3X17A

Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
548
structure length
548
Chain Sequence
LLQGAQILVNQVGYHPATPKQAVLALAPGTAAGIRPGWTPTLQIVRADDGQVVWEGTMAGPSEDRLVSGDTLYRADFTSLTAPGRYVAQVVGGPRSPEFAIGPVYRDVLYAAARSYYLQRCGVAIDDPITGVSHALDHHEDGYVLVDDPFYRAGTRLEATGGWHDAGDYGKYVTTTAVTAAQLLKAYELYPQAFADGQLHLPESGNGVPDILDEVRWGLEWLFRMQRPDGAVYHKLAGLRWPGMIRPEQDVQRRYVYRITTQDTAKAAAAWAMAARIFAPFDAAFARKALAAAEQAWRFLAASGPILDYPAEDNSGSGPYDDRDDADDRFWAAVELWVVTGRAEYHDYIARMARTGLPAYAPVSWVNPAALGYFDYVTLGQKGDPAIRARLVQRILEGARSVFQTYEQSGYGVPILAGSFHWGSNKEALAKGMLLLFAHHLEPRPEYERAALAQLDYVLGVNPLAKSYVTGLGSNPPRNPHHRLVKASGVMVPGLLVGGPNDHPQTKAIRPHMGPRGYADVTDSYETNEPAIDYNAPLVFVAAHFASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure, activity and stability of metagenome-derived glycoside hydrolase family 9 endoglucanase with an N-terminal Ig-like domain
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Endoglucanase
total genus 177
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
A PF02927 CelD_N Cellulase N-terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3x17A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3x17A01
3QFZA 2A9ML 2DKMA 1DTUA 3FB8B 1YMMB 4V1DB 1EJ6A 4F9LA 1FO0A 3O2WL 1CLYH 2KQMA 2VABA 2YPKA 4I13B 4K3JL 1YNTA 4UDUA 5GRUL 4X6DB 3U4EA 4GAJH 4PBVC 3OV6A 4F57L 2V17H 1IM3B 1QTYT 4XMKH 2DQHH 4Y1AE 1F4WL 1MIEL 2N7BA 2FD6H 5DJ6A 3HI5L 4YNYB 4UDUB 2CRIA 1S9XA 4ZFGH 3SKNB 1FVEB 1G7MB 2EIEA 2FGZA 3F12B 4M6ML 5FYLL 4HKJB 4ZNEE 2V9QA 4WY7L 1GL4B 1TZHB 4JKMA 2XQYG 1IKNA 4F33A 1RHFA 4KDTC 4CMMA 4UNVA 4GW1B 1JYXA 5TQ0L 2X9XA 1UZ8B 3QHZL 4IHOB 4K9EC 5I1IH 4YXLH 5I6XB 4GW5B 2IF7A 3LAFA 4P5KA 3BPLC 5E9DA 4LLUB 5FB8B 3VXUD 2Q8BH 4NBZB 3MXVL 3OB8A 1O5DT 4HCRH 4TVPE 1MY7A 4UQ3B 1NBVL 2E7MA 2GAZA 3TYFA 3RX7A 3DVIA 1MCWW 5EO0A 3F7QA 3LEYL 1P7QD 3VWJB 2X1XR 4ZYKB 3KPSE 3CPLA 3RWGB 1XGYH 2HG5A 1FZJA 2LAGB 3QXTA 4QXUH 3V6FA 4RNRA 3D25B 4EQ3A 1BJ1H 1M6OB 1N4XL 1RIUH 3LKOB 4MD5B 4O5LL 1PW3A 4MNHA 4QRTB 5EOTB 4H0IA 5D5ME 4YPJA 2AJVH 2NX5B 1P4BH 3PGFH 5EFIB 5JQ6H 5FUZL 3O6MH 5IKCB 1IGFL 2P5WA 1ED3A 3CX5K 2I27N 3S37H 1CFNB 2MMXA 3RWIA 1G7QB 2FJHA 1JWUA 3QI9A 1NBYA 4Y2DC 4IOSD 4OLVH 2A6IA 4QRRE 4X0KA 2FO4A 3BQUA 3D39E 1T0MA 1G9GA 2VDMH 1MELA 4O51B 3L5JA 4F3FA 4LVNB 4WHDA 3PP3H 4K8RD 3JWDC 1Z9LA 3EHBD 1DQJB 3TPKA 4YDJA 3QIWA 5ANMB 5C3TA 2W60A 1ZVSA 5C6WH 2VQUA 5I8CB 5F9WB 4MD4B 2VLRA 1E28A 2HMID 1YEFL 3MRQA 1U92A 3F5WB 4HMCA 1JUFA 5I16B 1C12B 4RIRB 3CMGA 3OHXB 4Z0XB 3DO7B 1B6DA 4JANB 3MXWL 3QWRD 5DHVA 5F1NB 4F7EB 1U6AL 4HBQA 1FNSL 4KTDL 3O3AB 3TVMB 4PTTB 2Z93A 1N6QH 2BSRB 3OKOA 3GSNH 2CXKA 2L0DA 3BIAX 4MS8D 4ERSH 1RI8A 4PRIB 2WUCH 3CFEA 1KACB 3RTQD 3MODH 8CGTA 2FX9L 3IDJB 4HWBH 1CQKA 2XTLA 1HHHB 5FA3B 3NFPA 4P2YA 5H94A 3QUMA 3PQYB 3VU2A 4NQTA 2YIKA 3LDBC 5E8PA 5C0AA 1R3KB 1CLCA 1NC2A 3U36A 1A6WL 2FECI 4ZPVA 5GS0C 3HHRB 4OCNC 4APQD 2AJXH 3AY4A 3WN5C 5K9JL 4GRLC 1HHIA 3D18A 4EUPA 2D03H 4P3DA 3C5JB 4KZDH 5T1DH 4P4KA 3WL9A 3P4NB 5CIPB 5F88B 1U6AH 3DX9A 4KTDH 2P7TB 1CE1H 3QWRA 4UBDC 5T3XE 2VLME 4UT6H 3FL7A 3N85H 5BXFB 4TNWF 4DVRL 5D70L 2P5WE 3SOBH 2E8ZA 1OAQL 4ZFZA 1YQVL 5EN2B 3M17B 4XNUL 4DTGH 3MUGB 1JS4A 3IFLH 1GOHA 2CQVA 1AIFA 1GGBH 1PSKH 4KI1A 1F90H 1K8IA 5GJSL 4JZOA 1U58B 5J9PB 1NBQA 1W72B 3HPJB 4HIHA 5ERWB 2FO1A 3CXHJ 1RAMA 2ZZUT 3EIFA 2EDOA 2BJMH 1CICA 1HKLL 1K2DA 4XAKE 3JWDH 3SQOH 2ZZRA 4OAWA 4ODXB 4R9HA 1MEXH 5EUKA 1HZHH 1VFAA 3QHTC 2HLAA 3LKRA 4N9OB 3TO4D 4HLJA 3ZE1E 1MWAB 3TZVA 4FQHA 5KN5B 2ITDA 3TIEA 4F7PA 4HT1L 4JO3H 2V5RA 3BKJL 1F4XH 2GTZB 5D70H 1QACA 4GKZB 1EXUA 2P46B 1OPGL 4OCSH 4ZFOB 2VDOH 4X7FC 1U8PA 3WFEH 2EDEA 4KQ3H 1U8QA 2BVOB 3MRBB 5EU7E 4JHAL 4MXQD 2RI8A 5JHDE 1PY4A 1IC5L 4HIXH 1UT9A 3QQ3B 5MEPA 1A6TA 4MCZB 5IIEA 5SV4A 3BRDA 3GB7B 3W82A 3DI2B 1QFPA 4YBHA 1LMKA 5CP7A 5CHNB 3RGVC 4QXTB 4Y2OA 1RULH 2M1KA 3RZWA 1PQZA 4JDVB 5AAMA 5ADOL 1YEKL 1OGTB 3BJ91 3EUUA 5D1ZB 1OM3H 3WIWA 3GUTA 3GBML 2EDLA 3LV3B 1C7SA 4Q6IB 1QLEL 2JJTC 5FDWA 2HFTA 2A2QT 1CGXA 5CBAA 5F96L 1KNOA 2QQLL 3D1MC 3X3FL 2Z92A 4XPAH 4DZ8B 3IXAB 1G6VK 4L1DA 4CGTA 4PV9B 5I30H 3LQMA 4LCWB 2DM3A 2XN9B 1HYSD 5HGAA 4TUOB 1KLFA 1L0QA 3NPZB 4DK3A 3QB7C 4FP8H 4I0KA 4QRQA 4ZPTB 1FRGL 4XPBH 3OF6D 3EYFA 2MQ0A 4PJHF 4L3EB 4KDTA 4LU5L 2AQ2A 3OR7B 1XH3B 1XCQA 5HHMB 4QTIL 4LSVH 2WBJD 1NUGA 3WNPA 3G5XB 4UU9B 1QA9B 1I1FA 1IAII 4WO4D 4EI6B 2C3VA 2K7QA 4L1HA 1KC5H 1BEYL 5JXAH 2WBWB 3VXNB 2WWKT 2JCCE 4PJCE 1O7VA 4IJ3C 3EZ8A 2DQEL 4DW2L 1PEZA 4LDOB 3O6FB 4WI8A 1SJEA 1KCRL 4OCWH 5JW4Q 5CGYD 3O4OB 3HAEH 3IDXH 3NCFB 4OLYL 3QG7H 3CSGA 4R4BA 3M17A 4OZIA 1I1YB 1PDKA 5T3ZH 2NLJB 4HWBA 3PJSA 3WLBB 3PP4H 4LLDA 4GQPH 2HH0H 4LOUC 5GRVK 1WIPA 3MSPA 4JM4H 5JUEL 3CVHA 1JHLL 3MA7A 4JFFD 5C0DA 4NFCA 4XNQA 2WWKO 1R5WB 4LARL 3UJIL 4UT7L 3FB6B 2JB6A 3BT2L 3OKEA 3C6SA 5D7KD 1BVZA 2QBWA 1IM9D 5EU3A 1QFWH 5CJXC 3SBWA 1I1AA 4M1DH 4MJIB 5KVFH 1MAML 2ERJB 4F37F 1LK3L 4ODBD 1R3KA 3H9ZA 3ARDD 1UH3A 1ULVA 1ZHNB 1P2CB 3V6OA 4D0DB 3OJMB 3WIRA 3IDJA 5FYLH 2R0LL 1NFKA 1RK1B 2I25N 4WHCA 2GUOA 1YNKH 3L1OL 5EO1A 4HW6A 5H35A 5EC1B 4GG6A 3QHZH 1IJ9A 5D5MF 5FCUH 4ONHA 2CSPA 3RWDA 1T7WA 4LP4A 5I6XC 4RDQF 5TFSL 3TVMA 