3WZUA

The structure of map2k7 in complex with 5z-7-oxozeaenol
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
299
structure length
270
Chain Sequence
b'GYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGAGCAAYMAPERIDPPPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 7
publication title 5Z-7-Oxozeaenol covalently binds to MAP2K7 at Cys218 in an unprecedented manner
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 67
structure length 270
sequence length 299
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2014-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3wzuA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3wzuA01
2WMWA 2XM8A 3FHRA 2AYPA 4UZDA 2XZSA 5AV1A 2BVAA 2RFEA 1JLUE 3MPTA 2BZIB 2PVJA 3D2IA 2R3KA 4N6ZA 2ERKA 2JKQA 3E63A 1YXVA 4OTFA 5M51A 3QZFA 4XRJA 2XEYA 3QD0A 4OBQA 1FGKA 3AC4A 2CDZA 3Q04A 2W1IA 2GU8A 4U45A 3UQFA 3FLZA 4FV2A 4JIAA 4FI1A 5L2SA 5JGDA 3DNDA 3GQLA 5CSWA 4C4FA 2VO7A 3E93A 3HMNA 3F3UA 1ZXEA 4F7JA 5M4UA 2NPQA 5E1EA 4DEIA 4EQUA 3GCVA 2QKWB 4XBRA 4BCIA 4CFVA 2CMWA 3D5XA 1P4FA 4DITA 2OBJA 2XYUA 5CEMA 2G2HA 4XOYA 4AN9A 1UWHA 2RFDA 3EYHA 4LL0A 4RJ5A 3MTFA 2HWPA 4IW0A 4ENYA 3IW5A 2CKPA 2C6OA 5DI1A 2CKOA 5HTBA 4ZZNA 1LUFA 5HVYA 4CKIA 4F9YA 3NUYA 4GU6A 4NKSA 3NRMA 1UVRA 2OF2A 4XG9A 3VJOA 4DEEA 5HX8A 1BI8A 1YOMA 2B0QA 1ZY4A 2JDRA 3COIA 3UOLA 3UO6A 3UYTA 3W8LA 3S1HA 2PVFA 4MD9E 5HD4A 2QQ7A 5EW3A 4DGGA 3OEZA 3EN5A 5D7VA 4O7LA 2VX3A 4FV0A 4QMUA 4GKIA 2OJJA 3PTGA 4Z55A 3QWKA 1URWA 1UNHA 4ID7A 5FXSA 4GT3A 3ZO3A 5IEXA 2HW6A 2OFVA 2W06A 2ITTA 3WF7A 3L9PA 3P23A 4IX3A 2H8HA 5GJFA 2A0CX 3I7CA 4AN3A 5HESA 3SRVA 4CQGA 3LKMA 4FTCA 4GFOA 2B9FA 2BILB 3LM5A 3OW4A 4D5KA 4PRJA 2UW5A 4ZTMA 2ETKA 2EVAA 4UZHA 4B6LA 3PG1A 2CGWA 4M67A 4PY1A 3VAPA 1YKRA 1QPEA 2AC5A 3ZLSA 3II5A 3ORPA 3WZUA 2F7EE 4RVMA 5DEYA 2XNBA 3DK7A 4WBOA 4YZ9A 1KE8A 3N4VA 4IAAA 4RVLA 1YXUA 1H8FA 4RG0A 3QC9A 5JFWA 4KNBA 4ZLYA 2WOUA 4QOXA 4Y83A 3QQKA 4FR4A 3ELJA 2W9FB 2YIRA 4HNIA 4O0YA 2PK9A 2RG6A 1OIYA 1JKTA 3OY1A 4RFMA 4X2FA 4C7TA 3QA8A 4NM5A 2XK3A 5EKNA 5ACKA 2XNPA 2VX1A 2Z2WA 2JGZA 5BVDA 3DV3A 3Q6WA 5LMAA 3LE6A 3P79A 3DT1A 3HX4A 4ZLOA 1K9AA 4F70A 3S0OA 3MY1A 5ETFA 3GCUA 5AP0A 3FXXA 4A9RA 2P2HA 4WRGA 4M7IA 3RHXA 2WB8A 1ZARA 4W9WA 4DH8A 4RZVA 2HK5A 4CT1A 3KEXA 4MXCA 4F9CA 5KMMA 2EB3A 3ITZA 2BMCA 3GU7A 4XP2A 3ENHA 5LCKA 2VNWA 1W98A 2PMOX 5AR5A 1S9JA 3ROCA 3T9TA 3KRWA 1U59A 1DI9A 3CQEA 4ZZOA 3O0GA 3NNUA 2YLFA 1FVVA 4YNEA 3TZ7A 5C26A 2QHMA 3KF4A 1YXTA 2IVTA 2W4OA 4IB5A 1YWVA 2OIDA 1YDSE 4OBOA 4GH2A 1R0PA 2XNGA 4I24A 3OXTA 3F66A 4K77A 4KIKB 5M07A 1E1VA 4U3YA 3E8CA 3QA0A 3D94A 2PVYA 1J1BA 3H9OA 3PYYA 1TQPA 5F94A 3QXPA 4IAZA 3LCDA 3NAXA 4C62A 1M2PA 2WMQA 4EBWA 3TT0A 3GC9A 4FVPA 2XK7A 1O6YA 2IZTA 4C3PA 3D0EA 3O2MA 4FG8A 4ANBA 1J7LA 3FBVA 2EXCX 3JXWA 3LXNA 4YZNA 5IMXA 5A4TA 3QYWA 3BHYA 1P5EA 3E3PA 2XNNA 3SDJA 3V5LA 3LXKA 3KXHA 2CJMA 5M4IA 1YI6A 3POZA 4O1PA 1G3NA 4IHPA 4OBPA 3Q96A 4I0SA 3IO7A 3AGMA 5CT7A 4EQCA 4J8NA 4E73A 4TW9A 1PMVA 2GHLA 5E90A 1P2AA 4GK4A 3C1XA 4IE9A 4CRLA 2WMXA 5DH3A 4RSSA 1SNXA 3WARA 3ZCLA 4CZUA 4MHAA 5DT0A 4JJRA 3HV7A 2HCKA 5CY3A 4F09A 3R1QA 1ZYLA 3C4EA 2BHEA 3QQHA 4FGBA 3LMGA 3DQWA 3K5UA 2VD5A 2Y7JA 2Q0NA 4N70A 4EUTA 5A46A 3DJ6A 1ZRZA 3MSSA 4XH6A 5HCXA 5LVNA 4C38A 3V3VA 3KN5A 4ACMA 4FEVA 4ZSGA 2YIXA 5TT7A 3PVWA 4PQNA 4L52A 4X21A 3CSVA 3TCPA 3V6RA 2QOCA 5AM7A 2BDJA 4FV7A 3RAKA 5I5ZA 4W4VA 4GW8A 4CTCA 4QMWA 4E4MA 1JBPE 5BUEA 2J0LA 2PVMA 3H10A 3MH1A 3LHJA 4R77A 4YZDA 5DT3A 5DLSA 3CKWA 1MQ4A 3FL5A 4FT3A 3HVCA 3SD0A 3D14A 4XS2A 2XRUA 3W1FA 2C68A 4EH9A 4ERKA 3PXFA 1PMUA 4JXFA 2C6IA 3ALOA 5KHWA 5IH4A 4LMUA 4TNDA 5HHWA 3R01A 3BKBA 4F0IA 3U55A 2VV9A 4O6EA 2J50A 1JAMA 3RCDA 4Y73A 3FMJA 5BVFA 2C1BA 5CEOA 1QCFA 4O2PA 5H3QA 4M8TA 5LCJA 2IZSA 3GFEA 4A7CA 3AD6A 4EKLA 2P55A 4RX8A 3D7TB 5JKGA 2C1AA 4GU9A 3VUMA 2R3JA 1YXSA 1IASA 3I60A 2ITPA 2R3PA 4UY9A 1OKZA 2CGUA 5B2KA 4FG9A 4A07A 2QVSE 4KINA 3W18A 3ZDIA 4EWQA 1PXLA 4K18A 1SYKA 3POOA 5AV3A 1XH8A 2Z8CA 3E64A 2QR8A 4M12A 4FIGA 5IA5A 4MF1A 4CMOA 2XRWA 4FKWA 3VVHA 5HU9A 5L3AA 1Y57A 1J91A 5LQFA 2H6DA 1AQ1A 3C0GA 3CPCA 4PMSA 4F9AA 3DB8A 2P33A 3E92A 5L6PA 4H39A 5CYIA 3P1AA 4FZDB 2GHMA 2H9VA 1SZMA 5EHLA 4ZTSA 4AU8A 4W9XA 4DINA 4H3PA 5M44A 3KREA 4RBLA 5IMEA 5FD2A 4OAVB 2HZNA 4RIWA 4C3RA 1PKDA 4P2KA 4EHGA 2ZDTA 4O7VA 1VZOA 3FLQA 5DRDA 3C0HA 4KSQA 3R83A 1M17A 4LRMA 4BIEA 4DYMA 3EIDA 3MVMA 1J1CA 3PFQA 3R0TA 3KMWA 1H1RA 1WAKA 4K2RA 2OIBA 4WBBB 5EDQA 4QYYA 2B9HA 5I9YA 5EOBA 4AOIA 2F57A 4TTHB 4UALA 5BYZA 2YDJA 5AUUA 1PXIA 2CLQA 2ITOA 4CMUA 1MRVA 1CKPA 2PWLA 4G3DA 4M14A 3CCNA 3E7OA 3NCZA 4EH7A 1PJKA 3MI9A 4MXOA 4FKTA 4KS8A 2WKMA 4I0TA 4RIXA 3V04A 2Y4PA 3KA0A 4KIOA 3L9LA 4EZ5A 4J97A 1R1WA 1OL1A 3DS6A 3FMEA 1ZZLA 4CYIA 1XH5A 3I5NA 4QP8A 4XRLA 1FMKA 3EQRA 2NRYA 4OTHA 4CYJA 4LGHA 2J0KA 4XCUA 5E8ZA 4MXXA 4EBVA 3CIKA 5AJQA 2GNFA 4X6QC 1IA9A 3RGFA 4L67A 3GOKA 4RJ3A 1A06A 1IA8A 3I0QA 3W2QA 4B7TA 2IO6A 4DLJA 5BYLA 3KXMA 2VGPA 4EH4A 4BBEA 3CQUA 5IZFA 4IM3A 2HENA 4M68A 2XCKA 3R8LA 4QQCA 4HZSA 3R04A 3PRFA 1L3RE 2G15A 3QKKA 5DT4A 