 1VWJB 1SWBA 4Z2PA 2IZJA 2RTEB 3X00A 4BX5B 1HXZA 1SLDB 1N43A 3SZIA 2A8GA 2RTIB 1LUQA 4EKVA 4BX5A 3FDCA 2C1QA 1SWLA 1SRIA 5IRUA 2RTHB 1VWQB 1VWPB 2IZGB 4Y5DA 3PK2A 3T2XA 4Z2VA 2OF9A 4JO6A 5F2BA 2OFAA 1KL3A 1HXLA 1MM9A 1SLEB 2RTFB 1LCZA 2JGSA 5IRWA 1RXHA 1VWFB 3RDQA 1RSTB 4Z28A 1N9YA 3VHMA 1AVEA 1LDOA 1VWOB 1NQNA 2IZEB 2Y3EA 2WPUA 3RDSA 3RDUA 3VHHA 1SWFA 1RAVA 2IZFB 5CHKA 1Y52X 1WBIA 2CAMA 2F01A 1HQQA 2RTNB 3SZJA 1IJ8A 2RTRB 2OFBA 2RTOB 2AVIA 2IZKA 1Y55X 1SRFA 1SWKA 1VWDB 2RTGB 4CPHB 1STPA 3WZNA 4JNJA 1KL5A 2G5LA 1NQMA 1VWAB 1Y53X 2A5CA 4CPHA 4Z6JA 4OKAA 3T6LA 2IZHB 2RTMA 3RE6A 3WZPA 1KL4A 3WZOA 1SWEA 1SWOA
chains in the Genus database with same CATH superfamily
1QWDA 3CKFA 5F1EA 2F09A 4NYQA 2QO5A 3UEUA 2FHLA 1VWNB 5H9LA 4MVLA 4BVMA 5FENA 4IMOA 4ZFXA 4I6SA 1AQBA 1FE3A 3RE5A 3S26A 5B3MO 1PMPA 4CDCA 4QGXA 4GGRA 1B0OA 3VG7A 5FQ6E 2FKJA 1SRGA 2RTJA 2HLVA 4CK4A 2DJGA 3BS2A 1I78A 1U17A 1YUPA 2JOZA 3AKMA 2ACOA 3IFBA 4FBVA 4GU8A 1G7NA 3CMPA 4GGZA 3VPJE 3EBKA 2X56A 5D4AA 3FA8A 4ORYA 5B5FA 4ZJ0A 2WSJA 1QY1A 3D4RA 1VWMB 4ID2A 2JN3A 1SXWA 2GTLO 3SZHA 3WYQA 4BX7B 5AEOA 5IRAA 1OPBA 3FELA 3HWFA 2FWVA 1ZNGA 3CQNA 3D95A 1UYNX 4BX7A 3NP1A 2P8GA 3KZAA 4OMWA 1QG5A 3STMX 5EEEA 4YMYA 3APXA 1W5RA 5EDCA 1BWYA 4M6SA 2G79A 5BVQA 3P6GA 1KXOA 1OBPA 5HWZA 2KW1A 2GTFX 3FMZA 1LIDA 2JU7A 5KICA 1SWUA 3U9PC 4RUNA 4Y0QA 5B5GA 4CPEA 4XMCA 4DNEA 4PJ2A 4QGWA 5K68A 3MBTA 3P24A 3FW4A 3Q34A 1X8QA 4TKBA 5KIDA 1VWGB 3ZWEA 4O3YA 4CDFA 4YCHA 4BCSA 5FFHA 1KOIA 1ZNEA 2M4LA 1VWCB 4QYPA 3APWA 2X8SA 3F8AA 2IZAA 4U9CA 1I9HA 3MG5A 2X55A 2ALLX 1DF8A 1E02A 4GNYA 4GDAA 2Q4NA 4BX6B 3KFFA 3FIDA 2RTPB 4ORSA 3WJCA 4NNSA 1UZ2X 3E3CA 3F9DA 1Y0GA 3WYPA 5CSEA 2IZLB 1DZPA 2C4IA 3P6HA 5D8JA 3BLGA 2LKKA 1VWLB 4XMEA 2C1SA 3C76X 2K23A 4BBOA 1UREA 2Q9SA 2IZDB 4NP1A 4Y59A 5IXGA 1SRJA 1MK5A 1H91A 2HZQA 2OVDA 2RTBB 3VG5A 2KD2A 2FLJA 3NQ9A 4Z2PA 1ALBA 1VPRA 3X00A 1GX9A 4TKHA 3OE3A 4IMNA 3SZIA 1GM6A 4I95A 3TGCA 1X8PA 1RBPA 4EKVA 2AKQA 3FDCA 2C1QA 3ELZA 4O3WA 1VWQB 1MX7A 2IZGB 2JW1A 2Q39A 2OL6O 2MWHA 3PK2A 3T2XA 5B11O 5CYBA 5HZ8A 2CBRA 3EM0A 2BSZA 2RTFB 3OD9A 5AJCA 1LCZA 3EYCA 2OVEA 1TOWA 1BSQA 4D6AA 1RXHA 1VWFB 3VG4A 3TGAA 4XMGA 1RSTB 3JSQA 3O22A 2NNDA 1SXYA 5LKFA 2Y3EA 3RDSA 3BU1A 4HWMA 3RDUA 4YFQA 1SWFA 2QMIA 2A2UA 5AQ6A 4AZPA 2IZFB 4MVKA 3JQOA 4GNWA 4D6BA 4YBPA 2F01A 3WJDA 3V8UA 1HQQA 2FRSA 3GAQA 3OBLA 4QQ1A 3CKGA 1O1VA 1SWKA 4PSQA 3UEXA 5CE4A 1MUPA 3DTQA 1KL5A 3FR4A 3P6FA 1IKEA 2IFBA 1VWAB 3HWGA 1FDQA 3NX1A 3RWXA 1RLBE 2CM4A 1HMRA 2WEWA 3T6LA 3WJEA 2ZAGA 3RE6A 3WZPA 1KL4A 1E00A 1JMXA 1SWEA 1SWOA 1IW2A 4ZH6A 1JV4A 2OY7A 1I4UA 1A2DA 2FTBA 2IZCB 1RXKA 2YG2A 3JS1A 3L4RA 4EEJA 4DCBA 3P6DA 1LCWA 1GXAA 2F73A 4KT5A 2CBSA 2QCBA 1P6PA 1SWSA 2CM9A 2RTKA 1SWCA 3EMMA 3EW1A 1ICNA 3BSZE 1KT6A 2MO5A 1GKAB 1MOYA 4ZCBA 2LA7A 1GT3A 1VYGA 3VG2A 2HNXA 1KT3A 3PP6A 1AVGI 4I60A 3BRNA 1GKAA 1LKEA 1T68X 2BHVA 4IABA 4MVIA 1SREA 1A57A 5EZ2A 1JJJA 1SWNA 2IZBA 1SWGA 4QZUA 2CZUA 5HA1A 4DQ3A 4NW4A 1HN2A 2A5BA 1T0VA 3FA7A 4IBAA 3VGWA 1MEPA 2RTAA 4GD9A 2HZRA 1LIBA 4Z2OA 2BT9A 4ORUA 5D47A 3CBSA 4ZR2A 1B8EA 4N7DA 1FJ1E 3CR6A 1PBYA 3LTWA 4QZTA 2OL8O 2Q2PA 1N7YA 4HPAA 3RSWA 1DV9A 