3X00A

Crystal structure of the core streptavidin mutant v212 (y22s/n23d/s27d/s45n/y83s/r84k/e101d/r103k/e116n) complexed with bis iminobiotin long tail (bis-imntail) at 1.3 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
124
Chain Sequence
b'GSAEAGITGTWSDQLGDTFIVTAGADGALTGTYENAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNSKNAHSATTWSGQYVGGADAKINTQWLLTSGTTNANAWKSTLVGHDTFTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Structure-based design and synthesis of a bivalent iminobiotin analog showing strong affinity toward a low immunogenic streptavidin mutant
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin binding protein
total genus 28
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 3x00A00
2RTNB 1SWTA 5JD2A 3WZNA 2GH7A 5IRWA 2IZGB 4GJVA 3RE5A 3WZOA 2RTDB 1N7YA 4BX7B 2RTLA 2Y3EA 1SREA 1SWKA 1LELA 2IZCB 2IZDB 2RTEB 4EKVA 1Y52X 1SRFA 3RDMA 1LDOA 3WZQA 4JNJA 1SLGB 2RTFB 4BCSA 4BX5A 4JO6A 5K68A 1HXZA 1LUQA 1VWFB 4U46A 3RE6A 2OF9A 2RTGB 4GDAA 1SWUA 1SWJA 2UYWA 1DF8A 1RAVA 2RTHB 5IRUA 3RDXA 2IZJA 3VHHA 2RTQB 2RTPB 1SLDB 4CPEA 2WPUA 1SWQA 2F01A 2C4IA 1VWBB 1SRIA 1VWNB 5F2BA 3T6FA 3EW1A 1VWHB 4GGRA 4CPFA 5IRAA 1MK5A 3PK2A 4Z27A 1HXLA 4GD9A 1RXHA 1SLFB 3WYPA 2BC3A 4BX6A 1RXJA 2IZIA 1SWNA 4BX5B 1KL4A 1RXKA 3T6LA 1KFFA 4CPIA 2OF8A 1SWPA 1N43A 1NC9A 2OFAA 1KL3A 5K67A 3SZIA 1SWBA 1SWGA 2A5BA 2RTRB 1Y55X 2QCBA 3RY2A 3SZHA 1AVDA 1VWCB 3MG5A 4IRWA 2AVIA 2ZSCA 2RTCB 5B5GA 1SWDA 3RDOA 1IJ8A 1VYOA 2IZHB 1VWOB 2RTIB 5CHKA 1VWGB 1SWEA 1SWLA 4BJ8A 1STSB 4GGTA 4OKAA 2G5LA 2RTAA 3RDQA 3WZPA 1RSTB 4GJSA 1LCWA 2Y3FA 1VWPB 1HQQA 1SRHA 1VWAB 3X00A 1I9HA 4BX6B 1MM9A 1VWEB 2RTMA 2IZKA 4Z2VA 1STPA 3VGWA 1VWIB 3RY1A 4CPHA 3VHMA 1MOYA 1N9MA 3EW2A 1VWQB 4BBOA 4DNEA 4Z6JA 1NQMA 1SRJA 1KL5A 1SWOA 3RDSA 4YVBA 4Z28A 1SRGA 1SWHA 2FHNX 3MM0A 1MEPA 1SWFA 1VWKB 3T2WA 1VWRB 2IZAA 3T2XA 1VWLB 1LDQA 4Y5DA 1SWSA 4JHQA 1NDJA 3SZJA 1STRB 1AVEA 1N9YA 4I60A 3RDUA 2OFBA 5B5FA 1RSUB 2RTBB 5L3YA 1VWMB 1NQNA 3VHIA 2C1SA 1N4JA 4CPHB 1VWDB 3FDCA 2IZBA 1HY2A 1LCZA 4Z2OA 2RTKA 1NBXA 2UZ2A 1SLEB 2IZLB 4GGZA 1WBIA 4BX7A 5CSEA 2RTJA 2MF6A 2FHLA 2Y32A 1SWAA 2IZFB 1PTSA 4Z2PA 3WYQA 1SWRA 2A5CA 1SWCA 2C1QA 1Y53X 1LCVA 2IZEB 2A8GA 1VWJB 4Y59A 2RTOB 2CAMA 2JGSA
chains in the Genus database with same CATH superfamily
2JW1A 2RTNB 3WZNA 4N7CA 5JR8A 2X8TA 1UREA 2Q2PA 5HTDA 2OVSA 3RE5A 2FTBA 5AQ6A 5H9LA 2RTDB 4MVIA 4BX7B 1SREA 1SWKA 4ORYA 1MX8A 2IZDB 4YKOA 2RTEB 3NQ3A 4EFGA 3KZAA 1OEJA 4EKVA 4O3ZA 1SRFA 3PQUA 3AUMO 4CDFA 2X32A 1TOWA 3EBKA 2DJFA 2RTFB 4JNJA 4OMWA 5D45A 4BGFA 2LKKA 4YFQA 1K3BA 3I17A 1LUQA 1IFBA 3GAQA 2OF9A 2G78A 3ZW2A 1HMTA 1SWJA 2OVEA 1TW4A 2Q4NA 1KT6A 4L3RA 1YP7A 4MVLA 1X8QA 2JU8A 4ZGUA 5LJKA 3MVFA 2A2UA 2WPUA 4GH7A 2C4IA 2A2GA 3UEUA 1NP1A 1KGLA 4KIIA 1PEEA 3T1DA 1BLRA 4GGRA 3ELXA 2AH7X 4CPFA 1YIVA 1Z24A 3FEKA 3U9PC 4XMCA 4CSBA 1B4MA 5AJBA 4Y0PA 5H9NA 4ZFXA 4QYPA 1KT7A 3PDFA 2MHDA 2GTLO 1DFVA 4GE1A 1UYNX 3EM0A 4YH0A 3RBYA 4BX5B 1N43A 5EDBA 5KHPA 1NC9A 1TXLA 1GX9A 1FE3A 3HOEA 3WJFA 2AF5A 4MEEA 4CV7A 3NP1A 3Q34A 4RUNA 1LIEA 4GKCA 3UAQA 1P6PA 1PBOA 2M4LA 4Y0QA 5HCEC 5HWZA 1E06A 4FBVA 1YUPA 2AKQA 2L67A 4GNYA 5D47A 3ZUIA 2AVIA 2F09A 3HOLA 1KQWA 1VYFA 2QO6A 1EPAA 4D6BA 1VYOA 5CHKA 1VWOB 2ANSA 1KZXA 1I78A 2WWPA 1I06A 2EU7X 5HA0A 3RDQA 2RTAA 5L8NA 4GJSA 3P6EA 1GT5A 3BDRA 1LCWA 3WJDA 1IW2A 4TNNA 