3WZUA

The structure of map2k7 in complex with 5z-7-oxozeaenol
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
299
structure length
270
Chain Sequence
GYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGAGCAAYMAPERIDPPPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 7
publication title 5Z-7-Oxozeaenol covalently binds to MAP2K7 at Cys218 in an unprecedented manner
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 67
structure length 270
sequence length 299
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3wzuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3wzuA01
3U51A 3EQFA 4DFXE 5C8NA 3ZXTA 1H0WA 3EFKA 4CMOA 4OAVB 4OT6A 3RJCA 2O5KA 4FT9A 3POZA 4UXQA 3OP5A 1OPJA 2JDTA 4YPDA 1UNLA 2EXEA 5CASA 2BRBA 2XM9A 2IO6A 3S00A 1MRUA 2RG5A 3ZSHA 5DI1A 4BGHA 3EHAA 4E5BA 2JITA 2JFMA 2X9FA 1F5QA 4BTJA 2OG8A 4G6OA 4RC3A 3UOKA 5CU0A 3B2TA 1H1RA 2C6OA 1PW2A 3HUBA 5EW3A 4C4IA 4DLIA 3W8QA 3PDTA 2BTRA 1JWHA 2PE0A 5D7VA 3KXXA 4L7FA 4U40A 3IOKA 1WVYA 3G2FA 4YTHA 4F7LA 2YIWA 3JUHA 2WMTA 1CKPA 4ANOA 4E6DA 4RIYB 3ZBXA 4J52A 1SVEA 1R1WA 3DTCA 3HRCA 4UWCA 1ATPE 4A9SA 3SAYA 4BTKA 5CF4A 3LJ2A 3MFSA 5DN3A 2XRUA 5J5TA 3E7VA 2BKZA 2W05A 4PDOA 5AAEA 3OC1A 4A9UA 4M97A 5E8VA 5IUIA 4CRSA 1OKWA 4G3DA 2R2PA 5E9EA 1JKSA 2V62A 3A60A 4FTRA 4GW8A 4XBUA 4ID7A 2YJSA 3LW0A 3MFRA 4L53A 3P7AA 2XB7A 2QO2A 4GRBA 5DIAA 4RIXB 4BKJA 5JQ8A 3CS9A 3R01A 4RWKA 3BLRA 2UZDA 4L68A 4F9WA 5JKGA 1LPUA 4KIQA 4J8MA 1FMKA 4P90A 4XV9A 4O7NA 4NSTA 5L8JA 3PIXA 2IW9A 4ZSAA 3E7OA 3QCQA 3DXPA 2BCJA 4MF1A 1P5EA 2IZRA 3Q5IA 2R0IA 4RIWA 3R7UA 4TL0A 1OUYA 3VRZA 2JIIA 2VTLA 4WBOA 3NUAA 3BBWA 2E9OA 5CNNA 4BKYA 2JKMA 4WNOA 3VBWA 4FV1A 3O50A 1JKLA 5FXQA 4PF4A 2X2LA 3FQHA 3P23A 2PE1A 4UB7A 5LWMA 2IVSA 3O0GA 4HPTE 4XMOA 1DAYA 5AM7A 3R8LA 4FVPA 4M69A 4QTAA 3M11A 3MH1A 3B8RA 4MBJA 3Q32A 4ACHA 3P79A 4CVAA 4BBMA 5BYYA 5IEXA 4V0GB 1PKGA 4BCHA 3L9NA 5IG1A 2W06A 2EXMA 1QMZA 5I9WA 3EN9A 2XNEA 2X7GA 2XA4A 3UG2A 3GOPA 4A7CA 2GNIA 4CKJA 3P08A 1KV1A 3R22A 3E64A 3VULA 4FT5A 4C62A 4AP7A 2Y6OA 3LJ0A 3TDWA 5M06A 5A4TA 2AC5A 4M0YA 4HZSA 3W2PA 4ORKA 4JBOA 2HWOA 1GZ8A 4AWIA 3RINA 3TWJA 3UC3A 4RWIA 4PMTA 3EYGA 2YCRA 2OI4X 3IO7A 4MK0A 1M2RA 1YOLA 2PUPA 3U4WA 3WF6A 2HZNA 5IQEA 1IA8A 3L1SA 3FMLA 4I6QA 4RIOA 2B9HA 1OIRA 3GP0A 4C36A 4OTHA 4IHPA 1QL6A 4PDPA 3ANRA 4BY9E 2XNGA 2XJ2A 4IB0A 2H9VA 4XG6A 1SVHA 2WTKB 3DAJA 4X3FA 5CZIA 4F65A 4WBBB 5IZFA 5K0XA 4M12A 2B1PA 2C5OA 3BCEA 3L9MA 3Q9XA 2XNNA 3VQHA 1YHWA 4ACGA 3UOLA 4QMUA 4C4EA 1XR1A 5CYIA 3R02A 4I23A 4I3ZA 1F3MC 4LGDA 3H4JA 3RHKA 1CM8A 4IANA 2GMXA 4I41A 3G15A 2JBOA 4UZDA 1IR3A 5IA2A 4PQNA 5CWZA 5IDNA 1R0EA 3D94A 3PWDA 4UN0C 5HIDA 5IQDA 3WZEA 5FP6A 2OIBA 4RJ5A 4QMSA 3OD6X 2UVXA 2PYWA 3IDBA 4QTCA 2JKOA 3CE3A 4QP1A 3ZSGA 4RC2A 4K6ZA 4GUBA 4AW0A 2QOKA 4U80A 3WE4A 1GZKA 3GFWA 4QYFA 4JNWA 3F2AA 3ZONA 1Q8WA 3DQWA 4JIAA 1H26A 3QAME 2XRWA 4YU2A 2VTSA 2Z7RA 4IVAA 5HD7A 4CZTA 2WQEA 4BDEA 3FLZA 1FVTA 4UMTA 3ZEPA 2QG5A 5EI2A 5EQYA 4BWPA 3SQQA 5CALA 3PIYA 1H1QA 4G9RA 1PXJA 4QQJA 4B99A 3QXOA 1IASA 5L8KA 3ZFXA 3MW1A 5E7RA 1ZYLA 3TUCA 4GFOA 5HO6A 3D5WA 4RZVA 4Y83A 1YRPA 2W1EA 1XKKA 4NCTA 4DF3A 3R28A 3OXIA 2J0IA 2OFVA 3BV3A 2QOHA 4EWHA 3AT2A 1IEPA 4GJ2A 5F4NA 1ZWSA 3R7IA 5CY3A 2WMAA 1S9JA 3NCZA 4CKIA 3OEFX 4NW5A 3ROYA 3LFAA 3N51A 4F9BA 2OFUA 4CLJA 5HNIX 4R5SA 2R3HA 3F3VA 2BR1A 5FDXA 3K54A 4EORA 4G6NA 1UU3A 3PUPA 2P2HA 2YLFA 1OL2A 3N4VA 4FKSA 4FX3A 2BRGA 4R1VA 4IAAA 4EOQA 3PXZA 1R0PA 2PWLA 4EBVA 4DAWA 5FD2A 3SKCA 3TNWA 2XS0A 1Q41A 2W1HA 4TYJA 1OITA 3KA0A 5HIBA 4CV9A 4I0TA 3VWAA 4FIFA 2QURA 4MD7E 4RX9A 4QYYA 5CLPA 5HI2A 2DQ7X 4K77A 3QCYA 3QCXA 5KHXA 4DH5A 3RZBA 2E9PA 3NS9A 4C34A 1OM1A 1XH5A 2ONLC 3QL8A 4IAFA 2OGVA 1CDKA 2PTKA 4KIKB 1HCLA 4UBAA 4ZOGA 4D4YA 2WTIA 3DBDA 4CZUA 4BI0A 2ETMA 4RMZA 5LVNA 1TKIA 2WNTA 4K2RA 1W98A 5FEQA 3OEZA 1IRKA 2XK8A 3RWPA 2X8DA 3W32A 4R5YA 3R63A 3BHYA 3TZMA 3OMVA 3FAAA 4FTCA 5IMEA 3DY7A 3RPVA 2YIQA 5EYDA 4XG7A 3NSZA 3QWJA 4F1OA 3S2PA 4PNKA 4RG0A 5JRQA 4DT8A 4AE9A 2OWBA 4L00A 5HOAA 2I6LA 4FTUA 3D0EA 1L3RE 3MGYA 5I9VA 3QTRA 4QMPA 2YM7A 3MDYA 4S33A 4BIBA 3B8QA 1YW2A 2X1NA 4GYGA 4BF2A 4CFMA 4J96A 5BQ0A 4APPA 4XP3A 4L01A 5IMXA 2QO7A 2R3JA 4KS7A 3WYYA 1SYKA 3TN8A 4FV9A 3F3UA 5FEEA 4L52A 4X21A 5FXRA 4D5KA 4YJQA 2VTJA 3MWUA 4O1OA 3TV6A 4FEUA 4U7ZA 1FGIA 2RFSA 3CKXA 3KXNA 4II5A 4N70A 4BWXA 5BVKA 4X7QA 5EYMA 3SLSA 3PY1A 4AA4A 4M8TA 1MQBA 1XH8A 3SG8A 3WI6A 4LMUA 4W8DA 4EH8A 3UYSA 3NVMB 2XK7A 4EUTA 5KCVA 3CIKA 3ZCLA 4J7BA 2XNPA 2VRXA 3IK3A 3FEGA 3AG9A 3I0QA 5CX9A 5CEOA 3HA8A 4MYGA 4Y5HA 5BVDA 3GCVA 4OUCA 5E1EA 2H6DA 3OT3A 4RC4A 4JXFA 4QMZA 3U9CA 2OJJA 3P7CA 3QKLA 4I0SA 1FPUA 3QLGA 4Q9ZA 2YACA 4MNFA 4EH2A 5I5ZA 4EK6A 1Q8UA 4UY9A 3TIYA 4GT5A 1G8AA 2C5YA 2BZJA 2ITXA 2GNJA 2W1DA 3BQCA 3NNUA 4BB4A 2BILB 4CFWA 3V5QA 4LRMA 4BIEA 3O8TA 2WU6A 4MF0A 5E8YA 2V7OA 2QOBA 4R7IA 4ZTRA 3ZTXA 2VTNA 4FOCA 4ITJA 3OFMA 1PMUA 3KKVA 5D7AA 4DLJA 1OL1A 5KZIA 2ITOA 2VTTA 2ITPA 4G34A 3KCFA 4BDCA 4RQVA 1UNHA 2C0IA 3ITZA 5AJQA 4OTFA 3VS0A 1FQ1B 3CXWA 3R1NA 2G15A 3MTFA 1FGKA 4BCQA 4K11A 5DE2A 