1KQWA 5BVTA 1LCVA 1SWQA 1HY2A 1O1UA 2WWPA 2Y32A 1LPJA 4ZH9A 4U8UM 3RZYA 3U03A 5FQ8E 2BS5A 3WJBA 4EDEA 4MISA 2AT8X 2ZSCA 5HZ5A 2OY8A 3OJYC 2AH7X 1BM5A 4GDZA 1ZRYA 1VWKB 2AMMX 1ZNLA 2FHNX 3CBCA 4QRLA 1ZNDA 1GT5A 3T2WA 2VFCA 4Y0PA 3CQRA 4FQBB 1NDJA 3BX7A 2OVSA 1IIUA 2ANSA 4HPBA 4YVBA 5LKEA 3TGBA 2GC9A 2W2BA 2OVAA 3ELXA 4NV7A 4ON1A 1W4TA 4YKMA 1SWTA 1SXXA 3WZOA 3CWKA 4YGHA 4IRWA 1LIFA 3IA8A 1X71A 4GETA 4KC7A 3ZUIA 1OSPO 4OS0A 1ADLA 2K62A 3EW2A 2QM9A 1DFVA 3PPTA 1ERXA 1HMTA 1N0SA 3B2IA 5B29A 1PBOA 2IZJA 2RTEB 4ORXA 4ODDA 4A1HA 4WFVA 1KZXA 1EPBA 3EBWA 2RTIB 3PQSA 4N7CA 3PDFA 3AUMO 1G85A 1SRIA 1VWPB 2A2GA 1OBQA 3UEWA 5HCEC 4Z2VA 3B2HA 2OF9A 2NNQA 4GE1A 4O49A 5L8NA 1MM9A 2WEXA 4YDAA 2G8CO 1IFCA 1B56A 1MVGA 2JGSA 4QAEA 4ARHA 4AZMA 5IRWA 3B2JA 1G5WA 1CBIA 2OY1O 2RA6A 3WXQA 5IO5A 1N9YA 4YDBA 1VWOB 5LJBA 4GK9A 4O4UA 1U0XA 1RAVA 3FLLA 5BYPA 1LF7A 1X8OA 1NGLA 3FEKA 4YH0A 5B10O 2RTNB 4IB6A 1S44A 1YP7A 5K06A 5EPQA 3HOEA 3AEHA 1ML7A 2OFBA 5DPQA 1DZJA 1BBPA 3UEVA 3T1DA 2KTDA 1LFOA 2RTGB 3LHNA 4I3CA 1EIIA 1STPA 1BSOA 3STNA 3WZNA 1OBUA 5D45A 4I9RA 3RBYA 5HAEA 2WQ9A 1XCAA 1FELA 1Y53X 2FT9A 2KT4B 4OKAA 2IZHB 1CBQA 2LBAA 5L8OA 1KZWA 1ICMA 5IO6A 3FR5A 3QQ2A 4GH7A 4YCEA 4ZGFA 1BLRA 2UYWA 3PQUA 5LJEA 2OF8A 2X46A 3VG6A 4BJ8A 4IAXA 3VHIA 5LJCA 1GGLA 3FA6A 1Y9TA 2GTLM 2MF6A 4MIRA 1EXSA 1EI5A 1TVQA 4FBOA 2N93A 1BJ7A 1WUBA 3RDOA 1RXJA 2OFMX 2VDFA 2R74A 4AYHA 1PTSA 2RCQA 4I3BA 1GT1A 1KFFA 1GX8A 1LICA 1SWRA 1U18A 1ZNKA 2DJFA 2RD7C 2R73A 5HTDA 1I05A 1SA8A 4Y0SA 3ZUOA 4L1NA 3TZSA 5JD2A 4FGIB 2O62A 2UZ2A 1BEBA 4GRJA 3SLJA 1VWEB 1MDCA 3RKGA 2BC3A 2QO6A 1E06A 3PH5A 1B4MA 1SWDA 5JR8A 5F6BA 3FIQA 1KT4A 4YFPA 1S7DA 1VYFA 2XSTA 3RDMA 1NP1A 4ZHDA 4CV7A 1SY2A 4ORWA 3UAQA 2L67A 3PH6A 1HBQA 1K3BA 3F6ZB 3STKA 4AW8A 4EXZA 1EQDA 1AVDA 1NC9A 3P02A 4U3QA 2WUTA 1X89A 1X8UA 3D9WA 4TJZA 2POAA 1AELA 2Y3FA 3C77X 1KQXA 3RY2A 4ZHFA 1Z24A 1YWCA 1S2PA 2KTSA 4COTA 1KGLA 4CPIA 1OEKA 1KT7A 1L6MA 1VYOA 1RSUB 4XMFA 3O19A 1XKIA 5EDBA 2VFBA 2RTLA 4AZNA 2L5PA 4GZVA 4YBUA 2A3FX 3NPOA 4IB9A 1SWJA 5F58A 1E5PA 4IAWA 3PEDA 5BVSA 4CPFA 1STRB 1CJ5A 1VWRB 3NQKA 2ASNX 1JBHA 1YP6A 4LKPA 2YMSA 1SWAA 4K19A 4A60A 1YIVA 1O8VA 4DQ4A 3GE2A 1Y9LA 2RCTA 2EU7X 1HQPA 3VG3A 5HZQA 5H9AA 4KCAA 4ZGUA 4KC8A 4QYNA 3WJFA 5HTEA 5D48A 3VU1A 2BLGA 1TXLA 1HXZA 1SLDB 2X8FA 1N43A 1CBSA 2FS6A 3B2LA 3WOVA 1BSYA 3B2KA 2JU8A 2ZAIA 3K3LA 1SWLA 3KQ0A 5IRUA 5LJGA 2AT5X 1EIOA 4Y5DA 4NYRA 2QO4A 1LNMA 1T8VA 5F2BA 5B2AO 1OEJA 2OFAA 1HXLA 2L9CA 4OS8A 4R0BA 1PM1X 2HMBA 1EW3A 2DM5A 5L8IA 1OEEA 3BX8A 4BGFA 1CBRA 1YWAA 3RDQA 1JQPA 3APVA 4HPDA 5LJHA 3VHMA 1AVEA 4ML7B 1NQNA 2IZEB 2JMBA 3HK1A 1EUOA 3VHHA 4TLJA 4EQAC 1Y52X 2CAMA 3Q6LA 4I3DA 4FBRA 4C5PA 4QGVA 3SZJA 2RTRB 1PEEA 2RTOB 1EPAA 2IZKA 3AKNA 1SRFA 4CPHB 1VWDB 3EC5A 3BDRA 4BOEA 4WBKA 4JNJA 4LQZA 3BU9A 4BQUA 5H8TA 1BRPA 1DZKA 1QQSA 2G5LA 4OELA 1ERBA 1NQMA 4U8UN 4ALBA 2A5CA 1SY1A 2ACPX 4Y0RA 4CPHA 4RUUA 2MJIA 2X32A 2RQ0A 4NLJA 4OMXA 4KH8A 2FS7A 1FTPA 5H9NA 1SWPA 4Z28A 5KHPA 1JZUA 1TW4A 3T6FA 4XMDA 1BRQA 1K24A 1VWHB 1N9MA 2AF5A 4U46A 4O3XB 3VE1A 5HCDC 1JYJA 5FQ7E 3MX7A 1N4JA 1YWDA 4OEMA 5LJDA 4UU3A 3S5VA 4A8ZA 3HOLA 5HA0A 3P6CA 5HCCC 