3X17A

Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
548
structure length
548
Chain Sequence
LLQGAQILVNQVGYHPATPKQAVLALAPGTAAGIRPGWTPTLQIVRADDGQVVWEGTMAGPSEDRLVSGDTLYRADFTSLTAPGRYVAQVVGGPRSPEFAIGPVYRDVLYAAARSYYLQRCGVAIDDPITGVSHALDHHEDGYVLVDDPFYRAGTRLEATGGWHDAGDYGKYVTTTAVTAAQLLKAYELYPQAFADGQLHLPESGNGVPDILDEVRWGLEWLFRMQRPDGAVYHKLAGLRWPGMIRPEQDVQRRYVYRITTQDTAKAAAAWAMAARIFAPFDAAFARKALAAAEQAWRFLAASGPILDYPAEDNSGSGPYDDRDDADDRFWAAVELWVVTGRAEYHDYIARMARTGLPAYAPVSWVNPAALGYFDYVTLGQKGDPAIRARLVQRILEGARSVFQTYEQSGYGVPILAGSFHWGSNKEALAKGMLLLFAHHLEPRPEYERAALAQLDYVLGVNPLAKSYVTGLGSNPPRNPHHRLVKASGVMVPGLLVGGPNDHPQTKAIRPHMGPRGYADVTDSYETNEPAIDYNAPLVFVAAHFASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure, activity and stability of metagenome-derived glycoside hydrolase family 9 endoglucanase with an N-terminal Ig-like domain
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Endoglucanase
total genus 177
structure length 548
sequence length 548
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
A PF02927 CelD_N Cellulase N-terminal ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3x17A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3x17A01
4EI5D 1AGCA 1S8DA 3KVQA 1NGYB 1GGTA 3SJVD 4EOWL 1EBAA 4N5UA 3RX5A 2X1OA 2R4SL 4WEBH 3EO1B 4LOUD 3HC3L 1EFXA 3KAAA 3W82A 3V4PL 2B1AH 4GQ9L 3G6AB 4PGEB 5ITBH 1OLZA 2VDPH 1I3RB 3AS2A 4E5XA 3MRIA 3LKRA 4WWID 2GFBA 4PIRF 4HPYH 3VMNA 2WBWB 7FABH 2B7DT 4I18B 5IEKB 3CU1A 5C0BB 2R39A 1H13A 3CFCH 4R7NB 1CLOL 1QBML 4S1SL 2AEQL 1YYLL 4YPGB 4XPHH 1JWMA 1K3IA 4Z7OF 3DROB 3LRSB 4NO3A 3TBSA 2IMNA 4MQ7A 4UUJA 3K4DA 4EKXA 5CD2A 3UTSB 3LHPH 4JHZA 3CFDB 4JRYB 1T66D 3A6OA 1S7WB 2VZ3A 2J5LB 2VQ1A 3I2CL 1MREL 4NKIL 3LMJH 2W59A 4HG4J 2R1YB 4ZXBC 4AT6A 3VMOA 4XCYA 2OK0H 4JPVH 5CMAA 1JZ4A 3ARED 3TBYB 5LKNA 2P5EA 1C1EL 1I7UB 4PP2A 1KXVC 4UMGA 1U8OB 2DRUA 4ZOCA 4R2GC 2EKSB 2ENSA 1BGXL 5F7UA 4BFIB 3HA0A 3QXWA 1A7PL 3U0WL 