4IVDA 3R9DA 3ZDIA 2J0MB 2QD9A 4AUAA 3PXFA 3ZRMA 5BVFA 3HVCA 4RPVA 3PP1A 5F94A 3WF8A 1MQ4A 5AA9A 3VUGA 1XH9A 2R3MA 1OPKA 5E8WA 3L9PA 5AA8A 1Y57A 5JGAA 3K5VA 4FK6A 4BVUA 5FDPA 5AR2A 3KVWA 3V5LA 2WTVA 4F08A 4KABA 2XYNA 4C0TA 4FTNA 3I6WA 4B0GA 4ZZNA 1BUHA 5LMAA 4ZJIA 2C5NA 5D11A 3WZUA 3G51A 1KE9A 2RG6A 2V0DA 3CTJA 3E92A 4EOLA 4C4FA 4Q5EA 5IQAA 3LLAA 4C37A 5AP3A 4EONA 3ZM9A 1H00A 4F1MA 4E6CA 4D58A 3MVLA 4QNAA 5I9ZA 2CKEA 3V5JA 3A4PA 1OL7A 3E8DA 4R3RA 4E4LA 1PKDA 3DKCA 5C1QB 3BE9A 5HTCA 4PDSA 5AV0A 3UQGA 3QQHA 2CNUA 3V6RA 3D2IA 4AZFA 2VWYA 2XP2A 3LE6A 5I4NA 1IAJA 4GG7A 2X2MA 4BZNA 3I7BA 4FV0A 3UZPA 4IX5A 2WMRA 4ZSLA 3W10A 2CGVA 4BRXA 2W0JA 4DGOA 3FQSA 2HCKA 2CKOA 2XVDA 3ORNA 4XG9A 4AA0A 3O51A 4D0XA 4C02A 3R8ZA 4FV4A 4PRJA 2RF9A 2XH5A 4K18A 4C33A 3LXNA 4Y85A 4JAIA 5KMIA 3ROCA 4QP6A 3Q9ZA 4YJUA 3DLZA 4BDKA 4RFMA 4USFA 2BDJA 4IAYA 4ZSEA 3FV8A 5DT0A 4EZ5A 3ZUTA 1WVWA 2ZM1A 2X4FA 3FMMA 3RCDA 5DPVA 5E1SA 5F95A 5KMOA 3CP9A 1YVJA 2I1MA 4L3LA 1CTPE 4RIWB 3W1FA 2YM5A 3PSDA 3MS9A 2JDRA 2KULA 2A27A 5CU4A 3II5A 4DEAA 2W4OA 4JX3A 4YO4A 5M56A 2RGPA 3H0ZA 2H8HA 3VUIA 4CZYB 3OCGA 4P4CA 4YTIA 3BQRA 3FKLA 5CVGA 3TTJA 5GIOE 4YPSA 4C57A 3V5TA 3FC2A 5EQPA 3AQVA 4IZYA 2EVAA 4FKWA 5TR6A 5CEIA 4M69B 3GU8A 4TRLA 5GNKA 4J53A 3VUKA 2YN8A 3KVXA 2YITA 4GFMA 3CY2A 3KXMA 2BRHA 4YJTA 4EYJA 4WRSA 3PWYA 5CAOA 1H4LA 2O64A 1Y91A 2QR8A 2VTIA 3C4WA 5B2LA 2OXDA 1CKIA 3ZUVA 4WKQA 2DYLA 5L2TA 3P9JA 4AFJA 4GU6A 3DBEA 4BL1A 4W8EA 1VJYA 4I1ZA 3EH9A 4DTKA 1M7QA 4Y5QA 2CLQA 3ALNA 4I22A 3PIZA 3BKBA 5IQBA 5DHJA 4CYJA 2I40A 1JSTA 4MBIA 5K4JA 5LVPA 2J9MA 2FA2A 1Q8YA 3WILA 1SNUA 4E20A 4L3PA 2X4ZA 4L6QA 4RVKA 5JEBA 3L8XA 4Q9SA 3KY2A 3EQIA 2WO6A 3PG1A 4TYEA 4O82A 2W5HA 5EDPA 3RPYA 3MTLA 4JQEA 4NWMA 4QO9A 4LM5A 2PHKA 5AV1A 4C2VA 5HX6A 5JRSA 2R3OA 5EM6A 2F7ZE 4BCFA 4KUJA 2ZM3A 4Z16A 1G8SA 2UZVA 3REPA 3FI4A 4X3FB 2P33A 3TNIA 5AUTA 5EHOA 4S2ZA 4ASXA 5KMNA 4WNMA 4O27B 3Q60A 3VUDA 2B53A 3HNGA 3GBZA 3BEAA 4FC0A 4G5PA 4BWKA 4DA5A 4ZJJA 3FC1X 5AUUA 4HGLA 5IQIA 5AR8A 4FSMA 5EM5A 4EK5A 3UVPA 3ZH8A 2WTDA 4BDAA 1J7IA 1BYGA 3I5NA 4O91A 4XG3A 5EW8A 2V22A 5KBQA 4CLIA 2WIHA 3IGOA 2WMWA 4FTOA 4YHTA 4L42A 3PJ8A 2GNHA 3VNTA 4F64A 3FZTA 3NYVA 4YMJA 2A19B 3W2OA 3AGLA 3PJ3A 5M4IA 1P4OA 4BGGA 4MQ1A 3RAKA 4FIHA 4ANLA 3QD3A 4DBNA 2GQSA 2F49A 3EQDA 5AFVA 4HVSA 3FMKA 3MV5A 3Q4TA 2ETKA 3ZM4A 4ASDA 2UVYA 3ZHPC 3EFWA 4FKIA 2CGWA 5IEVA 3MY5A 2C6KA 5K3YA 4YSJA 2WAJA 4QMNA 2ZDUA 2GFSA 4CEGA 4RFZA 5HLWA 2XM8A 3UGCA 4X6QC 2C6TA 3GI3A 1EH4A 1PXKA 2HK5A 5FXSA 1NW1A 3A4OX 3LVPA 3COHA 3NVKI 3ZC6A 4FSQA 3HV5A 4A4OA 5KE0A 5A46A 5AAGA 4IE9A 3HRBA 1O6YA 1Y6AA 3UO6A 4C59A 4BHZA 5D1JA 3TIZA 4LOOA 3GFEA 4YC6A 5M08A 2QO9A 3R73A 1SZMA 3ERKA 5DWRA 4XCUA 5ETAA 5J7BA 4LFIA 4O0XA 2P3GX 4FZDB 2GSFA 3C4CA 3UQFA 4GVAA 5HBJA 4IIRA 2ETRA 1W8CA 4JR3A 4CSVA 5M4UA 2XCKA 5DR2A 2FH9A 5CAUA 4LL5A 4GL9A 2WMSA 3PZHA 4GVJA 2Q83A 3QQJA 2W99B 4D1ZA 4EK4A 5JK3A 5M51A 4R1YA 2OF4A 3MH2A 4JG8A 3CJFA 3RI1A 1W82A 4DG0E 5ICPA 3UBDA 2ITQA 3EWHA 1T45A 4BDJA 3C9WA 2UW9A 3A99A 2ZV9A 3NRMA 4LGGA 4RLLA 5HZNA 3QRJA 4DHFA 5IH4A 4BI2A 4AT5A 4QQTA 3QFVA 5AEPA 2PULA 1YHSA 1XH7A 3Q6UA 5IQFA 3C51A 1ZARA 5AP0A 5IF1A 4KSQA 4MD8E 4ONAA 3KC3A 4RJ7A 2WHBA 1NY3A 3BHUA 3AGMA 4GK3A 4DEEA 4FEXA 1YKRA 3KN5A 3ZZWA 4MTAA 3JYAA 1RJBA 5EM7A 5HNBA 4CTCA 4F4PA 2BFXA 3DXNA 3FXXA 4FSYA 4ACMA 3UVQA 2PZPA 4RA4A 4NFMA 5CSWA 2HZ4A 3IW5A 3ZUUA 5E8XA 2JLDA 4FSTA 2J0JA 5FTGA 3PFQA 3FWQA 5CEPA 3RGFA 3Q6WA 2CNVA 2BUJA 4E1ZA 4YJPA 3I6UA 4HW7A 4XUFA 3BU5A 4JG7A 3QZFA 4RLKA 4QOXA 4RWLA 3VBTA 3DJ5A 4FV2A 1YI3A 1A48A 2XIXA 3A7FA 4FKLA 4LQMA 4ZTQA 3H10A 3R7GA 3ZOSA 5FUTA 2RSVA 3U54A 3K3IA 3U8WA 4C38A 5L4QA 4FTQA 4MCVA 3MVJA 1RW8A 2ACXA 3GC8A 1M17A 5J79A 1Q8TA 3RPRA 5KHWA 4IJ9A 1YDSE 2PUIA 1AQ1A 5A6NA 4I5HA 3OY3A 3SRVA 5F1ZA 4C35A 2BVAA 2R3NA 4F6UA 4PDYA 5BVWA 2YA9A 4PL3A 5HBEA 4O83A 4ACDA 5M4FA 3T9TA 4FG8A 4EZ3A 4I24A 3TXOA 3KEXA 2CSNA 5TKDA 2VNWA 4BGQA 5CT7A 2HAKA 2UZLA 5EYKA 4TY1A 2XK4A 3GEQA 3GU5A 2C69A 4GJ3A 3QTSA 3SW4A 4LGHA 3FMNA 3PA5A 3QKKA 4YTFA 5J7HA 4MXYA 2GHGA 2GFCA 4W4VA 5JH6A 5J8IA 3R04A 2W1IA 2HY81 2PUUA 1YOMA 3DZOA 2QCSA 1PMNA 3FDNA 3GGFA 4PMMA 4XOZA 3KMWA 1WVXA 1GAGA 3OUKA 2YHVA 2YZAA 5LARA 5CI6A 5HESA 2VU3A 1YXVA 2DWBA 1H25A 4A06A 4XNEA 3G33A 4W4WA 4Z3VA 4FGBA 3VUHA 5EHLA 1GOLA 2VWXA 3P1AA 4IZ5A 2BHEA 4O1PA 2EUFB 2HWPA 2CN5A 1XBBA 3LFCA 1GZOA 5IQGA 3LQ8A 4HNIA 3DNDA 2GTMA 3H30A 4MWIA 1WZYA 3SDJA 3CD8A 1O6KA 3KRXA 4FTLA 2G2HA 4FTIA 1H1WA 3GCSA 3NNVA 3IW7A 4L7SA 1WBWA 3FYKX 2PUNA 4U8ZA 3MESA 2X7OA 4TYIA 3CCNA 4CV8A 4WRGA 1FVVA 4CCBA 1J1CA 2X0GA 5M09A 3QXPA 5LCJA 3LPBA 3V6SA 4B8LA 3FI2A 3VVHA 5FP5A 4FEQA 3R9OA 3SVVA 1DI9A 1WBOA 4O38A 4U44A 1FOTA 3QTIA 4CTBA 1TVOA 4FKUA 3QC4A 3BZ3A 3C5UA 4I5CA 3BWJA 5ACKA 4IB1A 3OW3A 4ITIA 4FZ7A 4A9RA 4DGMA 5HQ0A 4OTRA 4L8MA 3DV3A 4TNBA 1NVQA 4FUYA 3PP0A 1OMWA 4HYSA 3RHXA 2ZB0A 3EFLA 3FMEA 3UO4A 3HMIA 2W9FB 2PZRA 1Q62A 3Q9WA 4JDJA 5AIKA 1ND4A 2R3RA 3GCPA 5BYLA 5KUPA 4W4XA 4TNDA 3TACA 1UKIA 3FI8A 2GU8A 3ZMMA 2PZ5A 3R7YA 3FZOA 3KXHA 2GHLA 2ITTA 4E4XA 2WOTA 5E4HA 3SGCA 