2CBRA 2KD2A 1SRHA 3VE1A 5IO5A 3DTQA 3ZWEA 1G74A 4BX6B 3BSZE 5IO7A 1JYDA 2FWVA 1KQXA 2NP1A 1VWIB 2GTLM 2LA7A 4LKTA 1HMRA 1OBQA 2BHVA 4DNEA 1JZUA 2WEXA 3KQ0A 3NR3A 1XCAA 3CKFA 3OD9A 5F6BA 1X8PA 1JJUA 3ZW0B 1YWBA 2GC9A 4I9RA 4C5PA 2KT4B 2X8FA 5D8JA 1EPBA 2AT3X 3MM0A 3OE3A 5BVSA 4CDCA 1OBUA 3P02A 2E4JA 2IZAA 3T2XA 1LF7A 5HCDC 1D2UA 1HBQA 3PH5A 2FLJA 2PY1A 3JQOA 2QO4A 1GKAB 3HTYA 2OFBA 1HN2A 2RTBB 5AEOA 1NQNA 2Q2MA 3RWXA 2OL6O 5LJHA 1HY2A 3NX2A 2QM9A 4IMOA 1UYOX 3D97A 4IB8A 3WJGA 5B29A 5KIDA 5EEEA 2NNDA 4U9CA 4YCEA 3RZYA 3ZUOA 2X56A 4GGZA 1QY2A 4LKPA 4MIRA 3WJCA 1O1VA 1BM5A 4BVMA 2RTJA 3D95A 2LBAA 5FENA 1ZRYA 1FJ1E 3O2YA 3JSQA 4QQ1A 1SWAA 5BVQA 1BSOA 1GT1A 2JOZA 5F6ZA 3FW4A 4GUZA 3B2LA 2MM3A 3H3IA 1DZJA 2OY1O 4OS3A 1T68X 4PSQA 5B11O 4CK4A 1S2PA 5H9AA 1O8VA 3FA7A 4AZNA 1ADLA 1SY0A 2CAMA 4COTA 3E3CA 5BYPA 3CR6A 2AMMX 3RKGA 5JD2A 4A1YA 2O62A 2HZQA 2RCTA 1GGLA 2GH7A 2XSTA 1DV9A 3JS1A 1EXSA 3MX7A 3O22A 1KOIA 4DQ3A 3PH6A 3EBWA 3O19A 1Y0GA 4YGHA 2IZCB 3LV4A 1E00A 2F73A 4MVKA 5H9KA 2JMBA 1ALBA 2X45A 1Y52X 2W2BA 3FR4A 1LDOA 3WZQA 4BCSA 1KXOA 5EEDA 5HZ6A 3D96A 2OVDA 4AW8A 5B10O 2BT9A 1VWFB 4XMHA 4GDAA 3TZSA 4QRLA 1LIBA 4KC8A 3KFHA 3FR2A 3SLOA 1IIUA 2L9CA 4IAXA 1DF8A 1RAVA 2RTHB 5EPQA 4GDZA 4IMNA 2QO5A 2RTPB 2DM5A 4CPEA 1QQSA 2BSZA 4DQ4A 2LB6A 3VG7A 1VWBB 1SRIA 4XMFA 2RN4A 2HYSA 3APWA 2KW1A 1VWHB 5FQ7E 1AELA 4O49A 4OS0A 1CBSA 2I5VO 4XMDA 1SXWA 2GTFX 1O1UA 1QY0A 2P8GA 1NP4A 2KTSA 1SLFB 3WYPA 1H91A 2BC3A 1RXJA 4O3XB 4QGVA 2IZIA 1SWNA 3FW5A 4TJZA 5F58A 4YMYA 3EMMA 3HWEA 4CPIA 4KT5A 3TGBA 4IB9A 1IKJA 5FQ6E 1CBIA 5FAZA 4IB7A 1KL3A 4UU2A 1SA8A 2WUTA 3BS2A 2JU3A 3WXQA 1B0OA 1ZNLA 4ZHHA 5IO6A 1D3SA 1Y55X 3RY2A 3K3LA 3MBTA 4O9SA 2ZSCA 3VPJE 5B5GA 3RDOA 2VDFA 1YWAA 4A60A 2RA6A 4HPDA 3F6ZB 4QYNA 1EUOA 1TVQA 1SWLA 2L68A 1SXUA 3I0AA 2ZAIA 4GGTA 4OKAA 3S26A 3F9DA 3WZPA 3ZW1B 3B2IA 5LJGA 2BS5A 3BX7A 1U18A 1CBRA 3C77X 2Y3FA 3CBSA 3AKMA 1VWAB 1N0SA 2FGSA 4OMXA 4QGXA 1VWEB 2IZKA 4NYQA 1STPA 3KFIA 3FIQA 3RY1A 2X8SA 4ZH6A 4CPHA 2KTDA 3U03A 3U0DA 1LFOA 3VHMA 3QQ2A 3BRNA 3EW2A 1A2DA 3FEPA 3FYFA 5AJCA 2OFMX 2CM9A 2G79A 2OZQA 4PJ2A 2OVAA 2R74A 1NQMA 4FGIB 3NADA 1SWOA 3RDSA 4Z28A 4TKJA 1FENA 5HZQA 2ACPX 3SAOA 3SLTA 1KT4A 2RD7C 3D9WA 3LTWA 1X71A 4YDAA 3ZQ3A 4FBOA 3APVA 1VWLB 1LDQA 2ASNX 5C0NA 3FMZA 2R73A 1NDJA 3ELZA 1AVEA 4R0BA 3UEXA 2WR6A 3UEVA 1PM1X 1LICA 4ZHDA 1RBPA 1RSUB 4ZR2A 1HBPA 1ICNA 3D4RA 5L3YA 2OY8A 4GZVA 5HZ5A 1ZNKA 1ML7A 1VWDB 2IZBA 3CKGA 3FDCA 4DCBA 5EZ2A 1K24A 1SMPI 1CRBA 1MUPA 1LCZA 2GJ5A 3BX8A 1YWDA 3VE2A 1PBYA 2A3FX 1WBIA 4ON1A 1FELA 2LBVA 4BX7A 3NX1A 2FR2A 4U3QA 4ORRA 3TGAA 3PQSA 1I4UA 4I3DA 2Y32A 4B55A 1IFCA 2IZFB 4BOEA 4M6SA 4Z2PA 1GX8A 2A5CA 1SWCA 5LJDA 2C1QA 2K62A 4FBRA 1DF3A 4M7MA 1DZMA 2A8GA 2FR3A 2NNEA 4JGLA 3V8UA 1VWJB 2RCQA 3C78X 1JYJA 3SZJA 2AL0X 4EDEA 4N7DA 4WHIA 3Q6LA 1LPJA 1SWTA 4YBPA 1KT5A 5HA1A 5HTEA 3FR5A 4HWMA 4YFPA 2G7BA 4QNIA 4MISA 1ZNHA 1SY1A 2Q9SA 1YP6A 3APUA 4U8UN 4UU3A 5BVTA 1W6FA 1OEEA 3F8AA 3FA8A 4K19A 5H8TA 1LKEA 2RTLA 2Y3EA 3P6DA 4LZUA 4O4SA 1LELA 4Y0RA 1OPAA 3SOTA 4NYRA 3STMX 3HWGA 2RQ0A 4ID2A 4YDBA 5DG4A 2OL7A 1SLGB 1Y9TA 2CZUA 5B27A 4BX5A 3DSZA 3HPEA 4JO6A 1HXZA 4QZTA 3BU9A 2CZTA 2OFRX 4O4XA 4U46A 5F7GA 1UZ2X 1B56A 1FDQA 2QOMA 1BJ7A 2UYWA 4IB6A 3VHHA 2A13A 3FENA 1MX7A 1OSPO 1SWQA 4LQZA 4KC7A 5F2BA 1VWNB 1A57A 4QAEA 2ALLX 2WQ9A 2CM4A 4AZOA 5IRAA 1MK5A 