4C61A 4D2TA 5IA1A 2OSCA 3A4PA 4C2WA 3CTHA 4JBOA 1LP4A 3WF8A 4FNYA 3LQ5A 3ZOSA 1Z9XA 2W1FA 3OCGA 3TIZA 4ACCA 3BWFA 1SM2A 1SMHA 3HMOA 3VQHA 2XNOA 4MWHA 2QC6A 5E91A 4D0XA 4RX7A 4FZAB 3R9DA 2A2AA 4ANOA 3PVGA 5FM2A 3T9IA 3FZPA 2FSMX 3SHEA 4U9AA 4PX6A 4EJ7A 5GJDA 4BCJA 3RPYA 2ITQA 3ENMA 3R9RA 3EL8A 3ZM4A 4JBVA 5CLPA 4IIRA 4APCA 3ZS5A 4AX8A 3DK6A 2J51A 3DNEA 4FKIA 3P9JA 1PMEA 4M97A 1VYWA 2YCRA 4C59A 4F7LA 2JC6A 3FLSA 5HBJA 2XKEA 4O0TA 4YPDA 4YJPA 5M56A 5IQAA 1Z57A 2W5BA 1H27A 4HOKA 1ZMVA 1U46A 4I6HA 3DY7A 4MF0A 3FZTA 5DEWA 3Q3BA 5EW9A 2XJ2A 2P3GX 2VTSA 5CENA 4IVBA 2ERZE 4ZSJA 1WCCA 3TZMA 3ZRKA 2QU5A 3EH9A 3PE1A 4AGDA 5HVKA 5IQBA 4RZWA 2ZV8A 2XCHA 3FAAA 2QKRA 4RQVA 4XV3A 3HYHA 4KRDA 5CU0A 4WKQA 3SC1A 5IU2A 3JY9A 3QAME 5BVOA 2BRBA 3QKLA 3R22A 4YR8A 3DXPA 4ORKA 1RQQA 2YJSA 4KABA 4CLIA 2VTRA 4D1SA 5I9WA 5JGAA 3N9XA 2W05A 2J0MB 2ZM4A 2C0OA 4JR3A 4YJNA 2BAJA 2PYWA 5JN2A 4TZRA 4WNMA 3PY1A 2PHKA 3QQFA 3QZIA 3NIZA 1V0BA 3LLTA 4L3LA 4C0TA 3HECA 5GNKA 5I0BA 5KHXA 3BYOA 2IW9A 1E1XA 1UV5A 2QCSA 2W1GA 3E8DA 3DA6A 4HZRA 4LRJA 4KWPA 4YJOA 4I1ZA 3Q2JA 3WF9A 2B9JA 3FLYA 5LVLA 3UVPA 1JQHA 2FSLX 2V0DA 4K6ZA 4BDKA 4FV3A 3S00A 5EQPA 3SG9A 1GZOA 4GT5A 3VBYA 4N0SA 2BRGA 4CZTA 3GU6A 5KKRC 3N4UA 5AAEA 2HY0A 1KV2A 4II5A 3RNYA 4RJ4A 4CKRA 1LEWA 3EN9A 4AFJA 1OIRA 2UZTA 2GNHA 1ZLTA 4LGGA 4DLIA 2ITUA 2WAJA 3PZHA 4XG6A 1FVRA 2IG7A 2WPAA 4FSYA 3NX8A 4GV1A 2VO3A 3FPMA 4X3FA 4IB1A 4D4SA 4G3CA 3MB7A 4I4FA 3E5AA 5EHYA 4ASDA 3FMMA 1IR3A 4O7NA 4FSRA 1FVTA 2UW4A 2QU6A 2UVXA 4L6QA 1XH4A 1KWPA 3QX2A 2C6TA 4V04A 1CMKE 2Y6OA 3R28A 3JPVA 3ZH8A 4CQEA 4J95A 5CU2A 4ZJVA 3OCTA 4ZEGA 1KE9A 2PMLX 3R71A 3ZXZA 3ZRLA 3TXOA 3ETAA 3HA8A 2C0TA 2XNEA 4JL9A 4JQ8A 1XBBA 4FT9A 4BICA 4U5JA 2EXMA 4KAOA 1XH7A 3LJ2A 2OH4A 3KMMA 5KO1A 3MH3A 5AM6A 4FKSA 5BNJA 3LFSA 2W99B 3GI3A 4V0GA 3H9RA 4L01A 1YOJA 3MN3A 1JKLA 3LJ1A 3O17A 2YAKA 3TNIA 4JBQA 3BWJA 4ZZMA 2GPHA 5HE2A 3BLHA 2VRXA 3L8PA 4DFBA 1XH9A 1M14A 3HMPA 4OGRA 4ERWA 3DPKA 5K9IA 1V0PA 3LZBA 3CD3A 4I92A 3DKOA 2GQSA 4O21A 4BTJA 4DFUA 1R3CA 2I0HA 3H4JA 5CVFA 2QD9A 2OJGA 4ZTRA 4ACHA 4BWKA 1G8AA 2JFMA 3ZFYA 2VTJA 4MXYA 4GVAA 5JFVA 1H0VA 4RC2A 4MQ1A 4WHZA 3U87A 2BRMA 4G9CA 3GENA 4D28A 4G9RA 5J8IA 4GIHA 4FUXA 3Q60A 5AP3A 3LFFA 1SVGA 3BLQA 4JVGA 4J96A 4YJQA 5EYCA 2F4JA 4AW5A 4QD6A 4D9UA 3UE4A 1ZOGA 3ZXTA 4JG8A 2X9FA 5EHOA 3FLWA 4CFNA 1OL7A 4AT4A 2XNMA 2LAVA 4CFXA 5HO7A 2WMUA 3OP5A 1G5SA 3KVXA 2QOHA 4GUBA 4B8MA 4BCGA 4IAYA 4PL5A 5HTIA 3BCEA 3ZO1A 4DC2A 1Y8GA 5HNBA 2VTTA 2O0UA 3RK5A 5A6OA 1CDKA 2BZHB 5DRBA 4ZY5A 2CCIA 4F6WA 5B2LA 4ZTHA 3E88A 2UZNA 3HEGA 4FIHA 3KCFA 2PSQA 3A8XA 3DJ5A 4FNWA 4Y8DA 5HIBA 5C9CA 1OB3A 2WMAA 3GT8A 4E5BA 3C7QA 4MKCA 5HE1A 4AGUA 2VNYA 3F61A 2VWUA 4IXPA 5CNNA 2X6EA 4YLKA 1ZWSA 4TWNA 4C4IA 4D1XA 5AAGA 2FGIA 1BI7A 1GAGA 4L3JA 4USFA 2V55A 3IECA 2CCHA 3TDVA 2YWVA 4MNFA 2C5NA 3O8PA 4O0VA 2JAMA 1BL6A 2C0IA 3AGLA 3DZQA 4WD5A 5AV0A 5C8NA 3OCBA 4JNWA 1BYGA 3TTIA 3G15A 4EHVA 4P90A 1RDQE 4QMMA 5HLWA 3NWWA 4KUJA 4H58A 3BHHA 3AC1A 3OOGA 2PUPA 1P14A 4S34A 3MJ1A 3OWJA 3FKOA 3MA3A 4IQ6A 4A4XA 4KKEA 2V7AA 3SG8A 4OTRA 4KKGA 4A9UA 3KULB 3GVUA 2J5FA 1U5RA 3DLZA 2Z7RA 4R8QA 1JKKA 3CPBA 3IDPA 4O2ZA 3E62A 2JKOA 2VTNA 3F2NA 2C3IB 4AG8A 4QYEA 3VUKA 2XIYA 1Q24A 4ASXA 1MRUA 1EH4A 3NMUF 2R9SA 5AP6A 3C4CA 5AP7A 1PYEA 5HLPA 4DG0E 4F1TA 4ZLZA 3BGZA 3GU8A 4FL2A 4ASZA 1JWHA 3R7VA 1OL5A 4A9YA 2VWXA 1Q4LA 3QFVA 4BB4A 5ANGA 3KXGA 4YMJA 2FUMA 2PVHA 4GRBA 4FGRA 1Q3DA 3NNXA 3SRVB 4AZWA 2JEDA 5IUGA 4CCBA 4YO4A 3SW4A 3BGQA 3I6UA 4E7WA 2B55A 1OBGA 2JLDA 2RFSA 4FSQA 2QONA 2C6KA 1OVEA 2YCSA 3NPCA 4FT5A 4YHFA 5I3OA 5TF9A 4JX7A 3TNHA 4DGOA 3DQXA 5FDPA 4MXAA 4HYHA 4XYFA 4UWCA 3UZPA 3EN4A 1KE7A 4FEQA 2J0IA 3PWYA 4E93A 4BGHA 4O7TA 5K3YA 4GFGA 2IPXA 4O27B 3GU4A 3S4QA 2SRCA 2PVNA 3NW6A 4RWIA 3RK9A 4KBCA 1MQBA 4UEUA 3DBDA 4RJ6A 2C3LA 3TEIA 2OJIA 2C5YA 4IC7A 4MH7A 4E6QA 1QL6A 4NZWB 3BU5A 3SOAA 4FTKA 4J1RA 5IA4A 4BIDA 3QHWA 1OITA 3GB2A 4EH6A 2ITWA 4L7FA 3UNKA 5AAFA 4EEVA 3KVWA 2ACXA 4FIFA 3O8TA 4WIHA 3RKBA 5H8GA 2ITVA 2WTWA 3QTSA 1OZ1A 4XHKB 4FTIA 4U42A 2Y6MA 4P4CA 5ICPA 3FMKA 2XP2A 2OLCA 5ANIA 5LMKC 1HCKA 5CSHA 5E9EA 5DIAA 4OW8A 4TYIA 4WUNA 3R1SA 4FKVA 4HGEA 4FKRA 4IACA 4X6RA 1OIUA 3QLGA 5E92A 4CV8A 3GOPA 3I1AA 4EONA 3Q9XA 4XG4A 3GCSA 4AE9A 3UGCA 2VTOA 2WTKC 5E8UA 5HO8A 1PXJA 1KSWA 4XLVA 5A6NA 3NVMB 4MWIA 3PJ3A 5FBOA 1ZY5A 1XH6A 3PPKA 4O0XA 4IB0A 5HU3A 2UW6A 2XBJA 3KGAA 4WNPA 3ZBFA 1V1KA 3O50A 3PG3A 2PMIA 4DG2E 5LJJA 1JKSA 2O64A 4PP9A 2B4SB 4JIKA 3LCKA 3AQVA 4BF2A 3V8SA 5L6OA 1REKA 1TQMA 2VN9A 2HZ4A 4NU1A 2X39A 2IN6A 4BRXA 4BWXA 4D2PA 4DEGA 3ZONA 5AA8A 3QWJA 4IZ5A 4EOPA 2VTAA 4N4SA 4RWLA 3MVHA 3VO3A 4NSTA 4H3QA 2BCJA 3B8RA 5FP5A 5ANOA 3JR1A 5FUTA 3TZ8A 4QO9A 5L2TA 4TYHB 4L46A 3GEQA 4NJ3A 2I7QA 2J7TA 2QI8A 4W8EA 4AZSA 3V6SA 4BKYA 3FI8A 4J52A 3NUPA 4D5HA 4BTMA 3C50A 2ITXA 3CLYA 2CKQA 3LFQA 5CNOA 2ZB0A 4O7WA 4JRNA 4HCUA 2C5VA 1G8SA 1H08A 2XS0A 5DR6A 2J9MA 1GNGA 3I7BA 4YZMA 4LUDA 3AC5A 1KOAA 3BU6A 4LMNA 2VZ6A 2XUUA 3FY0A 5BVEA 4CVAA 2BDWA 4QT1A 4YU2A 4DA5A 4JS8A 5TKDA 4X0MA 3BYVA 5K4IA 4FX3A 3P08A 1B6CB 