5C0AD 4DAGH 2GEEA 5D7IB 3BH8B 4OGZA 2Z4QB 5GZOC 1J8HE 4XMLH 5SWSE 2RB8A 3FHQA 2VLJE 2VJXA 4W4OC 3WIHL 1NCUA 2NY7H 5DGRA 1X9QA 4QOKA 3ZE1F 4EN3D 4R97B 2HTKD 3FQWB 2IEPA 4TVPL 4BFIB 1UXWB 4CL7A 3ARRA 3FQRB 5CSZB 3SDCA 1SBSL 3WEXB 2VC2H 4HC1A 2XZQH 4O51A 4PD4K 2Z35B 1CGTA 2VWEC 1BJ8A 1MF2L 3P3YA 3QDME 3R1GH 4O02L 1OY3B 2J8UB 4U6XB 4P49A 2B4CH 3BDBA 3TLRA 4JO2L 1WVZA 4KV5F 3VFNA 4M02A 4NWTH 4PJXE 3C87A 4L8BB 4DAGL 3BDYL 5E2JA 4Z78B 1WTGT 4JGMA 4TSCH 1J9CT 4HS3A 1DVFA 1U93A 4JQVC 1DVFB 1NGXB 2GTWB 4R2GB 5DFTA 5GZOD 3CNKA 1NMAH 5DJDB 4HD9A 3W5MA 5FHBH 3C60A 5HDBF 3RWJB 3QFJD 1Z9OA 1H3XA 3VXQA 3B43A 4YFLI 4JFPB 5ALBH 2FHFA 2V6HA 3I6LE 2QSVA 3P30H 5EU6A 1H3PL 1JNHA 3T2NH 4KJWC 2Z35A 4BELD 1AC6A 2DM7A 5HHPB 4Z7WF 4PG9B 3M1BB 2BC4A 4P59L 1A6VL 2VTFA 4QHKI 1RURH 4X4YA 5CSZA 3GO1L 1XW2A 5DJ2A 4NQEB 2R2CA 3CFKB 3NZHH 4GG6E 1BQSA 2EXYD 3FFCA 5ICYB 1ZTXH 3FO0L 3H42H 2Q86B 5T3ZD 1W0WB 2M26A 4U1SA 2C4FU 1HHJB 5T1KD 5IMKB 2VLJA 5JIPA 4YNYA 2D7PA 5LQBL 3N1QC 5ICYA 1AFVH 4E5XB 1ZSDA 2X41A 3UTTD 4LASL 4LSDA 2JIXD 3QH3B 3L95A 3W7XA 2AEWA 2VABB 5IBUB 4UB0H 1XWTA 1EEZB 2W91A 1N3NB 4KTEH 4AG4H 1XR9B 2V5TA 1YEIH 1FE8H 5IGXL 4KJPD 1I1AB 4MX7A 2BY2A 1G87A 5EBMB 5D1XB 5K9OA 1CG9A 3LQZA 2W0PA 4YAQB 1IAIL 3MLVH 5F7UA 4J3UA 3FZUC 4K23H 4ACPA 3E8UL 3QNZB 2BSSA 1QO3B 4EI5B 1BM3H 2X4QB 1FAIL 4Q7DA 2M8XA 3WLBA 2X4TA 1MCHA 3J7HA 1VADB 2CR6A 1A14H 2LV4A 3VFNB 3ZYJA 4GAJL 3WUXA 4JVUA 5EU6E 4JRYA 2PTTA 4DK6A 2ZPKL 1FBWA 1PG7W 4ZAKB 5F7MC 3BKJH 1X7QB 4K3DH 4ZOAA 1VGKB 1OPGH 5IB2A 1JV5A 2Q87A 3Q48A 1LO5A 2H2SC 4GUPA 2F54E 2RQ8A 3OPZL 4IRSD 3QEGL 3TBSA 4YQXH 3SDCB 1D5MA 1LNUA 3MNZB 4CVUA 4JR9L 1G0XA 4PRHB 5J56B 4XRCA 4NC1C 3O6FD 5LJYH 4OFYA 4PLKD 4UU9A 1R3HA 2QKIB 4A6YB 3QDAA 4NT6A 5C07D 4XH2A 3QHFL 3SKOB 5DVOA 4RMSA 4ZD3L 4XBPA 1A7QL 2A74A 2OR9L 4PJ9B 2XT1B 2ADIB 4P99A 1FG9C 1DN0B 5EBLB 3ULVF 5D2LB 2EABA 5DD6B 4QHLA 3K2UH 1YEKH 3FOMA 4KU1A 1AQDB 4LCWE 3HI6H 3B3IB 5BRZE 3MRNA 4PJHE 3S6CA 1AGBA 1SY6L 1NCCL 1YEDB 2DTSA 2X1WL 4IMLA 1NL0L 1KIPB 1KEML 4PV9A 1WFNA 4NQVA 4V2BA 4PB9H 4EXKA 1M71B 4G8GD 2W1NA 2VE6A 5JHLH 5DQ9B 2IPTH 1T1ZA 3O3DB 5FM8A 4OI8A 1CU4H 4X99A 5IW1A 1OF2B 4FZEH 1T66C 3LN4A 1NGZA 2BNQD 1DSFL 5TGBB 3PWJA 1NMBH 1U8KA 3AFJA 2VUYA 2EH8L 5DLMH 2YOCA 5D1ZA 2FEEL 4NZUL 2BZDA 3QNXA 4GXUN 5I19L 4UTBL 4URTB 1KCVL 5C7XL 4M62L 5ITBH 1YY9D 3LMJH 4EVNB 3ON6A 4OBSA 2R69H 5H8DA 4HXAH 1MHCA 4GLRH 1JRHI 5F7HA 1ZLUH 1HQRA 4GBXA 1T21A 2EIDA 1GC1L 2XWTA 2BY3A 4NP4L 4R4BB 4OZIB 4X9FA 1TF4A 4WFGD 4MAYA 1FMIA 4ZSOB 1H3GA 1FDLH 1ZS8A 3BWAB 3IDUA 1FL3B 2CR3A 4J23A 2D4DA 3P4MB 4I3SL 5CLTA 1WZ1L 5I8OL 4OKDA 1XR8A 1SJEB 3EYOA 3FB5B 2AFAA 4FMKA 5ICZA 2YPLA 5B4MC 1O7SA 1R3JB 4MWFB 2PETA 5DJ0A 5K9KA 3VXSA 2DN7A 2ITDB 4OGXH 3MC0A 5K9QI 1EX0A 1EBAA 2HLAB 3ARPA 4DOHE 1MCQA 2GY5A 1KCVH 3SGKA 5C7XH 1J5OL 1BQHG 1DBMH 5L2KA 1CF8H 3B9EA 5H2BB 2VZ1A 2YC1A 5DJAB 1OWWA 4YXKL 2GITB 1YZZA 2DKSA 4G6KH 3OR7A 2NY3C 5C6TL 4OD2B 4JM4L 5FKPB 1U8OA 4WTWA 5AYUL 3EYFB 1A6ZB 3D3IA 5D1ZC 3ULVC 4HIIB 1P84K 1T2QH 1NGWB 2E7LA 3WUWA 4J8RB 4FXLA 3OL2A 3KHOA 3OQ3B 5I18L 4FQ2H 4G6JL 4FTVB 3F7VA 4JLRA 1CR9H 2X05A 1KREA 2BNRA 2VISA 1RIHL 4XGZA 4AK1A 5CZVL 4KROC 4Y16D 3BGFB 3NAAH 4JFDE 4CBPA 3QPXH 1JK8A 2P42B 2IQAB 4J2XA 1ZHKA 5AG8A 3C5JA 5I71C 4UNUA 4XNUH 4DTGL 1S7UA 2GW5A 4JFOA 4PJGE 2EE6A 4S10A 2H8PA 4PV8B 3GUTB 3HMWH 4GQ9L 1BQHB 4HS6A 5C6TH 5FCUL 5J12C 3LKNB 3P4LA 3M45A 2I9LB 3GSXB 3SJVB 2VDPH 1ES0B 1WBYA 4KQ4H 5BRZB 3B83A 1Q9OB 3VRJB 4P48A 2MJWA 1HHGB 1MEXL 4HUKB 1XMWA 4RFEA 4YIQB 2NY5L 2Q7NA 4NOBA 1IGTB 4C4KO 4YHIA 3UO1H 2Z93B 1FZMB 2DQCH 1W0VA 2YBRA 3NA4A 2YPLE 1F2QA 2VUOA 2X2YA 2IADA 4QRSB 4PLNC 5HDBE 3DO7A 2O61B 3P9LB 2FYYA 1UB5B 2R0WH 2Y07H 4Y16C 3DYOA 2JIXB 1YNLH 3MA9H 1S3KL 1EGJL 4OCXH 4M1CC 5M95B 1A8JH 2Y23A 5B39B 1YQ2A 4JFYA 1PLGH 1KJ2L 3MOAL 2W60B 2FSEB 3PDOA 4DEPC 4GUPB 4UMGA 3G08B 1OARH 4K3EH 1VGKA 1FNEA 1L0XA 1PZ5A 2Q6WA 4PBXA 5ADOH 3K74B 5FYKL 2DQHL 4N0RA 2A0LC 1YPZF 3T3MF 4IMKC 1EHLH 1X5HA 4AYFA 1BX2B 1DBJH 3TJEL 4TNWK 1YYML 4MQTB 1ETZB 3SGKC 4ELMB 1QLRA 4NHUA 3H7BB 1ZGLM 2VN4A 4ZFZB 2EKJA 4JPIA 3KXFA 2MNUA 1IGYB 1FG2B 5JLZA 1KFGA 5EOTA 5B8CA 4JO1H 3EO9H 4JFDA 2ZJSL 5GGQH 2D7TH 4PJCB 3ZKQD 1RV6X 3CPLB 4BQ9A 5SWZB 3SDYH 3VXUA 4LVHB 3DVFA 2HJKA 1U8NA 3BGMA 3WL9B 2WINB 4BQCA 3BISA 3SE8L 5LGJA 2APXA 3TYFB 4CW1B 4R7NA 1XIWD 4WO4C 2ZUSA 5K33A 1V5CA 4ZTPL 4UBDD 3Q5OA 2R1YA 1J0YA 2D8LA 1QLFB 2YK1H 4YUEH 4Q74A 1IFHL 3GHEH 3HRPA 2YPVH 1MHEB 1N3NA 4MNGA 5E94A 3RWFB 5E6ZA 4IHOA 2XZAL 1YYMH 1G1YA 4G7YL 2GFBB 3EYUL 3TNNB 4DWHA 4JG1H 3O6LL 3H3BC 5CA3A 4PRIA 1UM5H 3VFTA 4MAYD 4RSVA 3BAEL 3QCUH 4EJ1C 2J8OA 3ACTA 1Z0MA 4DW2H 5HD8D 1QSEE 3T1FA 1LP9A 3O81A 4RIRA 2LTQC 4ZUUB 2VDKH 3BMVA 4E0RB 4FFZH 1D7FA 4OZFH 5I1JH 3VD4A 5BV7B 1GOFA 5I8CA 1QSVA 3MROB 2AVGA 2H32H 2N56A 2FB4L 5EZOH 2DM2A 3V6ZA 4FTVD 4YDJB 1CEMA 3LY6A 1Z5LB 1BFTA 1S9VA 1OTUC 5T5NG 3M1BA 3SPVB 5ESAB 1AKJD 1BM3L 5I1LA 3S34H 4J3WA 3T3PF 1DN2A 4MXQC 2WIIA 2BVTA 3WIIL 1TXKA 2E5EA 1K5NB 1U95B 1OD9A 5IQ7H 4C56E 1FH5L 2XQBH 3MXVH 3RWIB 1V7NH 4JDZB 1TQBC 2XIDA 1I8MA 3QYCA 4G42B 4GMSL 4A6YH 3BGFC 2A6DB 1OTSC 2VL5B 4HFWA 1BPVA 2LABA 2NX5A 