3PK2A 4AZQA 1HXLA 2QMIA 4GD9A 1ACDA 1IKEA 1RXHA 2G8CO 1ZNDA 2AT5X 2X55A 3P6GA 4HPBA 4MVEA 4YKMA 4BQUA 4BX6A 1I04A 3FLLA 2OF8A 1SWPA 2VFBA 1VPRA 3FELA 2WQAE 2X4MA 4NLJA 4ODDA 5CE4A 2OFAA 5HBSA 3SZIA 4EQAC 3ZI8A 2A5BA 4ES7A 2QCBA 3LHNA 4OEMA 3ZW0A 1VWCB 4GRJA 2NNQA 3B2KA 2AT6X 1QG5A 1SWDA 2RTCB 4NW4A 3L4RA 4ZGFA 2IZHB 4L1NA 1VYGA 1VWGB 1FEMA 4TKHA 4BJ8A 1X8NA 1STSB 4AZPA 1RSTB 2BLGA 1OPBA 3VG6A 4U8UO 1VWPB 2FS6A 1GKAA 4GNWA 1QFVA 2WEWA 1MM9A 5LKEA 2ACOA 3C76X 3VGWA 2FKGA 1A3YA 5HZ8A 4I9SA 1GT4A 4NNTA 5B3MO 1TOUA 4CDDA 2WSJA 2IFBA 1PMPA 1MOYA 1T8VA 2VFCA 4A8ZA 3PECA 3CBCA 3NQKA 4Z6JA 2MJIA 4YVBA 4ZCBA 1SRGA 4ZJ0A 1W5RA 4LZVA 1S44A 4O4OA 4HPAA 5B2AO 4ZHGA 1VWKB 2ZAGA 1EW3A 1VWRB 4I95A 5EDCA 3T2WA 1MVGA 3UEWA 1U17A 3IA8A 1SWSA 3NPOA 1ERBA 4EXZA 5LJCA 3S5XA 1STRB 1BSYA 1N9YA 2K23A 2JN3A 1SXXA 3RDUA 4YGZA 4U8UM 5B5FA 3VHIA 1N4JA 3P24A 5HCCC 1GT3A 1JMXA 5HAEA 4A1HA 2RTKA 2X34A 1NBXA 2UZ2A 1ERXA 1SLEB 2IZLB 1DC9A 3BU1A 4AZMA 2FS7A 1WUBA 1RLBE 2MF6A 4ALOA 1PTSA 1BBPA 3KFFA 2XKLA 3P6FA 5IXGA 2HNXA 1BSQA 4WFUA 4I3CA 2QOSC 2LFOA 1Y53X 3HK1A 3BY0A 1G5WA 2IZEB 5L8IA 5KICA 1ZNGA 3CWKA 2RTOB 3APXA 1BRPA 4INNA 2JGSA 1HQPA 1KZWA 2YG2A 1JBHA 2AT8X 4WBKA 5IRWA 1EI5A 1JMZA 2A0AA 4ORXA 2HMBA 4EEJA 2IZGB 2OL8O 4GJVA 3WZOA 1G85A 2W2FA 4O4UA 3P6CA 3SLJA 1N7YA 2OY7A 2FKJA 1AVGI 4AYHA 2Z4IA 1JQPA 1ZNEA 5FFHA 4ZHFA 4NP1A 3RDMA 1SY3A 1QWDA 3FA6A 1BRQA 3ZZVA 4KCAA 1I05A 1KT3A 1CJ5A 4ARHA 1W4TA 3HWFA 2L5PA 5K68A 1EALA 2POAA 3TGCA 3RE6A 2RTGB 1T0VA 4ZHCA 1SWUA 3STKA 5L8OA 3VG2A 3RDXA 3FA9A 5IRUA 2IZJA 4GETA 3WBGA 3WJEA 3S60A 2RTQB 1S7DA 1SLDB 1MDCA 3BLGA 4HFOA 4I3BA 5DPQA 3VG5A 4D6AA 2F01A 1JJJA 4TKBA 4IABA 4YCHA 1NGLA 3CMPA 3ZW1A 3EW1A 3T6FA 2AT0X 5F1EA 5CYBA 5HZ9A 5K06A 1AQBA 4NLIA 4AZRA 3NQ9A 1KL4A 1RXKA 4YBUA 1KFFA 3NBXX 4Y0SA 3T6LA 1JJXA 3VG3A 4GU8A 2FRSA 5K67A 3HWDA 1SWBA 1SWGA 3B2JA 3OBLA 2RTRB 1B8EA 4TQ2A 1BEBA 4NV7A 3EC5A 3KFGA 3SZHA 1OBPA 1AVDA 3MG5A 4IRWA 4YFRA 2HZRA 1AB0A 4QZUA 1LIFA 4ML7B 1IJ8A 2RTIB 3CQNA 1SWEA 2G5LA 3PP6A 3TF6A 4XMGA 4ORWA 3AKNA 4IBAA 1HQQA 1R0UA 5D48A 2JU7A 1I9HA 3WJBA 3X00A 3WOVA 4YGGA 4ORUA 2RTMA 4QGWA 4Z2VA 3EYCA 5LKFA 3B2HA 4O3WA 2YMSA 1X89A 1DZPA 3VG4A 1N9MA 1SY2A 1VWQB 4NV8A 2W2AA 4BBOA 1QFTA 1E02A 3P6HA 1EQDA 5LJBA 1SRJA 1GXAA 1KL5A 1Y9LA 3OJYC 5D4AA 1GM6A 1X8UA 1SWHA 1A18A 2FHNX 1E2TA 3PPTA 1GX3A 1MEPA 1OEKA 2MWHA 1SWFA 2HLVA 2N93A 2FT9A 1XKIA 1EIIA 4Y5DA 3STNA 4JHQA 1JV4A 3FIDA 2DJGA 1X8OA 4I60A 2OYBO 4FQBB 4ALBA 5LJEA 3VU1A 1YWCA 4ZH9A 1ICMA 1VWMB 4GK9A 2C1SA 1G7NA 4XMEA 2Q39A 4CPHB 4NNSA 4RUUA 4OS8A 4O3YA 4TLJA 1QABE 4Z2OA 3G7XA 2MO5A 1EIOA 2BS6A 1QY1A 5CSEA 1U0XA 2GTLN 3WVMA 1LIDA 2HKDA 3GE2A 1DZKA 1SXYA 1JIWI 1FTPA 1L6MA 2FHLA 3AEHA 4IAWA 4KH8A 2Z4HA 1SWRA 2PI3O 2R56A 1HMSA 4HPCA 3CQRA 4I6SA 2OY5O 3WYQA 4Z27A 1BWYA 3KVNA 4ORSA 5FQ8E 1LCVA 2CBSA 2X46A 1E5PA 3IFBA 3N91A 3PEDA 1CBQA 3QKGA 3S5VA 2I5ZO 4Y59A 4CDEA 1LNMA 3RSWA 4WFVA 4OELA
chains in the Genus database with same CATH topology