1GZKA 3OZ6A 3ZMMA 4ACGA 4C35A 3OC1A 4C4HA 2IW6A 4I4EA 3DLSA 5ETCA 3SKCA 1JOWB 4YSMA 3OCSA 2V22A 4XOZA 2E9UA 3F82A 4BHNA 5L4QA 4XP3A 4I41A 3DK3A 3MH0A 2F2UA 3F3ZA 4S33A 3NSZA 3VBTA 3LAUA 1Y6AA 3PXKA 4EL9A 3Q53A 3VBWA 2CSNA 4CNHA 3JYAA 3LCSA 3ATSA 1XBCA 3LQ3A 4DCEA 4RIYB 3ZSHA 1SNUA 2IZUA 3NYXA 4G5PA 4NEUA 3HV3A 3KRRA 4DH7A 4E3CA 5TE0A 1YDRE 3FV8A 4O82A 5J95A 1YI3A 4GJ3A 3WE4A 3W2OA 3A8WA 3EFKA 4FSZA 1YHSA 4DBXA 4K33A 4FV4A 3A60A 4GUEA 3Q4UA 5CAOA 3F7ZA 1CKIA 1FMOE 4E5AX 5KCVA 2CPKE 4UWYA 1HOWA 4PMTA 5E8XA 5M4CA 1J7IA 3R2YA 4XV2A 3VBVA 4I94A 1YWRA 5HQ0A 3PDTA 2GNIA 3D7ZA 4U41A 4YJUA 3UVQA 2Q0BA 2XYNA 2WU7A 3QCQA 4DF3A 1NVSA 3CR0A 4PPBA 2CLXA 3I81A 3AD4A 4G34A 1M2RA 2EWAA 4WNOA 3UDBA 4NM0A 4YJTA 4EC8A 3QTXA 3MW1A 3OTUA 4TWPA 5A3XA 5A14A 4LG4A 1ZMWA 4QMYA 1XHAA 4YZCA 4EORA 1J7UA 5AP1A 5H9BA 1IAJA 3FMLA 2ITNA 1GZ8A 3MFRA 3VS7A 4EHZA 3KCKA 4MAOA 5GINE 3TL8A 3VJNA 4I3ZA 2P2IA 4IFGA 2O65A 3ZFXA 3QD2B 4YZBA 4FA2A 4CKJA 3RMFA 4E26A 3A99A 3ZLWA 5GZ8A 2YM4A 1OBDA 3RVGA 3L8VA 4FC0A 4RIWB 4L44A 3U9CA 3DBFA 4MD8E 1W83A 5L2IA 1YHWA 4BCKA 3LFDA 3EFJA 4H1JA 4USDA 5CU3A 3QXOA 3OWPA 5A4QA 4IM2A 5BMMA 4FIEA 5LVMA 1H4LA 2VTQA 2RIOA 2W1ZA 3VS1A 4C58A 5AIKA 4O96A 4YHTA 2OIQA 4NUSA 3BZ3A 2OK1A 1U4DA 3UC4A 3EWHA 5E8WA 2REIA 4HGTA 5BPYA 4BCPA 5AR8A 4L53A 3DKCA 3KRXA 3OF0A 3DXNA 4XG2A 2B1PA 2NP8A 4NL0A 1H0WA 3A2CA 3EKNA 2XVDA 1YI4A 2RSVA 4YBKA 3ZRMA 1GIIA 2OG8A 2P0CA 4ITJA 2UZLA 2IJMA 3LIJA 2J90A 3QUPA 4WA9A 3PIYA 2XEZA 1YRPA 4QMQA 2O63A 3E7VA 4M84A 4O0RA 4RWJA 3TG1A 4OLIA 2XKCA 3OBJA 1W0XC 4QMOA 3TJDA 1ZYSA 3U6HA 2RFNA 4EJNA 3D2KA 3EQDA 5BVKA 4QQJA 2YISA 4FTMA 3F5UA 1KOBA 4G16A 3HRCA 5AR4A 3UIUA 4F9WA 3BEAA 4QMTA 3EHAA 4QMNA 5HORA 5CU6A 4FYOA 3P7AA 3U4WA 2WELA 5EYMA 4PTCA 2VTIA 1UU3A 4R1YA 4BCMA 4QMLA 5CVGA 4ZOGA 2ZV9A 2YA9A 4BR3A 2PY3A 4WOVA 2X9EA 3FI4A 2CN5A 4TT7A 5EK7A 3NEWA 5FXRA 2UW3A 2VO6A 5K0XA 5I3RA 2ZV2A 4D2RA 4IX6A 3VS2A 4JOAA 3O96A 4IWQA 5FRIA 5K4JA 3R9NA 4O86A 3B2WA 4TKSA 4C34A 3MFUA 3OXIA 5A4EA 3NYVA 4JDIA 3FUPA 5DGZA 5FDXA 2CGXA 2WMRA 4LL5A 4TWOA 3K3IA 3P0MA 4BN1A 2I0YA 2UW7A 3PRIA 4FT0A 3IK3A 4RGJA 5JGBA 4RX5A 3ZBXA 5HZNA 4ZY6A 3BELA 5IQDA 4QRCA 4FKQA 4XEYA 3MDYA 3UVRA 3EB0A 3ORKA 3FL4A 3QRUA 3VUIA 4JT3A 2HZIA 1YW2A 2YACA 4F6UA 4M69B 3P4KA 3QD4A 4MQ2A 1VYZA 4JDHA 5EKOA 3LMIA 1PY5A 1E9HA 3O71A 2OGVA 3EN7A 4B4LA 4PTGA 3VUTA 1MP8A 3RPOA 3DTWA 3KK9A 2R7BA 3G33A 3UBDA 4DBNA 4O7YA 1YHVA 5AUWA 5M4FA 2G01A 3ALNA 5CAPA 2WFYA 4X3JA 3GCQA 4WSQA 4B8LA 1DS5A 1HCLA 4FZ7A 3EQGA 1YQJA 2X2KA 3IW4A 3NGAA 4IANA 4CT2A 3TNWA 1A9UA 3IKAA 4KS7A 3I5ZA 5KBQA 4OTQA 4CFMA 3IGGA 4U0IA 4FE2A 5T68A 4BCNA 3HRFA 5M06A 1YOLA 2FSTX 2PE0A 3BQCA 2YM3A 2WU6A 4LV8A 4TNBA 4UWBA 3DBQA 4DEAA 2HXLA 4HGLA 3W8QA 4RRVA 4J53A 3V5TA 1OKWA 1WVXA 4OTIA 4YURA 3HV6A 5FXQA 5BYYA 4BI0A 4D55A 4JG6A 3UIBA 4IH8A 2UW0A 2WGJA 4UMUA 5LMBA 4KA3A 3GBZA 1OIQA 2JITA 3RK7A 1H1PA 3A61A 4BDBA 4FTUA 5CEIA 3FXZA 3NW7A 4YSJA 4XG8A 4O6LA 5T3QA 4NTSA 3G0EA 1K2PA 2PL0A 4O38A 5A4LA 3Q4TA 4GYGA 2YIQA 3FQSA 3D5VA 2YWPA 3BV3A 3K5VA 4DFNA 3PVUA 3QRIA 1RE8A 1TQIA 4KBAA 5DWRA 4AGWA 2HXQA 3DAEA 4O7ZA 2R3FA 5FGKA 4X3FB 3K54A 4AW1A 5DNRA 3QUEA 1H01A 4LUEA 4G6NA 5JMSA 2XJ0A 3UPXA 4ZJJA 5EQEA 3ACJA 1U54A 5JQ5A 5C01A 4CCUA 5TR6A 5D7AA 4FV1A 2RG5A 4LI5A 4WRSA 4DN5A 3FPQA 1JSUA 4XJ0A 4ANMA 3TKUA 3Q9YA 4J8MA 3VN9A 3OT8A 3D9VA 1M52A 1BMKA 2A19B 4LV5A 4QP6A 3R7OA 5I9ZA 4G17A 3VUGA 4MNEB 5EDRA 5LWNA 3KB7A 4FTLA 3M2WA 5HNIX 3FC2A 4FL1A 4YO6A 3BYMA 5C4KA 4EKKA 2YZAA 4C36A 4K1BA 4LOOA 3VS3A 3KY2A 3MH2A 4GG5A 2OZAA 4BBMA 4WG5A 4ITHA 3B8QA 3R30A 4BZNA 3UTOA 5DN3A 3BHVA 4QQTA 3U6IA 4FIIA 4QMPA 1Y6BA 4QNAA 2WTCA 2E9VA 3AT2A 3ZUTA 3GUBA 4BCQA 5IDNA 1KE6A 5AP2A 3TI1A 4FTTA 3ZZEA 4EQMA 4EHEA 3V01A 3EFWA 1DAWA 4QP3A 3CQWA 3LCOA 4YP8A 3UPZA 3ZO2A 4DCAA 3E8NA 1DM2A 3ROYA 3ORLA 1ZOHA 4JR7A 2OXDA 2WHBA 3H0ZA 5AR7A 3PSBA 4USEA 3OWLA 4L3PA 2OXYA 4O81A 4BCFA 4CTBA 4LRKA 3MPMA 5ANKA 5AV4A 4J98A 5E8TA 1H25A 4HYIA 5CVHA 4QPMA 5AUXA 2G9XA 3SLSA 3R7YA 3F5GA 1QPJA 1MRYA 4EOJA 1H1QA 2OH0E 4PDPA 4E8AA 4GG7A 3F3TA 4QNYA 3QLFA 5JH6A 3QUDA 1YXXA 4GFMA 3MGYA 1WBNA 3R21A 2R7IA 5L2QA 4HVHA 3QTIA 3AMBA 4DGMA 4JQ7A 2YZLA 4C8BA 2FVDA 2QOQA 3HGKA 3AG9A 3R8PA 3LFNA 4H05A 4LGDA 4M66A 3CY2A 5KNJA 4NH1A 4FZFB 3L8SA 5EI8A 2BZKB 4S32A 4BC6A 3LOKA 3NUSA 4FTAA 2R2PA 2X4ZA 4KIQA 3MIAA 4HW7A 3PJCA 5CZIA 5IPJA 3KN6A 5GHVA 3CD8A 3DDPA 3QALE 2WZJA 3KKVA 3FZ1A 3MB6A 1T45A 4YBJA 3D7TA 3SX9A 3CXWA 4L45A 3ZDUA 4RC4A 3AC2A 5B0XA 5J1WA 4NFMA 4EWHA 2Z7QA 3MIYA 4O0SA 1R78A 5JFXA 2B54A 1Q8TA 4O7RA 3FMNA 3R8VA 4NIFA 4IAKA 1Q3WA 3ODZX 2CNUA 3W2RA 1Q41A 5HLNA 4S2ZA 4U7ZA 5E8YA 5IEVA 3CP9A 4AOTA 3NNWA 2G2IA 4MYGA 2OF4A 4GEOA 4IWOA 4IJPA 3D5WA 5C03A 5IUHA 4E4LA 2H34A 5HG9A 3DBEA 5M55A 4X2KA 2F9GA 3SXSA 2CNVA 4PF4A 4XLIA 5AUZA 3MYGA 3ODYX 5AUTA 3CGFA 5DMZA 3BHUA 2GQRA 2PE2A 3LXPA 4EK8A 1W8CA 5LWMA 2R3QA 4HCVA 3MBLA 4L8MA 4YJVA 2BRNA 2Z60A 5K0KA 5J5TA 2ETMA 1F3MC 4XG3A 5IA0A 5EM5A 4ZIMA 4EC9A 1WVYA 2PTKA 4R1VA 2UV2A 4F64A 4JX3A 4P5ZA 4RA4A 4HYUA 3UC3A 3PJ8A 5JSMA 1NW1A 3FKLA 2WO6A 4D9TA 4TYJA 5AWMA 3I6WA 