2X45A 2HKDA 4TNNA 1VWBB 1GT4A 4GJVA 3KFIA 1QFTA 3RDXA 1EALA 1LELA 4A1YA 4M7MA 1SMPI 1TOUA 3KFGA 4UU2A 1D3SA 2WQAE 3I0AA 3MVFA 2I5VO 1STSB 3FEPA 4Z27A 3KFHA 2OFRX 2G78A 3O2YA 4MVEA 4OS3A 3S60A 1SXUA 3WBGA 4IB7A 4ALOA 3APUA 1LIEA 3QKGA 1UYOX 4O4OA 1DZMA 1I04A 3NR3A 2MHDA 4NNTA 5B27A 1VWIB 1NBXA 1D2UA 2XKLA 3VE2A 4MEEA 1JMZA 1DC9A 1JYDA 2GJ5A 2QOSC 3HWDA 5AJBA 3HWEA 2PI3O 2A13A 4GJSA 2NNEA 4O3ZA 1SRHA 4EFGA 4NV8A 2A0AA 4I9SA 2W2AA 2OZQA 2RTQB 3WZQA 3D96A 2RTCB 2Z4IA 2FGSA 2RN4A 2AL0X 3S5XA 3NADA 3G7XA 3FW5A 2X4MA 4HFOA 4YKOA 2L68A 3ZW2A 4B55A 4O4SA 1CRBA 1HBPA 3ZQ3A 1SLFB 4GKCA 2JU3A 2OY5O 2LFOA 3ZI8A 5C0NA 1LDQA 1SWHA 1R0UA 1HMSA 3H3IA 5FAZA 1JJXA 3RY1A 2WR6A 2Z4HA 4KIIA 1I06A 4NLIA 3ZZVA 2AT6X 4QNIA 2IZIA 1FEMA 3MM0A 4YGZA 1ACDA 1NP4A 5LJKA 1SY0A 2OL7A 3NQ3A 5L3YA 1GX3A 1A18A 3NX2A 4U8UO 2GH7A 2BS6A 2LBVA 1JJUA 4GGTA 2AT0X 3I17A 3BY0A 4IB8A 5F7GA 4CSBA 4TQ2A 1DF3A 2RTDB 5HZ9A 2FKGA 4AZOA 1ZNHA 4BX6A 3SLOA 3SOTA 5K67A 3ZW0B 1IFBA 4JGLA 1SLGB 4JHQA 1VWJB 1SWBA 2X34A 1AB0A 2GTLN 1W6FA 2X8TA 3C78X 4L3RA 4XMHA 3DSZA 2CZTA 5EEDA 4O4XA 3ZW0A 4BX5B 2QOMA 3HPEA 2A8GA 2AT3X 5H9KA 5IO7A 3TF6A 2FR3A 1LUQA 1MX8A 4O9SA 1KT5A 4BX5A 3WVMA 1X8NA 1G74A 2RTHB 3FYFA 4WHIA 4ES7A 4TKJA 2LB6A 3FA9A 1QY2A 4JO6A 4CDDA 1KL3A 3ZW1B 2PY1A 1SLEB 1FENA 3KVNA 3LV4A 4YGGA 3FENA 2OYBO 4AZQA 3D97A 1QFVA 3SLTA 2I5ZO 4LKTA 4CDEA 3ZW1A 2MM3A 4HPCA 1LDOA 5HBSA 3HTYA 2WPUA 4LZUA 4ORRA 4WFUA 1A3YA 5DG4A 3SAOA 3U0DA 3P6EA 1YWBA 2R56A 3N91A 4LZVA 4ZHHA 5CHKA 2W2FA 1WBIA 3FR2A 2G7BA 2HYSA 5F6ZA 4GUZA 1IJ8A 1OPAA 2E4JA 5HZ6A 2AVIA 4AZRA 1Y55X 1IKJA 2FR2A 1E2TA 2NP1A 2Q2MA 4YFRA 1JIWI 1SY3A 4ZHCA 3PECA 4Z6JA 4INNA 4ZHGA 3WJGA 2RTMA 1QABE 1QY0A 3NBXX
chains in the Genus database with same CATH topology
3T6FA 2IZCB 1RXKA 1VWHB 2FHLA 1VWNB 2UYWA 1N9MA 2OF8A 4U46A 1LCWA 4BJ8A 3RE5A 3VHIA 1N4JA 4GGRA 2MF6A 2QCBA 1SRGA 1SWSA 2RTJA 1SWCA 1VWBB 2RTKA 3EW1A 4GJVA 3RDXA 1LELA 1MOYA 4GGZA 3RDOA 1RXJA 1STSB 1PTSA 5B5FA 4Z27A 1KFFA 1SWRA 4I60A 1VWMB 1SREA 4BX7B 3SZHA 3WYQA 1SWNA 2IZBA 1SWGA 5IRAA 1VWIB 1NBXA 5JD2A 4BX7A 2A5BA 2UZ2A 3VGWA 1VWEB 1MEPA 2BC3A 2RTAA 4GD9A 1SWDA 4GJSA 4Z2OA 1SRHA 3RDMA 1SWUA 2RTQB 5B5GA 3WZQA 4CPEA 2RTCB 4DNEA 1AVDA 1NC9A 5K68A 1N7YA 1LCVA 1SWQA 1HY2A 1VWGB 2Y3FA 2Y32A 3RY2A 4BCSA 4CPIA 1VYOA 1VWCB 1RSUB 1SLFB 2ZSCA 1LDQA 1SWHA 1I9HA 1SWPA 2IZAA 2RTLA 1DF8A 3MG5A 4GDAA 1VWKB 3RY1A 2FHNX 1SWJA 2RTPB 2IZIA 3MM0A 3WYPA 5CSEA 3T2WA 2IZLB 2C4IA 1NDJA 4CPFA 5L3YA 1STRB 4BX6B 1VWLB 4YVBA 1VWRB 2GH7A 2C1SA 4GGTA 4BBOA 1SWTA 1SWAA 2IZDB 2RTDB 4IRWA 4Y59A 4BX6A 1SRJA 1MK5A 5K67A 4JHQA 1SLGB 2RTBB 3EW2A 1VWJB 1SWBA 4Z2PA 2IZJA 2RTEB 3X00A 4BX5B 1HXZA 1SLDB 1N43A 3SZIA 2A8GA 2RTIB 1LUQA 4EKVA 4BX5A 3FDCA 2C1QA 1SWLA 1SRIA 5IRUA 2RTHB 1VWQB 1VWPB 2IZGB 4Y5DA 3PK2A 3T2XA 4Z2VA 2OF9A 4JO6A 5F2BA 2OFAA 1KL3A 1HXLA 1MM9A 1SLEB 2RTFB 1LCZA 2JGSA 5IRWA 1RXHA 1VWFB 3RDQA 1RSTB 4Z28A 1N9YA 3VHMA 1AVEA 1LDOA 1VWOB 1NQNA 2IZEB 2Y3EA 2WPUA 3RDSA 3RDUA 3VHHA 1SWFA 1RAVA 2IZFB 5CHKA 1Y52X 1WBIA 2CAMA 2F01A 1HQQA 2RTNB 3SZJA 1IJ8A 2RTRB 2OFBA 2RTOB 2AVIA 2IZKA 1Y55X 1SRFA 1SWKA 1VWDB 2RTGB 4CPHB 1STPA 3WZNA 4JNJA 1KL5A 2G5LA 