4WUKH 3WIHL 1F58H 2Z8WC 3VRLE 4O9HL 3U4EA 1EMTL 4HD9A 4KI1A 3QUZC 2IBGA 5LWYH 1DUZA 5C0AB 3D85D 4LCWD 1KTDA 1VSCA 4EUPA 5H94B 4IRJD 4JFPB 4WFHE 4EOWH 1IGTA 3T0VA 4NO5B 3U1SH 4L6XA 3QXDA 4DKAA 3U83A 5H35B 1LDPH 3TZVD 2YPLA 1EEZB 1KG0B 2ZCLH 3PGFL 1A9EB 5BZWA 2R2HB 3UZVB 1G7PA 3T65B 5GS0H 4P46D 2AP2A 5HHVL 2AHFA 4NKQB 3CFKA 5HGBB 1BEYH 3UTQB 3TIDB 2EH8L 2Z93B 4JRXE 2IANB 2ZCKL 4WFFE 3HNSH 3B2UC 4UT7L 5EOQL 3IFLL 3CIHA 2ICES 2C1OA 1KPUA 2LFGA 2HKHL 2ED8A 1ZXQA 1CF8H 5JW4Q 5T1KA 1S9XB 4KK6C 3MLSL 3CFKB 5HGBA 5HI4C 3L5WB 4QHNB 2HLAB 5EU3A 4KZEL 2MKLC 4H1LA 2BNRE 2CRIA 4I0CC 4XPBH 5CZXD 1GXEA 3BDYH 2GAZB 2W1NA 5D70H 1G7MA 2J8UE 2NNAB 1K3ZA 1YNLL 1CGSH 1KV3A 1OVZA 2APWA 5DJ0B 5KOVC 3IJHA 2V7NA 5IVNA 4YHLH 1CYGA 1JNLL 1T89A 2F74A 1T21B 2LTQB 5EO9B 1EERB 1DANU 1YN7A 3QNYB 2QQLL 1GAIA 1FZJA 3RWJA 1S7QA 1UZ8A 5A40E 4LSRL 1N5YH 5C0BA 1HHKB 3D3VA 2AXJA 1NCBH 1ZGLB 4NKDB 1OTTD 3GKWL 3HNVL 4APQD 1AHWC 1HIMH 4MNHA 2DQCL 4PGBA 3H9SA 1MRFL 5L2KB 1LEIA 4HAFA 1UZ8B 3ZE1E 3GHBH 4X7TA 1JNHB 4XBEH 4N90D 1JPGB 5D7KD 2R8SH 3GRWL 5MEPB 3MA7B 1PX3A 1XR8B 1YEIH 2D03H 3QXFA 3GO1L 1JI2A 1YMHB 1HEZA 3O4LB 4Z7OE 1VFBB 2R1XB 2F9BT 1KBGH 4JZNA 4KZDL 1ZMYA 3GNMH 4K8RH 5D2NA 1N26A 2JELH 3KYOA 1NBZA 4LSTL 1QPXA 4D8PB 3RUGF 4L8CA 3JWDH 3LV3A 4RFNB 5DD0L 1NCDL 4QHMA 5IBLD 4O2CA 1JPTH 3G9AB 35C8L 2Z31B 3WIIL 2DTMH 3VJ6B 1F4XH 3WXWH 4LU5H 3DX6B 5KS9F 1I9JL 1G7LA 3ARDB 4X4ZA 4AQ1B 5IMMA 2YD8A 1I3GL 4MD5B 2ATPB 4OUUA 4PJAB 4WVCA 4Y7MA 5GPRA 5EUOF 4NO0B 4PP1D 3V6OC 2J1KA 3O0RL 5FUCC 1GLMA 4C56D 1NGWB 3EOBB 4ODWB 1KENL 3BISA 1GC1H 2VDLH 2X4RB 5DK3A 1RUQH 1J10A 4ZD3H 3JTTA 4UV7H 1EX0A 5EUOA 4X98B 1I1YB 4YHPB 5KAQG 4HFWA 3C5ZD 4OZIB 2AQ3A 3D9AH 3BKYH 3MRBB 4M7KL 5HHOE 5ALBH 3WLWD 1QNZH 3OAZK 2XV6B 5GGVY 1XCTB 2W92A 1BVKB 4XCCL 4LQ1A 4PD4J 4R8WL 5ERWB 3ZHDA 4ZFGL 4KV5F 3CMOL 1J86A 2I5YL 3REVB 4I0PB 1EZVY 2XZAL 4EN3C 3KLDA 1YNTA 5E6IB 2CXGA 4NZUH 2YWZA 1E6JH 5FYLL 1BVLB 1KN2L 1MJUH 