3EN6A 4FSTA 3BRBA 2PZIA 2WEVA 3ZTXA 1SVEA 3FC1X 4AA0A 4BKJA 3MJ2A 1JSTA 3R8UA 3WE8A 1JPAA 4GSBA 2OW3A 3KRJA 4HCTA 5FLFA 3M42A 3DKGA 2BTRA 4RLLA 4FTRA 3THBA 3ANQA 4I5HA 2W4JA 4YC8A 2X8DA 3CBLA 4A9TA 3IS5A 3ZO4A 2WQNA 2UZWE 3QHRA 4DFZE 4Z3VA 2Z02A 4W8DA 3GGFA 3V5WA 4IDVA 2XF0A 2Y4IB 3NUNA 4YTFA 3D15A 3PLSA 3TN8A 3SGCA 4C4EA 5CF4A 3DOGA 3MV5A 4CV9A 2QO7A 3F5PA 2XKDA 5HCZA 3LPBA 3OUNB 2BFYA 3KXXA 4AF3A 2UZBA 4I6QA 3R63A 5H8EA 3IQ7A 2V7OA 2GTNA 3QGWA 4L42A 4BZOA 1GY3A 3PA4A 4IZYA 4PP7A 5J9ZA 4EOQA 2ZVAA 4ZTLA 3UODA 2BAKA 3HP2A 3E8EA 3KRLA 4GVJA 4HJOA 4W4XA 4AW2A 3TNQB 2YM8A 4YLJA 3RTPA 4YPSA 4FNZA 3KFAA 2ITYA 3OG7A 3Q32A 4CFFA 3M11A 3QQGA 5IH5A 1Q8ZA 4ZTQA 4A4OA 5C1QB 3QC4A 5J5SA 3SXRA 4EK3A 1WBTA 4GYIA 4NWMA 4Y85A 4DT9A 4LM5A 3BHTA 4ZTNA 1GIHA 5JQ8A 1STCE 5CX9A 3UO5A 5LOHA 3NR9A 4XBUA 4R3PA 4U3ZA 3DAJA 5AIRA 3ORZA 3CJFA 2ZB1A 4JDKA 3WI6A 4EH8A 3ZZWA 2X7OA 3OXZA 2JBPA 3FSFA 3VRZA 3F2RA 5H2UA 3VQUA 1IRKA 1XJDA 4RJ7A 1ZYCA 4I5PA 5LVPA 4RX9A 2Z7SA 2WMTA 4AZVA 4UV0A 5HIDA 1FINA 3G9NA 3TWJA 1WBSA 3BE9A 4QQ5A 4UN0C 2OO8X 4EK5A 3GCPA 3QTQA 4QP7A 2ZMCA 4QPAA 4DH1A 4IJ9A 4Z7HA 3P78A 3OROA 3F3VA 4MD7E 4XV9A 4BZDA 4DFYA 4F9BA 4FSUA 4PTEA 2FA2A 1PYXA 1VJYA 4K8AA 3WILA 4BFMA 5EQYA 2WMSA 4D2VA 3NDMA 3C51A 3GC7A 4MBJA 2GS7A 5I4NA 5HX6A 2I1MA 2XK9A 2WXVA 3G51A 4GCJA 3GP0A 1URCA 3ZU7A 2XB7A 4ANNA 5CXZA 4ZSLA 4E1ZA 3QZHA 4O84A 4HVSA 4D2WA 1FOTA 2YERA 3R7EA 4FTOA 5CF8A 3IPHA 2PVLA 3R7GA 4QTEA 5EYKA 1F5QA 4U43A 2O5KA 3EMGA 4QP4A 2ZV7A 3RM6A 2ETRA 4R7BA 3DZOA 4M13A 4AAAA 1LPUA 2F2CB 3PLAE 2WMVA 4FKUA 3TKIA 4BDEA 1H24A 1NY3A 4O1OA 1RJBA 4Y5HA 3TV4A 2ZDUA 2EB2A 4BI1A 1O6LA 2UVZA 2X2MA 3BPRA 3OWKA 4IB3A 2ZOQA 4L68A 4NW6A 4QYGA 4H36A 3I79A 4QP2A 4BIBA 4U79A 3QTRA 4S31A 2XK8A 5FQDC 3EZRA 3WF6A 4KSPA 4OTPA 3DBCA 5IG1A 5FBNC 5DOSA 3QTZA 3COKA 3D4QA 4FBXA 5CALA 4FTQA 2BTSA 5L8JA 4E4NA 4EK4A 4CG8A 4NFNA 3ZLYA 1YWNA 4V05A 5KMLA 2BR1A 2DWBA 4AS0A 3FYKX 4TPTA 2WD1A 1AGWA 2XK4A 5ETAA 3TM0A 3PXZA 3SOCA 4QTDA 2PULA 1OUYA 4O0WA 4TL0A 2PUUA 3FLNC 2R3LA 3JVRA 3KL8A 3NCGA 2EUFB 4AE6A 4BYJA 3OS3A 3FJQE 2W17A 3K3JA 4UYAA 5ETIA 3R8MA 4ZSEA 4Z16A 3BU3A 3CJGA 3HNGA 2GS2A 3EQHA 4I6BA 3PPZA 5AX3A 5L8KA 4EI4A 3A4OX 3QTWA 2C6DA 1PXNA 3FYJX 2FYSA 3R9OA 5AUYA 4MX9A 1Y8YA 1XQZA 2WTIA 2WMBA 5I9XA 4BDGA 3AC3A 4EUUA 3DGKA 4AXAA 5CI6A 4HVGA 3PIZA 2QODA 4A9SA 3HMIA 5LXMA 4AUAA 3R9HA 3A7HA 3KQ7A 1S9IA 3C5UA 3DAKA 4RC3A 5HEZA 1PF8A 2YIYA 4FODA 4QMSA 4R7HA 5T6KA 4BDHA 3ZSGA 4HGSA 3HV5A 1Q5KA 2ESMA 3HV4A 2W5AA 5FTOA 4AZFA 4DH3A 3OTVA 2OFUA 5J79A 1DI8A 3R2BA 1H1WA 4FOCA 4FV9A 2C6LA 3OUKA 4BCHA 3ORMA 4FG7A 4BYIA 2XKFA 3MY0A 3EYGA 1OPLA 3FMHA 4NW5A 4RT7A 4XP0A 2VWVA 3HRBA 1X8BA 4Y72A 4CMTA 3ID6C 2UZOA 4N6YA 3WF5A 3NS9A 4D0WA 2DYLA 4QTBA 3HAMA 2PVRA 3BI6A 5FWKK 4AZEA 2FH9A 3RCJA 5AA9A 2JAVA 3GNIB 3V5PA 2HW7A 2I0VA 3ZHPC 4M0YA 1IEPA 3QGYA 3CTJA 5EOLA 2Z7LA 3MFTA 4KBKA 4MBLA 4U81A 4GIIA 2IW8A 4ALUA 2YJRA 2YN8A 2R3MA 3CY3A 4AN2A 4Y46A 3Q9WA 1IG1A 2OI4X 1ZAOA 3R00A 3UG2A 5AEPA 2PUIA 3NYOA 3JS2A 3UOHA 3UP7A 4I0RA 5IDPA 3EKKA 4PDOA 1VEBA 4AOJA 2GTMA 1W84A 5CU4A 2GDOA 2R3NA 2CGVA 2PZPA 2QLQA 5EDPA 2UVYA 2WQEA 4GJ2A 4G6OA 4RIOA 4YUQA 5CSPA 2W5HA 3I0OA 1SVHA 3BEGA 4HNFA 2QOOA 2C3JA 2RKUA 4G31A 4PL3A 4PL4A 3G5DA 5HKMA 3BX5A 3ZSIA 2OKRA 3FQEA 4KIPA 3RNIA 4NT4A 1Q62A 4N57A 1PXPA 3HUBA 3REPA 3TACA 4BDCA 5IEYA 4BGGA 1KUTA 2JIIA 3VF9A 2UZEA 4DE4A 4UXQA 3QF9A 4J71A 3V8TA 4XV1A 4BTFA 3KK8A 4EOSA 5J9YA 4BKZA 5D9HA 4M0ZA 5CASA 4ITIA 2HZ0A 5HI2A 5BVWA 4DGLC 3PXRA 2C5XA 3JVSA 2AC3A 1WZYA 3DJ7A 4RVTA 5CWZA 1Q97A 5KMJA 3PJ2A 4D1ZA 3TUBA 2OJFE 4IX5A 3GXLA 3KC3A 3SVVA 4Z7GA 4EH5A 4NYEA 4F4PA 1OI9A 2P4IA 3EQCA 2NNWB 3KULA 3IOPA 1T46A 4YC6A 1LR4A 5CTPA 4O0UA 2R5TA 3RJCA 2QLUA 4YJRA 5LMKA 3CC6A 2YCQA 5KZ0A 2C4GA 3LW0A 4IM0A 3UP2A 4ZXTA 5JFSA 4BI2A 3U51A 3E3BX 4AA5A 4FTJA 2FSOX 5ANJA 4A4LA 4L7SA 2YITA 4OTGA 4BVUA 1OM1A 3A7FA 4IZAA 2BUJA 4ZMEA 3TKHA 3KU2A 2R0IA 3L9NA 2UW9A 4RJ8A 4UBAA 3MESA 4U80A 5CXHA 3U9NA 3DXQA 2I0EA 4YTHA 3V5QA 2CHLA 2YAAA 5LVOA 3AMYA 3EQPA 5L8LA 1UKHA 5ANDA 4DFLA 3G6GA 3U54A 2BHHA 2VWIA 2ZM3A 3HUCA 3LJ0A 4BDJA 5A9UA 4CFWA 2X6DA 2IZRA 2HIWA 2GFSA 2EU9A 2RGPA 4R3CA 4BDAA 3NAYA 2J0JA 1Q99A 3BBTB 3K2LA 4F1OA 5K5XA 2VAGA 1WVWA 1H26A 3FHIA 2JIUA 4H3BA 4JQEA 4EYMA 2O3PA 5IQEA 2JBOA 4OT6A 3NNVA 4HVIA 4EOMA 3ANRA 3BE2A 1J3HA 3HZTA 4FSNA 4ANLA 3LFCA 1UU8A 4H1MA 3RI1A 3JUHA 4FSMA 5EH0A 1FPUA 4PPCA 1UKIA 4NCTC 3B2TA 3TZ9A 4DTAA 3GC8A 5HE3A 4BCOA 2E9PA 3OFMA 2PZYA 1NXKA 2W1HA 5DHJA 5F4NA 4OAUC 3DFCB 2ONLC 3L9MA 3RPVA 3UZRA 3U6JA 3F69A 4AW0A 2WQMA 3W33A 4EOOA 5BMSA 3W2CA 2YHVA 3LVPA 4RQKA 3MY5A 2Y0AA 4Y5QA 3TJCA 2BFXA 3R6XA 2JFLA 5DR9A 4EOKA 5K5NA 4BL1A 3UYSA 2QO2A 2RF9A 4FT7A 3ZLXA 4U8ZA 3RBWA 2QOLA 4FIJA 5EW8A 2YIWA 3DTCA 3HL7A 2HELA 2VGOA 3Q52A 4TYEA 4U97A 5C8MA 3SQQA 2BZJA 4FNXA 3L8XA 1U5QA 3R8ZA 4FKLA 3RALA 5J87A 2WEIA 2XIKA 2PVKA 4XX9A 5EM6A 2X8IA 2UZVA 5A4CA 3UQCA 4RIXB 3VRYA 1R39A 5TO8A 2R3IA 1U54B 4XMOA 5CEQA 5BQ0A 3H9FA 5HVJA 4HVDA 2W9ZB 4F7SA 1Q61A 4DEBA 3SA0A 3VBQA 4B0GA 3RHKA 3C4FA 2R3HA 3GC0A 4UYNA 2VWZA 3R1YA 4APPA 