1NQMA 1VWAB 1Y53X 2A5CA 4CPHA 4Z6JA 4OKAA 3T6LA 2IZHB 2RTMA 3RE6A 3WZPA 1KL4A 3WZOA 1SWEA 1SWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6F A;  2IZC B;  1RXK A;  1VWH B;  2FHL A;  1VWN B;  2UYW A;  1N9M A;  2OF8 A;  4U46 A;  1LCW A;  4BJ8 A;  3RE5 A;  3VHI A;  1N4J A;  4GGR A;  2MF6 A;  2QCB A;  1SRG A;  1SWS A;  2RTJ A;  1SWC A;  1VWB B;  2RTK A;  3EW1 A;  4GJV A;  3RDX A;  1LEL A;  1MOY A;  4GGZ A;  3RDO A;  1RXJ A;  1STS B;  1PTS A;  5B5F A;  4Z27 A;  1KFF A;  1SWR A;  4I60 A;  1VWM B;  1SRE A;  4BX7 B;  3SZH A;  3WYQ A;  1SWN A;  2IZB A;  1SWG A;  5IRA A;  1VWI B;  1NBX A;  5JD2 A;  4BX7 A;  2A5B A;  2UZ2 A;  3VGW A;  1VWE B;  1MEP A;  2BC3 A;  2RTA A;  4GD9 A;  1SWD A;  4GJS A;  4Z2O A;  1SRH A;  3RDM A;  1SWU A;  2RTQ B;  5B5G A;  3WZQ A;  4CPE A;  2RTC B;  4DNE A;  1AVD A;  1NC9 A;  5K68 A;  1N7Y A;  1LCV A;  1SWQ A;  1HY2 A;  1VWG B;  2Y3F A;  2Y32 A;  3RY2 A;  4BCS A;  4CPI A;  1VYO A;  1VWC B;  1RSU B;  1SLF B;  2ZSC A;  1LDQ A;  1SWH A;  1I9H A;  1SWP A;  2IZA A;  2RTL A;  1DF8 A;  3MG5 A;  4GDA A;  1VWK B;  3RY1 A;  2FHN X;  1SWJ A;  2RTP B;  2IZI A;  3MM0 A;  3WYP A;  5CSE A;  3T2W A;  2IZL B;  2C4I A;  1NDJ A;  4CPF A;  5L3Y A;  1STR B;  4BX6 B;  1VWL B;  4YVB A;  1VWR B;  2GH7 A;  2C1S A;  4GGT A;  4BBO A;  1SWT A;  1SWA A;  2IZD B;  2RTD B;  4IRW A;  4Y59 A;  4BX6 A;  1SRJ A;  1MK5 A;  5K67 A;  4JHQ A;  1SLG B;  2RTB B;  3EW2 A;  1VWJ B;  1SWB A;  4Z2P A;  2IZJ A;  2RTE B;  3X00 A;  4BX5 B;  1HXZ A;  1SLD B;  1N43 A;  3SZI A;  2A8G A;  2RTI B;  1LUQ A;  4EKV A;  4BX5 A;  3FDC A;  2C1Q A;  1SWL A;  1SRI A;  5IRU A;  2RTH B;  1VWQ B;  1VWP B;  2IZG B;  4Y5D A;  3PK2 A;  3T2X A;  4Z2V A;  2OF9 A;  4JO6 A;  5F2B A;  2OFA A;  1KL3 A;  1HXL A;  1MM9 A;  1SLE B;  2RTF B;  1LCZ A;  2JGS A;  5IRW A;  1RXH A;  1VWF B;  3RDQ A;  1RST B;  4Z28 A;  1N9Y A;  3VHM A;  1AVE A;  1LDO A;  1VWO B;  1NQN A;  2IZE B;  2Y3E A;  2WPU A;  3RDS A;  3RDU A;  3VHH A;  1SWF A;  1RAV A;  2IZF B;  5CHK A;  1Y52 X;  1WBI A;  2CAM A;  2F01 A;  1HQQ A;  2RTN B;  3SZJ A;  1IJ8 A;  2RTR B;  2OFB A;  2RTO B;  2AVI A;  2IZK A;  1Y55 X;  1SRF A;  1SWK A;  1VWD B;  2RTG B;  4CPH B;  1STP A;  3WZN A;  4JNJ A;  1KL5 A;  2G5L A;  1NQM A;  1VWA B;  1Y53 X;  2A5C A;  4CPH A;  4Z6J A;  4OKA A;  3T6L A;  2IZH B;  2RTM A;  3RE6 A;  3WZP A;  1KL4 A;  3WZO A;  1SWE A;  1SWO A; 
#chains in the Genus database with same CATH topology
 1QWD A;  3CKF A;  5F1E A;  2F09 A;  4NYQ A;  2QO5 A;  3UEU A;  2FHL A;  1VWN B;  5H9L A;  4MVL A;  4BVM A;  5FEN A;  4IMO A;  4ZFX A;  4I6S A;  1AQB A;  1FE3 A;  3RE5 A;  3S26 A;  5B3M O;  1PMP A;  4CDC A;  4QGX A;  4GGR A;  1B0O A;  3VG7 A;  5FQ6 E;  2FKJ A;  1SRG A;  2RTJ A;  2HLV A;  4CK4 A;  2DJG A;  3BS2 A;  1I78 A;  1U17 A;  1YUP A;  2JOZ A;  3AKM A;  2ACO A;  3IFB A;  4FBV A;  4GU8 A;  1G7N A;  3CMP A;  4GGZ A;  3VPJ E;  3EBK A;  2X56 A;  5D4A A;  3FA8 A;  4ORY A;  5B5F A;  4ZJ0 A;  2WSJ A;  1QY1 A;  3D4R A;  1VWM B;  4ID2 A;  2JN3 A;  1SXW A;  2GTL O;  3SZH A;  3WYQ A;  4BX7 B;  5AEO A;  5IRA A;  1OPB A;  3FEL A;  3HWF A;  2FWV A;  1ZNG A;  3CQN A;  3D95 A;  