3WNNA 4BH7B 4LCCA 2HJLB 4U1GC 4CW1B 4S11A 2HKHH 5DURB 4M7LH 4FQQA 3QUYA 5E0QA 1TQCC 4XX1E 2CRMA 1X9QA 2EKJA 3T2PA 1F9DA 3QSKB 4X6FA 3AU1A 3P11L 1A7NL 3MJ7B 2Z31C 1B6DA 2LQRA 4JN1H 4CKVX 3MLUL 4FMKA 1R0AH 3O3AA 1JGLH 4PG9B 5BMFH 2APBA 3QG7H 1O7SA 3QNXA 4H25A 4LASH 5I1LB 3UTTE 5AWNH 1XR9B 1I8LC 5F1IB 1FGNL 5M95B 4M3JA 4PLNC 4PJ8A 5DUBA 1L6ZA 4JZOA 4JDZA 4WTXA 1MEXH 1FORL 1WAAA 4P2CG 4FABH 2MNUA 1FL3B 4XP6L 5GGSY 5DJ6B 2PNDA 2R2BA 5DMJB 2GH4A 2LVEA 2IQAA 2WIMA 3NN8B 1G7IB 1Z6JT 1FZOA 1U0QA 2YPLE 5DYOA 3SDAA 4RRPA 1FNAA 1RJCA 4DZBA 4ODUA 4KRPB 4MJ6B 5IT2H 4TQEL 2VR9A 3LEXB 2JJSC 4X6DA 4OCYH 5IROA 3KPPA 4ETQB 2MQCA 1PAMA 3D5OF 3F58H 3TN0C 4WO4A 3B2VL 1K8IB 1VESA 1QLEL 2YD4A 4GW1A 4MXVF 1M7DA 4PJXE 4YE4H 2AXHA 1XF3B 4P5TD 4BSWB 4HK3N 2GK2A 2WM0A 2Q86B 4G42B 1TTGA 3WFEH 3JZ7A 4L9DA 2NY1C 4LSUL 1AGDB 2CGRL 4YDIH 3TJHC 2J8UA 4NQCE 5JW3L 2X7LA 4FXKB 4EI5B 1VERA 3WL9B 5B4MD 4M9OA 4F15B 1CFVH 1VFAB 5ICYA 1A1MA 2R69H 3HB3C 1EEYA 4Q6YA 3IDNA 3K2MC 4WIQA 4C58B 1FYTD 1OLLA 3MFGB 3GM0A 2J12B 4DOHE 2XFXB 4KAQL 4OF6A 5FYKD 3P0VL 2UZXB 4Q74A 1SHMA 5C0BE 4OIIL 4IS6B 1KCVL 4KK5D 5ESVB 4G7YH 4OF8A 1AO7A 3LZFL 2B1AL 3EOAA 5AYUL 2XA8L 3UC0L 1A6UL 2B20A 2E7BA 4LVOC 4R96A 4P5MB 3EFFA 3W81A 2OS7A 3BKCH 4BK4A 3LKRB 5I1EH 3CXDH 5CHNA 4KROB 1MLBA 4ESKA 1WFNA 2A8ZA 5C0CE 4PYGA 4J6RH 4XBGA 3KPLB 1ETZB 5ADPL 2JE8A 4LHUB 2W65B 4GAGL 5TH2A 5DD5H 3UBXG 1IZKA 3PL6B 4UQ2B 4WO4B 4MXQC 3GDBA 1O0VA 5CBAB 5DUML 1F4AA 1MWAB 1QSEB 5BOZG 5HGHB 4JPWL 3KPOB 3G04A 3FZUC 3PNWB 4W4OA 3ULUC 5TPWL 1G6IA 4NQEE 3P4NA 2ZOLB 4GRWF 1AC0A 3AMKA 4BFIA 1BBJA 4OI8A 5IFHL 1PZ5A 1IGJA 4I2XE 3SE3C 3O3DA 5F3HB 4W4OC 1IAKA 3RKPA 4TULL 3O9WC 5EBMA 1MFEH 4J6RL 4G6FB 1EHLL 4AIZB 2IH3B 1U8JB 2P7TA 5GGRA 1FE8H 5CEZL 3M07A 2UUDK 5IIEB 1QO3B 4K3EH 3ZDYF 5IB4B 1PZUB 5CZVH 2Y72A 4L9LC 3FT2B 2G2RA 5BS0D 4YDLC 1ZSDA 2VLLA 3HZKB 4JFOB 4G6JL 4L9LA 5DFTA 5DHVH 3ME0A 4M8QB 1PG7H 5CEZD 4PRBA 1VDGA 4UV4H 2APXA 3QA3A 