3ORTA 4CRSA 1LEZA 2WTJA 3EJ1A 2X2LA 4BTKA 4TRLA 2OXXA 4Q5EA 3AT4A 5DA3A 5EM7A 1Y91A 4G5JA 5DE2A 3P86A 1APME 3SAYA 3IOKA 4CGAA 3NUXA 2GNGA 2B9IA 2OZAB 2BALA 4HPUE 5CSXA 5F95A 4RA5A 3FZSA 5IUIA 1CM8A 2VTPA 3PVBA 3QRKA 3NLBA 3A7GA 4BBFA 4Q9ZA 2VWWA 4TYHA 5F20A 5D11A 5KZIA 4FK3A 4TY1A 4I22A 2WIPA 2WNTA 3P5KA 3P7BA 2NO3A 3QRTA 4G3GA 4X2JA 3ULIA 3AT3A 3ZC6A 2HOGA 2GNJA 3AC8A 3UNZA 3F6XA 5CQWA 2NRUA 4TWCA 5AV2A 5JK3A 4ZSAA 2VO0A 4OR5A 3FZRA 4IVDA 3OMVA 2HWOA 2R0UA 4NCTA 2IVSA 3TTJA 3W16A 3QL8A 2WQBA 1XO2B 4B99A 3DDQA 4P7EA 3VBXA 2UUEA 5A54A 2YM5A 5HICA 5KMIA 2YABA 2F49A 2UZDA 4OT5A 1H28A 3VW6A 3W2PA 4P5QA 2ONLA 1V0OA 4NTTA 4F99A 3UZTA 4ALWA 2H96A 4TYGA 5M09A 5B7VA 3BYSA 4QMZA 4ASEA 3G90X 2BDFA 3O23A 1UU7A 3HP5A 4FEWA 4YLLA 5M08A 2X4FA 2YCFA 1ATPE 4J99A 3D5UA 4GT4A 4LOQA 3ORXA 3T3VA 3ULZA 3ZC5A 2BAQA 5C4LA 3C13A 3L1SA 4FOBA 2C69A 3KMUA 4KRCA 4D4VA 3C0IA 4FKOA 3EOCA 4PMPA 1ND4A 2C47A 1FBNA 3QQUA 4R6VA 2JDSA 3NIEA 4HPTE 4UMTA 4CXAA 4JI9A 5F9EA 4K9YA 2JDOA 1WBWA 4RIYA 4ONAA 1OL6A 5CSVA 1B39A 3GU5A 4W4YA 2QG7A 3H0YA 2UW8A 1PMNA 2XMYA 5KUPA 5AR3A 4ZS4A 1ZYDA 2PZRA 5KE0A 3VS4A 5B2MA 5FTGA 5EYDA 4EH3A 3BYUA 2XBAA 4WG3A 4ZK5A 2BROA 3QCYA 4R78A 3CTQA 4KKHA 3QQJA 4BDDA 1BL7A 3UMWA 3TDWA 3LXLA 4C4JA 3E87A 2ZMDA 4GK2A 2JDTA 5HBHA 4FF8A 3C4ZA 3CEKA 4JG7A 5AR2A 3V51A 4C4GA 3W2SA 1WFCA 4NIFB 5FEQA 1UNLA 4LOPA 3HDNA 4FVRA 2IWIA 4JRVA 4F6SA 5FTQA 1W7HA 4IX4A 2C6MA 2GS6A 3RAHA 4IVCA 3PE2A 3QRJA 3AXWA 5HCYA 4UB7A 2C30A 4PV0A 3FWQA 1R0EA 3QYZA 5FEDA 1W82A 4Y95A 2KULA 4UMPA 3IW6A 2GQGA 1XR1A 4MBIA 3ORNA 5FEEA 2J4ZA 4AACA 4F08A 5JZJA 3UJGA 3UG1A 4CZYB 1NT2A 3ZM9A 1ZMUA 5AMNA 4YGAA 2BPMA 3HAVA 2QR7A 2KTYA 3UIXA 4WT6A 4NM7A 4AQCA 5IKWA 4KIKA 3FSKA 3G6HA 4WUAA 3KXZA 2A4LA 4QTCA 1H1SA 2E9NA 3F3WA 3PWDA 4WNKA 5D10A 3FEGA 4IVAA 5CQUA 2PPQA 4DH5A 4K11A 3CE3A 3CKXA 3CS9A 3FKNA 3MS9A 1KV1A 3LQ8A 5IQIA 2C6EA 2X81A 5AX9A 2GCDA 3MVJA 5E8SA 5CAUA 4E20A 1VR2A 4O7SA 5JRQA 2EXEA 1MUOA 4F63A 1OGUA 4I21A 3QD3A 2LGCA 2OU7A 3AOXA 4PNIA 3R7IA 3RWPA 4CSVA 4GMYA 1OMWA 3PZEA 1ERKA 4EK6A 4NM3A 4ANQA 2BKKA 2BIYA 5GZAA 4V0GB 4RPVA 4I23A 4R5YA 3DKFA 5LARA 3NUUA 3ORIA 1QMZA 4Z9LA 5AUVA 3TNPC 4EYJA 5KMKA 2QHNA 4Q2AA 1OUKA 2BKZA 4IAFA 3VW8A 3WBLA 2HY81 4GK3A 4KD1A 1BUHA 2XIRA 5AP5A 4NJDA 3WZKA 2PMNX 2G1TA 4C57A 3RPRA 2XM9A 3GQIA 1XWSA 4MTAA 4IFCA 3WYYA 5AFVA 4LYNA 3KF7A 3A7JA 2GMXA 3DCVA 3TUDA 4FV6A 3OOMA 4FZ6A 5I9VA 4YC3A 5CI7A 3ZEPA 5ITAA 3JY0A 3QTUA 5DBXA 1RW8A 3F7WA 3C4WA 3V8WA 3COMA 4DHFA 3FI3A 1OKYA 2GNLA 4L43A 2XJ1A 5HG7A 2PE1A 4C33A 1ZYJA 3F9NA 4ZS0A 3FI2A 4QTAA 5HTCA 5HIEA 4UX9A 4PDYA 1CSNA 3MA6A 2GHGA 2BIKB 4QYFA 5HG5A 1PKGA 2E2BA 1O6KA 3LM0A 4QP9A 4WSYA 5AP4A 5IA3A 5C8KA 4PNKA 3CGOA 3H3CA 4X3FC 4X2GA 5KKRB 4IZ7A 4JLCA 4CG9A 2XA4A 1PXKA 2AUHA 3UOJA 3COHA 5IQHA 3OVVA 1JSVA 4KB8A 4PUZA 4ZP5A 3UQGA 4AP7A 3UOKA 4YTIA 4YJSA 5DPVA 4AT5A 4E4XA 3C4XA 3RZBA 5TOZA 2XIXA 4CLJA 4GKHA 2YDIA 4ENXA 2OJ9A 4M69A 1PHKA 3I4BA 2J2IB 1YVJA 4O83A 3Q9ZA 3VS0A 4I5CA 1WBPA 4G3FA 4RFYA 1OPKA 4V01A 2W7XA 2OWBA 2YFXA 3F88A 1IAHA 4BDIA 5KMOA 4IC8A 3IG7A 2W96B 2R3OA 4DG3E 3DU8A 2J5EA 4FK6A 4R7IA 5BX0A 3O8UA 5JRSA 4ZJIA 3VULA 2YLEA 4XNEA 4S30A 2O8YA 3VHKA 3R73A 3LLAA 3SW7A 4OTDA 5JZNA 3OEFX 3ERKA 4IADA 1I44A 5D41A 3WYXA 2PU8A 4BDFA 3SXFA 3FY2A 4ZY4A 4E5WA 3TV6A 2JKKA 4C37A 2O2UA 3PPJA 5BUIA 3T3UA 4YTCA 4CFUA 4MEDA 1O9UA 2B52A 3RPSA 3VC4A 1I09A 3Q2MA 3VHEA 4FEXA 1PXOA 5DYJA 2I6LA 2B53A 4B9DA 2W1EA 1P4OA 3NZ0A 3NVKI 5EFQA 4DTBA 4FV5A 4BHZA 4FUYA 4FV8A 4EOLA 5EI2A 5HE0A 3SV0A 2FB8A 4W4WA 3D83A 4RMZA 1F0QA 4D58A 4MVFA 5CS6A 1OECA 3EZVA 3BQRA 3PXQA 2OICA 2QOKA 5HOAA 2W1CA 3PXYA 4ZAUA 1M7NA 3O51A 3Q5ZA 4K0YA 2QO9A 3LCTA 2YEXA 4X2NA 3Q5IA 5GJGA 3TV7A 4FL3A 3VIDA 3VWAA 3QQLA 3MTLA 5J7HA 3RP9A 2ZYBA 3OY3A 3KXNA 4FICA 4E6CA 3WOWA 4AFEA 5M53A 3G2FA 2CKEA 2CNQA 5GZ9A 4OTWA 1PRYA 3ZUVA 3ATTA 5IQGA 2XK6A 5IF1A 4QYHA 4FYNA 4PDSA 1QPDA 1OKVA 3FXWA 5IH6A 2QOIA 3ZYAA 1GOLA 2C3KA 1FGIA 3MPAA 5JEBA 4L9IA 4IDTA 5CEPA 4MNEA 4O22A 5G1XA 4ALVA 4AWIA 2F7XE 3DB6A 4YNOA 3NUAA 3QZGA 5E7RA 5KBRA 3RWQA 2F7ZE 4U6RA 2X7FA 2R3RA 3BGPA 5J1VA 1H00A 3VUHA 3TIYA 3FE3A 3DFAA 3VS6A 4RVKA 3EQBA 3VNTA 1L8TA 2CN8A 1GJOA 3QBNA 5G6VA 5J7BA 4M15A 3IDCA 2R3GA 1BLXA 3Q4CA 3RZFA 3UO4A 2GFCA 4HYSA 3WZDA 3RAWA 2IVUA 4BWPA 2DUVA 4AA4A 2I40A 4EZ7A 3G9LX 3MFSA 5L2WA 3WIGA 4PPAA 2WTVA 4MK0A 3VS5A 5CZHA 3HMMA 2ZM1A 5JT2A 1BKXA 2X8EA 4UMRA 3RAIA 4FMQA 1M2QA 2W4KA 1WBOA 5H8BA 4BGQA 4M3QA 3U8WA 1TKIA 4C02A 4G1WA 4D4RA 2Q83A 2C5OA 4ACDA 4F7NA 3EL7A 3PY3A 3PP1A 4F0FA 5HO6A 4YHJA 2PZ5A 4JAJA 4AZTA 3HKOA 3QCXA 5E8VA 4BY9E 4C3FA 4FEUA 3FQHA 3QX4A 5FG8A 3QU0A 4IWDA 2W1DA 4CD0A 2XH5A 3IDBA 2J6MA 3HDMA 3PA5A 2VUWA 4TXCA 3R7UA 4LFIA 1H07A 2X7GA 3QCSA 4GL9A 1CKJA 4E6AA 3FDNA 1FQ1B 3PIXA 1WBVA 4FKGA 4R3RA 1TVOA 4AGCA 5HGIA 2W0JA 4AT3A 4Q5HA 2DQ7X 2JIVA 2QURA 2Y4IC 5CT0A 3ACKA 5IQFA 3AMAA 4OUCA 4UXLA 4XG7A 1PXMA 2V5QA 3MWUA 4D2SA 5DG5A 4I93A 4GS6A 3S95A 4G6LA 2JD5A 3EFLA 2XIZA 2A1AB 2VTLA 3IW7A 4X7QA 3HLLA 2ZAZA 3UIMA 3T8OA 3C5IA 3UMXA 1QPCA 1YDTE 3EQFA 4TN6A 3G0FA 4C2VA 1UA2A 3FZOA 2A27A 