1UYN X;  4BX7 A;  3NP1 A;  2P8G A;  3KZA A;  4OMW A;  1QG5 A;  3STM X;  5EEE A;  4YMY A;  3APX A;  1W5R A;  5EDC A;  1BWY A;  4M6S A;  2G79 A;  5BVQ A;  3P6G A;  1KXO A;  1OBP A;  5HWZ A;  2KW1 A;  2GTF X;  3FMZ A;  1LID A;  2JU7 A;  5KIC A;  1SWU A;  3U9P C;  4RUN A;  4Y0Q A;  5B5G A;  4CPE A;  4XMC A;  4DNE A;  4PJ2 A;  4QGW A;  5K68 A;  3MBT A;  3P24 A;  3FW4 A;  3Q34 A;  1X8Q A;  4TKB A;  5KID A;  1VWG B;  3ZWE A;  4O3Y A;  4CDF A;  4YCH A;  4BCS A;  5FFH A;  1KOI A;  1ZNE A;  2M4L A;  1VWC B;  4QYP A;  3APW A;  2X8S A;  3F8A A;  2IZA A;  4U9C A;  1I9H A;  3MG5 A;  2X55 A;  2ALL X;  1DF8 A;  1E02 A;  4GNY A;  4GDA A;  2Q4N A;  4BX6 B;  3KFF A;  3FID A;  2RTP B;  4ORS A;  3WJC A;  4NNS A;  1UZ2 X;  3E3C A;  3F9D A;  1Y0G A;  3WYP A;  5CSE A;  2IZL B;  1DZP A;  2C4I A;  3P6H A;  5D8J A;  3BLG A;  2LKK A;  1VWL B;  4XME A;  2C1S A;  3C76 X;  2K23 A;  4BBO A;  1URE A;  2Q9S A;  2IZD B;  4NP1 A;  4Y59 A;  5IXG A;  1SRJ A;  1MK5 A;  1H91 A;  2HZQ A;  2OVD A;  2RTB B;  3VG5 A;  2KD2 A;  2FLJ A;  3NQ9 A;  4Z2P A;  1ALB A;  1VPR A;  3X00 A;  1GX9 A;  4TKH A;  3OE3 A;  4IMN A;  3SZI A;  1GM6 A;  4I95 A;  3TGC A;  1X8P A;  1RBP A;  4EKV A;  2AKQ A;  3FDC A;  2C1Q A;  3ELZ A;  4O3W A;  1VWQ B;  1MX7 A;  2IZG B;  2JW1 A;  2Q39 A;  2OL6 O;  2MWH A;  3PK2 A;  3T2X A;  5B11 O;  5CYB A;  5HZ8 A;  2CBR A;  3EM0 A;  2BSZ A;  2RTF B;  3OD9 A;  5AJC A;  1LCZ A;  3EYC A;  2OVE A;  1TOW A;  1BSQ A;  4D6A A;  1RXH A;  1VWF B;  3VG4 A;  3TGA A;  4XMG A;  1RST B;  3JSQ A;  3O22 A;  2NND A;  1SXY A;  5LKF A;  2Y3E A;  3RDS A;  3BU1 A;  4HWM A;  3RDU A;  4YFQ A;  1SWF A;  2QMI A;  2A2U A;  5AQ6 A;  4AZP A;  2IZF B;  4MVK A;  3JQO A;  4GNW A;  4D6B A;  4YBP A;  2F01 A;  3WJD A;  3V8U A;  1HQQ A;  2FRS A;  3GAQ A;  3OBL A;  4QQ1 A;  3CKG A;  1O1V A;  1SWK A;  4PSQ A;  3UEX A;  5CE4 A;  1MUP A;  3DTQ A;  1KL5 A;  3FR4 A;  3P6F A;  1IKE A;  2IFB A;  1VWA B;  3HWG A;  1FDQ A;  3NX1 A;  3RWX A;  1RLB E;  2CM4 A;  1HMR A;  2WEW A;  3T6L A;  3WJE A;  2ZAG A;  3RE6 A;  3WZP A;  1KL4 A;  1E00 A;  1JMX A;  1SWE A;  1SWO A;  1IW2 A;  4ZH6 A;  1JV4 A;  2OY7 A;  1I4U A;  1A2D A;  2FTB A;  2IZC B;  1RXK A;  2YG2 A;  3JS1 A;  3L4R A;  4EEJ A;  4DCB A;  3P6D A;  1LCW A;  1GXA A;  2F73 A;  4KT5 A;  2CBS A;  2QCB A;  1P6P A;  1SWS A;  2CM9 A;  2RTK A;  1SWC A;  3EMM A;  3EW1 A;  1ICN A;  3BSZ E;  1KT6 A;  2MO5 A;  1GKA B;  1MOY A;  4ZCB A;  2LA7 A;  1GT3 A;  1VYG A;  3VG2 A;  2HNX A;  1KT3 A;  3PP6 A;  1AVG I;  4I60 A;  3BRN A;  1GKA A;  1LKE A;  1T68 X;  2BHV A;  4IAB A;  4MVI A;  1SRE A;  1A57 A;  5EZ2 A;  1JJJ A;  1SWN A;  2IZB A;  1SWG A;  4QZU A;  2CZU A;  5HA1 A;  4DQ3 A;  4NW4 A;  1HN2 A;  2A5B A;  1T0V A;  3FA7 A;  4IBA A;  3VGW A;  1MEP A;  2RTA A;  4GD9 A;  2HZR A;  1LIB A;  4Z2O A;  2BT9 A;  4ORU A;  5D47 A;  3CBS A;  4ZR2 A;  1B8E A;  4N7D A;  1FJ1 E;  3CR6 A;  1PBY A;  3LTW A;  4QZT A;  2OL8 O;  2Q2P A;  1N7Y A;  4HPA A;  3RSW A;  1DV9 A;  1KQW A;  5BVT A;  1LCV A;  1SWQ A;  1HY2 A;  1O1U A;  2WWP A;  2Y32 A;  1LPJ A;  4ZH9 A;  4U8U M;  3RZY A;  3U03 A;  5FQ8 E;  2BS5 A;  3WJB A;  4EDE A;  4MIS A;  2AT8 