3EMGA 3VS6A 2JGZA 4EKKA 2J4ZA 4G3CA 3TKIA 5TOZA 3CQWA 4QMMA 3OCTA 2Z8CA 2Y4PA 2FUMA 1X8BA 2VO6A 5FM2A 4A9YA 3NW5A 4OT5A 2JKQA 1YDTE 4V05A 2GS2A 5L3AA 5DNRA 2C6MA 3NUNA 1YWRA 2CN8A 1OL5A 2GCDA 2VO3A 4FKPA 4TW9A 4B9DA 3AD4A 4ZLZA 2B9FA 4C8BA 4FT7A 1KE6A 2BRMA 4MXZA 3OUNB 3QQGA 4LUEA 2OK1A 4IQ6A 2X81A 4EK8A 5AX3A 4AN9A 3K2LA 5AV2A 3UZTA 2YZLA 5A4CA 4E4NA 3HAVA 4MKCA 3ACKA 3PYYA 3DGKA 3OWKA 3I60A 2JDOA 1IAHA 4QNYA 4FOBA 4IXPA 3OOGA 4I5PA 4IDVA 4D4RA 3GUBA 5AR7A 2GNGA 3UNJA 3FMHA 4YZCA 2F9GA 3MA6A 2VTOA 4LUDA 5HBHA 1KE7A 3TL8A 4NUSA 2NNWB 3ID6C 4RRVA 5ACBC 2PU8A 2DUVA 4X2FA 3R8UA 2F4JA 3AD5A 3ULZA 1OBDA 4AOTA 4RQKA 2XEZA 1QPCA 4L9IA 5M44A 3CPCA 4IADA 2J50A 3A8XA 1Q3DA 3ENMA 3FZSA 2FGIA 3W8LA 1B6CB 1M2QA 3IS5A 3SC1A 2CGXA 2JC6A 3MY1A 4IVCA 4YC8A 4XS2A 4IX3A 3DFAA 1UKHA 3VN9A 4YLJA 1XO2B 3GVUA 3WIKA 4JVGA 5JT2A 2RKUA 3GT8A 3C4FA 3KRLA 3NCGA 4PX6A 3D9VA 4FI1A 4EH9A 2Y6MA 4QMVA 1XH4A 3WZDA 5B7VA 4UEUA 2YIYA 4EZ7A 4TWCA 2I0HA 2OJFE 2R4BA 4JRNA 4D55A 3SXRA 3HDNA 3RTPA 2CKQA 4FNYA 5CI7A 3Q04A 1UU7A 4TWOA 3PY0A 4EQUA 2PVNA 5CAQA 2C3JA 4PPBA 3QD2B 3ZO2A 4EQCA 1Y8GA 2X6EA 1LR4A 5CANA 4FE2A 3F3WA 1HOWA 3EN6A 1Y6BA 3FBVA 5EDQA 1P4FA 4JJRA 4PL5A 3UPZA 2X39A 4LV5A 3NW7A 5AM6A 5FTOA 2ITVA 4HVGA 2C6EA 5G1XA 3R7OA 4I6HA 2W5AA 2O0UA 4AZSA 3PVUA 4J98A 4OTGA 3BHVA 4RVMA 4NYEA 1BLXA 5I3RA 4WHZA 4BCMA 3JY0A 4FEWA 3VS4A 2GQGA 2VO0A 3H0YA 5H2UA 3PE1A 3F82A 4QTEA 3V8SA 4F6WA 4DG3E 1V0OA 4FL2A 2YISA 4FZ6A 3VW6A 5L2QA 4D4SA 4USDA 3E8EA 2ZJWA 1Z57A 3NUXA 3EIDA 2BTSA 4GEOA 4AS0A 4DH3A 4G1WA 2ZDTA 4O7LA 3AMAA 3RM6A 1WBVA 2A1AB 3V5PA 4L45A 3N4TA 3RK9A 3MIAA 4KA3A 4JAJA 4FV6A 2OSCA 3V8WA 2HW7A 2G2IA 5CENA 4K8AA 2PMIA 4WT6A 2XIYA 3VF9A 3FE3A 4TT7A 4MEDA 4CYIA 3COMA 3I79A 5L6WL 3VBQA 4E93A 3DNEA 1H0VA 5AP4A 2ZV8A 4ZSJA 4BI1A 3F5XA 3LM5A 5KO1A 2OIDA 5F20A 3WF7A 3QLFA 4YJVA 3AC4A 5DOSA 2XK9A 2Z2WA 4RFYA 2XIKA 5IA5A 1SNXA 5AADA 5CAVA 4GKIA 2PPQA 3H9FA 5DMZA 4RJ6A 4KRCA 4IFCA 3UIBA 4P7EA 4UZHA 4M68A 1OB3A 3U4UA 4NJDA 2HENA 2WZJA 5DR6A 4D28A 1ZYJA 3JVSA 1REKA 5AV3A 2WPAA 2VWBA 3HLLA 3VW8A 3JVRA 2P0CA 5FBNC 3V04A 4FSNA 3TDVA 2ERKA 3KULB 3ZRLA 5F9EA 3BYUA 4FTAA 2WQOA 3IW8A 4NK9A 3PZEA 3E87A 4RVLA 2R3LA 4EJNA 3KQ7A 3FPQA 2UW8A 3IDPA 2HXQA 3VS5A 3KCKA 3PRFA 3IOPA 2VX0A 3MA3A 4W9WA 1VR2A 4FIGA 4G16A 4DH1A 4CFUA 1VYZA 5EI6A 5HO8A 4O86A 4TZRA 2QU5A 4KSPA 3COIA 2VX3A 3SXSA 2C3IB 3DDQA 1OVEA 2VTAA 5KMMA 4DTAA 4JR7A 4HGSA 3U87A 4H3PA 2F7XE 3G6HA 4JQ7A 3VAPA 3MH0A 5AP7A 1H24A 1H1SA 3D2KA 2HXLA 5T3QA 4O7YA 4YZBA 4EL9A 2YDIA 4OTQA 3IW4A 3QRUA 5AUYA 2FSLX 2GNLA 3L8SA 2Y4IB 2C3LA 2EXCX 1SM2A 4JLCA 2OZAA 2C6IA 1YHVA 4HGEA 3VBXA 4BCGA 3Q53A 4NM5A 2R3GA 3BPRA 1DAWA 3GQLA 2WTKC 2W1FA 3BWFA 1OKVA 2YAKA 3D15A 2QOOA 4RT7A 4P5QA 4BCIA 1PXLA 2HOGA 3QF9A 2OBJA 4AAAA 5DH3A 2W9ZB 4BTMA 3LIJA 4W4YA 4CFFA 2PE2A 3DT1A 1NT2A 3HEGA 1ZXEA 4UMQA 3FZRA 4FMQA 3R2BA 3FUPA 3QUDA 4QMYA 4RJ8A 2HELA 3PPJA 5BUJA 4S30A 2J5FA 2OKRA 4PV0A 4TWNA 1GZNA 1QCFA 3IW6A 3JR1A 4EHEA 4MNEA 3ORLA 4L44A 4EOKA 1R78A 4K9YA 5ETCA 2JKKA 4DYMA 1K9AA 1XBAA 3OOMA 3ALOA 2PY3A 4X2KA 5EHYA 1M2PA 1FBNA 5DYJA 3CLYA 3O71A 3G5DA 3GCQA 3PA3A 4KIOA 3SRVB 3ZSIA 5IU2A 4E26A 3OWLA 2CLXA 3R0TA 3KRJA 3PSBA 3W16A 5IPJA 4XX9A 3QQLA 4QMXA 5ANKA 4ZTLA 4ACCA 4ZTNA 2HYYA 4BCNA 3AC8A 4TXCA 4FICA 1BKXA 4WNPA 3UMXA 4E6QA 2IWIA 3AMYA 4DGGA 2YM4A 1APME 2OJGA 3RPOA 5K5NA 3V51A 2VWZA 3C4EA 3R7EA 4EC9A 5CF5A 4EOIA 5HCZA 3ZC5A 3GU6A 3G0FA 3D4QA 1YXTA 5M07A 2Z7QA 3A8WA 4LG4A 3NUSA 2VAGA 4C58A 4ZAUA 2CMWA 2JAMA 2WQBA 3LCDA 4GK4A 4NT4A 4ZS0A 3RP9A 4U97A 3WBLA 4BICA 3MFTA 5LMKC 4DFNA 4M66A 5D10A 3SOCA 1UA2A 3F6XA 3UPXA 3VIDA 1G5SA 1JQHA 3DA6A 2B52A 3DXQA 1Q3WA 3EKKA 4Y72A 5C9CA 1WFCA 4WIHA 5EW9A 4MXCA 5L2WA 3OWPA 3PVGA 1U59A 3L9LA 3PJ2A 4FSZA 1OECA 4QYHA 4EOMA 2W17A 1BL6A 1PXNA 2UW6A 2C6DA 4WD5A 3KK8A 5D12A 1U5QA 2UUEA 3QYZA 4BCPA 2C47A 5FG8A 4S32A 2ESMA 4U81A 5LOHA 3KGAA 1Z9XA 3VS3A 3FLYA 4BDIA 3SX9A 1MUOA 4G3FA 4Q5HA 3F3TA 3LMHA 1KE5A 3JXWA 3F5PA 2C30A 3QTZA 5ANDA 4FF8A 2YCFA 2OW3A 2ZOQA 3ZO4A 3D7ZA 3RK7A 4D9UA 5HD4A 4DEHA 3ORKA 5CSHA 4IB3A 3WYXA 5FGKA 3RM7A 3MVHA 3VUMA 3MB7A 5EG3A 4XV1A 2CNQA 1BMKA 4IMYA 3S95A 4GMYA 4YHJA 3ZYAA 2R3FA 4I93A 2B7AA 4GUEA 2Y0AA 4NM7A 3DPKA 3LFEA 5M57A 4BR3A 3DU8A 4RGJA 3RNYA 3NYNA 2EB2A 4G6LA 4E8AA 4F7SA 3RVGA 4FNXA 4U45A 3TNHA 3EQCA 3LFDA 3S0OA 1WMKA 4QYEA 3GCUA 1V0BA 4OBPA 4FT0A 4NKSA 1ZY4A 4BBEA 4B4LA 4ZZOA 2E9NA 4MX9A 2BDWA 5A3XA 4Y73A 5LWNA 3E88A 4YR8A 3E3BX 5A9UA 3ULIA 4FIEA 1JKTA 1ZLTA 4ITHA 4ZP5A 2VGPA 4O2PA 3HECA 2A0CX 3NAXA 3G9LX 4GIHA 1H28A 4NJ3A 5ANGA 4AGCA 5ANIA 3AT3A 4KBKA 4XV3A 5JGDA 5EYCA 5IUHA 1CKJA 2XYUA 2OH4A 2QC6A 4HYHA 4EK3A 3ATSA 3PJ1A 4I4FA 3TKUA 1JPAA 3PVBA 4UWYA 2YCQA 4F0GA 1KV2A 3TUBA 3HMNA 5LVOA 3ORZA 1RQQA 2YM3A 5IKWA 2C5XA 2UW7A 1Q24A 3G0EA 1Y8YA 4XYFA 2HZIA 3D5XA 5CVHA 3UVRA 3TI1A 4QQ5A 3OY1A 3RAIA 2ONLA 2RL5A 5CTPA 2DS1A 3EQGA 3ZEWA 4M13A 5IQHA 5I3OA 3SV0A 4WG5A 1PXPA 4I0RA 5AUXA 2VD5A 3RBWA 1J1BA 3ZO1A 2JIUA 1KOAA 1T46A 1JSUA 4ALUA 2O2UA 4ANMA 3E93A 4IVBA 3A7HA 3FHRA 2P55A 5IH5A 4XBRA 4XEYA 2WB8A 4UMPA 