2RTNB 1SWTA 5JD2A 3WZNA 2GH7A 5IRWA 2IZGB 4GJVA 3RE5A 3WZOA 2RTDB 1N7YA 4BX7B 2RTLA 2Y3EA 1SREA 1SWKA 1LELA 2IZCB 2IZDB 2RTEB 4EKVA 1Y52X 1SRFA 3RDMA 1LDOA 3WZQA 4JNJA 1SLGB 2RTFB 4BCSA 4BX5A 4JO6A 5K68A 1HXZA 1LUQA 1VWFB 4U46A 3RE6A 2OF9A 2RTGB 4GDAA 1SWUA 1SWJA 2UYWA 1DF8A 1RAVA 2RTHB 5IRUA 3RDXA 2IZJA 3VHHA 2RTQB 2RTPB 1SLDB 4CPEA 2WPUA 1SWQA 2F01A 2C4IA 1VWBB 1SRIA 1VWNB 5F2BA 3T6FA 3EW1A 1VWHB 4GGRA 4CPFA 5IRAA 1MK5A 3PK2A 4Z27A 1HXLA 4GD9A 1RXHA 1SLFB 3WYPA 2BC3A 4BX6A 1RXJA 2IZIA 1SWNA 4BX5B 1KL4A 1RXKA 3T6LA 1KFFA 4CPIA 2OF8A 1SWPA 1N43A 1NC9A 2OFAA 1KL3A 5K67A 3SZIA 1SWBA 1SWGA 2A5BA 2RTRB 1Y55X 2QCBA 3RY2A 3SZHA 1AVDA 1VWCB 3MG5A 4IRWA 2AVIA 2ZSCA 2RTCB 5B5GA 1SWDA 3RDOA 1IJ8A 1VYOA 2IZHB 1VWOB 2RTIB 5CHKA 1VWGB 1SWEA 1SWLA 4BJ8A 1STSB 4GGTA 4OKAA 2G5LA 2RTAA 3RDQA 3WZPA 1RSTB 4GJSA 1LCWA 2Y3FA 1VWPB 1HQQA 1SRHA 1VWAB 3X00A 1I9HA 4BX6B 1MM9A 1VWEB 2RTMA 2IZKA 4Z2VA 1STPA 3VGWA 1VWIB 3RY1A 4CPHA 3VHMA 1MOYA 1N9MA 3EW2A 1VWQB 4BBOA 4DNEA 4Z6JA 1NQMA 1SRJA 1KL5A 1SWOA 3RDSA 4YVBA 4Z28A 1SRGA 1SWHA 2FHNX 3MM0A 1MEPA 1SWFA 1VWKB 3T2WA 1VWRB 2IZAA 3T2XA 1VWLB 1LDQA 4Y5DA 1SWSA 4JHQA 1NDJA 3SZJA 1STRB 1AVEA 1N9YA 4I60A 3RDUA 2OFBA 5B5FA 1RSUB 2RTBB 5L3YA 1VWMB 1NQNA 3VHIA 2C1SA 1N4JA 4CPHB 1VWDB 3FDCA 2IZBA 1HY2A 1LCZA 4Z2OA 2RTKA 1NBXA 2UZ2A 1SLEB 2IZLB 4GGZA 1WBIA 4BX7A 5CSEA 2RTJA 2MF6A 2FHLA 2Y32A 1SWAA 2IZFB 1PTSA 4Z2PA 3WYQA 1SWRA 2A5CA 1SWCA 2C1QA 1Y53X 1LCVA 2IZEB 2A8GA 1VWJB 4Y59A 2RTOB 2CAMA 2JGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RTN B;  1SWT A;  5JD2 A;  3WZN A;  2GH7 A;  5IRW A;  2IZG B;  4GJV A;  3RE5 A;  3WZO A;  2RTD B;  1N7Y A;  4BX7 B;  2RTL A;  2Y3E A;  1SRE A;  1SWK A;  1LEL A;  2IZC B;  2IZD B;  2RTE B;  4EKV A;  1Y52 X;  1SRF A;  3RDM A;  1LDO A;  3WZQ A;  4JNJ A;  1SLG B;  2RTF B;  4BCS A;  4BX5 A;  4JO6 A;  5K68 A;  1HXZ A;  1LUQ A;  1VWF B;  4U46 A;  3RE6 A;  2OF9 A;  2RTG B;  4GDA A;  1SWU A;  1SWJ A;  2UYW A;  1DF8 A;  1RAV A;  2RTH B;  5IRU A;  3RDX A;  2IZJ A;  3VHH A;  2RTQ B;  2RTP B;  1SLD B;  4CPE A;  2WPU A;  1SWQ A;  2F01 A;  2C4I A;  1VWB B;  1SRI A;  1VWN B;  5F2B A;  3T6F A;  3EW1 A;  1VWH B;  4GGR A;  4CPF A;  5IRA A;  1MK5 A;  3PK2 A;  4Z27 A;  1HXL A;  4GD9 A;  1RXH A;  1SLF B;  3WYP A;  2BC3 A;  4BX6 A;  1RXJ A;  2IZI A;  1SWN A;  4BX5 B;  1KL4 A;  1RXK A;  3T6L A;  1KFF A;  4CPI A;  2OF8 A;  1SWP A;  1N43 A;  1NC9 A;  2OFA A;  1KL3 A;  5K67 A;  3SZI A;  1SWB A;  1SWG A;  2A5B A;  2RTR B;  1Y55 X;  2QCB A;  3RY2 A;  3SZH A;  1AVD A;  1VWC B;  3MG5 A;  4IRW A;  2AVI A;  2ZSC A;  2RTC B;  5B5G A;  1SWD A;  3RDO A;  1IJ8 A;  1VYO A;  2IZH B;  1VWO B;  2RTI B;  5CHK A;  1VWG B;  1SWE A;  1SWL A;  4BJ8 A;  1STS B;  4GGT A;  4OKA A;  2G5L A;  2RTA A;  3RDQ A;  3WZP A;  1RST B;  4GJS A;  1LCW A;  2Y3F A;  1VWP B;  1HQQ A;  1SRH A;  1VWA B;  3X00 A;  1I9H A;  4BX6 B;  1MM9 A;  1VWE B;  2RTM A;  2IZK A;  4Z2V A;  1STP A;  3VGW A;  1VWI B;  3RY1 A;  4CPH A;  3VHM A;  1MOY A;  1N9M A;  3EW2 A;  1VWQ B;  4BBO A;  4DNE A;  4Z6J A;  1NQM A;  1SRJ A;  1KL5 A;  1SWO A;  3RDS A;  4YVB A;  4Z28 A;  1SRG A;  1SWH A;  2FHN X;  3MM0 A;  1MEP A;  1SWF A;  1VWK B;  3T2W A;  1VWR B;  2IZA A;  3T2X A;  1VWL B;  1LDQ A;  4Y5D A;  1SWS A;  4JHQ A;  1NDJ A;  3SZJ A;  1STR B;  1AVE A;  1N9Y A;  4I60 A;  3RDU A;  2OFB A;  5B5F A;  1RSU B;  2RTB B;  5L3Y A;  1VWM B;  1NQN A;  3VHI A;  2C1S A;  1N4J A;  4CPH B;  1VWD B;  3FDC A;  2IZB A;  1HY2 A;  1LCZ A;  4Z2O A;  2RTK A;  1NBX A;  2UZ2 A;  1SLE B;  2IZL B;  4GGZ A;  1WBI A;  4BX7 A;  5CSE A;  2RTJ A;  2MF6 A;  2FHL A;  2Y32 A;  1SWA A;  2IZF B;  1PTS A;  4Z2P A;  3WYQ A;  1SWR A;  2A5C A;  1SWC A;  2C1Q A;  1Y53 X;  1LCV A;  2IZE B;  2A8G A;  1VWJ B;  4Y59 A;  2RTO B;  2CAM A;  2JGS A; 