X;  2ZSC A;  5HZ5 A;  2OY8 A;  3OJY C;  2AH7 X;  1BM5 A;  4GDZ A;  1ZRY A;  1VWK B;  2AMM X;  1ZNL A;  2FHN X;  3CBC A;  4QRL A;  1ZND A;  1GT5 A;  3T2W A;  2VFC A;  4Y0P A;  3CQR A;  4FQB B;  1NDJ A;  3BX7 A;  2OVS A;  1IIU A;  2ANS A;  4HPB A;  4YVB A;  5LKE A;  3TGB A;  2GC9 A;  2W2B A;  2OVA A;  3ELX A;  4NV7 A;  4ON1 A;  1W4T A;  4YKM A;  1SWT A;  1SXX A;  3WZO A;  3CWK A;  4YGH A;  4IRW A;  1LIF A;  3IA8 A;  1X71 A;  4GET A;  4KC7 A;  3ZUI A;  1OSP O;  4OS0 A;  1ADL A;  2K62 A;  3EW2 A;  2QM9 A;  1DFV A;  3PPT A;  1ERX A;  1HMT A;  1N0S A;  3B2I A;  5B29 A;  1PBO A;  2IZJ A;  2RTE B;  4ORX A;  4ODD A;  4A1H A;  4WFV A;  1KZX A;  1EPB A;  3EBW A;  2RTI B;  3PQS A;  4N7C A;  3PDF A;  3AUM O;  1G85 A;  1SRI A;  1VWP B;  2A2G A;  1OBQ A;  3UEW A;  5HCE C;  4Z2V A;  3B2H A;  2OF9 A;  2NNQ A;  4GE1 A;  4O49 A;  5L8N A;  1MM9 A;  2WEX A;  4YDA A;  2G8C O;  1IFC A;  1B56 A;  1MVG A;  2JGS A;  4QAE A;  4ARH A;  4AZM A;  5IRW A;  3B2J A;  1G5W A;  1CBI A;  2OY1 O;  2RA6 A;  3WXQ A;  5IO5 A;  1N9Y A;  4YDB A;  1VWO B;  5LJB A;  4GK9 A;  4O4U A;  1U0X A;  1RAV A;  3FLL A;  5BYP A;  1LF7 A;  1X8O A;  1NGL A;  3FEK A;  4YH0 A;  5B10 O;  2RTN B;  4IB6 A;  1S44 A;  1YP7 A;  5K06 A;  5EPQ A;  3HOE A;  3AEH A;  1ML7 A;  2OFB A;  5DPQ A;  1DZJ A;  1BBP A;  3UEV A;  3T1D A;  2KTD A;  1LFO A;  2RTG B;  3LHN A;  4I3C A;  1EII A;  1STP A;  1BSO A;  3STN A;  3WZN A;  1OBU A;  5D45 A;  4I9R A;  3RBY A;  5HAE A;  2WQ9 A;  1XCA A;  1FEL A;  1Y53 X;  2FT9 A;  2KT4 B;  4OKA A;  2IZH B;  1CBQ A;  2LBA A;  5L8O A;  1KZW A;  1ICM A;  5IO6 A;  3FR5 A;  3QQ2 A;  4GH7 A;  4YCE A;  4ZGF A;  1BLR A;  2UYW A;  3PQU A;  5LJE A;  2OF8 A;  2X46 A;  3VG6 A;  4BJ8 A;  4IAX A;  3VHI A;  5LJC A;  1GGL A;  3FA6 A;  1Y9T A;  2GTL M;  2MF6 A;  4MIR A;  1EXS A;  1EI5 A;  1TVQ A;  4FBO A;  2N93 A;  1BJ7 A;  1WUB A;  3RDO A;  1RXJ A;  2OFM X;  2VDF A;  2R74 A;  4AYH A;  1PTS A;  2RCQ A;  4I3B A;  1GT1 A;  1KFF A;  1GX8 A;  1LIC A;  1SWR A;  1U18 A;  1ZNK A;  2DJF A;  2RD7 C;  2R73 A;  5HTD A;  1I05 A;  1SA8 A;  4Y0S A;  3ZUO A;  4L1N A;  3TZS A;  5JD2 A;  4FGI B;  2O62 A;  2UZ2 A;  1BEB A;  4GRJ A;  3SLJ A;  1VWE B;  1MDC A;  3RKG A;  2BC3 A;  2QO6 A;  1E06 A;  3PH5 A;  1B4M A;  1SWD A;  5JR8 A;  5F6B A;  3FIQ A;  1KT4 A;  4YFP A;  1S7D A;  1VYF A;  2XST A;  3RDM A;  1NP1 A;  4ZHD A;  4CV7 A;  1SY2 A;  4ORW A;  3UAQ A;  2L67 A;  3PH6 A;  1HBQ A;  1K3B A;  3F6Z B;  3STK A;  4AW8 A;  4EXZ A;  1EQD A;  1AVD A;  1NC9 A;  3P02 A;  4U3Q A;  2WUT A;  1X89 A;  1X8U A;  3D9W A;  4TJZ A;  2POA A;  1AEL A;  2Y3F A;  3C77 X;  1KQX A;  3RY2 A;  4ZHF A;  1Z24 A;  1YWC A;  1S2P A;  2KTS A;  4COT A;  1KGL A;  4CPI A;  1OEK A;  1KT7 A;  1L6M A;  1VYO A;  1RSU B;  4XMF A;  3O19 A;  1XKI A;  5EDB A;  2VFB A;  2RTL A;  4AZN A;  2L5P A;  4GZV A;  4YBU A;  2A3F X;  3NPO A;  4IB9 A;  1SWJ A;  5F58 A;  1E5P A;  4IAW A;  3PED A;  5BVS A;  4CPF A;  1STR B;  1CJ5 A;  1VWR B;  3NQK A;  2ASN X;  1JBH A;  1YP6 A;  4LKP A;  2YMS A;  1SWA A;  4K19 A;  4A60 A;  1YIV A;  1O8V A;  4DQ4 A;  3GE2 A;  1Y9L A;  2RCT A;  2EU7 X;  1HQP A;  3VG3 A;  5HZQ A;  5H9A A;  4KCA A;  4ZGU A;  4KC8 A;  4QYN A;  3WJF A;  5HTE A;  5D48 A;  3VU1 A;  2BLG A;  1TXL A;  1HXZ A;  1SLD B;  2X8F A;  1N43 A;  1CBS A;  2FS6 A;  3B2L A;  3WOV A;  1BSY A;  3B2K A;  2JU8 A;  2ZAI A;  3K3L A;  1SWL A;  3KQ0 A;  5IRU A;  5LJG A;  2AT5 X;  1EIO A;  4Y5D A;  4NYR A;  2QO4 A;  1LNM A;  1T8V A;  5F2B A;  5B2A O;  1OEJ A;  2OFA A;  1HXL A;  2L9C A;  4OS8 A;  4R0B A;  1PM1 X;  2HMB A;  1EW3 A;  2DM5 A;  5L8I A;  1OEE A;  3BX8 A;  4BGF A;  1CBR A;  1YWA A;  3RDQ A;  1JQP A;  3APV A;  4HPD A;  5LJH A;  3VHM A;  1AVE A;  4ML7 B;  1NQN A;  2IZE B;  2JMB A;  3HK1 A;  1EUO A;  3VHH A;  4TLJ A;  4EQA C;  1Y52 X;  2CAM A;  3Q6L A;  4I3D A;  4FBR A;  4C5P A;  4QGV A;  3SZJ A;  2RTR B;  1PEE A;  2RTO B;  1EPA A;  2IZK A;  3AKN A;  1SRF A;  4CPH B;  1VWD B;  3EC5 A;  3BDR A;  4BOE A;  4WBK A;  4JNJ A;  4LQZ A;  3BU9 A;  4BQU A;  5H8T A;  1BRP A;  1DZK A;  1QQS A;  2G5L A;  4OEL A;  1ERB A;  1NQM A;  4U8U N;  4ALB A;  2A5C A;  1SY1 A;  2ACP X;  4Y0R A;  4CPH A;  4RUU A;  2MJI A;  2X32 A;  2RQ0 A;  4NLJ A;  4OMX A;  4KH8 A;  2FS7 A;  1FTP A;  5H9N A;  1SWP A;  4Z28 A;  5KHP A;  1JZU A;  1TW4 A;  3T6F A;  4XMD A;  1BRQ A;  1K24 A;  1VWH B;  1N9M A;  2AF5 A;  4U46 A;  4O3X B;  3VE1 A;  5HCD C;  1JYJ A;  5FQ7 E;  3MX7 A;  1N4J A;  1YWD A;  4OEM A;  5LJD A;  4UU3 A;  3S5V A;  4A8Z A;  3HOL A;  5HA0 A;  3P6C A;  5HCC C;  2X45 A;  2HKD A;  4TNN A;  1VWB B;  1GT4 A;  4GJV A;  3KFI A;  1QFT A;  3RDX A;  1EAL A;  1LEL A;  4A1Y A;  4M7M A;  1SMP I;  1TOU A;  3KFG A;  4UU2 A;  1D3S A;  2WQA E;  3I0A A;  3MVF A;  2I5V O;  1STS B;  3FEP A;  4Z27 A;  3KFH A;  2OFR X;  2G78 A;  3O2Y A;  4MVE A;  4OS3 A;  3S60 A;  1SXU A;  3WBG A;  4IB7 A;  4ALO A;  3APU A;  1LIE A;  3QKG A;  1UYO X;  4O4O A;  1DZM A;  1I04 A;  3NR3 A;  2MHD A;  4NNT A;  5B27 A;  1VWI B;  1NBX A;  1D2U A;  2XKL A;  3VE2 A;  4MEE A;  1JMZ A;  1DC9 A;  1JYD A;  2GJ5 A;  2QOS C;  3HWD A;  5AJB A;  3HWE A;  2PI3 O;  2A13 A;  4GJS A;  2NNE A;  4O3Z A;  1SRH A;  4EFG A;  4NV8 A;  2A0A A;  4I9S A;  2W2A A;  2OZQ A;  2RTQ B;  3WZQ A;  3D96 A;  2RTC B;  2Z4I A;  2FGS A;  2RN4 A;  2AL0 X;  3S5X A;  3NAD A;  3G7X A;  3FW5 A;  2X4M A;  4HFO A;  4YKO A;  2L68 A;  3ZW2 A;  4B55 A;  4O4S A;  1CRB A;  1HBP A;  3ZQ3 A;  1SLF B;  4GKC A;  2JU3 A;  2OY5 O;  2LFO A;  3ZI8 A;  5C0N A;  1LDQ A;  1SWH A;  1R0U A;  1HMS A;  3H3I A;  5FAZ A;  1JJX A;  3RY1 A;  2WR6 A;  2Z4H A;  4KII A;  1I06 A;  4NLI A;  3ZZV A;  2AT6 X;  4QNI A;  2IZI A;  1FEM A;  3MM0 A;  4YGZ A;  1ACD A;  1NP4 A;  5LJK A;  1SY0 A;  2OL7 A;  3NQ3 A;  5L3Y A;  1GX3 A;  1A18 A;  3NX2 A;  4U8U O;  2GH7 A;  2BS6 A;  2LBV A;  1JJU A;  4GGT A;  2AT0 X;  3I17 A;  3BY0 A;  4IB8 A;  5F7G A;  4CSB A;  4TQ2 A;  1DF3 A;  2RTD B;  5HZ9 A;  2FKG A;  4AZO A;  1ZNH A;  4BX6 A;  3SLO A;  3SOT A;  5K67 A;  3ZW0 B;  1IFB A;  4JGL A;  1SLG B;  4JHQ A;  1VWJ B;  1SWB A;  2X34 A;  1AB0 A;  2GTL N;  1W6F A;  2X8T A;  3C78 X;  4L3R A;  4XMH A;  3DSZ A;  2CZT A;  5EED A;  4O4X A;  3ZW0 A;  4BX5 B;  2QOM A;  3HPE A;  2A8G A;  2AT3 X;  5H9K A;  5IO7 A;  3TF6 A;  2FR3 A;  1LUQ A;  1MX8 A;  4O9S