2XZSA 1UU9A 4N6ZA 2ZB1A 1WCCA 3DCVA 3P78A 1OIYA 4XRLA 5CSVA 5CSXA 2JDSA 3DOGA 1ZY5A 2B55A 5ITAA 4H3QA 4Y8DA 3BLHA 2CHLA 2UW5A 3GC9A 3LZBA 4R77A 3FLQA 1WBPA 2JAVA 4X6RA 4YURA 5A4LA 4RZWA 1AGWA 4DC2A 4EBWA 4IW0A 3JS2A 4BCJA 2YDKA 2GS6A 2FVDA 2R5TA 1S9IA 1RDQE 4KIPA 4YBJA 4GYIA 2LAVA 5IA3A 4O0YA 1ZRZA 3NAYA 4BDFA 4QMQA 4AW1A 3HRFA 2ZMCA 3NYOA 3K3JA 5AX9A 4ZZMA 1M14A 5I9UA 3QZHA 2PMNX 3FLNC 3Q5ZA 1SVGA 3IPHA 3ORPA 2XJ0A 4JL9A 3UDBA 3DTWA 4DFLA 4RVTA 5DRDA 3LFQA 2G1TA 3LXKA 2QHMA 4E5AX 1V0PA 5C26A 4D5HA 4FA2A 4K1BA 5C03A 4XLIA 1XQZA 2OXYA 2IN6A 3NUUA 1URCA 2QR7A 2XBAA 3CJGA 1MP8A 1R3CA 3NIZA 4DCEA 4YGAA 4H05A 4DGNA 5KKRB 4MXAA 1KUTA 1TQIA 2AYPA 3C0HA 4YZMA 4FKJA 5HG5A 2YAAA 5AMNA 3BHHA 2X9EA 3ZLXA 4AT4A 4HVHA 5LQFA 4MWHA 4ZEGA 3QA0A 3MI9A 5CQUA 2I0YA 2WOUA 2F57A 4A07A 4YZDA 2YABA 3R1SA 3QU0A 3EZRA 3LJ1A 3MPTA 3NYXA 3P4KA 4HYIA 4NM3A 4EJ7A 1E1VA 3I7CA 3C50A 3LMGA 2C1BA 5JQ5A 1UU8A 3KULA 4OGRA 3LXLA 2XCHA 3THBA 4ZMEA 1LUFA 3QX2A 4XJ0A 4DG2E 2X7FA 4TTHB 4UX9A 1BI7A 3QBNA 3EQHA 4D2SA 5IH6A 3UIMA 4ANBA 3RCJA 4NL0A 1URWA 2QOFA 3NUPA 3WF5A 5ETIA 5EQEA 2JEDA 3FXZA 3UYTA 4FSWA 5CT0A 4XG8A 4FV5A 3E5AA 3NWWA 1GIJA 4RX8A 1L8TA 3UP7A 4U43A 2IJMA 3QX4A 3TEIA 4CT1A 3KMMA 2BIKB 3V8TA 2G2FA 4AW2A 3BEGA 4NZWB 3VO3A 3BU6A 3L8VA 2WQMA 3QRKA 3BLQA 3LM0A 5ANEA 5H3QA 4QYGA 1ZYCA 3BRBA 5FEDA 4QTDA 3LLTA 3UMWA 4NM0A 4C3RA 3LAUA 2Q0BA 1NXKA 4C4HA 4FTTA 2FSMX 5DFPA 4XH6A 1WBSA 2VX1A 4BDDA 3Q3BA 2XMYA 3QD0A 2VUWA 4ANNA 4GKHA 4LI5A 2WEVA 2ZV2A 4U79A 4BC6A 4J97A 2O8YA 4P2KA 3KN6A 1NA7A 3NR9A 4J1RA 5KX8A 3C4ZA 4C7TA 4N57A 1P2AA 1FVRA 4ZS4A 3VBVA 3PPZA 1UV5A 4EOOA 1K2PA 3G9NA 2PVKA 4KBAA 4X3JA 2VN9A 2O65A 3NZ0A 1W84A 4IWQA 5J95A 4LRJA 2OZAB 2BDFA 2ZAZA 2YCSA 3SA0A 4YUQA 5J1VA 1H8FA 2OJIA 4O0RA 2C1AA 3CC6A 3M42A 4BYIA 5L2SA 4X3FC 4C2WA 4B7TA 1XJDA 3MY0A 3F5UA 3IGGA 3MBLA 4J8NA 3RWQA 2WTWA 4AFEA 4YJNA 3HV3A 2JFLA 2X6DA 3E8NA 4UYAA 4H36A 5KNJA 2XNOA 5E91A 3Q2JA 2R3IA 3ORIA 4R6VA 3BGPA 3LFNA 2UW0A 3QWKA 3NNXA 2J6MA 4CQEA 2YM6A 3AC5A 1VEBA 3GU4A 3OXZA 4DGLC 4FT3A 3DKGA 4O84A 3QGWA 4DEDA 1IA9A 3QC9A 5CF8A 4MNEB 3QZGA 3PLAE 4L67A 3UIUA 4QQCA 2QODA 4E6AA 1U46A 3HL7A 3HV6A 2OH0E 4IM0A 3FLSA 4EC8A 3BE2A 4QP4A 5CF6A 4USEA 3OHTA 4ASZA 3DAEA 4TYHA 1GIHA 4D9TA 5AUZA 2YIRA 4YLKA 5EKNA 5A54A 2YEXA 3NX8A 3UE4A 1VYWA 2QOCA 2WFYA 4HZRA 5HLPA 5HVKA 5H8EA 5BX0A 3VC4A 2FYSA 4GV1A 3BBTB 4BFMA 4ZY5A 2ZYBA 5B2MA 3TCPA 2QLUA 5LMBA 3RKBA 2RIOA 5HCXA 2IVUA 3AT4A 2J2IB 3Q4ZA 4QTBA 2XBJA 3A7IA 1JBPE 1PY5A 2O3PA 4BIDA 4EKLA 2C68A 4F1TA 4O7SA 4FK3A 5IA1A 4H58A 1U5RA 3FL4A 2QOLA 3HV4A 3OCSA 4R3CA 4RBLA 1QPDA 5DBXA 4EQMA 3Q2MA 4V01A 4APCA 1O9UA 3GQIA 4JRVA 4PMSA 2I7QA 3ODZX 2OF2A 4EH3A 4YJOA 2EB3A 3L8PA 5IUGA 4OAUC 3IQ7A 5JN2A 2B0QA 5JFWA 4DCAA 3CEKA 2GNFA 3MPMA 4NCTC 2GPHA 4MHAA 3PVWA 2VTRA 4OBQA 2YWPA 3HP2A 3UOJA 1REJA 1P14A 2ITYA 2AC3A 4ZXTA 4LYNA 3CR0A 3VS2A 3WF9A 1ZOGA 4MBLA 4H39A 2Y7JA 3PE2A 4FKOA 2WELA 2WQNA 4LOPA 5AP5A 5TT7A 5J9ZA 4O7VA 4A4LA 2PZIA 3QRTA 3KU2A 3OCBA 5TF9A 2BZIB 2W1CA 3NIEA 4XHKB 4EI4A 3DKFA 3QTXA 3E62A 3QD4A 4GK2A 3SW7A 4AOJA 5BUEA 3F61A 5M55A 4FIJA 2WMBA 3HX4A 3HKOA 4IAKA 4AACA 4R8QA 3E8CA 4FKVA 5C4LA 5GJDA 5JFSA 4XG4A 2GDOA 4H1JA 4E73A 4EHVA 2C6LA 3ANQA 4YBKA 4IB5A 3R8MA 2C4GA 2P4IA 4X2NA 4HOKA 5HVYA 3RAHA 5BVOA 3PXYA 5L2IA 3N4UA 2YIXA 3D5UA 3LCOA 1PMVA 4IZ7A 3F88A 4JG6A 3W2QA 3F2NA 3C0IA 2ITZA 3OF0A 3OS3A 3F7WA 4IC7A 3TT0A 3D83A 4KNBA 4AU8A 4D2TA 4F0FA 3V01A 4CMTA 2XIRA 3M1SA 1OBGA 1JNKA 4TWPA 4FKQA 4QP9A 4DT9A 3LKMA 3ZXZA 4C3PA 5DRBA 3QKMA 4FGRA 1KSWA 3GENA 5C8MA 3BV2A 1PRYA 3LFSA 3NPCA 4CT2A 3R7VA 3C4XA 4JDIA 2QLQA 5C4KA 3ACJA 4OTWA 4ERKA 1W83A 4BHNA 4AQCA 1SMHA 3NGAA 4BDGA 3G90X 4IX6A 5AR5A 3EQPA 3AC2A 4CFXA 3T3UA 2QOQA 3KMUA 2OIQA 4H3BA 3VJOA 3CY3A 4WNKA 2VTHA 3O7LB 5FM3A 5T6KA 3UG1A 4G17A 4N0SA 3VS1A 1U54A 2OXXA 3HA6A 4NH1A 3QTUA 4FG9A 4I6BA 3A62A 4LMNA 4HVIA 5CVFA 1YOJA 2IW6A 2QI8A 3OVVA 3F5GA 4QMTA 4UYNA 4AGWA 3GU7A 4YLLA 3R71A 3TZ8A 3IDCA 3KK9A 3QQUA 5I9YA 2BAJA 3S3IA 3TZ9A 2RFDA 3EOCA 4DFZE 4WOVA 3D7TB 1LEZA 3QQFA 5A14A 2XEYA 4KKGA 3EFJA 2A2AA 2R9SA 2W4KA 2C5VA 2W1GA 3LMIA 5E8TA 3OZ6A 4G31A 2PL0A 5AP2A 3AC1A 1PYXA 1WBTA 3C7QA 2X8EA 3FHIA 5HG9A 5DEWA 4FKRA 3DJ7A 1MRYA 5HICA 4YNOA 4M14A 4DINA 5BNJA 3R9RA 2VZ6A 4U9AA 3HUCA 4E4MA 5K9IA 2Z7LA 4QP2A 1DM2A 4Z9LA 2BFYA 1PHKA 3VUTA 3GB2A 1UVRA 2CCHA 4AW5A 5E8UA 1LP4A 2W96B 2VTQA 3VHKA 4IBMA 4PPCA 4X2GA 3KRWA 4IAZA 4FBXA 3FSFA 3OBJA 4FG7A 4WUNA 4C4JA 1Q4LA 3PXKA 3VHEA 2EWAA 2Z7SA 3BYSA 2NP8A 3KXGA 4MQ2A 4NKAA 4O7ZA 5HU3A 4FV7A 1OL6A 3TKHA 4IDTA 4BKZA 2QG7A 2JIVA 2WEIA 2YERA 1YWVA 3GOKA 1B38A 1MRVA 2SRCA 4KBCA 5HG8A 2IPXA 4HYUA 2IVVA 1Q99A 1OIUA 4QP8A 3T8OA 4BYJA 2I0VA 4GCJA 4FKTA 2BKKA 1BL7A 3IECA 2PK9A 3IKAA 3WARA 2B9JA 2WU7A 3ENHA 3NW6A 5BYZA 2YM8A 4YC3A 5FQDC 4G5JA 3F7ZA 4KB8A 4KRDA 5HE1A 2E9UA 5BVNA 4KKHA 3AXWA 4GU9A 3OBGA 4YSMA 4I21A 3EL8A 4CQGA 4DTBA 4CFNA 1GY3A 2UZOA 3QALE 1TQMA 4PNIA 4FEVA 2QKRA 3MN3A 4EHGA 4M3QA 3MVMA 3BYOA 3H9RA 3HV7A 2FSTX 3FI3A 4L3JA 4OTDA 4DE4A 2CJMA 2I0EA 2WKMA 3FLWA 3Q4UA 3LXPA 4Z55A 5LJJA 3LFBA 2ZVAA 3ZU7A 2QKWB 4E5WA 4J71A 1J91A 5K4IA 3HYHA 3ZFYA 5J9LA 4DN5A 3RZFA 3ZO3A 3SOAA 2ZV7A 4MH7A 3PTGA 2ZM4A 5HVJA 2UZNA 2NRUA 4OTPA 2PVRA 1TQPA 3KRRA 4ALWA 4S31A 4NIFA 2REIA 3HMPA 4F09A 1I44A 4MVFA 4EEVA 3F66A 1WBNA 4IC8A 2XKFA 5FWKK 4P5ZA 2HW6A 4DEGA 4I5MA 3UNZA 2BIYA 4A9TA 4RJ4A 4PTEA 5J1WA 3ZZEA 3W18A 4F9AA 5J87A 3R00A 4AX8A 4LOQA 5EM8A 3UP2A 1GJOA 5L6OA 1OI9A 2J51A 5KZ0A 5JSMA 2F2UA 5K5XA 1ZMVA 3ZS5A 4MXXA 1DI8A 3H9OA 3QCSA 2WMUA 4YP8A 2X2KA 3GXLA 1ZYDA 5HE2A 4IAIA 5HLNA 3R2YA 5AUVA 4IZAA 3ZFMA 3CTQA 5IISA 2PMOX 2YLEA 3MB6A 3NDMA 3TM0A 3CGFA 4GSBA 5B0XA 4AZTA 3R8PA 3FMJA 4KD1A 3FPMA 3Q96A 5HU9A 4BCOA 5EK7A 2GTNA 2R3PA 5M53A 3LQ3A 2Z60A 3HMOA 3O8UA 4D2WA 3FQEA 4ENXA 4I20A 4AZEA 2UZWE 1JLUE 1OUKA 3ET7A 4D1SA 4CGAA 2PMLX 2WTCA 4TYGA 4O0WA 3RK5A 2BMCA 5BMMA 2QHNA 2ERZE 2VO7A 5B2KA 3O8PA 4JX7A 2WMXA 3LOKA 4GG5A 5E8ZA 4CRLA 4MD9E 4F9YA 4DFYA 4FYNA 3QA8A 4EH5A 3EL7A 1YI6A 3O17A 3SD0A 3MFUA 3PXQA 5BMSA 3ORXA 4O22A 1W0XC 4OW8A 4U5JA 4HNFA 3W2SA 4OLIA 4DFUA 3NEWA 1FMOE 3Q52A 1STCE 2PVFA 4FUXA 5DG5A 4NFNA 3Q4CA 5CNOA 3QRIA 3TJCA 4U0IA 4CD0A 5JFXA 3PJCA 4YTCA 1J7UA 4F0IA 3AMBA 1H08A 4LL0A 5IA0A 3CQEA 3CBLA 3A7GA 3A61A 2BZHB 2J90A 2Q0NA 2YFXA 3OTUA 5J9YA 3F3ZA 5HORA 5GZ9A 3ZRKA 3EQRA 1YXSA 4G2FA 3DK6A 5CZHA 4YHFA 2UZEA 5GINE 3ELJA 4QD6A 3D14A 3LHJA 4L43A 2IZSA 2R64A 3P7BA 3PA4A 4QPSA 5GZ8A 3EN5A 4TKSA 5J5SA 2YDJA 1WAKA 3MJ2A 2XK3A 5HCYA 4DBXA 2RFNA 2BAKA 3EN4A 4PMPA 4E3CA 4GH2A 4D2VA 1A06A 3OTVA 4IACA 5EI8A 3UO5A 2WMVA 3DLSA 2QQ7A 3I81A 5M4CA 3UJGA 4BZOA 4QP3A 2OU7A 2VGOA 4K33A 5TE0A 2VNYA 2C3KA 2XKDA 3GC0A 2GS7A 2ZMDA 4K0YA 4LV8A 4M7IA 4Q2AA 5D9HA 5AR4A 4FNWA 3R9NA 3BYMA 3DK7A 3QGYA 4B8MA 3MYGA 4M84A 4O7TA 3DAKA 4DH7A 1LEWA 5GIPE 4TYHB 4BN1A 5EKOA 3COKA 5AAFA 4HGTA 5CEKA 4AZWA 5L8LA 1OPLA 4JIKA 4NU1A 3FMDA 4OBOA 4ZIMA 4KWPA 3GC7A 3I1AA 1U4DA 5T68A 5CU6A 4QMOA 3ZLWA 2QVSE 4UALA 4ENYA 2CGUA 2B9IA 4AA5A 1J7LA 4HPUE 3C5IA 3FKOA 3P0MA 5K0KA 4EHZA 4EOJA 4Z7GA 5I0BA 4OTIA 4U3ZA 4FTMA 3FY2A 3RAWA 4U6RA 3FJQE 4RSSA 4CNHA 5E8SA 4O81A 1PMEA 2LGCA 3W55A 5DVRA 1QPEA 4ARKA 3AD6A 5AIRA 4RWJA 4RX5A 3WE8A 3TUDA 3N9XA 3KB7A 5GJGA 2XJ1A 3ZLYA 4CXAA 5DGZA 3ZBFA 3A2CA 4PY1A 3BU3A 5AUWA 3ZDUA 2OZOA 2XKCA 5HE0A 2XKEA 3EQBA 3Q9YA 4TPTA 1ZYSA 5AV4A 2ITNA 3LCKA 5H8BA 1H01A 3UOHA 3KF4A 4FL3A 5A4EA 2W7XA 3R6XA 4XLVA 3R9HA 2IZUA 1JSVA 2CKPA 4C61A 4FODA 4R7HA 2QONA 3HAMA 4QT1A 4GFGA 4WUAA 1XH6A 3R1QA 5HE3A 5HIEA 3FYJX 5CXZA 2HIWA 3EN7A 4I92A 5EFQA 5HEZA 3TTIA 5A6OA 1JKKA 3D5VA 5GHVA 4RIYA 3F9NA 4XP2A 5CEQA 3BYVA 3MH3A 4EH7A 2J5EA 2WMQA 4KS8A 1QPJA 4GT4A 3G6GA 2YWVA 2R3KA 2IW8A 3PY3A 4J95A 5DT3A 1CMKE 4HCTA 2Y4IC 5EH0A 4BBFA 3MPAA 3QYWA 4FTKA 3M2WA 4O0UA 4M15A 1JVPP 4YZ9A 1KWPA 5L6PA 3U55A 4RIXA 1YI4A 4UMRA 4IH8A 4JI9A 2P2IA 5KMJA 1CSNA 5LXMA 5EOLA 3FZPA 4ZTMA 3DBCA 3B2WA 3AOXA 3FSKA 3PG3A 4ZSGA 3R8VA 5HHWA 4CMUA 1XBCA 4I6FA 4C3FA 3K5UA 4X2JA 4JDKA 4YJRA 2NO3A 4U3YA 5E92A 3QQKA 2ITWA 3JPVA 3TG1A 4FSUA 4FZFB 3U9NA 4FV8A 4WSYA 2FB8A 1UNGA 1IG1A 2VWIA 2BHHA 3VRYA 3PRIA 3WZKA 4NW6A 3SG9A 3P5KA 4G3GA 3HZTA 3U6HA 2IVTA 3PPKA 5FLFA 3OROA 3BIZA 2QU6A 2BPMA 3UIXA 3CGOA 5JMSA 2V7AA 1Q61A 3EKNA 5CQWA 4IX4A 4XP0A 1FINA 3D7TA 1PXOA 4FIIA 1U54B 3QHWA 1ERKA 1W7HA 5DA3A 3UTOA 4C4GA 3TZ7A 4CG8A 4PP9A 3UZRA 2W4JA 3BGQA 4AE6A 1PYEA 1PXMA 3MIYA 4IEBA 4V0GA 4IWPA 4ZY4A 5CSPA 1PXIA 3E3PA 4CKRA 3H3CA 3DB8A 4BTFA 5KMLA 1GIIA 4ZY6A 2NRYA 4O6EA 4HJOA 4I4EA 3LQ5A 4YJSA 4DITA 4KAOA 5CAPA 1PJKA 4AGDA 3DK3A 5CEMA 1OKYA 3CPBA 5BUIA 1KOBA 2NPQA 3CKWA 3RALA 2XF0A 5CU2A 4F70A 2IZTA 2UVZA 5HG7A 1H07A 2HY0A 3QTQA 1NVSA 1JAMA 1OKZA 3R1YA 3W33A 4FVQA 3U6IA 3VS7A 2C0TA 3KREA 3NMUF 3AC3A 2FO0A 1YDRE 4WG3A 5E90A 2XIZA 3BI6A 4JT3A 1VZOA 2AUHA 2ITUA 3CTHA 5AP1A 2EU9A 1UWJA 2BRNA 4IWOA 4EUUA 5ANJA 2W1ZA 3DKOA 2UZUE 4TN6A 1YWNA 2PVHA 2WIPA 2H34A 3DBQA 3FZ1A 2G9XA 5HO7A 1PF8A 3HDMA 4R3PA 5G6VA 3QZIA 3DZQA 3QUPA 2PVYA 4BDHA 4D2RA 5EOBA 3I0OA 4QRCA 1BI8A 1YXXA 3RNIA 3DQXA 3JY9A 3ORTA 5LVLA 4D0WA 4HCVA 2PVMA 5IQCA 3GNIB 1E1XA 4FYOA 4YZNA 1DS5A 2PVLA 5IEYA 5JZJA 3C0GA 4WA9A 4FKGA 2J7TA 4ERWA 2VWUA 5IDPA 2VTMA 1Q5KA 4G9CA 2OJ9A 3T9IA 1F0QA 1RE8A 4M67A 4NTTA 4U42A 4FZAB 4EWQA 5CXHA 4F63A 5HTIA 5GJFA 5HNGA 4HCUA 5DT4A 3P86A 4AT3A 5KBRA 2OICA 3TV4A 3DFCB 5LCKA 4B6LA 4CG9A 1Q97A 2O63A 3O7LD 4V04A 3ZLSA 1NVRA 4QMWA 3UQCA 3SHEA 1B39A 4JS8A 4FL1A 4XRJA 2XNBA 4O6LA 1OIQA 3EB0A 4EYMA 4PPAA 5A4QA 3DB6A 5BPYA 4J99A 4HVDA 4ANQA 1BX6A 4GS6A 1ZAOA 4IM3A 4ZTHA 5ETFA 5HKMA 3FKNA 2GQRA 2HZ0A 5HTBA 3VJNA 2BZKB 1Q8ZA 5CS6A 5TO8A 3ATTA 3I5ZA 5H9BA 3W2RA 3O2MA 4JBPA 4WSQA 4D2PA 3FY0A 4FV3A 1M52A 4OR5A 4U41A 2XNMA 2PVJA 4H1MA 3QTWA 4BCKA 4NIFB 5I9XA 4BDBA 1XWSA 3R30A 3DBFA 4FR4A 4UXLA 4KINA 4DEBA 3CSVA 2XUUA 5C01A 2JBPA 3E63A 1ZMUA 3ORMA 1J3HA 3PXRA 5LMKA 4Y46A 4YNEA 2IG7A 4XG2A 2B4SB 1M7NA 4IFGA 1V1KA 1KE8A 2KTYA 4RX7A 3BHTA 3KXZA 3LCSA 4GIIA 3RMFA 4D4VA 4PTGA 4PL4A 3SXFA 3OW4A 5JGBA 2XK6A 3F69A 1OZ1A 4RA5A 4ZLYA 4Z7HA 3BX5A 3OWJA 2E2BA 2UW4A 3EZVA 3TV7A 2F2CB 1GNGA 1Z5MA 3TNQB 4AOIA 4N4SA 2VWWA 3ETAA 3MSSA 2OO8X 3O96A 5HGIA 4QP7A 3IONA 5CU3A 