#chains in the Genus database with same CATH topology
 2JW1 A;  2RTN B;  3WZN A;  4N7C A;  5JR8 A;  2X8T A;  1URE A;  2Q2P A;  5HTD A;  2OVS A;  3RE5 A;  2FTB A;  5AQ6 A;  5H9L A;  2RTD B;  4MVI A;  4BX7 B;  1SRE A;  1SWK A;  4ORY A;  1MX8 A;  2IZD B;  4YKO A;  2RTE B;  3NQ3 A;  4EFG A;  3KZA A;  1OEJ A;  4EKV A;  4O3Z A;  1SRF A;  3PQU A;  3AUM O;  4CDF A;  2X32 A;  1TOW A;  3EBK A;  2DJF A;  2RTF B;  4JNJ A;  4OMW A;  5D45 A;  4BGF A;  2LKK A;  4YFQ A;  1K3B A;  3I17 A;  1LUQ A;  1IFB A;  3GAQ A;  2OF9 A;  2G78 A;  3ZW2 A;  1HMT A;  1SWJ A;  2OVE A;  1TW4 A;  2Q4N A;  1KT6 A;  4L3R A;  1YP7 A;  4MVL A;  1X8Q A;  2JU8 A;  4ZGU A;  5LJK A;  3MVF A;  2A2U A;  2WPU A;  4GH7 A;  2C4I A;  2A2G A;  3UEU A;  1NP1 A;  1KGL A;  4KII A;  1PEE A;  3T1D A;  1BLR A;  4GGR A;  3ELX A;  2AH7 X;  4CPF A;  1YIV A;  1Z24 A;  3FEK A;  3U9P C;  4XMC A;  4CSB A;  1B4M A;  5AJB A;  4Y0P A;  5H9N A;  4ZFX A;  4QYP A;  1KT7 A;  3PDF A;  2MHD A;  2GTL O;  1DFV A;  4GE1 A;  1UYN X;  3EM0 A;  4YH0 A;  3RBY A;  4BX5 B;  1N43 A;  5EDB A;  5KHP A;  1NC9 A;  1TXL A;  1GX9 A;  1FE3 A;  3HOE A;  3WJF A;  2AF5 A;  4MEE A;  4CV7 A;  3NP1 A;  3Q34 A;  4RUN A;  1LIE A;  4GKC A;  3UAQ A;  1P6P A;  1PBO A;  2M4L A;  4Y0Q A;  5HCE C;  5HWZ A;  1E06 A;  4FBV A;  1YUP A;  2AKQ A;  2L67 A;  4GNY A;  5D47 A;  3ZUI A;  2AVI A;  2F09 A;  3HOL A;  1KQW A;  1VYF A;  2QO6 A;  1EPA A;  4D6B A;  1VYO A;  5CHK A;  1VWO B;  2ANS A;  1KZX A;  1I78 A;  2WWP A;  1I06 A;  2EU7 X;  5HA0 A;  3RDQ A;  2RTA A;  5L8N A;  4GJS A;  3P6E A;  1GT5 A;  3BDR A;  1LCW A;  3WJD A;  1IW2 A;  4TNN A;  2CBR A;  2KD2 A;  1SRH A;  3VE1 A;  5IO5 A;  3DTQ A;  3ZWE A;  1G74 A;  4BX6 B;  3BSZ E;  5IO7 A;  1JYD A;  2FWV A;  1KQX A;  2NP1 A;  1VWI B;  2GTL M;  2LA7 A;  4LKT A;  1HMR A;  1OBQ A;  2BHV A;  4DNE A;  1JZU A;  2WEX A;  3KQ0 A;  3NR3 A;  1XCA A;  3CKF A;  3OD9 A;  5F6B A;  1X8P A;  1JJU A;  3ZW0 B;  1YWB A;  2GC9 A;  4I9R A;  4C5P A;  2KT4 B;  2X8F A;  5D8J A;  1EPB A;  2AT3 X;  3MM0 A;  3OE3 A;  5BVS A;  4CDC A;  1OBU A;  3P02 A;  2E4J A;  2IZA A;  3T2X A;  1LF7 A;  5HCD C;  1D2U A;  1HBQ A;  3PH5 A;  2FLJ A;  2PY1 A;  3JQO A;  2QO4 A;  1GKA B;  3HTY A;  2OFB A;  1HN2 A;  2RTB B;  5AEO A;  1NQN A;  2Q2M A;  3RWX A;  2OL6 O;  5LJH A;  1HY2 A;  3NX2 A;  2QM9 A;  4IMO A;  1UYO X;  3D97 A;  4IB8 A;  3WJG A;  5B29 A;  5KID A;  5EEE A;  2NND A;  4U9C A;  4YCE A;  3RZY A;  3ZUO A;  2X56 A;  4GGZ A;  1QY2 A;  4LKP A;  4MIR A;  3WJC A;  1O1V A;  1BM5 A;  4BVM A;  2RTJ A;  3D95 A;  2LBA A;  5FEN A;  1ZRY A;  1FJ1 E;  3O2Y A;  3JSQ A;  4QQ1 A;  1SWA A;  5BVQ A;  1BSO A;  1GT1 A;  2JOZ A;  5F6Z A;  3FW4 A;  4GUZ A;  3B2L A;  2MM3 A;  3H3I A;  1DZJ A;  2OY1 O;  4OS3 A;  1T68 X;  4PSQ A;  5B11 O;  4CK4 A;  1S2P A;  5H9A A;  1O8V A;  3FA7 A;  4AZN A;  1ADL A;  1SY0 A;  2CAM A;  4COT A;  3E3C A;  5BYP A;  3CR6 A;  2AMM X;  3RKG A;  5JD2 A;  4A1Y A;  2O62 A;  2HZQ A;  2RCT A;  1GGL A;  2GH7 A;  2XST A;  1DV9 A;  3JS1 A;  1EXS A;  3MX7 A;  3O22 A;  1KOI A;  4DQ3 A;  3PH6 A;  3EBW A;  3O19 A;  1Y0G A;  4YGH A;  2IZC B;  3LV4 A;  1E00 A;  2F73 A;  4MVK A;  5H9K A;  2JMB A;  1ALB A;  2X45 A;  1Y52 X;  2W2B A;  3FR4 A;  1LDO A;  3WZQ A;  4BCS A;  1KXO A;  5EED A;  5HZ6 A;  3D96 A;  2OVD A;  4AW8 A;  5B10 