A;  1KT5 A;  4BX5 A;  3WVM A;  1X8N A;  1G74 A;  2RTH B;  3FYF A;  4WHI A;  4ES7 A;  4TKJ A;  2LB6 A;  3FA9 A;  1QY2 A;  4JO6 A;  4CDD A;  1KL3 A;  3ZW1 B;  2PY1 A;  1SLE B;  1FEN A;  3KVN A;  3LV4 A;  4YGG A;  3FEN A;  2OYB O;  4AZQ A;  3D97 A;  1QFV A;  3SLT A;  2I5Z O;  4LKT A;  4CDE A;  3ZW1 A;  2MM3 A;  4HPC A;  1LDO A;  5HBS A;  3HTY A;  2WPU A;  4LZU A;  4ORR A;  4WFU A;  1A3Y A;  5DG4 A;  3SAO A;  3U0D A;  3P6E A;  1YWB A;  2R56 A;  3N91 A;  4LZV A;  4ZHH A;  5CHK A;  2W2F A;  1WBI A;  3FR2 A;  2G7B A;  2HYS A;  5F6Z A;  4GUZ A;  1IJ8 A;  1OPA A;  2E4J A;  5HZ6 A;  2AVI A;  4AZR A;  1Y55 X;  1IKJ A;  2FR2 A;  1E2T A;  2NP1 A;  2Q2M A;  4YFR A;  1JIW I;  1SY3 A;  4ZHC A;  3PEC A;  4Z6J A;  4INN A;  4ZHG A;  3WJG A;  2RTM A;  1QAB E;  1QY0 A;  3NBX X; 
#chains in the Genus database with same CATH homology
 3T6F A;  2IZC B;  1RXK A;  1VWH B;  2FHL A;  1VWN B;  2UYW A;  1N9M A;  2OF8 A;  4U46 A;  1LCW A;  4BJ8 A;  3RE5 A;  3VHI A;  1N4J A;  4GGR A;  2MF6 A;  2QCB A;  1SRG A;  1SWS A;  2RTJ A;  1SWC A;  1VWB B;  2RTK A;  3EW1 A;  4GJV A;  3RDX A;  1LEL A;  1MOY A;  4GGZ A;  3RDO A;  1RXJ A;  1STS B;  1PTS A;  5B5F A;  4Z27 A;  1KFF A;  1SWR A;  4I60 A;  1VWM B;  1SRE A;  4BX7 B;  3SZH A;  3WYQ A;  1SWN A;  2IZB A;  1SWG A;  5IRA A;  1VWI B;  1NBX A;  5JD2 A;  4BX7 A;  2A5B A;  2UZ2 A;  3VGW A;  1VWE B;  1MEP A;  2BC3 A;  2RTA A;  4GD9 A;  1SWD A;  4GJS A;  4Z2O A;  1SRH A;  3RDM A;  1SWU A;  2RTQ B;  5B5G A;  3WZQ A;  4CPE A;  2RTC B;  4DNE A;  1AVD A;  1NC9 A;  5K68 A;  1N7Y A;  1LCV A;  1SWQ A;  1HY2 A;  1VWG B;  2Y3F A;  2Y32 A;  3RY2 A;  4BCS A;  4CPI A;  1VYO A;  1VWC B;  1RSU B;  1SLF B;  2ZSC A;  1LDQ A;  1SWH A;  1I9H A;  1SWP A;  2IZA A;  2RTL A;  1DF8 A;  3MG5 A;  4GDA A;  1VWK B;  3RY1 A;  2FHN X;  1SWJ A;  2RTP B;  2IZI A;  3MM0 A;  3WYP A;  5CSE A;  3T2W A;  2IZL B;  2C4I A;  1NDJ A;  4CPF A;  5L3Y A;  1STR B;  4BX6 B;  1VWL B;  4YVB A;  1VWR B;  2GH7 A;  2C1S A;  4GGT A;  4BBO A;  1SWT A;  1SWA A;  2IZD B;  2RTD B;  4IRW A;  4Y59 A;  4BX6 A;  1SRJ A;  1MK5 A;  5K67 A;  4JHQ A;  1SLG B;  2RTB B;  3EW2 A;  1VWJ B;  1SWB A;  4Z2P A;  2IZJ A;  2RTE B;  3X00 A;  4BX5 B;  1HXZ A;  1SLD B;  1N43 A;  3SZI A;  2A8G A;  2RTI B;  1LUQ A;  4EKV A;  4BX5 A;  3FDC A;  2C1Q A;  1SWL A;  1SRI A;  5IRU A;  2RTH B;  1VWQ B;  1VWP B;  2IZG B;  4Y5D A;  3PK2 A;  3T2X A;  4Z2V A;  2OF9 A;  4JO6 A;  5F2B A;  2OFA A;  1KL3 A;  1HXL A;  1MM9 A;  1SLE B;  2RTF B;  1LCZ A;  2JGS A;  5IRW A;  1RXH A;  1VWF B;  3RDQ A;  1RST B;  4Z28 A;  1N9Y A;  3VHM A;  1AVE A;  1LDO A;  1VWO B;  1NQN A;  2IZE B;  2Y3E A;  2WPU A;  3RDS A;  3RDU A;  3VHH A;  1SWF A;  1RAV A;  2IZF B;  5CHK A;  1Y52 X;  1WBI A;  2CAM A;  2F01 A;  1HQQ A;  2RTN B;  3SZJ A;  1IJ8 A;  2RTR B;  2OFB A;  2RTO B;  2AVI A;  2IZK A;  1Y55 X;  1SRF A;  1SWK A;  1VWD B;  2RTG B;  4CPH B;  1STP A;  3WZN A;  4JNJ A;  1KL5 A;  2G5L A;  1NQM A;  1VWA B;  1Y53 X;  2A5C A;  4CPH A;  4Z6J A;  4OKA A;  3T6L A;  2IZH B;  2RTM A;  3RE6 A;  3WZP A;  1KL4 A;  3WZO A;  1SWE A;  1SWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...