5H8GA 5AWMA 3FXWA 3S4QA 4PWNA 4O0TA 3LCTA 1A9UA 4IWDA 4BZDA 4JDHA 4O0SA 3BGZA 3U6JA 3ODYX 5KMKA 2VWVA 4O2ZA 5DEYA 3OT8A 3DDPA 4KIKA 4AGUA 5DLSA 2UZTA 2UW3A 4S34A 4AN3A 4F9CA 1AD5A 4AG8A 4AXAA 4WO5A 5FTQA 3WOWA 4DH8A 2WD1A 3UNKA 3C13A 4R7BA 3POOA 4ALVA 2R3QA 2V5QA 4F99A 4ZJVA 3F2RA 1ZOHA 4M0ZA 3A7JA 4O96A 4IM2A 3KF7A 2R0UA 4ANSA 2GHMA 1I09A 2BALA 4Y95A 3QUEA 4G3EA 4X0MA 4EH4A 4ZMFA 3EJ1A 3BELA 5DR9A 3NUYA 2W5BA 4QPMA 1G3NA 3R21A 3MJ1A 4UV0A 1E9HA 4CCUA 4AN2A 4D1XA 3DS6A 4MXOA 4PTCA 3CQUA 4ZTSA 4JOAA 4UMUA 3R83A 3O23A 2Y9QA 4CFVA 5AR3A 1ZZLA 4XOYA 4WG4A 4AZVA 1H27A 2PZYA 1ZZ2A 2Y8OA 5BVEA 4E7WA 2V55A 3EYHA 2A4LA 4PUZA 5FBOA 2QOIA 3CD3A 5LVMA 5JFVA 3PLSA 1UWHA 3C1XA 4JBVA 1R39A 4EOPA 2QNJA 4YO6A 5IA4A 4JBQA 4NEUA 2FSOX 4FTJA 4ASEA 4F6SA 1JOWB 2JDVA 2J0LA 4N6YA 5C8KA 5FRIA 4F7NA 1YQJA 1OGUA 3VF8A 4FNZA 3OXTA 1ZOEA 4IJPA 5D41A 2UV2A 3TNPC 1HCKA 4A4XA 4AF3A 4F7JA 4PP7A 3UC4A 1K3AA 3IG7A 4MAOA 3PSCA 4O0VA 2UZBA 2H96A 3HMMA 4L46A 3TJDA 4EH6A 3T3VA 3HP5A 4UWBA 4R78A 3FL5A 5ANOA 4W9XA 3I4BA 4ZK5A 4JQ8A 2F7EE 2G01A 2VV9A 4GT3A 4QPAA 1ZMWA 2B54A 2E9VA 2X8IA 2YJRA 5KKRC 2VTPA 4EOSA 3DJ6A 2R7IA 4ZLOA 3HGKA 4KKEA 5HX8A 2J0KA 2RFEA 4FSRA 3WIGA 3WZJA 4NTSA 4O7WA 3NNWA 1XHAA 4O21A 4XV2A 3KL8A 2R7BA 2WXVA 2BROA 1YXUA 2JD5A 4I94A 2CCIA 3UODA 1O6LA 3V5WA 4FVRA 3LFFA 5GZAA 3VQUA 2PSQA 2OLCA 3QHRA 2CPKE 3RPSA 1H1PA 2C0OA 3NLBA 2Z02A 4DFBA 2CDZA 4QMLA 5JZNA 4LRKA 3W2CA 3KFAA 4RJ3A 5AP6A 5C27A 3V3VA 5EDRA 3OG7A 3VBYA 2BAQA 2WTJA 4O7RA 4DEIA 3S1HA 2WGJA
chains in the Genus database with same CATH superfamily
3U51A 3PUFC 3EQFA 4DFXE 5C8NA 3ZXTA 1H0WA 3EFKA 4CMOA 4OAVB 4OT6A 3RJCA 2O5KA 4FT9A 3POZA 4UXQA 3OP5A 1OPJA 2JDTA 4YPDA 1UNLA 2EXEA 5CASA 2BRBA 2XM9A 2IO6A 3S00A 1MRUA 2RG5A 3ZSHA 5DI1A 4BGHA 3EHAA 4E5BA 2JITA 2JFMA 2X9FA 1F5QA 4BTJA 2OG8A 4G6OA 4RC3A 3UOKA 5CU0A 3B2TA 1H1RA 2C6OA 1PW2A 3HUBA 5EW3A 4C4IA 4DLIA 3W8QA 3PDTA 2BTRA 1JWHA 2PE0A 5D7VA 3KXXA 4L7FA 4U40A 3IOKA 1WVYA 3G2FA 4YTHA 4F7LA 2YIWA 3JUHA 2WMTA 1CKPA 4ANOA 4E6DA 4RIYB 3ZBXA 4J52A 1SVEA 1R1WA 3DTCA 3HRCA 4UWCA 1ATPE 4A9SA 3SAYA 4BTKA 5CF4A 3LJ2A 3MFSA 5DN3A 2XRUA 5J5TA 3E7VA 3VONA 2BKZA 2W05A 4PDOA 5AAEA 3OC1A 4A9UA 4M97A 5E8VA 5IUIA 4CRSA 1OKWA 4G3DA 2R2PA 5E9EA 1JKSA 2V62A 3A60A 4FTRA 4GW8A 4XBUA 4ID7A 2YJSA 3LW0A 3MFRA 4L53A 3P7AA 2XB7A 2QO2A 4GRBA 2IF8A 4RIXB 5DIAA 4BKJA 3CS9A 5JQ8A 2X0PA 3R01A 4RWKA 4DHZA 3BLRA 2UZDA 4L68A 4F9WA 5JKGA 1LPUA 4FRFA 4KIQA 4J8MA 1FMKA 4P90A 4XV9A 4O7NA 4NSTA 5L8JA 3PIXA 2IW9A 4ZSAA 3E7OA 3QCQA 3DXPA 2BCJA 4MF1A 1P5EA 2IZRA 3Q5IA 2R0IA 4RIWA 3R7UA 4TL0A 1OUYA 3VRZA 2JIIA 2VTLA 4WBOA 3NUAA 3BBWA 2E9OA 5CNNA 4BKYA 2JKMA 4WNOA 3VBWA 4FV1A 3O50A 1JKLA 5FXQA 4PF4A 2X2LA 3FQHA 3P23A 2PE1A 4UB7A 5LWMA 2IVSA 3O0GA 4HPTE 4XMOA 1DAYA 5AM7A 3R8LA 4FVPA 4M69A 4QTAA 3M11A 3MH1A 3B8RA 4MBJA 3Q32A 4ACHA 3P79A 4CVAA 4BBMA 5BYYA 5IEXA 4V0GB 1PKGA 4BCHA 3L9NA 5IG1A 2W06A 2EXMA 1QMZA 5I9WA 3EN9A 2XNEA 2X7GA 2XA4A 3UG2A 3GOPA 4A7CA 2GNIA 4CKJA 3P08A 1KV1A 3R22A 3E64A 3VULA 4FT5A 4C62A 4AP7A 2Y6OA 3LJ0A 3TDWA 5M06A 5A4TA 2AC5A 4M0YA 4HZSA 3W2PA 4ORKA 4JBOA 2HWOA 1GZ8A 4AWIA 3RINA 3TWJA 3UC3A 4RWIA 4PMTA 3EYGA 2YCRA 2OI4X 3IO7A 4MK0A 4AAYA 1M2RA 1YOLA 2PUPA 3U4WA 3WF6A 2HZNA 5IQEA 1IA8A 3L1SA 3FMLA 4I6QA 4RIOA 2B9HA 1OIRA 3GP0A 4C36A 4OTHA 4IHPA 1QL6A 4PDPA 3ANRA 4BY9E 2XNGA 2XJ2A 4IB0A 2H9VA 4XG6A 1SVHA 2WTKB 3DAJA 4X3FA 5CZIA 4F65A 4WBBB 5IZFA 5K0XA 4M12A 2B1PA 2C5OA 3BCEA 3L9MA 3Q9XA 2XNNA 3VQHA 1YHWA 4ACGA 3UOLA 4QMUA 4C4EA 1XR1A 5CYIA 3R02A 4I23A 4I3ZA 3UDTA 1F3MC 4LGDA 3H4JA 3RHKA 1CM8A 4IANA 2GMXA 4I41A 3G15A 2JBOA 4UZDA 1IR3A 5IA2A 4PQNA 5CWZA 5IDNA 1R0EA 3D94A 3PWDA 4UN0C 5HIDA 5IQDA 3WZEA 5FP6A 2OIBA 4RJ5A 4QMSA 3OD6X 2UVXA 2PYWA 3IDBA 4QTCA 2JKOA 3CE3A 4QP1A 3ZSGA 4RC2A 4K6ZA 4GUBA 4AW0A 2QOKA 4U80A 3WE4A 1GZKA 3GFWA 4QYFA 4JNWA 3F2AA 3ZONA 1Q8WA 3DQWA 4JIAA 1H26A 3QAME 2XRWA 4YU2A 2VTSA 2Z7RA 4IVAA 5HD7A 4CZTA 2WQEA 4BDEA 3FLZA 1FVTA 4UMTA 3ZEPA 2QG5A 5EI2A 5EQYA 4BWPA 3SQQA 5CALA 3PIYA 1H1QA 4G9RA 1PXJA 4QQJA 4B99A 3QXOA 1TFFA 1IASA 5L8KA 3ZFXA 3MW1A 5E7RA 1ZYLA 3TUCA 4GFOA 5HO6A 3D5WA 4RZVA 4Y83A 1YRPA 2W1EA 1XKKA 4NCTA 4DF3A 3R28A 3OXIA 2J0IA 2OFVA 3BV3A 2QOHA 4EWHA 3AT2A 1IEPA 4GJ2A 5F4NA 1ZWSA 3R7IA 5CY3A 2WMAA 1S9JA 3NCZA 4CKIA 3OEFX 4NW5A 3ROYA 3LFAA 3N51A 4F9BA 2OFUA 4CLJA 5HNIX 4R5SA 2R3HA 3F3VA 2BR1A 5FDXA 3K54A 4EORA 4G6NA 1UU3A 3PUPA 2P2HA 2YLFA 1OL2A 3N4VA 4FKSA 4FX3A 2BRGA 4R1VA 4IAAA 4EOQA 3PXZA 1R0PA 2PWLA 4EBVA 4DAWA 5FD2A 3SKCA 3TNWA 2XS0A 1Q41A 2W1HA 4TYJA 1OITA 3KA0A 5HIBA 4CV9A 4I0TA 3VWAA 4FIFA 2QURA 4MD7E 4RX9A 4QYYA 5CLPA 5HI2A 2DQ7X 4K77A 3QCYA 3QCXA 5KHXA 5BV3A 4DH5A 3RZBA 2E9PA 3NS9A 4C34A 1OM1A 1XH5A 2ONLC 3QL8A 4IAFA 2OGVA 1CDKA 2PTKA 4KIKB 1HCLA 4UBAA 4ZOGA 4D4YA 2WTIA 3DBDA 4CZUA 4BI0A 2ETMA 4RMZA 5LVNA 1TKIA 2WNTA 4K2RA 1W98A 5FEQA 3OEZA 1IRKA 2XK8A 3RWPA 2X8DA 3W32A 4R5YA 3R63A 3BHYA 3TZMA 3OMVA 3FAAA 4FTCA 5IMEA 3DY7A 3RPVA 2YIQA 5EYDA 4XG7A 3NSZA 3QWJA 4F1OA 3S2PA 4PNKA 4RG0A 5JRQA 4DT8A 4AE9A 2OWBA 4L00A 5HOAA 2I6LA 4FTUA 3D0EA 