3KPSD 3V8OA 1XGRB 5HHOA 2QQKL 4JRXD 3MRHB 2G9HB 1C5DA 2VIRA 2OCFD 1U2CA 4PGDA 1QSFA 3LS4H 3VXSE 1NCNA 3EOYG 5EBWA 4POYA 1N5AB 3MJ8B 3ZYIA 4HIHA 3RNQA 4NM8L 1WBZA 2EDQA 2OTUA 3DV4B 5F9DC 5GJTH 5SX5K 3MRMB 3N9GH 4I9WD 3MLYL 4G43A 2DLFH 3PL6C 5D5MB 5DTFB 1KCKA 1ZANL 3WSQH 1KELL 1YA5A 2H41A 2UYLB 1LK3L 3IS0X 4N68A 2DOCA 1LEGA 3GMPB 3OKMB 4XP5H 3G6JF 3P0VH 25C8H 2QKIA 4HH9A 5TQ2L 2RR3A 4F15C 1CDUA 4ZS7L 5C6TH 4OSUL 4B53A 1MJ8H 1INDL 3T4YA 5MEPA 1JWUB 4NNXB 4ZUVA 5J06A 4G9DA 2CR6A 2ZNXA 3CZFA 1P9MA 3O9WB 1I1FB 2ZG1A 3G04B 5HHPB 2D7OA 3ZSSA 3O2DL 1UXWA 4JZOB 3ELAT 4NIKB 4L8SA 4Z7NE 5DD6A 4KKLC 2H2PC 1XR9A 3CH8A 1IC4L 2PW1A 4YDVA 4WI6A 5E8OA 4Y19A 2F74B 2R0KH 5FHBH 3RWHB 3ARPA 1T66C 1WZKA 2ZP0T 3GMMA 2D0GA 5IW1B 1I7TB 4NPYA 4MWFB 3E6UA 3DVGA 1DL7H 4JHBA 5D1QD 5GRUH 5FOBA 4OV5A 4IOSD 4LHUD 5F7DB 3WIFA 1I8KB 4N0UE 2XZZA 4PYHA 4TYUA 4X9BA 1W0WA 5E8OB 4HIXH 2FJGA 2GJ6D 1RUKH 4OZIF 1TCRB 2HFEB 4Y2DC 2BDNL 2Q1EA 2XICA 3VXUA 4X6DE 1QRNE 1XF4B 5I8CB 1ZHKB 2AFAA 1J1OL 3CPLB 1RUAH 1ZE3C 2GITA 4ZUWA 1ED3A 2E9JA 2FO1A 5CJOH 2JJTA 1IAKB 1D5ZA 5E9DD 3WS6C 5AD0B 1QFWL 3MJGX 1OAUH 1AIFA 3UCRA 3NFPA 4LLDB 4XXCA 2QLVB 4RMVA 4LMQI 2EDDA 4YDJA 1U3JA 5E1AB 2C3VA 5ALCL 4AEEA 3QT9A 1J7VR 2D0FA 2YMXH 5B3JE 3S4DA 3F7RA 4JHAH 3IETA 4G42A 4OZGF 5BVPL 3PP4H 5HHOD 4OJFL 2JTDA 4ZMAT 4PY7B 4NCC1 1HINL 2BOCA 4LCWB 2WANA 2YRZA 1KSCA 1P5VA 2G9HA 4N0FA 3FO1A 3GUTA 5L7XH 2P8PB 4K8RC 4PRNA 5I6XC 3KLHC 4MA7H 4ZQKB 2ADGA 2ZSWA 1X6LA 2H6PA 4MCYA 3ZYOA 1BFSA 4UB0L 1GGIL 3DV6A 2X4TA 3U4BH 3ECBA 4HXBL 3B2VH 3EDKA 4I77L 3FQRB 5DJDB 1I1AC 3JVGC 5KS9A 2Y1VA 4XP4H 2NY0C 2DQFB 5DLML 4LSPL 5F88A 1MCKA 3LS5L 5ITFA 1AXIB 3TN0A 3P73B 4FQCL 2OSLA 4KHTL 1S5IL 1VKXA 1L4IA 5JA9A 5GS1B 3BOVA 2X10A 5C0CA 5DSCA 3IDJB 5F72S 1WIUA 1FN4A 5KS9B 3QUYB 4NC0B 3ZE2F 2WMPA 4P0DA 2VLJD 4NZJA 3PWPD 2YD2A 3P9MA 4ZG1A 1BFVH 3T0DA 1A1NB 5EDXA 3OHXB 4I18A 1A3RH 2FEEI 2MCG1 4Q2ZA 1LHZA 2F19H 5D6DA 1X4ZA 4FFWC 3IJSA 