O;  2BT9 A;  1VWF B;  4XMH A;  4GDA A;  3TZS A;  4QRL A;  1LIB A;  4KC8 A;  3KFH A;  3FR2 A;  3SLO A;  1IIU A;  2L9C A;  4IAX A;  1DF8 A;  1RAV A;  2RTH B;  5EPQ A;  4GDZ A;  4IMN A;  2QO5 A;  2RTP B;  2DM5 A;  4CPE A;  1QQS A;  2BSZ A;  4DQ4 A;  2LB6 A;  3VG7 A;  1VWB B;  1SRI A;  4XMF A;  2RN4 A;  2HYS A;  3APW A;  2KW1 A;  1VWH B;  5FQ7 E;  1AEL A;  4O49 A;  4OS0 A;  1CBS A;  2I5V O;  4XMD A;  1SXW A;  2GTF X;  1O1U A;  1QY0 A;  2P8G A;  1NP4 A;  2KTS A;  1SLF B;  3WYP A;  1H91 A;  2BC3 A;  1RXJ A;  4O3X B;  4QGV A;  2IZI A;  1SWN A;  3FW5 A;  4TJZ A;  5F58 A;  4YMY A;  3EMM A;  3HWE A;  4CPI A;  4KT5 A;  3TGB A;  4IB9 A;  1IKJ A;  5FQ6 E;  1CBI A;  5FAZ A;  4IB7 A;  1KL3 A;  4UU2 A;  1SA8 A;  2WUT A;  3BS2 A;  2JU3 A;  3WXQ A;  1B0O A;  1ZNL A;  4ZHH A;  5IO6 A;  1D3S A;  1Y55 X;  3RY2 A;  3K3L A;  3MBT A;  4O9S A;  2ZSC A;  3VPJ E;  5B5G A;  3RDO A;  2VDF A;  1YWA A;  4A60 A;  2RA6 A;  4HPD A;  3F6Z B;  4QYN A;  1EUO A;  1TVQ A;  1SWL A;  2L68 A;  1SXU A;  3I0A A;  2ZAI A;  4GGT A;  4OKA A;  3S26 A;  3F9D A;  3WZP A;  3ZW1 B;  3B2I A;  5LJG A;  2BS5 A;  3BX7 A;  1U18 A;  1CBR A;  3C77 X;  2Y3F A;  3CBS A;  3AKM A;  1VWA B;  1N0S A;  2FGS A;  4OMX A;  4QGX A;  1VWE B;  2IZK A;  4NYQ A;  1STP A;  3KFI A;  3FIQ A;  3RY1 A;  2X8S A;  4ZH6 A;  4CPH A;  2KTD A;  3U03 A;  3U0D A;  1LFO A;  3VHM A;  3QQ2 A;  3BRN A;  3EW2 A;  1A2D A;  3FEP A;  3FYF A;  5AJC A;  2OFM X;  2CM9 A;  2G79 A;  2OZQ A;  4PJ2 A;  2OVA A;  2R74 A;  1NQM A;  4FGI B;  3NAD A;  1SWO A;  3RDS A;  4Z28 A;  4TKJ A;  1FEN A;  5HZQ A;  2ACP X;  3SAO A;  3SLT A;  1KT4 A;  2RD7 C;  3D9W A;  3LTW A;  1X71 A;  4YDA A;  3ZQ3 A;  4FBO A;  3APV A;  1VWL B;  1LDQ A;  2ASN X;  5C0N A;  3FMZ A;  2R73 A;  1NDJ A;  3ELZ A;  1AVE A;  4R0B A;  3UEX A;  2WR6 A;  3UEV A;  1PM1 X;  1LIC A;  4ZHD A;  1RBP A;  1RSU B;  4ZR2 A;  1HBP A;  1ICN A;  3D4R A;  5L3Y A;  2OY8 A;  4GZV A;  5HZ5 A;  1ZNK A;  1ML7 A;  1VWD B;  2IZB A;  3CKG A;  3FDC A;  4DCB A;  5EZ2 A;  1K24 A;  1SMP I;  1CRB A;  1MUP A;  1LCZ A;  2GJ5 A;  3BX8 A;  1YWD A;  3VE2 A;  1PBY A;  2A3F X;  1WBI A;  4ON1 A;  1FEL A;  2LBV A;  4BX7 A;  3NX1 A;  2FR2 A;  4U3Q A;  4ORR A;  3TGA A;  3PQS A;  1I4U A;  4I3D A;  2Y32 A;  4B55 A;  1IFC A;  2IZF B;  4BOE A;  4M6S A;  4Z2P A;  1GX8 A;  2A5C A;  1SWC A;  5LJD A;  2C1Q A;  2K62 A;  4FBR A;  1DF3 A;  4M7M A;  1DZM A;  2A8G A;  2FR3 A;  2NNE A;  4JGL A;  3V8U A;  1VWJ B;  2RCQ A;  3C78 X;  1JYJ A;  3SZJ A;  2AL0 X;  4EDE A;  4N7D A;  4WHI A;  3Q6L A;  1LPJ A;  1SWT A;  4YBP A;  1KT5 A;  5HA1 A;  5HTE A;  3FR5 A;  4HWM A;  4YFP A;  2G7B A;  4QNI A;  4MIS A;  1ZNH A;  1SY1 A;  2Q9S A;  1YP6 A;  3APU A;  4U8U N;  4UU3 A;  5BVT A;  1W6F A;  1OEE A;  3F8A A;  3FA8 A;  4K19 A;  5H8T A;  1LKE A;  2RTL A;  2Y3E A;  3P6D A;  4LZU A;  4O4S A;  1LEL A;  4Y0R A;  1OPA A;  3SOT A;  4NYR A;  3STM X;  3HWG A;  2RQ0 A;  4ID2 A;  4YDB A;  5DG4 A;  2OL7 A;  1SLG B;  1Y9T A;  2CZU A;  5B27 A;  4BX5 A;  3DSZ A;  3HPE A;  4JO6 A;  1HXZ A;  4QZT A;  3BU9 A;  2CZT A;  2OFR X;  4O4X A;  4U46 A;  5F7G A;  1UZ2 X;  1B56 A;  1FDQ A;  2QOM A;  1BJ7 A;  2UYW A;  4IB6 A;  3VHH A;  2A13 A;  3FEN A;  1MX7 A;  1OSP O;  1SWQ A;  4LQZ A;  4KC7 A;  5F2B A;  1VWN B;  1A57 A;  4QAE A;  2ALL X;  2WQ9 A;  2CM4 A;  4AZO A;  5IRA A;  1MK5 A;  3PK2 A;  4AZQ A;  1HXL A;  2QMI A;  4GD9 A;  1ACD A;  1IKE A;  1RXH A;  2G8C O;  1ZND A;  2AT5 X;  2X55 A;  3P6G A;  4HPB A;  4MVE A;  4YKM A;  4BQU A;  4BX6 A;  1I04 A;  3FLL A;  2OF8 A;  1SWP A;  2VFB A;  1VPR A;  3FEL A;  2WQA E;  2X4M A;  4NLJ A;  4ODD A;  5CE4 A;  2OFA A;  5HBS A;  3SZI A;  4EQA C;  3ZI8 A;  2A5B A;  4ES7 A;  2QCB A;  3LHN A;  4OEM A;  3ZW0 A;  1VWC B;  4GRJ A;  2NNQ A;  3B2K A;  2AT6 X;  1QG5 A;  1SWD A;  2RTC B;  4NW4 A;  3L4R A;  4ZGF A;  2IZH B;  4L1N A;  1VYG A;  1VWG B;  1FEM A;  4TKH A;  4BJ8 A;  1X8N A;  1STS B;  4AZP A;  1RST B;  2BLG A;  1OPB A;  3VG6 A;  4U8U O;  1VWP B;  2FS6 A;  1GKA A;  4GNW A;  1QFV A;  2WEW A;  1MM9 A;  5LKE A;  2ACO A;  3C76 X;  3VGW A;  2FKG A;  1A3Y A;  5HZ8 A;  4I9S A;  1GT4 A;  4NNT A;  5B3M O;  1TOU A;  4CDD A;  2WSJ A;  2IFB A;  1PMP A;  1MOY A;  1T8V A;  2VFC A;  4A8Z A;  3PEC A;  3CBC A;  3NQK A;  4Z6J A;  2MJI A;  4YVB A;  4ZCB A;  1SRG A;  4ZJ0 A;  1W5R A;  4LZV A;  1S44 A;  4O4O A;  4HPA A;  5B2A O;  4ZHG A;  1VWK B;  2ZAG A;  1EW3 A;  1VWR B;  4I95 A;  5EDC A;  3T2W A;  1MVG A;  3UEW A;  1U17 A;  3IA8 A;  1SWS A;  3NPO A;  1ERB A;  4EXZ A;  5LJC A;  3S5X A;  1STR B;  1BSY A;  1N9Y A;  2K23 A;  2JN3 A;  1SXX A;  3RDU A;  4YGZ A;  4U8U M;  5B5F A;  3VHI A;  1N4J A;  3P24 A;  5HCC C;  1GT3 A;  1JMX A;  5HAE A;  4A1H A;  2RTK A;  2X34 A;  1NBX A;  2UZ2 A;  1ERX A;  1SLE B;  2IZL B;  1DC9 A;  3BU1 A;  4AZM A;  2FS7 A;  1WUB A;  1RLB E;  2MF6 A;  4ALO A;  1PTS A;  1BBP A;  3KFF A;  2XKL A;  3P6F A;  5IXG A;  2HNX A;  1BSQ A;  4WFU A;  4I3C A;  2QOS C;  2LFO A;  1Y53 X;  3HK1 A;  3BY0 A;  1G5W A;  2IZE B;  5L8I A;  5KIC A;  1ZNG A;  3CWK A;  2RTO B;  3APX A;  1BRP A;  4INN A;  2JGS A;  1HQP A;  1KZW A;  2YG2 A;  1JBH A;  2AT8 X;  4WBK A;  5IRW A;  1EI5 A;  1JMZ A;  2A0A A;  4ORX A;  2HMB A;  4EEJ A;  2IZG B;  2OL8 O;  4GJV A;  3WZO A;  1G85 A;  2W2F A;  4O4U A;  3P6C A;  3SLJ A;  1N7Y A;  2OY7 A;  2FKJ A;  1AVG I;  4AYH A;  2Z4I A;  1JQP A;  1ZNE A;  5FFH A;  4ZHF A;  4NP1 A;  3RDM A;  1SY3 A;  1QWD A;  3FA6 A;  1BRQ A;  3ZZV A;  4KCA A;  1I05 A;  1KT3 A;  1CJ5 A;  4ARH A;  1W4T A;  3HWF A;  2L5P A;  5K68 A;  1EAL A;  2POA A;  3TGC A;  3RE6 A;  2RTG B;  1T0V A;  4ZHC A;  1SWU A;  3STK A;  5L8O A;  3VG2 A;  3RDX A;  3FA9 A;  5IRU A;  2IZJ A;  4GET A;  3WBG A;  3WJE A;  3S60 A;  2RTQ B;  1S7D A;  1SLD B;  1MDC A;  3BLG A;  4HFO A;  4I3B A;  5DPQ A;  3VG5 A;  4D6A A;  2F01 A;  1JJJ A;  4TKB A;  4IAB A;  4YCH A;  1NGL A;  3CMP A;  3ZW1 A;  3EW1 A;  3T6F A;  2AT0 X;  5F1E A;  5CYB A;  5HZ9 A;  5K06 A;  1AQB A;  4NLI A;  4AZR A;  3NQ9 A;  1KL4 A;  1RXK A;  4YBU A;  1KFF A;  3NBX X;  4Y0S A;  3T6L A;  1JJX A;  3VG3 A;  4GU8 A;  2FRS A;  5K67 A;  3HWD A;  1SWB A;  1SWG A;  3B2J A;  3OBL A;  2RTR B;  1B8E A;  4TQ2 A;  1BEB A;  4NV7 A;  3EC5 A;  3KFG A;  3SZH A;  1OBP A;  1AVD A;  3MG5 A;  4IRW A;  4YFR A;  2HZR A;  1AB0 A;  4QZU A;  1LIF A;  4ML7 B;  1IJ8 A;  2RTI B;  3CQN A;  1SWE A;  2G5L A;  3PP6 A;  3TF6 A;  4XMG A;  4ORW A;  3AKN A;  4IBA A;  1HQQ A;  1R0U A;  5D48 A;  2JU7 A;  1I9H A;  3WJB A;  3X00 A;  3WOV A;  4YGG A;  4ORU A;  2RTM A;  4QGW A;  4Z2V A;  3EYC A;  5LKF A;  3B2H A;  4O3W A;  2YMS A;  1X89 A;  1DZP A;  3VG4 A;  1N9M A;  1SY2 A;  1VWQ B;  4NV8 A;  2W2A A;  4BBO A;  1QFT A;  1E02 A;  3P6H A;  1EQD A;  