2WQOA 2Y9QA 4QMVA 4UMQA 3F5XA 3F2AA 4IMYA 4NKAA 3IW8A 2B7AA 2E9OA 4PWNA 3PY0A 2OZOA 5E1SA 3NW5A 4DEHA 4ZMFA 4RLKA 3OW3A 2Y8OA 3GFWA 2IVVA 4DEDA 2JKMA 3IGOA 3Q4ZA 3RM7A 1GIJA 5HG8A 3LFBA 3PSDA 3O7LD 3Q6UA 4WO5A 4PMMA 5C27A 1REJA 5HD7A 2PUNA 5CANA 2HYYA 1JNKA 4A06A 2QNJA 1XKKA 4FTNA 4FVQA 1JVPP 2VTHA 4Q9SA 5HBEA 3U4UA 3WZJA 3ZFMA 2R4BA 5CAQA 1ZOEA 4FSWA 3VUDA 2VX0A 3ET7A 4JBPA 4XUFA 3HA6A 4G2FA 4LQMA 4CEGA 1GZNA 3OBGA 5GIOE 2RL5A 3C9WA 4G3EA 4D4YA 1CTPE 2DS1A 2QG5A 2YM6A 4U40A 4EZ3A 3N51A 1OPJA 5D12A 3ZEWA 4EH2A 5ANEA 1ZZ2A 3LFAA 2R64A 3A7IA 4DT8A 2ITZA 4QPSA 3QKMA 3BV2A 1AD5A 3PUPA 2WTDA 3OD6X 2VU3A 5KX8A 5ACBC 2WTKB 4R5SA 1Q8UA 1Q8WA 5I9UA 3M1SA 5IA2A 3BLRA 1M7QA 1XBAA 1NVRA 1WMKA 4QMXA 3WIKA 4NK9A 2HAKA 3OT3A 5FP6A 4QP1A 3S2PA 4WG4A 5F1ZA 3OHTA 5KMNA 3VF8A 4DTKA 1A48A 2VWYA 3PSCA 1KE5A 1UNGA 4DGNA 4O91A 1K3AA 4I6FA 4DFXE 2ZJWA 3A62A 4I20A 4I5MA 3ZUUA 2X1NA 5L6WL 3IONA 4EOIA 5GIPE 4MCVA 2VWBA 3R1NA 5EM8A 5AADA 2X0GA 1NVQA 2YM7A 4F65A 1B38A 2QOBA 4IAIA 1UWJA 4MXZA 5EG3A 3LMHA 2GSFA 2JDVA 1PW2A 2BRHA 3O7LB 5DFPA 3W55A 1Z5MA 3PJ1A 2QOFA 1UU9A 4J7BA 2VTMA 3V5JA 5FM3A 3UNJA 3W32A 3MVLA 3AD5A 4RFZA 2WOTA 3H30A 3P7CA 5HNGA 1Q8YA 3N4TA 1BX6A 3EQIA 3RINA 4ANSA 2FO0A 2WIHA 5EI6A 5E4HA 3BIZA 3R02A 4ARKA 4RWKA 4F1MA 5D1JA 5DR2A 4E6DA 5BUJA 5BVNA 3NYNA 3FMDA 3TUCA 5DVRA 5IISA 4JAIA 4DAWA 2V62A 4IEBA 5CF5A 3W10A 5IQCA 1NA7A 4IWPA 4FKJA 2UZUE 3BBWA 1DAYA 3PA3A 4IBMA 2YDKA 5CEKA 5M57A 1OL2A 3LFEA 3PP0A 4FKPA 3S3IA 2G2FA 5CF6A 5CAVA 4U44A 3WZEA 4JDJA 5J9LA 4L00A 4F0GA
chains in the Genus database with same CATH superfamily
2WMWA 2XM8A 3FHRA 2AYPA 4UZDA 2XZSA 5AV1A 2BVAA 2RFEA 1JLUE 3MPTA 2BZIB 2PVJA 3D2IA 2R3KA 4N6ZA 2ERKA 2JKQA 3E63A 1YXVA 4OTFA 5M51A 3QZFA 4XRJA 2XEYA 3QD0A 4OBQA 4DHJA 1FGKA 3AC4A 2CDZA 3Q04A 2W1IA 2GU8A 4U45A 3UQFA 3FLZA 4FV2A 4JIAA 4FI1A 5L2SA 5JGDA 3DNDA 3GQLA 5CSWA 4C4FA 2VO7A 3E93A 3HMNA 3F3UA 1ZXEA 4F7JA 5M4UA 2NPQA 5E1EA 4DEIA 4EQUA 3GCVA 2QKWB 4XBRA 4BCIA 4CFVA 2CMWA 3D5XA 1P4FA 4DITA 2OBJA 2XYUA 5CEMA 2G2HA 4XOYA 4AN9A 1UWHA 2RFDA 3EYHA 4LL0A 4RJ5A 3MTFA 2HWPA 4IW0A 4ENYA 3IW5A 2CKPA 2C6OA 5DI1A 2CKOA 5HTBA 4ZZNA 1LUFA 5HVYA 4CKIA 4F9YA 3NUYA 4GU6A 4NKSA 3NRMA 1UVRA 2OF2A 4XG9A 3VJOA 4DEEA 5HX8A 1BI8A 1YOMA 2B0QA 1ZY4A 2JDRA 3COIA 3UOLA 3UO6A 3UYTA 3W8LA 3S1HA 2PVFA 4MD9E 5HD4A 2QQ7A 5EW3A 4DGGA 3OEZA 3EN5A 5D7VA 4O7LA 2VX3A 4FV0A 4QMUA 4GKIA 2OJJA 3PTGA 4Z55A 3QWKA 1URWA 1UNHA 4ID7A 5FXSA 4GT3A 3ZO3A 5IEXA 2HW6A 2OFVA 2W06A 2ITTA 3WF7A 3L9PA 3P23A 4IX3A 2H8HA 5GJFA 2A0CX 3I7CA 4AN3A 5HESA 3SRVA 4CQGA 3LKMA 4FTCA 4GFOA 2B9FA 2BILB 3LM5A 3OW4A 4D5KA 4PRJA 2UW5A 4ZTMA 2ETKA 2EVAA 4UZHA 4B6LA 3PG1A 2CGWA 4M67A 4PY1A 3VAPA 1YKRA 1QPEA 2AC5A 3ZLSA 3II5A 3ORPA 3WZUA 2F7EE 4RVMA 5DEYA 2XNBA 3DK7A 4WBOA 4YZ9A 1KE8A 3N4VA 4IAAA 4RVLA 1YXUA 1H8FA 4RG0A 3QC9A 5JFWA 4KNBA 4ZLYA 2WOUA 4QOXA 4Y83A 3QQKA 4FR4A 3ELJA 2W9FB 2YIRA 4HNIA 4O0YA 2PK9A 2RG6A 1OIYA 1JKTA 3OY1A 4RFMA 4X2FA 4C7TA 3QA8A 4NM5A 2XK3A 5EKNA 5ACKA 2XNPA 2VX1A 2Z2WA 2JGZA 5BVDA 3DV3A 3Q6WA 5LMAA 3LE6A 3P79A 3DT1A 3HX4A 4ZLOA 1K9AA 4F70A 3S0OA 3MY1A 5ETFA 3GCUA 5AP0A 3FXXA 4A9RA 2P2HA 4WRGA 4M7IA 3RHXA 2WB8A 1ZARA 4W9WA 4DH8A 4RZVA 2HK5A 4CT1A 3KEXA 4MXCA 4F9CA 5KMMA 2EB3A 3ITZA 2BMCA 3GU7A 4XP2A 3ENHA 5LCKA 2VNWA 1W98A 2PMOX 5AR5A 1S9JA 3ROCA 3T9TA 3KRWA 1U59A 1DI9A 3CQEA 4ZZOA 3O0GA 3NNUA 2YLFA 1FVVA 4YNEA 3TZ7A 5C26A 2QHMA 3KF4A 1YXTA 2IVTA 2W4OA 4IB5A 1YWVA 2OIDA 1YDSE 4OBOA 4GH2A 1R0PA 2XNGA 4I24A 3OXTA 3F66A 4K77A 4KIKB 5M07A 1E1VA 4U3YA 3E8CA 3QA0A 3D94A 2PVYA 1J1BA 3H9OA 3PYYA 1TQPA 5F94A 3QXPA 4IAZA 3LCDA 3NAXA 4C62A 1M2PA 2WMQA 4EBWA 3TT0A 3GC9A 4FVPA 2XK7A 1O6YA 2IZTA 4C3PA 3D0EA 3O2MA 4FG8A 4ANBA 1J7LA 3FBVA 2EXCX 3JXWA 3LXNA 4YZNA 5IMXA 5A4TA 3QYWA 3BHYA 1P5EA 3E3PA 2XNNA 3SDJA 3V5LA 1VLRA 3LXKA 3KXHA 2CJMA 5M4IA 1YI6A 3POZA 4O1PA 1G3NA 4IHPA 4OBPA 4AXDA 3Q96A 4I0SA 3IO7A 3AGMA 5CT7A 4EQCA 4J8NA 4E73A 4TW9A 3KIOC 1W2DA 1PMVA 3P5JC 2GHLA 5E90A 1P2AA 4GK4A 3C1XA 4IE9A 4CRLA 2WMXA 5DH3A 4RSSA 1SNXA 3WARA 3ZCLA 4CZUA 4MHAA 5DT0A 4JJRA 3HV7A 2HCKA 5CY3A 4F09A 3R1QA 1ZYLA 3C4EA 2BHEA 3QQHA 4FGBA 3LMGA 3DQWA 3K5UA 2VD5A 2Y7JA 2Q0NA 4N70A 4EUTA 5A46A 3DJ6A 1ZRZA 3MSSA 4XH6A 5HCXA 5LVNA 4C38A 3V3VA 3KN5A 4ACMA 4FEVA 4ZSGA 2YIXA 5TT7A 3PVWA 4PQNA 4L52A 4X21A 3CSVA 3UDTA 3TCPA 3V6RA 2QOCA 5AM7A 2BDJA 4FV7A 3RAKA 5I5ZA 4W4VA 4GW8A 4CTCA 4QMWA 4E4MA 1JBPE 5BUEA 2J0LA 2PVMA 3H10A 3MH1A 3LHJA 4R77A 4YZDA 5DT3A 5DLSA 3CKWA 1MQ4A 3FL5A 4FT3A 3HVCA 3SD0A 3D14A 4XS2A 2XRUA 3W1FA 2C68A 4EH9A 4ERKA 3PXFA 1PMUA 4JXFA 2C6IA 3ALOA 5KHWA 5IH4A 4LMUA 4TNDA 5HHWA 3R01A 3BKBA 4F0IA 3U55A 2VV9A 4O6EA 2J50A 1JAMA 3RCDA 4Y73A 3FMJA 5BVFA 2C1BA 5CEOA 1QCFA 4O2PA 5H3QA 4M8TA 5LCJA 1TFFA 2IZSA 3GFEA 4A7CA 3AD6A 4EKLA 2P55A 4RX8A 3D7TB 5JKGA 2C1AA 4GU9A 3VUMA 2R3JA 1YXSA 1IASA 3I60A 2ITPA 2R3PA 4UY9A 1OKZA 2CGUA 5B2KA 4FG9A 4A07A 2QVSE 4KINA 3W18A 3ZDIA 3BL7A 4EWQA 1PXLA 4K18A 1SYKA 3POOA 5AV3A 1XH8A 2Z8CA 3E64A 2QR8A 4M12A 4FIGA 5IA5A 4MF1A 4CMOA 2XRWA 4FKWA 3VVHA 5HU9A 5L3AA 1Y57A 1J91A 5LQFA 2H6DA 