1L3RE 4JMQA 3MGYA 5I9VA 3QTRA 4QMPA 2YM7A 3MDYA 4S33A 4BIBA 3W0RA 3B8QA 1YW2A 2X1NA 4GYGA 4BF2A 4CFMA 4J96A 5BQ0A 4APPA 4XP3A 4L01A 5IMXA 2QO7A 2R3JA 4KS7A 3WYYA 1SYKA 3TN8A 4FV9A 3F3UA 5FEEA 4L52A 4X21A 5FXRA 4D5KA 4YJQA 2VTJA 3MWUA 4O1OA 3TV6A 4FEUA 4U7ZA 1FGIA 2RFSA 3CKXA 3KXNA 4II5A 4N70A 4BWXA 5BVKA 4X7QA 5EYMA 3SLSA 3PY1A 4AA4A 4M8TA 1MQBA 1XH8A 3SG8A 3WI6A 4LMUA 4W8DA 4EH8A 3UYSA 3NVMB 2XK7A 4EUTA 5KCVA 3CIKA 3ZCLA 4J7BA 2XNPA 4O4DA 2VRXA 3IK3A 3FEGA 3AG9A 3I0QA 5CX9A 5CEOA 3HA8A 4MYGA 4Y5HA 5BVDA 3GCVA 4OUCA 5E1EA 2H6DA 3OT3A 4RC4A 4JXFA 4QMZA 3U9CA 2OJJA 3P7CA 3QKLA 4I0SA 1FPUA 3QLGA 4Q9ZA 2YACA 2AEGA 4MNFA 4EH2A 5I5ZA 4EK6A 1Q8UA 4UY9A 3TIYA 4GT5A 1G8AA 2C5YA 2BZJA 2ITXA 2GNJA 2W1DA 3BQCA 3NNUA 4BB4A 2BILB 4CFWA 3V5QA 4LRMA 4BIEA 3O8TA 2WU6A 4MF0A 5E8YA 2V7OA 2QOBA 4R7IA 4ZTRA 3ZTXA 2VTNA 4FOCA 4ITJA 3OFMA 1PMUA 3KKVA 5D7AA 4DLJA 1OL1A 5KZIA 2ITOA 2VTTA 2ITPA 4G34A 3KCFA 4BDCA 4RQVA 1UNHA 2C0IA 3ITZA 5AJQA 4OTFA 3VS0A 1FQ1B 1W2FA 3CXWA 2G15A 3R1NA 3MTFA 1FGKA 4BCQA 4QEBA 4K11A 5DE2A 4IVDA 3R9DA 3ZDIA 2J0MB 2QD9A 4AUAA 3PXFA 3ZRMA 5BVFA 3HVCA 4RPVA 3PP1A 5F94A 3WF8A 1MQ4A 5AA9A 3VUGA 1XH9A 2R3MA 1OPKA 5E8WA 3L9PA 5AA8A 1Y57A 5JGAA 3K5VA 4FK6A 4BVUA 5FDPA 5AR2A 3KVWA 3V5LA 2WTVA 4F08A 4KABA 2XYNA 4C0TA 4FTNA 3I6WA 4B0GA 4ZZNA 1BUHA 5LMAA 4ZJIA 2C5NA 5D11A 3WZUA 3G51A 1KE9A 4F78A 2RG6A 2V0DA 3CTJA 3E92A 4EOLA 4C4FA 4Q5EA 5IQAA 3LLAA 4C37A 5AP3A 4EONA 3ZM9A 1H00A 4F1MA 4E6CA 4D58A 3MVLA 4QNAA 5I9ZA 2CKEA 3V5JA 3A4PA 1OL7A 3E8DA 4R3RA 4E4LA 1PKDA 3DKCA 5C1QB 3BE9A 5HTCA 4PDSA 5AV0A 3UQGA 3QQHA 2CNUA 3V6RA 3D2IA 4AZFA 2VWYA 2XP2A 3LE6A 5I4NA 1IAJA 4GG7A 2X2MA 4BZNA 3AKKA 3I7BA 4FV0A 3UZPA 4IX5A 2WMRA 4ZSLA 3W10A 2CGVA 4BRXA 2W0JA 4DGOA 3FQSA 2HCKA 2CKOA 2XVDA 3ORNA 4XG9A 4AA0A 3O51A 4D0XA 4C02A 3BLAA 3R8ZA 4FV4A 4PRJA 2RF9A 2XH5A 4K18A 4C33A 3LXNA 4Y85A 4JAIA 5KMIA 3ROCA 4QP6A 3Q9ZA 4YJUA 3DLZA 4BDKA 4RFMA 4USFA 2BDJA 4IAYA 4ZSEA 3FV8A 5DT0A 4EZ5A 3ZUTA 1WVWA 2ZM1A 2X4FA 3FMMA 3RCDA 5DPVA 5E1SA 5F95A 5KMOA 3CP9A 1YVJA 2I1MA 4L3LA 1CTPE 4RIWB 3W1FA 2YM5A 3PSDA 3MS9A 2JDRA 2KULA 2A27A 5CU4A 3II5A 4DEAA 2W4OA 4JX3A 4YO4A 5M56A 2RGPA 3H0ZA 2H8HA 3VUIA 4CZYB 3OCGA 4P4CA 4YTIA 3BQRA 3FKLA 5CVGA 3TTJA 5GIOE 4YPSA 4C57A 3V5TA 3FC2A 5EQPA 3P5JC 3AQVA 4IZYA 2EVAA 4FKWA 5TR6A 5CEIA 4M69B 3GU8A 4TRLA 5GNKA 4J53A 3VUKA 2YN8A 3KVXA 2YITA 4GFMA 3CY2A 3KXMA 2BRHA 4YJTA 4EYJA 4WRSA 3PWYA 5CAOA 1H4LA 2O64A 1Y91A 2QR8A 2VTIA 3C4WA 5B2LA 2OXDA 1CKIA 3ZUVA 4WKQA 2DYLA 5L2TA 3P9JA 4AFJA 4GU6A 3DBEA 4BL1A 4W8EA 1VJYA 4I1ZA 3EH9A 4DTKA 1M7QA 4Y5QA 2CLQA 3ALNA 4I22A 3NFFB 3PIZA 3BKBA 5IQBA 5DHJA 4CYJA 2I40A 1JSTA 4MBIA 5K4JA 5LVPA 2J9MA 2FA2A 1Q8YA 3WILA 1SNUA 4E20A 4L3PA 2X4ZA 4L6QA 4RVKA 5JEBA 3L8XA 4Q9SA 3KY2A 3EQIA 2WO6A 3PG1A 4TYEA 4O82A 2W5HA 5EDPA 3RPYA 3MTLA 4JQEA 4NWMA 4QO9A 4LM5A 2PHKA 5AV1A 4C2VA 5HX6A 5JRSA 2R3OA 5EM6A 2F7ZE 4BCFA 4KUJA 2ZM3A 4Z16A 1G8SA 2UZVA 3REPA 3FI4A 4X3FB 2P33A 3TNIA 5AUTA 5EHOA 4S2ZA 4ASXA 5KMNA 4WNMA 4O27B 3Q60A 3VUDA 2B53A 3HNGA 3GBZA 3BEAA 4FC0A 4G5PA 4BWKA 4DA5A 4ZJJA 3FC1X 5AUUA 4HGLA 5IQIA 5AR8A 4FSMA 5EM5A 4EK5A 3UVPA 3ZH8A 2WTDA 4BDAA 1J7IA 1BYGA 3I5NA 4O91A 4XG3A 3W0NA 5EW8A 2V22A 5KBQA 4CLIA 2WIHA 3IGOA 2WMWA 4FTOA 4YHTA 4L42A 3PJ8A 2GNHA 3VNTA 4F64A 3FZTA 3NYVA 4YMJA 2A19B 3W2OA 3AGLA 3PJ3A 5M4IA 1P4OA 4BGGA 4MQ1A 3RAKA 4FIHA 4ANLA 3QD3A 4DBNA 2GQSA 2F49A 3EQDA 5AFVA 4HVSA 3FMKA 3MV5A 3Q4TA 2ETKA 3ZM4A 4ASDA 2UVYA 3ZHPC 3EFWA 4FKIA 2CGWA 5IEVA 3MY5A 2C6KA 5K3YA 4YSJA 2WAJA 4QMNA 2ZDUA 2GFSA 4CEGA 4RFZA 5HLWA 2XM8A 3UGCA 4AXFA 4X6QC 2C6TA 3GI3A 1EH4A 1PXKA 2HK5A 5FXSA 1NW1A 3A4OX 3LVPA 3COHA 3NVKI 3ZC6A 4FSQA 3HV5A 4A4OA 5KE0A 5A46A 5AAGA 4IE9A 3HRBA 1O6YA 1Y6AA 3UO6A 4C59A 4BHZA 5D1JA 3TIZA 4LOOA 3GFEA 4YC6A 5M08A 2QO9A 3R73A 1SZMA 3ERKA 5DWRA 4XCUA 5ETAA 5J7BA 4LFIA 4O0XA 2P3GX 4FZDB 2GSFA 3C4CA 3UQFA 4GVAA 5HBJA 4IIRA 2ETRA 1W8CA 4JR3A 4CSVA 5M4UA 2XCKA 5DR2A 2FH9A 5CAUA 4LL5A 4GL9A 2WMSA 3PZHA 4GVJA 2Q83A 3QQJA 2W99B 4D1ZA 4EK4A 5JK3A 5M51A 4R1YA 2OF4A 3MH2A 4JG8A 3CJFA 3RI1A 1W82A 4DG0E 5ICPA 3UBDA 2ITQA 3EWHA 1T45A 4BDJA 3C9WA 2UW9A 3A99A 2ZV9A 3NRMA 4LGGA 4RLLA 5HZNA 3QRJA 4DHFA 5IH4A 4BI2A 4AT5A 4QQTA 3QFVA 5AEPA 2PULA 1YHSA 1XH7A 3Q6UA 5IQFA 3C51A 1ZARA 5AP0A 5IF1A 4KSQA 4MD8E 4ONAA 3KC3A 4RJ7A 2WHBA 1NY3A 3BHUA 3AGMA 4GK3A 4DEEA 4FEXA 1YKRA 3KN5A 3ZZWA 4MTAA 3JYAA 1RJBA 5EM7A 5HNBA 4CTCA 4F4PA 2BFXA 3DXNA 3FXXA 4FSYA 4ACMA 3UVQA 2PZPA 4RA4A 4NFMA 5CSWA 2HZ4A 3IW5A 3ZUUA 5E8XA 2JLDA 4FSTA 2J0JA 5FTGA 3PFQA 3FWQA 5CEPA 3RGFA 3Q6WA 2CNVA 2BUJA 4E1ZA 4YJPA 3I6UA 4HW7A 4XUFA 3BU5A 4JG7A 3QZFA 4RLKA 4QOXA 4RWLA 3VBTA 3DJ5A 4FV2A 1YI3A 1A48A 2XIXA 3A7FA 4FKLA 4LQMA 4ZTQA 3H10A 3R7GA 3ZOSA 5FUTA 2RSVA 3U54A 3K3IA 3U8WA 4C38A 5L4QA 4FTQA 4MCVA 1XMLA 3MVJA 1RW8A 2ACXA 3GC8A 1M17A 5J79A 1Q8TA 3RPRA 5KHWA 4IJ9A 1YDSE 2PUIA 1AQ1A 5A6NA 4I5HA 3OY3A 3SRVA 5F1ZA 4C35A 2BVAA 2R3NA 4F6UA 4PDYA 5BVWA 2YA9A 4PL3A 5HBEA 4O83A 4ACDA 5M4FA 3T9TA 4FG8A 4EZ3A 4I24A 3TXOA 3KEXA 2CSNA 5TKDA 2VNWA 4BGQA 5CT7A 1W2DA 2HAKA 2UZLA 