1OGAA 2J5LB 1A3RH 1NGXA 2B1HH 4M9OA 3LKSA 4PRPD 4PJ5B 5JORB 3VXUE 3KPQB 1G7IA 5DA4A 1HKFA 1FFRA 4XCNB 1OP5H 4OF7A 5HHOE 1M05B 3VXRD 1ZGLB 2VAAB 4BJLA 2BCKA 5DJ8A 4MVBC 3MV7B 4YHYB 2P8MA 1FN4A 4M93C 5KSBA 1IC4H 4KKNA 4XC1H 3BZFB 3UYOD 4D9QD 4LK4A 2EDTA 2ARJA 4LLUA 3CX5J 5K9JH 2CD0A 3WIIH 4MZ2A 3PP3K 3LEVH 4MJ2A 3JTSA 3CIQA 3G5VB 4Z7UA 1OP5K 1JNJA 3T0AA 1FJ1B 3F6LA 4F9PA 4NO2B 4QOKB 1NMCB 2L4OA 3WE6B 3DRQB 4HUXA 1RIVH 3S5LA 1MRFH 4HJGB 1FL5A 3RVUD 4NZDA 4XXCC 3TIDA 1BZ7B 3BQUC 4O02H 3HC3L 2B4CL 1IM3A 1FNSH 3HE6A 2X89A 3FQXA 1JF1A 5E00A 2GUOB 2IAMC 3UPAA 1U8MA 2UWEA 5JZ7C 4HMDA 4LF3B 2BJML 3DWTA 3ARZA 2ADGA 2H26A 1Q94B 1R5IB 4D0CA 4NO3A 1YMHB 1KJVA 3U30C 4FABL 2DTMH 5GGVH 1FIEA 3WFDL 3IJYB 4UOW1 1NFDA 4OI7A 2P5EB 1F11A 3PDDA 3UAJC 3DHMA 3MRLB 4UDTA 3JSSA 5I66B 3TBYA 4M6OL 1G9MC 1I3UA 3O3UN 1I1CA 5HI5C 1PBYA 2V2WB 3STBA 4LRNL 2D03L 1NSNL 1Q1JL 4JM2A 4RGMB 1ZT1B 5D1QB 4PRHD 1A6VH 5GS0H 3CLFL 2Q76B 1AQKL 4U31A 3BP6A 5AUMB 1K9TA 3V7MA 4G9FA 3GBLA 4K7FA 3DSNA 3HC4L 3MLXL 3QQ9C 5EA0L 4L3CA 3ARDB 4XXCA 2OJEA 3BKYH 3H6JA 4DN3L 5IMMA 2XNAA 4LVHC 3GKWL 3REVA 3SJVD 3STZB 1MCFA 2AK4E 3D39B 1X4ZA 5EUOA 1Y0LA 3HFML 1I1AC 3DRTB 4XAWH 4X6CA 4AENB 1KB5H 3PGDA 1J11A 5C08E 1J1OL 2R4RL 1KT2A 1JTTA 1PYWA 2ICWJ 3V5KA 1FCEA 1NSNH 1OAKL 1CYGA 4UB0L 5D8JH 2FX8L 3DV6B 3RWCB 3MACL 4CN6A 3HUJA 3BP4B 3KPSB 4CNIA 3MOQA 4QRQB 3HC4H 3MLXH 3WKFA 1CICC 4ZO6A 5LWYL 4OKVB 2W9LA 4NRYB 5CUSL 3ZT6A 4U6YA 1KJ2B 3RBGA 4YFLF 4QTIH 3VXTB 4BKLB 1J8KA 1DUZA 5IM7B 3MPCA 1FFPB 1A7RH 2J1KA 1H54A 4J6RH 1EHXA 3FT4A 4L0GA 3IFOA 4NN6B 4ZQKA 4KQ4L 4F2MA 4IRSC 4BUGA 4EDXA 5HGBA 1MCNA 5J1SC 5D2LF 3BIBX 5TE7H 4EDWL 3O6FC 2AHFA 5F6HJ 3JTTA 1KXQE 3O11B 3GMPB 3QEQA 1TVHA 2XTJB 1IQDA 2QSTA 4HJ0D 2NNAA 4NQDD 5F9JB 1NGYA 4WI9A 3WBDA 2BNUB 3VDBA 4LPCA 3E3QE 2XA3A 3KVQA 2XXCB 3A0OA 3U7YL 2DLTA 1I8LC 1ZGLP 3VWKC 1HSBA 5IIEB 3ROLA 2X70A 3C6LD 4ZUWA 1C5CL 2X4UA 4JQVA 1KEGH 1TVBB 2V9RA 2J5LC 2DWEA 4L4JA 3X3GL 1OW0A 3VD3A 3O0RH 2X4SA 1ZT7A 4HG4J 1IE5A 3TVMC 3C60C 3LS4L 5D7JD 3WKIA 3HE7B 3DUSB 3UJIH 1LF6A 5DYOB 3SGEH 4HJJL 3BUTA 3ECBA 4LMQE 4XWGH 4TTGA 2GJZA 4PY8I 4XPBL 5ENWA 4KK9D 4Y4KA 4I5BB 5KN5A 1TETL 5C08A 4U1NA 3TZVB 5C0BA 5JA9A 2UY6A 2ZCKL 4JFZH 3P0VL 3K7UA 5EULV 4AJ0A 4L8DA 1J88A 2MOVA 5IUSA 3O6KL 1I7TA 3FN3A 3OR6A 1WSST 4MMZC 1UENA 3B9KB 5D9SA 3QDJD 2RFXB 2R23B 3P9WB 1U36A 1JHKL 4QRPE 1R6VA 4KI5E 5C0EA 4PJXB 5T5NF 4PJFA 4QYOA 5E24E 2QL1A 5C2BH 1HCUA 4FZ8L 1FYTA 3FO2A 1H3UA 1NC4B 4LLWB 5GS1A 4X4ME 4NC1E 5KZCD 1JNNL 1JPTH 5AZEL 4Z7VA 4GW4B 1LEGB 3AXLB 3MCKB 1T2XA 4MXVF 3QDJE 4UAOC 3PDGA 3HB3C 1T0NA 5K93A 1OB1A 3ZKMD 1RUMH 1QKZL 5INCA 4YX2L 4GXVL 2VZ3A 4TSBH 3KPRE 3TBWB 1SY6A 4POUB 5HXMA 5KSVA 3PQYE 2NW3B 3BP7B 4ODSH 1H3VA 2BVPB 3GMOA 3BAEH 4HWUA 5F89B 1RZJL 5LXGL 5E8PB 1DZBA 3CD4A 1HDMB 5CWSB 5JA8B 3L3KA 5FM5O 1PEWA 1TJHL 1AY1L 4J4PD 5GGUA 1N6QL 1WFOA 4YZFF 4RWYL 5ITFB 1CVSC 5IVZB 3T04D 2B4FA 4TSCL 3G9VA 3KDMA 4RRPA 4K94L 2DQJH 3RPIA 2R0LH 5DMKB 4FMFA 1A2YA 2NZ9D 2AJSH 2OL3A 4PYHA 3RPIB 5KZCB 1WU4A 3TN0D 1S7VA 3MRJA 4RGMC 5D1QC 1UKSA 1WBXA 3JVGC 3ARSA 4BQ8A 5HYQB 2WSKA 2DLFH 1N26A 1S9YA 3EFDH 3S34L 3EW3B 3SDAB 5IFJB 3WDHA 3DARA 3VWKA 2YD7A 4HGMA 3IVKB 1WWCA 2BSTA 5IK3B 4Z95H 3EAKA 4ODSL 3SDXA 3WIHH 5I18H 4I9WE 2NY0D 1IEBB 4CADB 2DJUA 1W8OA 4H0GA 5C09E 5EZIH 4BZ2L 5TDPA 3PGCA 4I3RL 3D85A 3BPNC 5AWNH 4M5ZH 1WC7A 4S0SD 4MLSA 4R26L 5JNYB 4GMTL 5IBTH 3MLYL 1DEEB 2YZ8A 3L5WB 2FL5A 4UIKL 4XHJD 4PREB 1TPXB 3ORJA 3I9GL 1P5UA 1MPAH 4DKEL 5HYQA 4P2CG 3JV5A 4OSUL 3FFCD 4OFDA 3L7FB 2VLKE 2YD3A 4D3CH 3DETD 2BOCA 2ARWA 3EJYC 5HVWA 3MNVB 3GIVB 1KENL 4KHTL 2X4NB 4YHMH 2A77H 2GAZB 1A1NA 3MOBH 5T1LA 4XMKL 5ITFA 4NYLA 1NMCC 3UTOA 3CFDB 4EIGB 4KI5D 5GS1C 3FN9A 4JO3L 1F6AA 1HDMA 4TSAH 3DXAE 2ESVA 4NUJA 4OZ4A 4P5KB 3FRUB 4L3EE 1B3JA 2AK4D 4KQ3L 5J13B 3QDHA 4YXHL 1QQDB 2NXYB 3NCJL 4WUKL 1XF2B 3W0WD 3W11C 3GI8H 5D2NA 3REWA 5HVHB 1SJXA 4XNYL 5C0CD 5H37H 4GAYB 3X13B 4LRIA 1FFNB 2VMFA 2CDFA 4OLZH 3O4OC 3VRLE 4HUNB 1HSBB 5DJ6B 3RIFF 2VZTA 1FLRH 1V8HA 2GSGA 4X6DE 4R0LA 5FO8B 4O2CB 1LO3H 5C0EB 2FLBT 4P23B 4OLWL 2FBJH 4KMTL 1XIWC 5LQBH 2EXYC 3VD7A 4L3AA 1FNFA 3FB8A 5TDNA 4RBPH 3BESR 3NH7H 3JV0A 1BP3B 2B7DT 1D5IH 1LWRA 2ADJA 5DK3A 3GSRB 3KXFD 3LHPH 5FUZH 4EN3A 5EU4A 1R3LA 3U46A 5LCVL 2Z31D 1T6VN 3LIZH 3VGAC 4ZNCD 4PLOB 1NFIB 1KJ2A 2B39A 4I0PC 3RGVD 3A6CH 3W9EB 1SYVB 3ZO0A 4NQCE 1VSCA 3VXME 3MBEA 3FOLB 3QA3A 1KWFA 4ZXBB 4KZEL 3U0WH 5DYOA 3QG6A 5AYQA 5HD8C 3K2MC 5GS3A 1NJ9A 2RBLA 3EDEA 4HUWA 3ULSA 2OBGA 3UTQA 5EC2B 2MWCA 1NBZA 1YEFH 5D7IF 2HFGL 1YMMD 2G75B 1AR2A 2VLLB 4LRIC 4N68A 4Y2DD 3U4BH 4P4RB 2C1OB 3QCUL 4LSRL 3NFNB 2W9DL 3ULVH 2NXYD 4NQXA 1P4LA 4HX1B 5D8JL 2BNUA 1MJUH 1OTUD 1WAAF 2VWEE 1S7TA 1UFUA 4DZBA 4MJID 4M48H 1AO7A 3GMMB 4L9DA 1YYLH 5E2UL 5IB4A 4NRXB 1KYOJ 3ARDA 2BNQA 2J6EL 4LBEA 5CKGA 1KCUL 1LP9F 2Z9TA 5D7SL 2UYLB 3K8MA 3MV7E 4WW1B 1QRKA 1MVFA 1U9KA 5HHOD 2CRZA 1PX3A 3QXFA 1CLOH 4H5SA 1Q9KA 4WWKA 1B4RA 1F42A 1NGQH 4KHXL 4U6YB 4GRWE 3QSPA 3RAJH 4GAGH 1EO5A 1KJMA 4YPGA 4YDIL 1F58H 2WWMD 3HG1B 2AKRB 3HCVA 3VH8B 4PRAA 5HYEA 3O41B 4XP4L 1RK0A 4LCYB 2NW2A 3CFCH 4ZS7L 4M93B 5F9OH 5FHAL 