4Q58C 5FDYA 1DQQA 1ORQB 3HCVA 4Y16A 2ILLA 5E5MA 3ISWA 1XWTA 1S9YA 2ESVA 1JRHL 4GRWH 3RVVC 4WU7A 4M93C 5HHNB 2IAMD 2E27H 4X83A 1R5WB 1PZ5B 3K46A 3SDXE 3HZYB 3FFCD 4JN1L 1NMAH 1KB5H 4HKBB 3C6SA 1P4IH 4N1EA 1NKOA 3KLAA 4UTBL 5CILL 3X3FL 1CT8A 3NBNA 2XWBA 4D9RE 1G6RA 3SKMB 1FC1A 3O6FC 4GAFB 4KK5C 3VXPB 3ARDC 2BX5A 2FO4A 3H6JA 4TVPE 3HS0A 3HZVB 1YPZF 3E73A 4ZFOL 2GITB 4MJ5B 4Z7VF 3O2DA 3QB7C 1T2XA 4NJ9L 3KXFA 4ERSH 2EE9A 4JGJA 3A6BL 5SWSB 2J2ZA 1D5XB 3HE6B 3GSVA 1QFHA 3RGVD 3ARRA 2R15A 5DQ9A 4PY8I 5HVHC 2PCPA 3DX6A 1O7VA 5SWZA 1IAIL 1ZA6B 1AP2B 4G8EA 3BP6B 4JQVC 5KBNC 4PJFE 3TA3C 2Y9RT 1NAKH 3OZ9H 4JHAL 1HQRB 2AQ2A 4U31A 3AFLA 1F6AB 3MREA 2B5IB 4Y2DB 4TSBH 3E6FB 2V5MA 1RUQL 5FYKU 1AQKH 3F7PC 4QRQB 2R2HA 1GC1C 4F7CA 4GBXB 3EYVA 3L7EB 4LSRH 1I4FA 5I71C 1A7NH 5HD8C 3LKQA 3MRFB 3TH2T 1PEZA 4IRSB 2HTLC 3O9WA 3IDXH 1MUJB 1VFMA 2F6DA 3FN9A 3UPRB 4L8SB 3VFUB 1YNTB 4Y4FD 5I8EB 3AVEA 3VXQA 5IMOB 2WSKA 1MF2L 3HZMB 4B7IA 1LNUA 3VI3E 4L3AA 1LO2L 3MUY1 5L0QC 2IAMB 3DMMB 3VFOB 1YMMD 4WW2F 5EIQA 3S4CA 4OCWL 4Y19E 5E24E 1SVZA 5C6PB 4WEUD 4ZXBB 5CA3A 4JN2B 5D7JA 3EYFA 2E7LC 5BQ7B 2V9QA 1E28B 1NCBL 3E2HC 4OGXL 5C09B 3CUPB 4ZS7H 5T1MA 5C6TL 3BUYA 2AKRB 1MCOH 1AJ7L 4CBPA 1HK6A 4JR9H 3DUSA 1U8HA 2OL3H 3TFKC 5I19L 1EMTH 2VDLL 3NACH 3ES6A 5CGYC 4F58H 1FL6B 1QRNA 5EOCL 5IVXB 1T7ZA 4WW1B 2Y5TA 4MNQA 3PWVB 1UC6A 5TE4H 4KDWA 1I3GH 5MHSD 5GRXG 2NLJB 1FL3A 4FP8L 4C4KT 4GRWE 1NMCC 3ULUF 3V4VH 4BA8A 1NANH 5GS3A 4P5KA 4WUUB 5BS0E 2XY1A 3W11C 1IGCL 4ZS6C 3SEPA 2X05A 1J1XH 4PJ5A 1IGML 3EKCA 1UXSA 5J13C 4QHNA 1KGCD 2X9YA 1XR8A 5FB8B 1CGUA 5H35A 5KN5B 1WU6A 1MHCB 2A6KA 1YEIL 4OF5A 1G9EA 2P48B 5GS0L 1NEZG 2NY1D 3QXUA 1P1ZA 5J56B 5DDHB 5A16A 3FO1B 1EEUA 4XVSH 3FO2B 4PJBB 3QUMB 3D3VE 3ALWA 5T3ZE 5C0NC 2FJFA 3C09C 3HNSL 5CZVL 2B0SL 3WLBB 1IQWH 1JWSA 5FCUH 3RTQB 4HC1H 5KS9E 4N5ED 3MLXL 3PQYE 4NHCH 3MYZA 4QRPB 4QTIL 1BQLH 1F11A 3RBGA 3IS1X 4PRPB 5IV2B 4PBWD 2IALA 4UZGA 4MD5A 5CSZB 4J3UA 2HLFC 2DQJL 4PLJD 1NGWA 5EN2A 5GS1C 4GAJL 4R90L 2P0VA 2EC9T 3UXFA 4P5MA 2CIIA 4L4VA 2EE2A 3AUVA 2XFXA 5C9KA 3LD8B 1AC6A 4PS4L 4H8WL 3V4UL 1A6AA 5F21B 4H20L 3KNBB 3WIWA 1BZ9A 1CGVA 5T3ZH 4P48A 1IZJA 4PTUA 2YD6A 3JBG7 4UOJA 3PWJA 5D2NE 1ZEAL 3ET9F 2WV3A 4Z9KB 2YUVA 4I4WB 3NIGE 3M17B 3FTGB 1QLEH 2CLZA 4J4PA 1A7QL 1UXWB 4RFEA 1VCAA 3OPZL 1TETL 4K7PX 4LVHB 1H5BC 4LSQL 2VDQL 4I2XB 3MXWH 4OF3A 2ZCHL 4NCC2 5F8QC 5IMKB 4QXTB 1ZLSH 3IAPA 4NRYB 1R5WA 4TQEH 2ICWB 1AGMA 2HWZL 4WU7B 1GZQB 5L2KA 3H0TA 4Z78A 1LEIB 4ONHA 3STZB 3BQUD 4LRIA 3RL1B 5C0RH 2YUZA 3X11B 1HOCA 2XTJD 1NSNH 5FIEA 2A77L 2AV1B 3PGCB 5DMYA 4S2SA 1DDHB 4YHYB 3WKHA 4M3KB 1CT8B 1YEHH 2R9HC 2WBJD 2NY0D 1FFRA 4U6YB 2HYMA 2ATKB 3QFYA 3QDJD 5I18L 3RVTD 3CFBA 4PD4K 5GXBB 3GK8L 1OB1A 5J1TC 3GBNL 1R3LB 2FECI 1XGQB 2VXVL 2Y6SC 3SGDH 3SKUD 4HK3J 4RMWA 1DE4A 1X9DA 2NXYD 1UH2A 2L4OA 2VDMH 1MCJA 5AG9A 3KYMB 3DRQA 3QWQB 3I6GB 1KGCE 4OF0A 3GMRA 2LU4A 6FABH 1HH6A 3HZKA 3N0PB 1GH7A 4IDJL 1LE5B 5AZEH 3IXAA 2AEPH 5F7EL 2R2BB 2YD1A 3LEVL 4JFYA 1T7VA 3B5HA 2JCCF 2C3HA 2BY3A 5E7BA 3OKYA 3LKPA 3IFPA 5ENWA 1ZLWH 3SJVB 5D1ZA 3W9EB 5HYQB 4Y16C 2WW8A 3RVUD 4BZ1H 1QSFD 4NJAH 4ZNCD 2X4PA 1KIRB 3IJYB 4RAVB 1K6QH 3MRHA 1MJJA 3B6SB 1KEGH 4KUZL 4MS8D 4F2MA 4ZNEA 5E00A 2NPLX 1DEEB 2FLBT 4HC1L 1IAOB 3FQXB 4HQQL 3QIUA 4UILH 5D96B 3BYYA 3K8MA 3VFSA 4NQDD 1FVCB 4XPGH 1RJLB 1QOKA 3BJLA 1CD0A 1B3JA 2NZ9C 2XOTA 4GKNA 5IK3B 1YEKL 1RQ5A 3K4AA 1DBBL 2NW3A 1RJYA 3CLFH 5F7FA 2AJSL 4K7PL 4EI6B 4PJAF 2N1KA 4NP4H 2DLEA 1N7ML 1A9BA 7FABL 3MX0A 5JZ7C 5DURD 4HUWB 1UENA 2P8PA 1PVHA 1I9EA 3V52L 3G5ZA 3H9YA 1QLFA 4KK8D 3QEUB 1UWXK 5D2LB 4PJEA 1S7RA 2P8MB 1M05B 4LCUB 5GSRB 4NC2B 2NX5A 3DO3A 5JHDE 4LGRB 4GQ9H 3QZWG 1OPGH 1BJ1H 5CJQL 3TYGL 3B9KA 3VXOA 3F7YA 2HFFB 2DYPB 5DD6B 2R0KL 5FHBL 4MNQE 1H3PH 3ZHKA 1Y6KR 5GZNC 3I75A 3ZKND 5IQ9A 4HMDA 4NN6C 2IJ0C 4PJXA 5JXAH 4RZCA 4AH2A 5E6YA 4M43H 1QFWI 1R6VA 5HHXL 1CU4L 4YHNA 4DAGL 4ZAKD 4P3DB 4E0RB 