1AQ1A 3C0GA 3CPCA 4PMSA 4F9AA 3DB8A 2P33A 3E92A 5L6PA 4H39A 5CYIA 3P1AA 4FZDB 2GHMA 2H9VA 1SZMA 5EHLA 4ZTSA 4AU8A 4W9XA 4DINA 4H3PA 5M44A 3KREA 4RBLA 5IMEA 5FD2A 4OAVB 2HZNA 4RIWA 4C3RA 1PKDA 4P2KA 4EHGA 2ZDTA 4O7VA 1VZOA 3FLQA 5DRDA 3C0HA 4KSQA 3R83A 1M17A 4LRMA 4BIEA 4DYMA 3EIDA 3MVMA 1J1CA 3PFQA 3R0TA 3KMWA 1H1RA 1WAKA 4K2RA 2OIBA 4WBBB 5EDQA 4QYYA 2B9HA 5I9YA 5EOBA 4AOIA 2F57A 4TTHB 4UALA 5BYZA 2YDJA 5AUUA 1PXIA 2CLQA 2ITOA 4CMUA 1MRVA 1CKPA 2PWLA 4G3DA 4M14A 4AAYA 3CCNA 3E7OA 3NCZA 4EH7A 1PJKA 3MI9A 4MXOA 4FKTA 4KS8A 2WKMA 4I0TA 4RIXA 3V04A 2Y4PA 3KA0A 4KIOA 3L9LA 4EZ5A 4J97A 1R1WA 1OL1A 3DS6A 3FMEA 1ZZLA 4CYIA 1XH5A 3I5NA 4QP8A 4XRLA 1FMKA 3EQRA 2NRYA 4OTHA 4CYJA 4LGHA 2J0KA 4XCUA 5E8ZA 4MXXA 4EBVA 3CIKA 5AJQA 2GNFA 4X6QC 1IA9A 3RGFA 4L67A 3GOKA 4FRFA 4RJ3A 1A06A 1IA8A 3I0QA 3W2QA 4B7TA 2IO6A 4DLJA 5BYLA 3KXMA 2VGPA 4EH4A 4BBEA 3CQUA 5IZFA 4IM3A 2HENA 4M68A 2XCKA 3R8LA 4DDGA 4QQCA 4HZSA 3R04A 3PRFA 1L3RE 2G15A 3QKKA 5DT4A 4C61A 4D2TA 5IA1A 2OSCA 3A4PA 4C2WA 3CTHA 4JBOA 1LP4A 3WF8A 4FNYA 3LQ5A 3ZOSA 1Z9XA 2W1FA 3OCGA 3TIZA 4ACCA 3BWFA 1SM2A 1SMHA 3HMOA 3VQHA 2XNOA 4MWHA 2QC6A 5E91A 4D0XA 4RX7A 4FZAB 3R9DA 2A2AA 4ANOA 3PVGA 5FM2A 3T9IA 3FZPA 2FSMX 3SHEA 4U9AA 4PX6A 4EJ7A 5GJDA 4BCJA 3RPYA 2ITQA 3ENMA 3R9RA 4BJJB 3EL8A 3ZM4A 4JBVA 5CLPA 4IIRA 4APCA 3ZS5A 4AX8A 3DK6A 2J51A 3DNEA 4FKIA 3P9JA 1PMEA 4M97A 1VYWA 2YCRA 4C59A 4F7LA 2JC6A 3FLSA 5HBJA 2XKEA 4O0TA 4YPDA 4YJPA 5M56A 5IQAA 1Z57A 2W5BA 1H27A 4HOKA 1ZMVA 1U46A 4I6HA 3DY7A 4MF0A 3FZTA 5DEWA 3Q3BA 3AKLA 5EW9A 2XJ2A 2P3GX 2VTSA 5CENA 4IVBA 2ERZE 4ZSJA 1WCCA 3TZMA 3ZRKA 2QU5A 3EH9A 3PE1A 4AGDA 5HVKA 5IQBA 4RZWA 2ZV8A 2XCHA 3FAAA 2QKRA 4RQVA 4XV3A 3HYHA 4KRDA 5CU0A 4WKQA 3SC1A 5IU2A 3JY9A 3QAME 5BVOA 2BRBA 3QKLA 3R22A 4YR8A 3DXPA 4ORKA 1RQQA 2YJSA 4KABA 4CLIA 2VTRA 4D1SA 5I9WA 5JGAA 3N9XA 2W05A 2J0MB 2ZM4A 2C0OA 4JR3A 4YJNA 2BAJA 2PYWA 5JN2A 4TZRA 4WNMA 3PY1A 2PHKA 3QQFA 3QZIA 3NIZA 1V0BA 3LLTA 4L3LA 4C0TA 3HECA 5GNKA 5I0BA 5KHXA 3BYOA 2IW9A 1E1XA 1UV5A 2QCSA 2W1GA 3E8DA 3DA6A 4HZRA 4LRJA 4KWPA 4YJOA 4I1ZA 3Q2JA 3WF9A 2B9JA 3FLYA 5LVLA 3UVPA 1JQHA 2FSLX 2V0DA 4K6ZA 4BDKA 4FV3A 3S00A 5EQPA 3SG9A 1GZOA 4GT5A 3VBYA 4N0SA 2BRGA 4CZTA 3GU6A 5KKRC 3N4UA 5AAEA 2HY0A 1KV2A 4II5A 3RNYA 4RJ4A 4CKRA 1LEWA 3EN9A 4AFJA 1OIRA 2UZTA 2GNHA 1ZLTA 4LGGA 4DLIA 2ITUA 2WAJA 3PZHA 4XG6A 1FVRA 2IG7A 2WPAA 4FSYA 3NX8A 4GV1A 2VO3A 3FPMA 4X3FA 4IB1A 4D4SA 4G3CA 3MB7A 4I4FA 3E5AA 5EHYA 4ASDA 3FMMA 1IR3A 4O7NA 4FSRA 1FVTA 2UW4A 2QU6A 2UVXA 4L6QA 1XH4A 1KWPA 3QX2A 2C6TA 4V04A 1CMKE 2Y6OA 3R28A 3JPVA 3ZH8A 4CQEA 4J95A 5CU2A 4ZJVA 3OCTA 4ZEGA 1KE9A 2PMLX 3R71A 3ZXZA 3ZRLA 3TXOA 3ETAA 3HA8A 2C0TA 2XNEA 4JL9A 4JQ8A 1XBBA 4FT9A 4BICA 4U5JA 2EXMA 4KAOA 1XH7A 3LJ2A 2OH4A 3KMMA 5KO1A 3MH3A 5AM6A 4FKSA 5BNJA 3LFSA 2W99B 3GI3A 4V0GA 3H9RA 4L01A 1YOJA 3MN3A 1JKLA 3LJ1A 3O17A 2YAKA 3TNIA 4JBQA 3BWJA 4ZZMA 2GPHA 5HE2A 3BLHA 2VRXA 3L8PA 4DFBA 1XH9A 1M14A 3HMPA 4OGRA 4ERWA 3DPKA 5K9IA 1V0PA 3LZBA 3CD3A 4I92A 3DKOA 2GQSA 4O21A 4BTJA 4DFUA 1R3CA 2I0HA 3H4JA 5CVFA 2QD9A 2OJGA 4ZTRA 4ACHA 4BWKA 1G8AA 2JFMA 3ZFYA 4O4FA 2VTJA 4MXYA 4GVAA 5JFVA 1H0VA 4RC2A 4MQ1A 4WHZA 3U87A 2BRMA 4G9CA 3GENA 4D28A 4G9RA 5J8IA 4GIHA 4FUXA 3Q60A 5AP3A 3LFFA 1SVGA 3BLQA 4JVGA 4J96A 4YJQA 5EYCA 2F4JA 4AW5A 4QD6A 4D9UA 3UE4A 1ZOGA 3ZXTA 4JG8A 2X9FA 5EHOA 3FLWA 4CFNA 1OL7A 4AT4A 2XNMA 2LAVA 4CFXA 5HO7A 2WMUA 3OP5A 1G5SA 3KVXA 2QOHA 4GUBA 4B8MA 4BCGA 4IAYA 4PL5A 5HTIA 3BCEA 3ZO1A 4DC2A 1Y8GA 5HNBA 2VTTA 2O0UA 3RK5A 5A6OA 1CDKA 2BZHB 5DRBA 4ZY5A 2CCIA 4F6WA 5B2LA 4ZTHA 3E88A 2UZNA 3HEGA 4FIHA 3KCFA 2PSQA 3A8XA 3DJ5A 4FNWA 4Y8DA 5HIBA 5C9CA 1OB3A 2WMAA 3GT8A 4E5BA 4QDEA 4QEBA 3C7QA 4MKCA 5HE1A 4AGUA 2VNYA 3F61A 2VWUA 4IXPA 5CNNA 2X6EA 4YLKA 1ZWSA 4TWNA 4C4IA 4D1XA 5AAGA 2FGIA 1BI7A 1GAGA 4L3JA 4USFA 2V55A 3IECA 2CCHA 3TDVA 2YWVA 4MNFA 2C5NA 3O8PA 4O0VA 2JAMA 1BL6A 2C0IA 3AGLA 3DZQA 4WD5A 5AV0A 5C8NA 3OCBA 4JNWA 1BYGA 3TTIA 3G15A 4EHVA 4AXEA 4P90A 1RDQE 4QMMA 5HLWA 3NWWA 4KUJA 4H58A 3BHHA 3AC1A 3OOGA 2PUPA 1P14A 4S34A 3MJ1A 3OWJA 3FKOA 3MA3A 4IQ6A 4A4XA 4KKEA 2V7AA 3SG8A 4OTRA 4KKGA 4A9UA 3KULB 3GVUA 2J5FA 1U5RA 3DLZA 2Z7RA 4R8QA 1JKKA 3CPBA 3IDPA 4O2ZA 3E62A 2JKOA 2VTNA 3F2NA 2C3IB 4AG8A 4QYEA 3VUKA 2XIYA 1Q24A 4ASXA 1MRUA 1EH4A 3NMUF 2R9SA 5AP6A 3C4CA 5AP7A 1PYEA 5HLPA 4DG0E 4F1TA 4ZLZA 3BGZA 3GU8A 4FL2A 4ASZA 3AKKA 1JWHA 3R7VA 1OL5A 4A9YA 2VWXA 1Q4LA 3QFVA 4BB4A 5ANGA 3KXGA 4YMJA 2FUMA 2IF8A 2PVHA 4GRBA 4FGRA 1Q3DA 3NNXA 3SRVB 4AZWA 2JEDA 5IUGA 4CCBA 4YO4A 3SW4A 3BGQA 3I6UA 4E7WA 2B55A 1OBGA 2JLDA 2RFSA 4FSQA 2QONA 2C6KA 1OVEA 2YCSA 3NPCA 4FT5A 4YHFA 5I3OA 5TF9A 4JX7A 3TNHA 4DGOA 3DQXA 5FDPA 4MXAA 4HYHA 4XYFA 4UWCA 3UZPA 3EN4A 1KE7A 4FEQA 2J0IA 3PWYA 4E93A 4BGHA 4O7TA 5K3YA 4GFGA 2IPXA 4O27B 3GU4A 3S4QA 2SRCA 2PVNA 3NW6A 4RWIA 3RK9A 4KBCA 1MQBA 4UEUA 3DBDA 4RJ6A 2C3LA 3TEIA 2OJIA 2C5YA 4IC7A 4MH7A 4E6QA 1QL6A 4NZWB 3BU5A 3SOAA 4FTKA 4J1RA 5IA4A 4BIDA 3QHWA 1OITA 3GB2A 4EH6A 2ITWA 4L7FA 3UNKA 5AAFA 4EEVA 3KVWA 2ACXA 4FIFA 3O8TA 4WIHA 3RKBA 5H8GA 2ITVA 2WTWA 3QTSA 