4ZUTB 2NXYC 3RWCA 5CINL 1OOAA 4P57A 3VE0B 4OI9A 2COQA 1BAFH 4RGOL 4PRPA 3CZFB 4RAVA 3FT2B 2YWZA 3PGDB 2NW2B 3CSYA 4JGJA 3WS6C 5GJSH 3WNNA 4LVEA 3OJDB 5DF0A 1JI2A 2DI7A 5EUOB 3UEZA 1UQSA 1U8MB 5SX4H 5E00B 4WEBH 2Q1EA 3G6JB 3D0VA 1CXLA 2HKFL 4MNQA 1FHGA 5ITBL 3LEVL 2BNRD 3VGAB 5ID0A 3CIHA 2OZ4L 2QR0A 4POZD 3O8XC 4JAMB 4JFEB 3T2PA 1NCAH 4WW1A 4LNVA 1FQ9C 3GSNB 4JFEA 1KIQA 4ALAL 1LGVA 3INUH 3JUYA 3UTPE 2NY6C 3BD3A 3RWHB 1I75A 3MLUL 1NGPL 2QQQA 3OKLA 4R96B 4D0BB 1MJJA 2R29H 1DCLA 2AW2A 4MJ4A 4ISVB 2EDJA 4KTRA 1AO7E 1X6LA 4H1LA 3WDIA 4ODVH 1HILA 1F11B 4HIJB 2IQ9H 3GBNL 3UAJD 5IJKC 1AD9A 4P4RA 2VZUA 1BZQK 2P8MB 5ETUA 4C54A 1KJVB 1RHHB 1RUAH 2AERT 3CH1B 5D7JA 4AZ8A 4N1EA 4R4ND 1AI1L 1B0GA 1KPUB 1NBZB 1RZGA 1LO4H 2AHGA 4OIIH 4X6DF 2ADGB 4JREB 3RA7H 4Y0GA 3ULSB 5TDOB 5J6HB 1JGLL 1XAUA 3U6RA 3KPQA 3EOAB 4IMKA 4M6NH 5T1KB 2UWEB 4JFED 5LVEA 2Z31B 4ZXBA 4Q9QH 4WW2A 3DYMA 1G6RA 4Z8FH 3DJ9A 1KV3A 1EFXB 2BDNL 2YRLA 3U48A 4JKPH 2CIKB 1FAEA 1T1WA 4H5SB 1TTFA 4LLQB 3GMNA 5HJ3B 3OG6B 1FL5B 2WIIB 1D6VH 2KL6A 4CE7A 1UB6A 2B2XL 3DOSA 1G9MH 1XF4B 2EYRA 5IBLC 1ZLWK 3RUGB 4XVSL 5BVPL 1AD0A 3NZHL 3MZTA 3WJJC 4C56D 3OKNB 4BH7A 2CKBH 1G7PA 3CDYA 3QFJB 2X40A 3TZVD 3BZFA 3KWWB 4OLEA 4UI2A 4RMVA 1I3GL 1CL7I 1ZT4A 3I2CH 3CGTA 3FFDB 4PJIF 1WTLA 5DS8A 5HYJD 1E4XI 3DX8B 4P0DA 3V4UL 4HF5L 4OIAA 5I15H 1JYWA 1DLFH 3CFBA 1TJIL 5F7FA 3TBVA 2FWOB 1CICD 4MB3A 3BX7C 3U2SA 3UTQB 4NPYA 1L6XA 1DANT 1RPQA 4ZNEA 2W0LA 3QG6B 4R0LC 3ILQD 2B4CC 5M94B 3X14A 3DUUA 2NTFA 5CD5D 1QBMH 1MFBH 4WW2C 2GKIA 4RCAA 5JOEA 4MB5A 5E8NA 5DMIH 4LVNC 1QLFA 2HVJB 1K5NA 1U95A 5T3ZL 2E27L 4Y19A 2YPVL 2B8OT 3MLZH 2PR4H 5DRXA 4Y4FA 4EN3B 5LGJB 1LK2B 5FGCB 3SDXF 3I02B 1ZKAA 4KVCH 2IG2L 1CGUA 1OP9A 3VFOB 2GT9B 4N0FA 3N50A 5A1AA 2X09A 1JZ2A 1IGYA 5JLZB 4GFTB 2FLRT 4QHNA 4E0RA 5DJCA 4P9HL 3MCLL 1S7RA 3W0WE 3EYVA 3PG2A 4ZUUA 3D0LA 5ALCL 2BRQA 4X5LA 5D7JC 1N59A 1GZPA 6FABH 3EJZD 4KJPC 2EXWD 4WTZG 3QJFB 4ZO7A 2H1PL 5BS0B 2GJ6A 1YNKL 1QFOA 4OFPA 4DVBB 4NKOB 1Z2KA 4WUKH 1WZZA 1KB9K 1KLUA 2J12B 3UJJH 3MUZ1 1WT5C 3MV8D 2R56L 2D7QA 4XCYA 4JZJA 1MVUB 3QO0A 2OXHA 1F6AB 3BYYA 2IC2A 5GJTL 4IRZH 2I5YL 5TQ2L 2EDNA 3KPPB 4N8CL 1NDGB 1JZ5A 3K80A 4QRSA 1T89A 1QNZL 3CMOH 2FHCA 4L5FL 4ELKA 1S7WA 4WFHE 2BVQB 2VDLL 4M43L 4OLWH 1JI1A 3V6BR 5T1MB 1C1EH 3TFKC 4RFEB 4MQXC 5IVZA 5B8CB 1JHTA 4GOSA 5ELIA 3STLA 4NQCD 5JIIA 2EYTB 4HG4K 1H15A 4YJZL 4MQ7B 3GIZL 4HUUB 2B5IB 3BW9B 2XWJA 1DQDH 2I9LA 2R2EB 3ZKMC 5GXBB 1HXMB 5KJRL 2CK0H 2R56H 3QUZA 5F8QC 1A6AA 4MAYC 1JGUL 4HZLB 3LH2L 3A3VA 2BMKA 2LE9A 3ARVA 4A2LA 1AH1A 1PZ5B 2Q6WB 4JJ5A 1C08B 3C6LB 2DI9A 4NNXA 1NMAL 1OAZH 3B5HA 1EEYB 2FSEA 3PDOB 1UH4A 2OJZH 2W9EL 4K2UL 4RFNC 1RUML 1VPOL 5L2JA 3SDXB 4JFYB 1JBJA 5F7KC 4JG0H 2BSTB 1BZ9B 1X5ZA 1FDLL 5C6PB 3VH8G 1WCBB 3GKZA 3MUJA 2IBZY 3DV4A 5IQ7L 4PJFB 4QYOB 5CZXC 4MYWB 1WBXB 4LCWD 3LKPA 4X6FB 4X9IA 5AAWA 1MCCA 2IALB 2GJ6E 4JY6B 3F7YB 1A2YB 1L9NA 3PQYD 3DX7A 3U1SH 1QBLL 3OZ9L 4LFHD 3W5NA 3BZEB 2GITA 3QDGA 1LO2H 3SCMB 2FV0A 5L6YL 2QJDA 5CJBA 5A2FA 3HRZB 1FCGA 5L2KB 1KCUH 5CWSA 1EA9C 3SJVA 4WU5A 5T5FH 1JN6A 3AU1B 4LL9A 2W07A 3QUYB 4K2UH 1ZLVK 5B21A 5ENWB 2DB8A 2H32A 3EJJX 4Q9BA 4TUJA 4DUVA 2R8SH 5DQDL 1A6UL 2XKUA 3UYRL 1OB1B 1MH5B 1N5AA 4OZFB 3IAQA 2WP3O 2NXZD 4KVNL 4OFYD 4EUPH 3WHXB 4ZUSA 4UT9L 5EU5A 2JJBA 3MCKA 3BN9C 3GRWH 4I3RH 1AHWC 2YMXH 3CVHL 3ARGD 3IT8D 5ADPL 4PGEB 5D7LE 4J8RA 3BO8A 4HWBL 4S1RH 2MPAL 3RVXD 3BVNA 2ZUQB 2ZCHL 3T0XA 2ZCLH 5FKPA 5C09B 4KGJA 3WFCH 4Y4HC 4P2RD 1W8NA 2HKFH 4IRSA 1G9NL 2LU4A 4N5EC 1RUKL 3JV4A 3P0GB 2A77L 4H88H 3UZVB 4I18B 1G7HB 3V52H 3D69B 2ZPKH 1FC1A 3MACH 3N85L 3N9GH 2FR4B 2DLEA 5DWUH 1Z3GL 3KPMA 1KLGA 3L9RA 4PRBB 1LE9A 4XXDA 1V7ML 3HE7A 2V2XA 2DL9A 3HNTL 4GKSA 1Q1JH 3MRDB 4MAYB 4ZSOA 3NCJH 4X6CF 4YXHH 2OQJB 4XBPB 5BW7C 3WKGA 4AIZA 1GAFL 1MFEH 3GJFB 3DVGB 4X8JA 2CMRH 3UBXG 1A1OA 2XKNB 3HPLA 2JF1A 3ROLB 4M7JL 4J6RL 1JGDB 2W65B 4HFUL 1NCDL 5IT2L 1F4AA 1NANH 5D6DC 1U3ZA 5ILTH 3ULUF 3IF1B 1TFHA 4JRYE 4PJBB 4AENA 1CBVL 4PIRF 4WVCA 1GGCL 5F9JA 1I9JL 4QTHB 3TT3H 3IDIA 4LU5H 5JXEA 3BSZH 3TV3L 3L3DB 1X5YA 3RL2A 5GIRA 3Q6FA 3F62A 2FJGA 4NZRL 5T3XL 5TGBA 2P8PB 4X7CC 3AFLA 1WGOA 4XPGL 3THML 4ZQKB 2B1AH 4FFVC 5IVXB 3WC3A 3LS5H 3HR5B 2IPTL 4G8EB 4G9FB 2DD8L 4OCYH 1FP3A 3ANJA 2VE6B 4JHAH 4XP5H 1LE5B 4OD1H 1GJIA 2VZSA 4BKLA 4YZFE 4M1CD 4NBYB 1P53A 3D48R 4PJDF 4C59B 5D1QA 3C5ZC 1OQOA 3IDNB 4QRPB 4YLQT 4HULB 3BWUC 2V2WA 5LBSL 4KI5F 4PLKC 4R4FL 3TA3C 3OKYA 4YAQA 3AUVA 3QZWG 1NFDB 3QUZD 4KY1L 2J8UE 2V7HA 1QFWM 2XZAH 1C5BL 1FNHA 2Y6SC 1Q94A 1EMTL 1REIA 1MFDL 2H26B 3MUY1 5KANG 3O6LH 1DLFL 2B1AL 3IJSB 4N8VG 4PB0H 4U1LB 3S35X 1CXKA 5IG7A 3RVVC 1F9DA 3KJ4C 1JV5B 4XVTH 1JF1B 4E5XA 5L2KD 1A0QH 5MP6L 2EEBA 2AAVA 5FGSA 2VDRH 4MAUL 1PJ9A 1MQKH 4ONGL 4PRID 1YYLL 5E5MA 1EVTC 4NZTH 1DVFD 1A21A 5AUMA 3P11L 1UJ3A 1XEDA 2F53B 5EOQL 4ZOCA 3W7TA 3RIFK 2Q76A 2X4TB 3ZHKA 4MGXA 3TA3D 4G43A 1OAUH 2QADD 2H9GA 2X4QA 4YWGL 4WFFE 2BSSB 3IFPA 3ZE2E 3G5VA 2AEQH 3QUZC 2UZIL 3GM0A 1AJ7H 4NBXB 4P2OB 5AZ2H 4XWGL 5I66A 2P44B 1F58L 2F5BL 5EBMA 5CBEB 3NA9L 2QTEA 1QOKA 2FIKA 3V4PH 4L8SA 4XTRC 4RBPK 1RY7B 4HK0A 3OAUL 2X9YA 3E1F1 3C60D 