5LJB A;  1SRJ A;  1GXA A;  1KL5 A;  1Y9L A;  3OJY C;  5D4A A;  1GM6 A;  1X8U A;  1SWH A;  1A18 A;  2FHN X;  1E2T A;  3PPT A;  1GX3 A;  1MEP A;  1OEK A;  2MWH A;  1SWF A;  2HLV A;  2N93 A;  2FT9 A;  1XKI A;  1EII A;  4Y5D A;  3STN A;  4JHQ A;  1JV4 A;  3FID A;  2DJG A;  1X8O A;  4I60 A;  2OYB O;  4FQB B;  4ALB A;  5LJE A;  3VU1 A;  1YWC A;  4ZH9 A;  1ICM A;  1VWM B;  4GK9 A;  2C1S A;  1G7N A;  4XME A;  2Q39 A;  4CPH B;  4NNS A;  4RUU A;  4OS8 A;  4O3Y A;  4TLJ A;  1QAB E;  4Z2O A;  3G7X A;  2MO5 A;  1EIO A;  2BS6 A;  1QY1 A;  5CSE A;  1U0X A;  2GTL N;  3WVM A;  1LID A;  2HKD A;  3GE2 A;  1DZK A;  1SXY A;  1JIW I;  1FTP A;  1L6M A;  2FHL A;  3AEH A;  4IAW A;  4KH8 A;  2Z4H A;  1SWR A;  2PI3 O;  2R56 A;  1HMS A;  4HPC A;  3CQR A;  4I6S A;  2OY5 O;  3WYQ A;  4Z27 A;  1BWY A;  3KVN A;  4ORS A;  5FQ8 E;  1LCV A;  2CBS A;  2X46 A;  1E5P A;  3IFB A;  3N91 A;  3PED A;  1CBQ A;  3QKG A;  3S5V A;  2I5Z O;  4Y59 A;  4CDE A;  1LNM A;  3RSW A;  4WFV A;  4OEL A; 
#chains in the Genus database with same CATH homology
 2RTN B;  1SWT A;  5JD2 A;  3WZN A;  2GH7 A;  5IRW A;  2IZG B;  4GJV A;  3RE5 A;  3WZO A;  2RTD B;  1N7Y A;  4BX7 B;  2RTL A;  2Y3E A;  1SRE A;  1SWK A;  1LEL A;  2IZC B;  2IZD B;  2RTE B;  4EKV A;  1Y52 X;  1SRF A;  3RDM A;  1LDO A;  3WZQ A;  4JNJ A;  1SLG B;  2RTF B;  4BCS A;  4BX5 A;  4JO6 A;  5K68 A;  1HXZ A;  1LUQ A;  1VWF B;  4U46 A;  3RE6 A;  2OF9 A;  2RTG B;  4GDA A;  1SWU A;  1SWJ A;  2UYW A;  1DF8 A;  1RAV A;  2RTH B;  5IRU A;  3RDX A;  2IZJ A;  3VHH A;  2RTQ B;  2RTP B;  1SLD B;  4CPE A;  2WPU A;  1SWQ A;  2F01 A;  2C4I A;  1VWB B;  1SRI A;  1VWN B;  5F2B A;  3T6F A;  3EW1 A;  1VWH B;  4GGR A;  4CPF A;  5IRA A;  1MK5 A;  3PK2 A;  4Z27 A;  1HXL A;  4GD9 A;  1RXH A;  1SLF B;  3WYP A;  2BC3 A;  4BX6 A;  1RXJ A;  2IZI A;  1SWN A;  4BX5 B;  1KL4 A;  1RXK A;  3T6L A;  1KFF A;  4CPI A;  2OF8 A;  1SWP A;  1N43 A;  1NC9 A;  2OFA A;  1KL3 A;  5K67 A;  3SZI A;  1SWB A;  1SWG A;  2A5B A;  2RTR B;  1Y55 X;  2QCB A;  3RY2 A;  3SZH A;  1AVD A;  1VWC B;  3MG5 A;  4IRW A;  2AVI A;  2ZSC A;  2RTC B;  5B5G A;  1SWD A;  3RDO A;  1IJ8 A;  1VYO A;  2IZH B;  1VWO B;  2RTI B;  5CHK A;  1VWG B;  1SWE A;  1SWL A;  4BJ8 A;  1STS B;  4GGT A;  4OKA A;  2G5L A;  2RTA A;  3RDQ A;  3WZP A;  1RST B;  4GJS A;  1LCW A;  2Y3F A;  1VWP B;  1HQQ A;  1SRH A;  1VWA B;  3X00 A;  1I9H A;  4BX6 B;  1MM9 A;  1VWE B;  2RTM A;  2IZK A;  4Z2V A;  1STP A;  3VGW A;  1VWI B;  3RY1 A;  4CPH A;  3VHM A;  1MOY A;  1N9M A;  3EW2 A;  1VWQ B;  4BBO A;  4DNE A;  4Z6J A;  1NQM A;  1SRJ A;  1KL5 A;  1SWO A;  3RDS A;  4YVB A;  4Z28 A;  1SRG A;  1SWH A;  2FHN X;  3MM0 A;  1MEP A;  1SWF A;  1VWK B;  3T2W A;  1VWR B;  2IZA A;  3T2X A;  1VWL B;  1LDQ A;  4Y5D A;  1SWS A;  4JHQ A;  1NDJ A;  3SZJ A;  1STR B;  1AVE A;  1N9Y A;  4I60 A;  3RDU A;  2OFB A;  5B5F A;  1RSU B;  2RTB B;  5L3Y A;  1VWM B;  1NQN A;  3VHI A;  2C1S A;  1N4J A;  4CPH B;  1VWD B;  3FDC A;  2IZB A;  1HY2 A;  1LCZ A;  4Z2O A;  2RTK A;  1NBX A;  2UZ2 A;  1SLE B;  2IZL B;  4GGZ A;  1WBI A;  4BX7 A;  5CSE A;  2RTJ A;  2MF6 A;  2FHL A;  2Y32 A;  1SWA A;  2IZF B;  1PTS A;  4Z2P A;  3WYQ A;  1SWR A;  2A5C A;  1SWC A;  2C1Q A;  1Y53 X;  1LCV A;  2IZE B;  2A8G A;  1VWJ B;  4Y59 A;  2RTO B;  2CAM A;  2JGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...