1OZ1A 4XHKB 4FTIA 4U42A 2Y6MA 4P4CA 5ICPA 3FMKA 2XP2A 2OLCA 5ANIA 5LMKC 1HCKA 5CSHA 5E9EA 5DIAA 4OW8A 4TYIA 4WUNA 3R1SA 4FKVA 4HGEA 4FKRA 4IACA 4X6RA 1OIUA 3QLGA 5E92A 1XMLA 4CV8A 3GOPA 3I1AA 4EONA 3Q9XA 4XG4A 3GCSA 4AE9A 3UGCA 2VTOA 2WTKC 5E8UA 5HO8A 1PXJA 1KSWA 4XLVA 5A6NA 3NVMB 4MWIA 3PJ3A 5FBOA 1ZY5A 1XH6A 3PPKA 4O0XA 4IB0A 5HU3A 2UW6A 2XBJA 3KGAA 4WNPA 3ZBFA 1V1KA 3O50A 3PG3A 5BV3A 2PMIA 4DG2E 5LJJA 1JKSA 2O64A 4PP9A 2B4SB 4JIKA 3LCKA 3AQVA 4BF2A 3V8SA 5L6OA 1REKA 1TQMA 2VN9A 2HZ4A 4NU1A 2X39A 2IN6A 4BRXA 4BWXA 4D2PA 4DEGA 3ZONA 5AA8A 3QWJA 4IZ5A 4EOPA 4FJVA 2VTAA 4DHIB 4N4SA 4RWLA 3MVHA 3VO3A 4NSTA 4H3QA 2BCJA 3B8RA 5FP5A 5ANOA 3JR1A 5FUTA 3TZ8A 4QO9A 5L2TA 4TYHB 4L46A 3GEQA 4NJ3A 2I7QA 2J7TA 3TMOA 2QI8A 4W8EA 4AZSA 3V6SA 4BKYA 3FI8A 4J52A 3NUPA 4D5HA 4BTMA 3C50A 2ITXA 3CLYA 2CKQA 3LFQA 5CNOA 2ZB0A 4O7WA 4JRNA 4HCUA 2C5VA 1G8SA 1H08A 2XS0A 5DR6A 2J9MA 1GNGA 3I7BA 4YZMA 4LUDA 3AC5A 1KOAA 3BU6A 4LMNA 2VZ6A 2XUUA 3FY0A 5BVEA 4CVAA 2BDWA 4QT1A 4YU2A 4DA5A 4JS8A 5TKDA 4X0MA 3BYVA 5K4IA 4FX3A 3P08A 1B6CB 1GZKA 3OZ6A 3ZMMA 4ACGA 4C35A 3OC1A 4C4HA 2IW6A 4I4EA 3DLSA 5ETCA 3SKCA 1JOWB 4YSMA 3OCSA 2V22A 4XOZA 2E9UA 3F82A 4BHNA 5L4QA 4XP3A 4I41A 3DK3A 3MH0A 2F2UA 3F3ZA 4S33A 3NSZA 3VBTA 3LAUA 1Y6AA 3PXKA 4EL9A 3Q53A 3VBWA 3W0PA 2CSNA 4CNHA 3JYAA 3LCSA 3ATSA 1XBCA 3LQ3A 4DCEA 4RIYB 3ZSHA 1SNUA 2IZUA 3NYXA 4G5PA 4NEUA 4DHZA 3HV3A 3KRRA 4DH7A 4E3CA 5TE0A 1YDRE 3FV8A 4O82A 5J95A 1YI3A 4GJ3A 3WE4A 2X0OA 3W2OA 3A8WA 3EFKA 3W0NA 4FSZA 1YHSA 4DBXA 4K33A 4FV4A 3A60A 4GUEA 2XAMA 3Q4UA 5CAOA 3F7ZA 1CKIA 1FMOE 4E5AX 5KCVA 2CPKE 4UWYA 1HOWA 4PMTA 5E8XA 5M4CA 1J7IA 3R2YA 4XV2A 3VBVA 4I94A 1YWRA 5HQ0A 3PDTA 2GNIA 3D7ZA 4U41A 4YJUA 3UVQA 2Q0BA 2XYNA 2WU7A 3QCQA 4DF3A 1NVSA 3CR0A 4PPBA 2CLXA 3I81A 3AD4A 4G34A 1M2RA 2EWAA 4WNOA 3UDBA 4NM0A 4YJTA 4EC8A 3QTXA 3MW1A 3OTUA 4TWPA 5A3XA 5A14A 4LG4A 1ZMWA 4QMYA 1XHAA 4YZCA 4EORA 1J7UA 5AP1A 5H9BA 1IAJA 3FMLA 2ITNA 1GZ8A 3MFRA 3VS7A 4EHZA 3KCKA 4MAOA 5GINE 3TL8A 3VJNA 4I3ZA 2P2IA 1W2FA 4IFGA 2O65A 3ZFXA 3QD2B 4YZBA 4FA2A 4CKJA 3RMFA 4E26A 3A99A 3ZLWA 5GZ8A 2YM4A 1OBDA 3RVGA 3L8VA 4FC0A 4RIWB 4L44A 3U9CA 3DBFA 4MD8E 1W83A 5L2IA 1YHWA 4BCKA 3LFDA 3EFJA 1ST0A 4H1JA 4USDA 5CU3A 3QXOA 3OWPA 5A4QA 4IM2A 5BMMA 4FIEA 5LVMA 1H4LA 2VTQA 2RIOA 2W1ZA 3VS1A 4C58A 3AKJA 5AIKA 4O96A 4YHTA 2OIQA 4NUSA 3BZ3A 2OK1A 1U4DA 3UC4A 3EWHA 5E8WA 2REIA 4HGTA 5BPYA 4BCPA 5AR8A 4L53A 3DKCA 3KRXA 3OF0A 3DXNA 4XG2A 2B1PA 2NP8A 4NL0A 1H0WA 3A2CA 3EKNA 2XVDA 1YI4A 2RSVA 4YBKA 3ZRMA 1GIIA 2OG8A 2P0CA 4ITJA 2UZLA 2IJMA 3LIJA 2J90A 3QUPA 4WA9A 3PIYA 2XEZA 1YRPA 4QMQA 2O63A 3E7VA 4M84A 4O0RA 4RWJA 3TG1A 4OLIA 2XKCA 3OBJA 1W0XC 4QMOA 3TJDA 1ZYSA 3U6HA 2RFNA 4EJNA 3D2KA 3EQDA 5BVKA 4QQJA 2YISA 4FTMA 3F5UA 1KOBA 4G16A 3HRCA 5AR4A 3UIUA 4F9WA 3BEAA 4QMTA 3EHAA 4QMNA 5HORA 5CU6A 4FYOA 3P7AA 3U4WA 2WELA 5EYMA 4PTCA 2VTIA 1UU3A 4R1YA 4BCMA 4QMLA 5CVGA 4ZOGA 2ZV9A 2YA9A 4BR3A 2PY3A 4WOVA 2X9EA 3FI4A 2CN5A 4TT7A 5EK7A 3NEWA 5FXRA 2UW3A 2VO6A 5K0XA 5I3RA 2ZV2A 4D2RA 4IX6A 3VS2A 4JOAA 3O96A 4IWQA 5FRIA 5K4JA 3R9NA 4O86A 3B2WA 4TKSA 4C34A 3MFUA 3OXIA 5A4EA 3NYVA 4JDIA 3FUPA 5DGZA 5FDXA 2CGXA 2WMRA 4LL5A 4TWOA 3K3IA 3P0MA 4BN1A 2I0YA 2UW7A 3PRIA 4FT0A 3IK3A 4RGJA 5JGBA 4RX5A 3ZBXA 5HZNA 4ZY6A 3BELA 5IQDA 4QRCA 4FKQA 4XEYA 3MDYA 3UVRA 3EB0A 3ORKA 3FL4A 3QRUA 3VUIA 3O5AA 4JT3A 2HZIA 1YW2A 2YACA 4F6UA 4M69B 2NYAA 3P4KA 3QD4A 3ML1A 4MQ2A 1VYZA 4JDHA 5EKOA 3LMIA 1PY5A 1E9HA 3O71A 2OGVA 3EN7A 4B4LA 4PTGA 3VUTA 1MP8A 3RPOA 3DTWA 3KK9A 2R7BA 3G33A 3UBDA 4DBNA 4O7YA 1YHVA 5AUWA 5M4FA 2G01A 3ALNA 5CAPA 2WFYA 4X3JA 3GCQA 4WSQA 4B8LA 1DS5A 1HCLA 4FZ7A 3EQGA 1YQJA 2X2KA 3IW4A 3NGAA 4IANA 4CT2A 3TNWA 1A9UA 3IKAA 4KS7A 3I5ZA 5KBQA 4OTQA 4CFMA 3IGGA 4U0IA 4FE2A 5T68A 4BCNA 3HRFA 5M06A 1YOLA 2FSTX 2PE0A 3BQCA 2YM3A 2WU6A 4LV8A 4TNBA 4UWBA 3DBQA 4DEAA 2HXLA 4HGLA 3W8QA 4RRVA 4J53A 3V5TA 1OKWA 1WVXA 4OTIA 4YURA 3HV6A 5FXQA 5BYYA 4BI0A 4D55A 4JG6A 3UIBA 4IH8A 2UW0A 2WGJA 4UMUA 5LMBA 4KA3A 3GBZA 1OIQA 2JITA 3RK7A 1H1PA 3A61A 4BDBA 4FTUA 5CEIA 3FXZA 3NW7A 4YSJA 4XG8A 4O6LA 5T3QA 4NTSA 3G0EA 1K2PA 2PL0A 4O38A 5A4LA 3W0OA 3Q4TA 4GYGA 2YIQA 3FQSA 3D5VA 2YWPA 3BV3A 3K5VA 4DFNA 3PVUA 3QRIA 1RE8A 1TQIA 4KBAA 5DWRA 4AGWA 2HXQA 3DAEA 4O7ZA 2R3FA 5FGKA 4X3FB 3K54A 4AW1A 5DNRA 3QUEA 1H01A 4LUEA 3VONA 4G6NA 5JMSA 2XJ0A 3UPXA 4ZJJA 5EQEA 3ACJA 1U54A 5JQ5A 5C01A 4CCUA 5TR6A 5D7AA 4FV1A 2RG5A 4LI5A 4WRSA 4DN5A 3FPQA 1JSUA 4XJ0A 4ANMA 3TKUA 3Q9YA 4J8MA 3VN9A 3OT8A 3NFFB 3D9VA 1M52A 1BMKA 2A19B 4LV5A 4QP6A 3R7OA 5I9ZA 4G17A 3VUGA 4MNEB 5EDRA 5LWNA 3KB7A 4FTLA 3M2WA 5HNIX 3FC2A 4FL1A 4YO6A 3BYMA 5C4KA 4EKKA 2YZAA 1ST4A 4C36A 4O4DA 4K1BA 4LOOA 3VS3A 3KY2A 3MH2A 4GG5A 2OZAA 4BBMA 4WG5A 3UDSA 4ITHA 3B8QA 3R30A 4BZNA 3UTOA 5DN3A 3BHVA 4QQTA 3U6IA 4FIIA 4QMPA 1Y6BA 4QNAA 2WTCA 2E9VA 3AT2A 3ZUTA 3GUBA 4BCQA 5IDNA 1KE6A 5AP2A 4LV7A 3TI1A 4FTTA 3ZZEA 4EQMA 4EHEA 3V01A 3EFWA 1DAWA 4QP3A 3CQWA 3LCOA 4YP8A 3UPZA 3ZO2A 4DCAA 3E8NA 1DM2A 3ROYA 3ORLA 1ZOHA 4JR7A 2OXDA 2WHBA 3H0ZA 5AR7A 3PSBA 4USEA 3OWLA 4L3PA 2OXYA 4O81A</