5BRZA 1J1XL 4ONHB 3CPLA 3SPVA 1TF4A 1W8NA 5IVXE 1A6TA 2QBWA 5D1ZB 1IGIH 2AW2A 1BF8A 4QWWD 4QHMB 2OZ4A 1QP1A 4G5ZH 3RWCB 4RCAA 4H8WH 3V4UH 4FP8H 3S98A 4JB9L 4APQC 1M6OA 4F37K 2CH8A 3M8OH 3QIUB 4K07A 4HIEB 2ATPA 1F3RB 4ZFZA 4M5YH 1LO4L 3T8XB 4MCZA 2GTZA 4KTPA 1TVHB 2NQCA 2WUCL 1T03H 2IFGA 3N1PC 1CK0H 1TXKA 2NY4B 4NHCL 4QTIH 1FO0H 3GSOA 4MQSB 2OTWA 4YHOL 1AQDA 3CK0L 4KJYA 3HE6C 3VFGL 2LVCA 1IT9L 3KHQA 3PQYA 1PKOA 1SYVB 4X4MA 2BVYA 4JM4L 2FD6L 4HS6B 5E99H 5EO1A 2YHGA 1S8DB 3QZWA 1BLNB 2OP4H 1WSST 3IFNL 4MAYB 5GHWH 4ELMB 1W0VA 1GAHA 4OFKA 4XWGH 2VXSH 5D1XD 1ZGLM 5EC2B 4ZUUB 3U36B 4J1UB 1VENA 3RUGA 1A7OL 4I0PA 3PJSB 4L4VE 1CICB 3UTZB 2AJZB 1FZJB 3W0WD 4PJ9B 3A67L 1JE6A 2GCYB 3GJFB 3K3QA 3P4MA 5K33A 4XTRC 4JFOA 2Z35B 5F44A 2F53D 2VQTA 1OGAE 4R9HA 2CO6B 3KJ4C 3FT4A 4XCNB 1R3JB 5EOQH 4Z77A 4O2FA 2OJZH 3TCXA 4D9QD 4LLQB 3VGFA 4LLYB 3BKMH 3AS1A 4ODXA 3H9ZA 2OJZL 1T20B 1KSRA 3NH7L 5LXGH 1QFUH 2BOBA 3SDXB 4Z7NF 2NY6B 1JGUL 1ZLWK 5C0AD 3BD4A 3UJIL 5I1GL 3LN4A 3QUXB 3C60D 3MRPB 4HC1A 3ROLB 4NZTL 3N85H 3HPJB 5FK9A 1N6VA 2C26A 3KXFD 3CGTA 3MBEA 1YYMH 2BSSA 3PWPB 4XHJD 4JCLA 1X5LA 3O6FB 3OKDA 3VWKA 1WFOA 3D87B 5J12C 2R0ZL 2KZWA 4P3CL 3MV9E 3VD5A 1G6RB 3L5JA 4MJ5A 1JYNA 3X17A 1BEYL 2EYRB 1CVSC 4HMEA 2PKDA 1BLNA 1MEXL 1D5XA 4HDIB 4GSDH 3VW3L 3O45B 2HFGL 1V7NL 2VLKA 5FO8B 4NDMB 5CD3B 4FHBD 2FX9L 4EUPB 3QJFA 4MJ4A 4KI5D 4PGCB 5FHAH 2BY2A 3P30L 4PJ9D 1KB5L 1CXLA 1QG3A 2ZUXA 2EDKA 2A6JB 4NO5A 4AEHL 1L2AA 1XCQB 2VDNL 4UT6H 2WAHA 3IDUA 2C7UA 4M4PA 2MJWA 5C07E 4LF3B 4PRHB 5CZXC 5D1XA 3V0AC 5HHVH 2OTWB 2BRRH 2OR9L 5HJ3B 5KAQF 2X7LB 4L3EA 5FYLH 4XI5D 3B6SA 2DLHA 3S5LG 3BH9B 3T3PF 2BJMH 1IA6A 1KB5A 3THMH 2Y06L 3V9FA 1KN4H 3CMOH 1LO3L 3L3KA 5KVMC 1KB9J 5EU3B 4G8GD 1KN4L 3NCYP 3BRDA 4PJEE 5L2JB 1HH9B 4Z4JA 4UUJB 3W0WB 2NX5E 4LCCC 3UYOD 2Q87A 1FJ1B 5JHDA 5JHDD 1N6QH 2XQYK 4G7VL 3EGSA 1FO2A 3L3JB 5JOEA 4OCNC 1YEFH 3JWNC 4ZD3L 5BQ7A 2D8LA 4LSDA 5GRJL 2BNUA 3AS0A 5EIIA 