2HJFB 5I1HH 1ZANH 1KKTA 2R1XB 2OYPA 3ZYZA 1ZA6A 4XP9H 4TTDD 2ATKA 4Y2DB 1ZHLA 3QUML 3QRGH 3EDDA 5JXEC 2W0KA 5TF1L 1PD6A 4U6HB 4MSWB 4OQTA 1I8KA 43CAA 1UA6L 1SEBA 2JB5L 1P7KA 4AY0A 1JHLH 1IKFH 4OZHE 2I07A 3EFDL 3C08H 3B5GA 4XC1L 1WBZB 1AXTH 2UZIH 4HJGA 2VZOA 4LDEB 2O5ZL 5GRJH 3IDYC 4WVAA 5L9DH 5EO9B 3ABZA 2YXFA 5SX4I 1QFWL 4PFEA 1HWGB 2DYPA 4IEFB 5DJ2B 4K7PX 3A6BL 3V6ZB 1HH6B 1P4IH 2UWEF 4AEIH 4WEUD 4X9BA 2PN5A 32C2A 4ELMF 4PJGA 2CO7B 1M7DA 3BPLB 3OTTA 4NNYB 4E41E 2ZNWA 3EYSL 4KUCD 3JWOL 4QHMA 3QUMH 3ES6A 2OCFD 1X4XA 2X10A 2KUTA 3VA2C 1LP9B 3HB3D 2D5JA 3U9PL 3GLYA 1MCPL 1QEWB 1T1XB 2IAMB 3IRZA 3S4SB 3O2VH 1K4DA 3E2HC 2C1PB 3Q6GL 4ONHB 4M4PA 1Q72L 1XGRB 3DMMB 2CK0L 3NBNA 3O3EA 4PJ5A 1INQB 2GFBA 3I6GB 3OWEA 3TNNA 5SWSD 3ZDZF 2XN9E 4D0DA 4G42A 2XZCL 1H5BB 4NSKA 4HKBA 4AEIL 1F8TL 5C0JB 1F3DH 1KN4H 5ABDE 2ICCA 1U3YA 3EYSH 5TE6L 2Y5EA 1L4IA 2CLVB 4LHUG 4Z95L 5T1LD 2CQTA 2BK8A 1YN6A 5C92A 3RRQA 2JB6B 3OKEB 1CDHA 1MI5A 3CFJA 1UM4L 5IOPB 1V3MA 1KN2L 2JG0A 2C3WA 5DMYA 1MJ8H 5SWZA 5IFHL 5EUOF 4F7CB 3MA7B 1IGMH 3VXOA 1TZIB 4BFIA 4B7LA 4PRDB 4CAGA 5FOBB 4QY8B 1QPPA 4LQFH 4G5ZH 4Y1AA 1FG2A 3T3ME 4QT5A 3BFOA 3V0VB 4S2SB 5FYKE 3TT1L 3WKHA 1L7TH 4PJ7E 2YK1L 2G5BA 1U3HB 3T1FB 3WSQL 4HWZB 3Q2CA 3QISA 4K9EH 3KYAA 1Y6KR 3EYUH 2WAHA 2D2OA 1IEAA 4JB9L 4J3OC 2JELH 5FUOH 3RZCB 1RZFL 2AXGB 4LSSL 4Q88A 4QEGA 5M7QA 1FL6A 1MIMH 3EOTH 1PAMA 2K9UA 2QQKH 4FQ1L 1ORSB 4H25B 2HRLA 5IQ9B 2PF6A 3P9LA 1ADQA 2E7HA 1ZEAH 3OPZH 4R7NB 3TO4C 4CW1A 3H42L 3U0TA 4DN4L 5C0IA 4OJFL 4AT6A 4PJDE 3UBXB 3OXRA 2Q3ZA 4WDIB 4ZPTA 3VXUB 4PJ5E 1IGTA 5HHQA 1B0RB 1SM3H 2RHEA 3CVHB 5FYJL 2WV3A 5HHNA 2C3GA 4WI5A 2XN9A 1JZ4A 2XY1A 4LLDB 3C09B 5BRZA 3KXFB 2EIZA 4G6ML 5IHUL 1G9NH 3QUKB 3GSXA 1NEZG 4DKFL 3TWCH 3WXWH 3ZTNH 3SKMA 2W9DH 3ULVL 4G8FA 5IJVB 2UV3A 4QRRA 4XNMA 5IVOA 5CJOL 4ENEC 4KKLC 3HI6L 4RMTA 4ODWA 1BQHA 3TF7C 1HSAB 5C07A 4MNQD 3ULUL 2DM4A 5FO7B 1YEHH 2YS4A 4Q58C 1IT9H 2RCSH 3WHE0 3IDIB 3VW3L 4NDMA 3TM6A 3J8F7 4P2OC 5DJXA 5DZOA 2WLYA 1MJ7L 2ZOKA 3N1FC 2FBAA 4XGZB 4O00A 5B39A 5JPMB 2HWZL 4JLRB 4PJIB 4MCZA 1A6TB 4JPVH 3O0RL 4ZS6C 4OV5B 3W39B 5D71H 5I1IL 4OCMC 1KG0A 1NGQL 3C2AH 1OTSD 4LIQE 4NHCL 5HDOA 2IADB 3RHWK 1QSFD 3EO1B 3LSOA 4LKCA 4MDJA 5DSCA 1IAOB 1U8PB 4JM2D 1IQWL 1KCKA 1U8OB 4XXDB 5D2LE 1K6QL 4J7RA 4MLIA 3PL6A 4EI5C 1KUMA 4U1JB 3VRJA 3QEUA 1GIGH 1ZK9A 5INDB 3T65A 5KS9E 5CZKA 4JDTH 4JFHD 3UXFA 3X11B 4L4TA 2YD8A 1RIUL 3E6FA 3U4BL 4XPAL 4BQBA 5KSBF 1ZLUK 4OF8A 5MEOB 4NWUL 4IRJD 4HS6B 1Z9SA 3NGBC 1CICB 2LQRA 5J57B 1MLCA 3O4LD 4E41B 1A3LL 5JOPD 3B8YA 2HT4D 4OGXL 5ACZA 5J8OA 1OP3H 3HKFA 4EQ2A 3GSQB 1CFVL 3C2AL 2IQAA 3NOIA 1U8HB 4LOUD 5J13C 1AGCA 4YHLL 4G9DB 4FFYH 2VISB 2EECA 4WIQA 2EIZB 4HIEB 1W72L 4OFVA 3F7VB 4JQXA 4KY1H 3PUCA 3VD9A 2R2HB 4G7VH 5I74C 15C8H 5FO9A 2XKSA 5HHQB 4KXZH 4PB9L 4YX2H 4HKXA 5GRXG 2IAMD 2CDEA 4ONFL 3RAJL 4P3DB 2FJFB 1JPSL 4YDIH 5ACZB 2UWEE 3ARDC 2JK5A 1CL7L 2P5WD 1SJVA 2QV2A 2A1WL 2VXTL 4HBCH 3TCXA 1NGZB 2EADA 1G7JB 3RVUC 1H5BC 1CLZL 3GSNL 2VYRE 1X5KA 4N8PA 1A4KA 1VFAB 4IOFC 3R4DA 3DGGB 3MCG1 1EDQA 1KIPA 4HXAL 4UV7L 4YHOH 5DJ0B 4U1JA 3ZKXC 3L3OA 1MAKA 1YPZB 3K8LA 3LKQA 2YPLD 1W72A 3HPJA 1XR8B 2DDQH 5GSVA 1KB5L 5CJQH 4F7EA 4PJ8B 5A43C 5A40E 3IDMA 4PJ8D 4U7KA 2G5BB 1FNGB 3HAEA 3V0VA 35C8L 4NJAL 4OV5A 2A8ZA 1ROWA 1RJZB 4M1DL 4XRCB 1ZVSB 1JGEA 3VXRA 4POYA 1LNUB 1GSMA 2VO5A 2OP4H 3QXWA 4FQPA 4LPTA 1WU5A 4KRPC 4KTYA 1L9MA 2EE2A 4JJ5B 4ETQA 5IW6A 1NH6A 5EUOE 4YXKH 1S3KH 2OI9B 3LN4B 1ZA3B 4ZPVB 3P9MB 4MQXD 1CN4A 1V05A 3BKCL 1VKXA 1H5BA 1CFNA 1RU9H 3QUMB 1T2JA 3QUKA 4XCCL 1KXTB 3LRHA 1VADA 3UC0H 3WKMH 2B20A 1RZKL 1NAML 1H13A 5MI0C 4IMLB 1DFBH 1JHTB 3UZEA 3MLWH 1U8LB 4ZODA 3D25A 2NY7L 2P48B 4HGWB 3V6FB 2DLIA 1JGLH 2PNDA 1EO7A 4TXTA 3HA0A 2OM5A 3ZYIA 2LTQB 3OKOB 2BSRA 1CI5A 2EDHA 3NFSH 3H9HB 3UPRB 1E4WL 4GRMB 1CG9B 3QPQD 4XC3H 5IJKA 4X7TA 4JANA 3U7YH 5DMIL 3JWOH 1R3HB 1P1ZA 3LRGA 3G6DL 2EDXA 3MV8A 1S8DA 3QWTA 1UWEH 4PRHA 4N90D 5BCAA 5ANMA 4HFUH 3O2DA 4PD4J 1RD6A 1ITCA 4S1SL 3ANIA 4ZXBC 1IAMA 3ROOB 1UKTA 5EWIL 4LKXA 4DVBA 3G5YA 3LPGA 4GW1A 1ZSDB 1CLYL 3PHOB 4UZGA 4KXZI 3B9AA 2EO9A 1JCKA 3GJEA 2A6IB 3F12A 2Q8AH 2NY5H 1FVEA 2PTTB 2PW2A 3D9AH 3VWKD 1YECL 3T2QA 1UKQA 1LO3L 1W0WA 5C3LD 1GGUA 3MREA 3D0LB 3X12A 3H3PL 2EO1A 2HP4A 2FBJL 3ME0A 1HXYB 2I9TA 3GSVB 1YUHB 5F44A 4OZFG 1QSEA 1Q0XL 5FYLE 4PJ7B 4YBLC 1H3PH 3CFKA 4MD5A 5GRWA 3FTGA 3SBWC 5CJXA 1ZHLB 3HS0B 1FZJB 5KVEH 1MOEA 5I2IA 1ZA6B 4X4YB 4ZYKA 5B4MD 3VWJA 1UWEL 3Q3GA 2X1OA 1NLBH 1EAPA 4XPHL 3I02A 4XBEL 4NQCB 5CGYC 3B2VL 4UQ3A 5D1XA 5K9OB 2CLVA 2P1YA 1ZAGA 4AMKL 4KKBD 5C0BE 4IDJH 2GK0A 1UADC 3L5XL 5C0JA 3D6GA 1HCFX 2Q8AL 3PWLA 4U7SA 4U7MA 3RGVB 3L3GB 1BD2E 5CGMA 4GW5A 3AB0C 3GJFK 4XNZB 2C4FT 5T3ZE 2C4XA 4XCEA 3QH3A 4LIQH 2A6JB 3PIQB 2EDKA 2OL3H 4BZ1H 3T1WA 2LU7A 3O9WA 4NNPL 2JELL 3WXVH 2O93L 3DMMA 1ZVHA 4HKJA 4QXWA 3VG0L 3PGFL 3TBVB 4IM8A 1HHJA 1DQDL 4U1SB 1HNGA 4U6XA 1LEKA 2H41A 3GJFH 1T7VA 3HI5H 3MRPB 4YGVB 3ES6B 4MJ5A 3EOYG 2HKHL 4WI4A 5KSBE 4L8CA 1M7DB 2O5XH 4WO4A 5FCSH 1I1RA 1VEMA 2DQJL 4U4BA 3MYZA 3TO4B 1H0DA 5ANME 3CJJA 32C2B 4DN4H 3EGSB 1FO0B 3RI5F 3QFJE 3FQRA 4AQOA 5KVGH 4W6YB 2BC4B 