5EYKA 4TY1A 2XK4A 3GEQA 3GU5A 2C69A 4GJ3A 3QTSA 3SW4A 4LGHA 3FMNA 3PA5A 3QKKA 4YTFA 5J7HA 4MXYA 2GHGA 2GFCA 4W4VA 5JH6A 5J8IA 3R04A 2W1IA 2HY81 2PUUA 1YOMA 3DZOA 2QCSA 1PMNA 3FDNA 3GGFA 4PMMA 4XOZA 3KMWA 1WVXA 1GAGA 3OUKA 2YHVA 2YZAA 5LARA 5CI6A 5HESA 2VU3A 1YXVA 2DWBA 1H25A 4A06A 4XNEA 3G33A 4W4WA 4Z3VA 2XAMA 4FGBA 3VUHA 5EHLA 1GOLA 2VWXA 3P1AA 4IZ5A 2BHEA 4O1PA 3AKLA 2EUFB 2HWPA 2CN5A 1XBBA 3LFCA 1GZOA 5IQGA 3LQ8A 4HNIA 3DNDA 2GTMA 3H30A 4MWIA 1WZYA 3SDJA 3CD8A 1O6KA 3KRXA 4FTLA 2G2HA 4FTIA 1H1WA 3GCSA 3NNVA 3IW7A 4L7SA 1WBWA 3FYKX 4AQKA 2PUNA 4U8ZA 3MESA 2X7OA 4TYIA 3CCNA 4CV8A 4WRGA 1FVVA 4CCBA 1J1CA 2X0GA 5M09A 3QXPA 5LCJA 3LPBA 3V6SA 4B8LA 3FI2A 3VVHA 5FP5A 4FEQA 3R9OA 3SVVA 1DI9A 1WBOA 4O38A 4U44A 1FOTA 3QTIA 4CTBA 1TVOA 4FKUA 3QC4A 3BZ3A 3C5UA 4I5CA 3BWJA 5ACKA 4IB1A 3OW3A 4ITIA 4FZ7A 4A9RA 4DGMA 5HQ0A 4OTRA 4L8MA 3DV3A 4TNBA 1NVQA 4FUYA 3PP0A 1OMWA 4HYSA 3RHXA 2ZB0A 3EFLA 3FMEA 3UO4A 3HMIA 2W9FB 2PZRA 1Q62A 3Q9WA 4JDJA 5AIKA 1ND4A 2R3RA 3GCPA 5BYLA 5KUPA 4W4XA 4TNDA 3TACA 1UKIA 3FI8A 2GU8A 3ZMMA 2PZ5A 3R7YA 3FZOA 3KXHA 2GHLA 2ITTA 4E4XA 2WOTA 5E4HA 3SGCA 3EMGA 3VS6A 2JGZA 4EKKA 2J4ZA 4G3CA 3TKIA 5TOZA 3CQWA 4QMMA 3OCTA 2Z8CA 2Y4PA 2FUMA 1X8BA 2VO6A 5FM2A 4A9YA 3NW5A 4OT5A 2JKQA 1YDTE 4V05A 2GS2A 5L3AA 5DNRA 2C6MA 3NUNA 1YWRA 2CN8A 1OL5A 2GCDA 2VO3A 4FKPA 4TW9A 4B9DA 3AD4A 4ZLZA 2B9FA 4C8BA 4FT7A 1KE6A 2BRMA 4MXZA 3OUNB 3QQGA 4LUEA 2OK1A 4IQ6A 2X81A 4EK8A 5AX3A 4AN9A 3K2LA 5AV2A 3UZTA 2YZLA 5A4CA 4E4NA 3HAVA 4MKCA 3ACKA 3PYYA 3DGKA 3OWKA 3I60A 2JDOA 1IAHA 4QNYA 4FOBA 4IXPA 4AXEA 3OOGA 4I5PA 4IDVA 4D4RA 3GUBA 5AR7A 2GNGA 3UNJA 3FMHA 4YZCA 2F9GA 3MA6A 2VTOA 4LUDA 5HBHA 1KE7A 3TL8A 4NUSA 2NNWB 3ID6C 4RRVA 5ACBC 2PU8A 2DUVA 4X2FA 3R8UA 2F4JA 3AD5A 3ULZA 1OBDA 4AOTA 4RQKA 2XEZA 4LDTA 1QPCA 4L9IA 5M44A 3CPCA 4IADA 2J50A 3A8XA 1Q3DA 3ENMA 3FZSA 2FGIA 3W8LA 1B6CB 1M2QA 3IS5A 3SC1A 2CGXA 2JC6A 3MY1A 4IVCA 4YC8A 4XS2A 4IX3A 3DFAA 1UKHA 3VN9A 4YLJA 1XO2B 3GVUA 3WIKA 4JVGA 5JT2A 3W0OA 2RKUA 3GT8A 3C4FA 3KRLA 3NCGA 4PX6A 3D9VA 4FI1A 4EH9A 2Y6MA 4QMVA 1XH4A 3WZDA 5B7VA 4UEUA 2YIYA 4EZ7A 4TWCA 2I0HA 2OJFE 2R4BA 4JRNA 4D55A 3SXRA 3HDNA 3RTPA 2CKQA 4FNYA 5CI7A 3Q04A 1UU7A 4TWOA 3PY0A 4EQUA 2PVNA 5CAQA 2C3JA 4PPBA 3QD2B 3ZO2A 4EQCA 1Y8GA 2X6EA 1LR4A 5CANA 4FE2A 3F3WA 1G8KA 1HOWA 3EN6A 1Y6BA 3FBVA 5EDQA 1P4FA 4JJRA 4PL5A 3UPZA 2X39A 4LV5A 3NW7A 5AM6A 5FTOA 2ITVA 4HVGA 2C6EA 5G1XA 3R7OA 4I6HA 2W5AA 2O0UA 4AZSA 3PVUA 4J98A 4OTGA 3BHVA 4RVMA 4NYEA 1BLXA 5I3RA 4WHZA 4BCMA 3JY0A 4FEWA 3VS4A 2GQGA 2VO0A 3H0YA 5H2UA 3PE1A 3F82A 4QTEA 3V8SA 4F6WA 4DG3E 1V0OA 4FL2A 2YISA 4FZ6A 3VW6A 5L2QA 4D4SA 4USDA 3E8EA 2ZJWA 1Z57A 3NUXA 3EIDA 2BTSA 4GEOA 4AS0A 4DH3A 4G1WA 2ZDTA 4O7LA 3AMAA 3RM6A 1WBVA 2A1AB 3V5PA 4L45A 3N4TA 3RK9A 3MIAA 4KA3A 3W0MA 4JAJA 4FV6A 2OSCA 3V8WA 2HW7A 2G2IA 5CENA 4K8AA 2PMIA 4WT6A 2XIYA 3VF9A 3FE3A 4TT7A 4MEDA 4CYIA 3COMA 3I79A 5L6WL 3VBQA 4E93A 3DNEA 1H0VA 5AP4A 2ZV8A 4ZSJA 4BI1A 3F5XA 3LM5A 5KO1A 2OIDA 5F20A 3WF7A 3QLFA 4YJVA 3AC4A 5DOSA 2XK9A 2Z2WA 4RFYA 2XIKA 5IA5A 1SNXA 5AADA 5CAVA 4GKIA 2PPQA 3H9FA 5DMZA 4RJ6A 4KRCA 4IFCA 3UIBA 4P7EA 4UZHA 4M68A 1OB3A 3U4UA 4NJDA 2HENA 2WZJA 5DR6A 4D28A 1ZYJA 3JVSA 1REKA 5AV3A 2WPAA 2VWBA 3HLLA 3VW8A 3JVRA 2P0CA 5FBNC 3V04A 4FSNA 3TDVA 2ERKA 3KULB 3ZRLA 5F9EA 3BYUA 4FTAA 2WQOA 3IW8A 4NK9A 3PZEA 3E87A 4RVLA 2R3LA 4EJNA 3KQ7A 3FPQA 2UW8A 3IDPA 2HXQA 3VS5A 3KCKA 3PRFA 3IOPA 2VX0A 3MA3A 4W9WA 1VR2A 4FIGA 4G16A 4DH1A 4CFUA 1VYZA 5EI6A 5HO8A 4O86A 4TZRA 2QU5A 4KSPA 3COIA 2VX3A 3SXSA 3W0SA 2C3IB 3DDQA 1OVEA 2VTAA 5KMMA 4DTAA 4JR7A 4HGSA 3U87A 4H3PA 2F7XE 3G6HA 4JQ7A 3VAPA 3MH0A 5AP7A 1H24A 1H1SA 3D2KA 2HXLA 5T3QA 4O7YA 4YZBA 4EL9A 2YDIA 4OTQA 3IW4A 3QRUA 5AUYA 2FSLX 2GNLA 3L8SA 2Y4IB 2C3LA 2EXCX 4QDVA 1SM2A 4JLCA 2OZAA 2C6IA 1YHVA 4HGEA 3VBXA 4BCGA 3O5AA 3Q53A 4NM5A 2R3GA 3BPRA 1DAWA 3GQLA 2WTKC 2W1FA 3BWFA 1OKVA 2YAKA 3D15A 2QOOA 4RT7A 4P5QA 4BCIA 1PXLA 2HOGA 3QF9A 2OBJA 4AAAA 5DH3A 2W9ZB 4BTMA 3LIJA 4W4YA 4CFFA 2PE2A 3DT1A 1NT2A 3HEGA 1ZXEA 4UMQA 3FZRA 4FMQA 3R2BA 3FUPA 3QUDA 4QMYA 4RJ8A 2HELA 3PPJA 5BUJA 4S30A 2J5FA 2OKRA 4PV0A 4TWNA 1GZNA 1QCFA 3IW6A 3JR1A 4EHEA 4MNEA 3ORLA 4L44A 4EOKA 1R78A 4K9YA 5ETCA 2JKKA 4DYMA 1K9AA 1XBAA 3OOMA 3ALOA 2PY3A 4X2KA 5EHYA 1M2PA 1FBNA 5DYJA 3CLYA 3O71A 3G5DA 3GCQA 3PA3A 4KIOA 3SRVB 3ZSIA 5IU2A 4E26A 3OWLA 2CLXA 3R0TA 3KRJA 3PSBA 3W16A 5IPJA 4XX9A 3QQLA 4QMXA 5ANKA 4ZTLA 4ACCA 4ZTNA 2HYYA 4BCNA 3AC8A 4TXCA 4FICA 1BKXA 4WNPA 3UMXA 4E6QA 2IWIA 3AMYA 4DGGA 2XALA 2A98A 3ML1A 2YM4A 1APME 2OJGA 3RPOA 5K5NA 3V51A 4FJVA 2VWZA 3C4EA 3R7EA 4EC9A 5CF5A 4EOIA 5HCZA 3ZC5A 3GU6A 3G0FA 3D4QA 1YXTA 5M07A 2Z7QA 3A8WA 4LG4A 3NUSA 2VAGA 4C58A 4ZAUA 2CMWA 2JAMA 2WQBA 3LCDA 4GK4A 4NT4A 4ZS0A 3RP9A 4U97A 3WBLA 4BICA 3MFTA 5LMKC 4DFNA 4M66A 5D10A 3SOCA 1UA2A 3F6XA 3UPXA 3VIDA 1G5SA 1JQHA 3DA6A 2B52A 3DXQA 1Q3WA 3EKKA 4Y72A 5C9CA 1WFCA 4WIHA 5EW9A 4MXCA 5L2WA 3OWPA 3PVGA 1U59A 3L9LA 3PJ2A 4FSZA 1OECA 4QYHA 4EOMA 2W17A 1BL6A 1PXNA 2UW6A 2C6DA 4WD5A 3KK8A 5D12A 1U5QA 2UUEA 3QYZA 4BCPA 2C47A 5FG8A