3HMXL 3KYKL 1JNLL 3QDMA 5GSRB 1RZKC 4YXLL 2DAVA 5EB9A 1AJ7L 2W92A 1X5GA 2Z4QA 3QXAB 5E8DL 2QHRL 2AXJA 3MNWB 3UPRA 3RTQC 3HZKA 1K85A 2CIKA 2VITA 1SEBB 2YSSA 2VSDA 4JKKA 5KVDL 1TPXC 4RGND 3TCLA 1FORH 3QUXA 2BSED 5T1KA 1QBLH 3P0YL 1FGNH 2AK1H 1OAYL 1AP2B 1S5HA 2DIAA 5EORL 2BP3A 4KPHL 5I1JL 1BAFL 2R1XA 4GRLD 2GQHA 3S5LG 1BGXL 5DI8B 5F1OB 5FA4B 1DQML 1RJCA 1A7OL 3ARFB 1A6PA 1KTKE 5IWLC 4QGYA 3Q6FB 1MRCH 1HILB 2NY0C 5E4IA 1MCJA 2A83B 2L7UA 2GI7A 2YUZA 4D3CL 5EIQA 3IYLW 5E8DH 3PHSA 4OF6A 5C0DB 3PWPA 3QIBA 4LNRB 4G43B 3MMEB 3CLEL 5D96C 4P5TD 5F7NC 3BI9X 1YY9C 2XKNA 3CK0L 1UJ3B 1VD5A 3MV11 3PV6A 4JRXB 3OAYK 1JIBA 5CJ8A 3MLUH 3VFSB 4U2ZA 1MLBA 2XZQL 1Q9LA 2V7NA 4OF0A 3UMTA 5EC1A 2CUMA 3LKQB 3HTLX 3KYMA 1LE9B 1LDPL 2JJUA 4Y5XB 4X5WB 3S3JA 3Q6GH 3GBNH 5JW5A 3SGJC 3VFUB 1EUUA 4WTXA 2GYSA 5BVJA 3OZ9H 5FECB 3O9WC 5I19H 1BD2D 1P2CA 1T5XB 3E6HB 1JZ6A 2MKLC 4JFFE 4PRPB 3C09C 3G5XA 4TQEH 4MJIA 1CXEA 2V7HB 2VRAA 3CFIC 3ULVD 1DL7L 4QHKJ 5DMGD 1IC7L 3FCTA 4UAOB 5DQJA 3EFFA 1MCLA 1QP1A 2DF3A 2FV1A 1RIVL 4GRWF 5TH2B 3NCYP 3W11D 3D2UA 2AJXL 2XOTA 1RFDL 4N0YL 2E9BA 2R2HA 1LDPH 3JV6B 5FKAA 1SJHB 4U1GB 3VRLF 3PJSB 5HHOA 5GGRB 4M1GH 3VG9B 4CU7A 1AR1D 1FZKB 3O2DL 5F1IA 3HR5A 2MFNA 3GMQA 4APQA 2VDQH 1OAQH 1RULL 1K4CA 3KPLA 3IJHB 43C9A 3GSQA 4UINL 5FDWB 1R24B 2AEPH 1EZVX 4KZEH 4TPRL 2DIBA 1WWBX 4ODHH 2YA2A 2ZUVA 1T0PB 1VACB 4RAUB 4M7ZC 1HQ4A 4WV1C 1JN6B 2HTLD 5CHNA 4L4TB 3CDGA 1DBBL 1AHWB 3NTCH 2DBLH 3T65B 4PJEA 3RVXC 2F8OA 1CDUA 1X6NA 5IFAH 2NY4C 3LB6D 3KJ6H 4XX1E 1HZHL 4HH9A 4NRZB 4RFNB 1CR9L 4YHZH 3VG9C 3MRDA 1Z9MA 5DEZA 1MIML 3EOTL 4ZO9A 3OGOE 3RUGF 4CVZA 5DWUL 4P2QE 1Q0YL 4OFIA 4X6FA 3EO1A 2FHBA 2IBBA 3C5SA 2OR7A 5LG1A 2VDOL 4ODUA 1TDQA 3WHE1 4O2FA 4ZFOA 5KG9A 2Z31C 3OKDB 2X89D 4UINH 3BEVB 4JRXD 2CGRH 2N1KA 4O2FB 5KG9B 2IAND 3FRPA 5H37G 3LDBB 2C9AA 4PJIA 3MRCB 5EZJA 4DKAA 3TZVC 4JFFA 5GQBA 3RU8L 2R0KL 4I2XB 2CDGA 3QP3A 1MFDH 2G2RA 3TGXA 1NEUA 3PNWA 4HQQH 5IHUH 2PO6D 1KC5L 5DT1L 1RZKH 1IEHA 3CDGB 1YEEL 3RFZC 5JW4R 3K0WA 1NQBA 1PG7X 3R0NA 1D9KA 4JZOB 1HHKB 5FF6B 4ODWB 2ZCKH 2VR9A 4UQ2A 4QRRB 4RAUA 4G8FB 1PQZB 1FVDB 5JOPE 1SEQL 5DGQA 3GHBL 4X7SH 2DBJA 1WT5A 3UP1A 5AEAA 1WZMA 4MQ7A 3UBXI 2VR4A 1FAKT 4WY7H 3MLTA 5MEPB 2DD8H 3H9SA 5GS0D 3LEXA 5EU5B 3VFVB 2X7LB 3WHXA 1RZIA 1JHKH 5DHXB 4RISH 3T0VA 4CU6A 4UOW0 5LBSH 2BHUA 1HHIB 3B2UC 1A7NL 1IQWH 2I5YH 1QSFE 3SDDB 3RY6C 1ZLVH 5EIIA 2MCG1 3QDEA 3PQYA 1NBVH 4ORGB 4AM0B 5EUKB 1KSDA 1T22B 1X44A 3X17A 2ZWLT 1PKQA 3OG4B 3VFGL 5FXCH 4LQ1A 1FFOA 3ESVF 4NN6C 5I1HL 2E7LC 4MD0B 4NYLB 2X9WA 3SCMA 2IMNA 3QDGB 2DQTH 3VFMB 1UXSA 1IEAB 4GRWH 1V7XA 4JREC 3F7YA 4WTZA 1U58A 5J9PA 2AJVL 4GS7B 2HFFA 5GPRA 1K8IB 4R8WL 3P4OA 3QIWC 2AXHA 1N59B 2DQEH 1C5DA 4U6TA 1NLBL 4MNQE 3TNMA 3EO0B 4L4VE 4OCWL 4HPOH 3VFRA 1WCBA 4AMKH 4CVWA 5GRJL 1FO0L 2AXFB 1LO0H 2VLRB 4M7ZB 4JFEE 1Q9LB 1MLBB 3IDGB 4X7DC 5GY3A 1I85A 3CU1A 4KK6C 1BF8A 1DQJA 3SDXE 4V1DE 1IAIM 4NZJA 3SO3B 3U4AA 5IOPA 5TDPB 2VXQL 3ARYA 4F3FB 5K9QG 3PWUB 2I60H 4OT1L 1MAJA 5KSUB 5GRYA 2HVKB 4O58H 1SQ2N 5GGSY 1MF2H 2VSCA 4BH8B 3IVKA 4U0RB 3UX9B 3BW9A 4JO4H 5HYIA 3SDAA 4HUUA 3OAUH 1HHHA 5FA3A 1MRDH 2NTFB 3S8WA 2Q20A 2H45A 1CLZH 4C57C 4MHHG 1JGVL 4HEME 4MNHB 4QRTA 1AC0A 3U1SL 1QYGL 3CFEB 2V9TA 3QWOA 4OUUA 5F7EH 4PJ8C 4HLZG 1J05B 4WI7A 4N1HB 4KK5D 2YD5A 2ZP0T 1J0IA 4PJGF 1T1XA 2IAMA 5J3HC 1I3GH 1XF1A 5IV2B 4KUZL 1JNLH 1ZT4B 5TFSH 3BPOB 2C3HA 1U92B 3F5WA 4PG2C 4UILH 4P4KD 4TSBL 4JVPA 4LEOB 3WDJA 1G7PB 4KRPD 1T83A 5KSVB 2QADB 4MXWH 5FYKD 1IBGL 4XAKD 2ZUYA 3T4AA 1ND0B 4XVJH 4A6YL 4GMSH 4ZTOH 1FORL 1JGVH 1T0NB 1XF4A 3KLHC 2Z8WC 3I3BA 3LN9A 3CCHA 5J7CC 3WIFB 1G7MA 5D2NE 3GMNB 1YEJH 4TOYH 2AJSL 1OLZA 4FN0A 1MFCL 2K7PA 3MRGA 2YA0A 2CLRB 1VFBA 1DDHA 4M5YL 3EYVB 5JIKA 43CAB 1UWGL 3B6SA 3MRPA 4YGVA 5J6GB 3BYTA 4QHNB 4LCUB 5C70A 1XCTB 4X6DA 3U4EB 1CT8A 3LKOA 1MRCL 1Q72H 4JB9H 5ISZA 4AH2A 2ZG2A 2VLMD 3AAZB 1F2XK 4NUGL 5DD1L 3P2TA 4OZGE 4OLZL 4K3JH 5IB1A 1F4HA 1KPUA 4MQSB 3TO2A 2AJZA 1J86A 2A6JA 3VXMB 2XZCH 4N0UA 4FXKB 5FGCE 3ZYOA 1KFAL 3HNSH 4LHUB 1GRWA 3TN0B 2Z8SA 4NKDA 2EH7L 4MNGE 1RJYB 3BH9B 3VMNA 2FEDD 2VN7A 4P2OA 2DWDB 3RIAK 1B2WL 2A6KB 4PJAE 4WCYL 3GSUA 1KRFA 3C5ZB 1ORQA 4KKCC 4Y16B 1ACYH 3MRHA 3PABB 4R96A 3OKLB 1XGUA 5HYSA 3DUSA 3LCYA 3ARBB 3MRMA 4BZYA 4CN4A 2JJTA 2L7JA 2F53A 4S11A 1CVRA 2VXSL 1FZOB 3KNBA 5EBWA 1I7ZB 4KHTH 5IEKA 1OSZA 4KDVA 4TQEL 2I26N 4I0PB 5J6GA 3GSVA 3B6SB 3WV0A 1MCRA 3KWWA 1YECH 2IPKA 3K4DA 3DBXB 3QI9C 1HI6B 1DBJL 1NGYB 4CN1A 2NNAB 2ZG3A 3OXSB 1YEHL 4QF1B 5CP3H 2CKNA 1V5JA 1NCBL 1B2WH 3BUYB 4TULL 3AY4C 4U1MA 5TPWL 4RAVB 5CD2A 5KKBA 4X80L 1EUTA 3T09A 3E6UA 3P40A 1YPZE 1RUPL 1P6FA 5E9DE 3CLFH 4FUSA 5FK9B 5D72L 4C56A 4ZUTA 3RVTC 3S4BA 1U8JA 3PHQB 2VOTA 3QQ4B 4XNZC 3GDBA 1KJ3L 5IB5B 4EBQH 3VH8A 3V5DA 2OR9H 2NX5E 1OGAE 1K3IA 4R4FH 3HR6A 5CIPH 3R8BB 5HDQH 1BVKA 3T0EA 2NZ9C 2AEPL 1WAAA 1T03H 5D6CA 1MUJB 1NCCH 4LSVL 1LE5A 3RZCD 5HI4C 1C5BH 1EPFA 3QO1B 4PGJA 4Y5VA 2DQDL 2XG5A 1FAIH 2UYLA 1EMTH 1RHHA 4YHYC 5JHDA 2A73B 4P46A 1T3FB 2VXVL 4YK4B 4D2NA 2BFVH 5IB4B 2CUHA 1A0QL 3O4LB 4E41D 1BLNA 1EK3A 4G80B 5LCVH 4X4ZA 4IRJB 4P2RA 3CSBA 3D39A 4H1LB 5FM5M 4C4KT 4FFZL 2HVKA 3P73A 2Q3AA 3O4LA 4K55A 4KJQD 1L7IL 3PWUA 1K72A 4JM2F 4F8TA 2NY1D 3VJ6B 5L6YH 3QEGH 5LWYH 3HPLB 2G75A 1TJGH 5E7BA 1P9MC 5CFHA 4LLVA 4M3JA 4JAMA 4BSWA 3V0WL 4KK9C 4GKSB 3KPOA 3K1KC 5D71L 1V7WA 2DQDH 2VLKD 3C6LC 2GK2A 3QHFH 1BECA 3AGVA 3VFRB 4WUUE 1UACH 3CVIH 1A6UH 3O3BA 5F9WC 1UQSB 4KJYA 1YMME 3NA9H 1CL7H 1CE1L 4UT9H 4FQQA 4ZS6D 2G60H 4IIQC 5GSVB 1MAMH 2AP2A 5HVFB 4G6AD 3GMLA 4BA8A 1MHHA 2IH3B 5E2UH 4IRSB 1YMHA 3OKMB 1T7XA 4JM2C 1V3LA 3SGDI 1T22A 1YJDL 1Q9WB 4PGCB 3L1OH 4G6KL 5D7SH 2HT2C 4QF1A 1F02I 3BVNB 2DJ4A 4RFOH 4BSVB 2NXZC 2EH8H 5DLML 1R5VA 5HHXL 3S37X 1IL1A 1CFVH 3L5HA 4PGEA 2JK5B 3FONB 2VXUH 5MEND 5JOFB 2CK2A 3TIDB 3S4CA 2MHAA 4JRYD 1V3JA 5J0BA 1NC2D 2F19L 5FUCC 3MJ8B 3NCYS 5DD5H 3VGFA 1E4KC 3ARBA 2NY5C 1BFSA 1MWAH 3QIUB 5CINH 4P9HC 5C9JB 1QR1B 4P2RE 3T0EC 2GJJA 3MRHB 1OAXH 5IVXF 2Y06H 3GMMA 4Z7QF 1M7IA 3Q5YA 1N8ZB 5F93C 3RI5K 3T2OA 1MCSA 5CEZD 3R1GL 1U8HA 1EEUA 5C0BD 5I1AA 2B2XH 5E8OA 1AKJB 1FV1B 4HX1A 5F72S 4PJDB 2Y36H 3TN0C 1JE6A 3BIKA 3L3HB 4HPOL 3MV7A 4H20H 2VLLA 1BBDL 2APVA 2HJLA 5I9QB 1NAMH 3UYPA 3MNVA 2R15A 1DQQB 1CDIA 2GHWB 2O5YL 3DLQR 4YHPA 3BHBA 1VGEH 1YEGH 3LKPB 3GBMH 3LKSB 5DRWB 4Y8DC 1LVEA 4LSTH 5AYUH 3ET9F 2I60L 4OT1H 3AS3A 4ZSOE 4BFBD 2X4OA 3QEQD 1QHOA 3EDJA 5FUCE 3MJ6A 4NQDA 1O0VA 2GSIB 4M7LL 3ULUE 1N5YL 4P59H 1RZJH 2IPUK 4JN2B 5LXGH 3VWJC 4X6EB 5SWQA 4L9LC 1CGVA 4YFDB 5I1LB 3GSWB 5D93C 3GSRA 4Y19E 4NM4H 3GO1H 1PGRB 1CD1A 1ND0A 4C83A 2ATPB 2PXYD 1X5IA 5IROC 3ANKA 1U3HC 1VACA 3FO1B 1P5VA 4LGPB 4Y8AA 5FO8A 2LU3A 3SKUD 1S9YB 3B9VA 2R9HC 5C09D 3SE9H 3GGWA 1D6EA 3RQ3A 4W70A 4MJ6A 1G7LA 3EBAA 1UZ6E 5IJVA 4K71B 5C0NC 4XPTL 1HK6A 4OM1H 1T5WB 1H8NA 1IARB 3RWEA 1GLMA 5F6HI 4ELKB 1C16A 4XVJL 1WWWX 2C3XA 3MCLH 5D93B 2Z8RA 5HHNB 2VKWA 4XBEH 1DBAH 4QRUB 1M4KA 2MSPA 3SGEI 4MNGB 5E94B 3RWFA 3B9KC 4FQ1H 1X9DA 1OTTD 3OXRB 5C8JA 4ZFFA 4XCYB 2D3VA 4R26H 5KSAD 3EFFB 3T33A 1WJ3A 3G6DH 4H8WH 4WFED 2CKBB 4PJAF 1U41A 3RGHA 2MQ3A 4PGZA 5T1LB 2C7UA 3FT3A 2OTWA 3RVVD 5JUEH 4DKEH 4NO5B 3L7EB 2R0KH 3QT2A 3MJGX 2AXGA 2XRAH 2F54B 2BOCB 1MCBA 4S1SH 2SEBB 1YN7A 5CEYB 2DYPD 2FUZA 1B90A 1GZPB 4QOKD 1FYTE 1B4JL 3PWVB 3TWCL 1KENH 1K8DA 1XGQA 3O9WD 1S7RB 3KYMB 3D9AL 4Z77A 1K8DB 1CFTB 3N06B 4LPWA 1LK3H 1BX2A 3PWVA 1LEIB 2VDLH 2V7NB 1QBML 4CJ0A 5FYKU 4TSAL 2MCPL 1WC7B 2APTA 3ILPB 3FN0H 4YE4L 5DUPH 2W38A 4S2SA 1G9EA 3OR6B 3CAFA 4JN1L 1FNEB 3GNMH 3MLZL 2AJ3B 3GIZH 3G08A 5FOBA 3X3GH 4PRDA 1EIBA 1MREL 4N9GA 3MFFA 5AD0A 2R39A 3R0MA 3S3PA 2APWA 2DROA 3D85D 3MJ9H 5CD3B 2O5ZH 4ZG1A 4U1NB 1MCKA 4K8RC 3AMKA 3MR9A 1JGUH 5MHSD 5BS0D 3DIFB 2FNBA 1R3IL 4OB5L 3QIWD 5I0DA 2UY7A 5KVDH 2VKXA 3DROA 4I0PD 2OJZL 2DQUH 2W9EH 3I3EA 5IB3A 1SBSH 2OL3B 1GIGL 1FGNL 2AK1L 3P0YH 5DMKA 2CUIA 3IU4H 5IROA 1AP2A 1S5HB 3O6KH 5C1MB 1INQA 3I6GA 1Q9OA 1FSKB 3GMRB 5DEGA 4X6BA 3QIBD 3DTXB 2PYEE 5TQ0H 3B4NA 3BD5A 1ES0A 3ISWA 5D72H 3MFGB 1J8HA 3FO1A 3GT5A 3S4SA 1FBIL 3SGJA 5BQ7B 5DK2B 4ERSL 2HN7A 3KYOB 2E3VA 1CD1B 1JNNH 1ZOXA 5INCB 5A16A 5E8EA 5F71A 1ZHKB 3GSWA 1BOGA 1R3IH 2JJSA 3IFOB 3KR3L 4PJGB 3LD8C 4HPYH 5DC9B 2CDGB 3CLEH 3QG0A 5F3HA 2YKLH 3HMXA 2XFXA 4JFXB 2BNRB 1LEGA 1F8TH 5HJ3A 1FFPA 4WGWB 1MCEA 2YUWA 1WLHA 3QDJB 3IU4L 4NQDB 5KS9F 1F6FB 1WEJL 4FTVA 3QXDA 4R90H 4KZDL 1OSPL 1FH5H 1LEKB 4TNVK 1VEPA 1HYRC 3ARED 5J3HD 4CNIB 1WBZA 2VQTA 3BHBB 4IRJC 1MRDL 5IFHH 3HUJB 5F7DB 3EYQC 3MRIA 4BFEA 4Q9CA 1FBIH 4C55A 3O9WB 1B0GB 1RZGB 3VA6A 4NRZA 4HH9B 1KS8A 5ADPH 2PW1B 4L29B 1BWMA 1DQLH 1LDSA 3BN3B 4Q6IC 2YRPA 5D2NC 4RAHA 2PXYB 5GGVL 3L3GA 3WFDH 2ERJC 3LOWA 1BFVL 1IC4L 1VPOH 2DLFL 5DC0A 4MWFA 1NAKH 4Y4KB 5K9KB 1AFVL 2GK0B 5CILH 25C8L 4JEGB 5IMMB 2J4WH 3EYOB 3FB5A 2EEDA 3V9FA 3V52L 1LILA 2P49B 4Z5RB 1XF3A 3TC9A 2KDGA 4LPYA 2G60L 4NM8H 5I2IB 4HS8H 5GGRA 1BFOA 1D5BA 2QR0B 2PYEA 3FTGB 2H9GB 5IWLA 4PJBE 1DUYA 5JOFA 5I8EA 3WFHB 2YEZB 4Q9RL 4PJ5D 3FONA 1QSEB 1QSZA 4MXVE 3EYQD 1YUHA 4JM2B 3RPKA 3ARUA 1DLHA 3L3IA 4BUHA 2FZ3B 5E6IC 2ORBH 4F7MA 3V4VH 5E5MB 4YEFA 4ODHL 2XFGA 1FNAA 3W81A 1MPAL 1J10A 1HINH 4KWUA 1MQ8A 2XG4A 4TVSa 3UJTH 1UEYA 1T20B 4LHJB 5HGBB 1JWMB 4MA3A 3LQAH 4U1IB 1OF2A 3VE0A 1A14L 5EDXA 3GMLB 1CBVH 3KYNB 4X7EC 4WEMB 3NN8A 2P0VA 4FQQB 5FIEA 3MO1A 1GHFH 2AKRA 3HCVB 2Y5TB 5IHZA 4YH6A 1YEDA 2D4FA 3NFSL 3QCTL 5BJTA 5C71A 3K1DA 1MWAL 1IT9L 4XT1C 5GZND 1AQDA 5DVKA 2LAAA 3FOMB 3TFKD 2R0WL 4U1KB 4WU7A 3KPOB 4OCYL 4NGHL 1GAIA 3MA9L 3VFSA 5SX5H 3PV6B 4JRXA 1HINL 3WE6A 4Y88A 2CXGA 2QKIA 4M3KB 4OLXL 1A02N 3LQAL 4OGAD 3KLAB 4NHCH 3RSYA 4JCMA 1OT2A 5C0RH 2Y72A 2WUBH 3V2AR 2C5DC 3RY6A 4DZBB 1VKXB 5TE7L 4Y4FC 5MEQB 3WFZA 3STZA 2JCCB 3REVB 1EO8L 2H2PD 5GIRB 1T3FA 2JCCA 1F4XL 4NO0D 4QGTA 5JHLL 2BCKB 1WICA 4K7FB 4Z0BL 1ZGLA 4LGRB 4V1DD 5E1AA 3LHPL 1DL2A 5GGQL 5HPMB 1HEZB 1MUJA 5D6CB 3KJ6L 3ALPA 1RUPH 5E2VL 2VDRL 4YHZL 4I48B 4HIXL 3FHAA 1A1OB 3NIDF 3SE8H 5C0CA 2HTLC 1OLLA 3SQBA 1NCWH 2DLHA 3RY4A 3TJHD 3WNKA 5HDQL 4MA7H 5JR1H 2V2XB 4OGAC 1AGFB 1JPFB 4GRLB 5HGDB 4NC2B 1W72H 3VMPA 4JRWA 5BJTB 4PRPE 3GEWB 2P5EE 4YWGH 4WJ5A 2AJUL 4LVOB 1A9BB 2FR4A 3D3VE 3S97C 3KPNA 3D69A 3DGGA 4NO0A 1YDPB 1EEZA 3RIAF 4Z0BH 3KYNA 4NJ9H 2D7MA 3OXSA 1I7UB 4EDWH 3ZSSA 1JWMA 4MA3B 2IPKB 1T20A 4Q0XL 5CS7A 3IGAA 1RMFH 2XY2A 3UTPD 5J89A 4NOFA 4OCLC 1KCSH 1FZOA 3KNBB 2CDFB 1MFBL 1J5OH 2CDEB 1H3WM 3QXUA 4XP9L 3ZMRA 1S9KC 4OZHA 4PTUA 5E70A 1I7RA 1IAKA 1JPTL 2Q86A 5HI3C 3VFTB 2EDRA 5TF1H 2NY0B 4Z7WE 3BP5B 4DEPB 2D0GA 3ARTA 1D9KC 1QQDA 4PLJC 3KXFE 4RISL 4QOKE 5LKNA 4OZGF 4JY5L 4GKNA 3JTSB 3UTSB 3FRUA 1T7YA 1TNMA 2MTPA 3BH9A 1A47A 1INDH 4XMLL 1T83C 3RDTA 3VGEA 4AL8H 1QFHA 3CFDA 4N0UB 4ETYA 5ICXB 1QRNA 1A1NB 1NUFA 4PR5A 1KCRH 2AJZB 1P4IL 2FD6L 3SN6N 4DOHB 1G0YR 1WQVT 4XCNA 4U1HB 5CMAA 3DURB 3X11A 3LPWA 2PW1A 4AH2B 2ZSWB 5B3JE 5ISZB 1U93B 3HZMA 4WGVB 4YBQC 3HMWL 3HZVA 5JMRA 4G8GA 3H7BA 3DX7B 1MCPH 4S0TD 4HUVB 3X12B 1MREH 2DKUA 4HKZA 2FL5B 1J7VR 5BS0E 3MRGB 3M8OH 5HHXH 3WLWD 1DEEA 2PTVA 2IPUG 3WN5A 5DTFB 4UT7H 3BT2H 3GJEB 1LO0L 3CCHB 1KG0B 3W39A 3CC5B 5GGTL 4LLAA 1BZ9A 1KBGL 3GFUA 2VQ1B 4MVBD 3G9AB 1DR9A 1MCOL 5CJ5A 4PY7A 4GBXC 3H9YA 4MA8H 5FYJU 3LEYH 5E95B 2G9HB 1EEYA 4GG6F 3MV8B 1U8IB 5GHWL 3VWKB 4J1UA 3HC0B 5MHSE 1TLKA 2AEIT 1GZQA 3C9NB 4I0CC 1PZUB 1JFQH 2PYFA 5IV2A 5BQ7A 5D7IA 1UA6H 4GO6B 4XNMB 4BQ6A 1HXMA 3H9HA 1INEH 2YD6A 1IKFL 1FZMA 5KTEL 1MSPA 4N5UA 4U0RC 4D9LH 2UUDH 1CFBA 5DURD 2XXMB 4G5ZL 4OLVL 5IR1A 5B8CC 4WFGE 4LPVA 1KGCD 2F53D 1I4FB 2CIIA 1TCRA 1HOCA 3WLWC 3TT1H 1RK1A 2W0FB 2EKSB 3QZWA 2DMKA 4JPKL 1I4FA 2CIIB 3A6OA 1F4YH 2P8LB 1WWAX 3SKJH 3A67H 4P46C 1NEZB 2VR5A 4QKXB 1OP3K 4E42B 4WDIA 4XVUD 2B5IC 5IB3B 2DQGH 3DROB 2J3SA 4FG6C 4I9WD 4BH8A 2R2BA 5C0IB 3BP7A 4LSTL 4PY8J 1JWSA 3W9DB 4M6OH 3I50H 2RAMA 1FYTD 5IW6B 3TF4A 1KPVB 1U8IA 3AS1A 4YO0A 4M7LH 3PE9A 3VRIA 5CD3A 1OCWL 2VNCA 3NIDE 5KTEH 2XWBB 1J1PH 5IGXH 1N6UA 2AJ3A 5HBBA 2NY1B 3ZL4L 2VXSH 3BPOC 5EA0H 1V7VA 4G6AC 3TNMB 3NPSC 2FGWL 1SMAA 1KXVC 2WLZA 3MRRB 3S35L 5I1GL 1CD0A 2QADC 4D9RD 2HFEA 5E2TL 5D5MB 1JZ7A 2P43B 4S1QL 4M8VA 1H8OA 5TE6H 5C07E 1UCBH 3I50L 4G6MH 5GGVY 3VXNA 2GIYA 2GT9A 4DQOL 5DJAA 1FFOB 2XWBA 3DURA 3BZ4A 1XWQA 4N0CD 4LSPL 1XGTB 5EIIB 3L7EA 4LLMA 2H2SD 4P5MA 1KFAH 5D4QA 2QEJA 4ZAKC 2JIXA 1MFAH 1U0QA 4Q9RH 5F9AC 5E0QA 2ZSVB 3LN5B 5C8JB 3SHSA 1ZT7B 5DO2D 2X4SB 5F1SA 3U0WL 4YHIB 4KRNA 4PP1C 4GKNB 4MZ3A 4YHKH 5BMFL 3VGDA 2P8LA 3FFCE 2ZCLL 4ZUWB 4L4TD 4LCWA 2EYSB 5IESL 1I8LA 4LASH 2QHRH 1I7RB 1IAKB 2ICWI 2P47B 4XP6H 1A1MB 5EZLA 1FVDA 4I77H 3CFBB 1QEWA 4L6XA 2FATH 1CFQB 2ZBLA 4LAJH 5F8RC 4PV8A 2KZWA 3FFDA 3QCTH 1GZQB 1MFAL 1QZ1A 3C9NA 4J12A 4KMTH 1GGIH 1RJLA 3WUZA 3RKDD 4M6MH 4Z7UF 2G9HA 5TPWH 1BGXH 2AK4A 3CU7A 4F9PC 2ID5A 1A7OH 5DUBA 3FQNA 5F7YC 5IM7A 2F8VA 2VQ1A 1NMBL 1A3LH 3QQ3A 2A9NH 5EO9A 2GJ6D 2ED7A 4NZUH 1JPFA 4GRLA 5CEZE 3C5SB 1SYSA 1TZGH 5BO1H 2ZUWA 4Z7OF 3MLRH 3WXWL 4XNXH 4OD2A 3QAZC 1G6RB 3FAWA 3QT9A 4G8GB 1BREA 3HZVB 2CPCA 2EC8A 3ARQA 1KTDA 2ATKB 3BKML 3WMSA 5JPMA 4YHPB 4GRWB 1HEZA 4OGYH 1EHAA 4YR6A 1PG7H 1MJ7H 4XZUA 1D5MB 3MNZA 1MCDA 2V5YA 1FGVH 2ZOKB 4PR5B 5MENE 3HNVH 4LSRH 1LO5B 5J1AA 4FQJH 5IVXE 5MEHA 1N0XH 1R3JA 3DETC 4Z7QE 4OBRA 3N0PB 5C07B 5F21B 2QQNL 2XZZA 3NIGE 5IEHA 3AROA 4PJ9C 4U2YA 3KPLB 4ZD3H 5KANI 5L8JB 3UTSA 1N8ZA 1L7IH 2ED9A 2QLVB 3MUGA 4JHZA 4MA7L 3B2UD 4XNXL 5I8KL 1FPTL 4D0BA 6CGTA 3E3QC 1BJ1J 1DL7H 5SWSB 5D1ZD 3QUXD 4OZIE 1DEDA 2WNGA 3PL6C 4EI5A 3LPFA 3V0WH 5KSAC 5BXFA 4KJQC 2P7TA 4EVNA 2J8HA 3ARFC 2R29L 4P4KB 4AT6B 4KGLA 4EUPB 1NXCA 1OSPH 4WI3A 3IGAB 4IJ3B 4FQXD 5DQJB 1ORSA 2DS4A 5IG7B 1AY1H 2PO6A 1KYOK 4P3CL 5DQ9A 1KSRA 3KPNB 12E8H 4DGVL 1QFUL 2PO6B 3L95B 4LF3A 4QHUB 5JW5B 5CP3A 2RIKA 3QEHB 1NC5A 1NFDF 3FQXB 2IH3A 1TQBB 4M61B 4M6NL 1OAUL 1BFVH 3DECA 3FAXA 4G7VL 4OM0L 3IS0X 4Q97A 4HWZA 5IMKA 3QFYA 2NX5D 5DHVB 2A74B 4PJ9A 3PF2A 5F1NA 2R8SL 3NTCL 5C0CB 3DRQA 3UYRH 3IDNA 4OD3H 3NPSB 3UTTE 3MRQB 3W7UA 2F19H 2P4AB 2ZOLB 4RQQA 2FEEI 2YEZA 5SWSA 4UT6L 4ZTOL 3ZDXE 1FJ1A 1BFOB 1D5BB 4LNRA 3TH3T 3VXOB 4NM4L 5EZIL 4BZ2H 4FQXC 4Z5RA 3QIWB 3OAZK 4PRHE 4KTPA 2WP3T 1DE4B 4K8RH 2IBZX 3MV9D 3RL2B 1PSKL 3V7AE 5MENB 1BVLB 3NCCB 4UIKH 4C58B 4NN7C 4X6CE 1UWGH 2BHYA 3KPRA 1KJ2H 3MOAH 3UJTL 4HKBB 1G7QA 4OSUH 5HHVH 3GRWA 4HF5H 1F3DJ 1OARL 3KLAA 2JTDA 4P46B 5HHME 2OMBA 2HRPH 1AI1H 1E6JH 1M6OA 1IZKA 3NZ8A 2EDQA 2X44D 4FQIL 4F58L 2WM0A 4YHML 4CMHC 5A2LH 3QNZA 2E6PA 5L7XL 4P2QA 2OQJA 1K3ZA 1VGEL 1JYNA 1GHFL 1GC1C 1EHLL 4HUWB 2OLDA 5L88H 4WU7B 3SDDD 4XX1G 4Q9QL 1X5FA 3TP4A 2NY4D 3FJTA 5DD3H 3ZKNC 2EH7H 3QXAA 4JQIL 4FFVD 4LSUL 3SCMD 2J8UA 3T3PE 4F9LC 5JDJA 3WFEL 3KPMB 1SYVA 1J0JA 2FX7H 3EJYD 3QXDB 4WCYH 1I9IL 3MO1B 1S9VB 1MFEL 2CO6B 2N7AA 3C5ZD 3O45B 4DOEA 5GGSB 3OAYH 2B0SL 4NKMB 1I9EA 1XIWA 2WWMC 3FQWA 3U46B 4WO4B 3TO4A 1RJLB 4FRWA 3UC0L 3WKML 3Q1SH 5B3NA 1DFBL 4GSDL 4MS8C 3SKNA 1WFTA 2PO6C 4OQTL 3JVGA 2I07B 4K3GA 3I2CL 1A1MA 4NZRH 2FZ3A 3IKKA 1EJOH 4JG1L 4I0PA 4U3XA 3FFCB 1Z0NA 2DQTL 5DEGB 2EYSA 5F6IB 4TULH 3VXRE 1YNTB 4XCEB 1J8HD 1F3RB 1CD9B 2BHZA 3T0WA 4TF4A 2NY2B 3MRMB 3PWLB 4K7PY 2DL2A 4FZ8H 5HHPA 5HGHB 3R06A 2OS7A 1XF2A 3OBAA 2R1YB 4HK0B 3ZL4H 4R2GD 2FIKB 4W4OA 5GJTH 2OTUB 4K3HA 5LGHH 3MR9B 4P5MB 1AO7D 1NUDA 5FYKH 3MQIA 1U8NB 3BGMB 2PR4L 3FO9A 3KPTA 5DJDA 1AYXA 3BZ4B 4L29A 1CCZA 2FRGP 5CCKH 1HE7A 1U91A 4LCIL 1G84A 4RDQG 4O58L 4L8BA 3I75B 1LF9A 5B39G 3ILPA 4HH8A 5I1KH 3AAZA 3O6ML 4WWKD 3L7FA 5J11B 1TJHH 5ALCH 2GH4A