1E4JA 2EO1A 2BOCB 4RWYL 5DMGD 1CLOH 5DC0A 2ZPKL 1WFTA 4GRMA 4NGHL 3I9GL 3TBTA 4B5EA 1FMIA 4O58H 4ZQKA 2P4AB 1NMAL 3PWJB 1K8DB 1SMAA 1Q9KA 3QFJB 1J8HA 1JGUH 1JHKL 3RL2B 3HC4H 4HZLB 2XG5A 4NZRH 4LHUA 4DN4L 1OP9A 2APVA 1FG9C 3EDEA 4LVNB 3WE6B 3KPRD 3E6HA 3WDHA 3BUYB 4R3SB 3CVHA 4OZHF 4PTTA 1C08B 5ETUB 1CTOA 2EEAA 3VW3H 4GSDL 4X5LA 2P5ED 3S35L 4Y5VC 5SWZD 5GRVL 4BELD 1D6VL 5IBLC 5C8JA 3QUXC 4UNTA 3O6LH 3U7AA 4DCQA 3MOBH 1OHQA 3L6FA 3VDBA 3RL1A 1T3FB 2R0ZH 3AAZA 3K8KA 4JFQB 3N1MC 4PG2C 5EZLA 1LD9B 1U41A 2A6DB 4OD3L 1DL2A 1FV1A 5EUKB 2VLKD 3VXUD 2QV2A 3MBED 3TBWA 5J3HC 1T7YA 5IJVA 5KVFL 1CLZL 5CP7B 1A1NA 4PV9B 4UIMB 3OAYK 1D5MA 3NCCB 1RPQA 4P4RA 2X4QA 3ROOB 2PR4L 3PP4L 1ZKAA 2YEZA 3BESR 1YECH 4DVBB 2UZIH 2BJML 1B0RB 2AK4D 5T5NF 5ADOH 3V6FA 8CGTA 3JV0A 1G87A 5IHUH 4GW4A 1JN6B 1LP9B 4HWBL 1UB6B 3VGEA 4ODWA 4HF5L 1WBYB 2OZ4H 2UWEA 4WUUD 2XIDA 3HZVA 3ARBA 3BWAB 2EO9A 5I2IA 1KLGA 3IVKB 2J8OA 1HYSC 5FYJH 3O0RH 1NH6A 2YXMA 3FRUA 2H32B 4M02A 2F58L 4YGVB 3RWIB 1CICC 1HKFA 4F57H 1H0DB 1W2KT 4X5XA 3RSYA 2HVJA 1T89C 3QWTA 3SHSA 3PJSA 3C08L 4WHYG 4HZLA 5C7XL 3QFJD 2Z35A 4B50A 4U6XA 5IFJA 4WFHD 1YY9C 3G6AA 4Q7DA 4BZYA 1R3JA 5EOCJ 2VISA 1KLUA 1MHHB 1XCTA 1BIIA 3OX8A 4R7DB 3LVEA 5C0CD 1EFXB 4V1DE 3EUUA 4ZYKA 3VDAA 1JZ7A 1ZTXH 2L0DA 1U8NB 1Z9SA 4U2YA 4AENA 4HUXB 1OP5H 4WHTA 1RIVH 4H0IA 5GISL 4ZFFA 2JIXB 1GAFL 2OSLB 4OGAD 3MODH 1IAII 3DV4A 1DBML 2BNQE 2CKBL 4UI2A 3ON6A 2J4WL 5CBEB 1KTKE 1UVQB 5CJQH 3GBMH 4GLRH 3B2UD 5HTSA 4PJ7F 3MUZ1 1XH3A 2NXZD 4P9HH 4HMCA 5JPNA 4I3SL 5HI5D 3GJEA 3UTSD 2VZTA 4N0YL 4DN3L 4F9LA 5SWZE 3MV9A 3MV9D 2BNRD 3T0WA 5LXGL 3AM8C 4QRRA 3OAZH 4PJ7A 2B0SH 1UVQA 3G6JA 3RWGA 3EDFA 3IGAA 2VZVA 4G6JH 3BT2H 4JRYA 1X7QB 4Z0XB 3VRIB 3WD5L 4NM4L 4XMPH 4LAJH 4G8IB 5C09A 3BDXA 4PJXB 4NDMA 1YDPB 4HUVA 3V7AG 5B38B 3TYFA 1NLBL 2MOVA 1WWCA 1B6UA 4WW2B 3QIBA 2NW2A 3OR7B 1CXIA 4PBVC 4WI9A 5DHVA 4IJ3B 4TPRL 3ZT7A 1QA9B 4FTVD 5DR5L 1G1CA 4Z5RB 2P44B 5TE7L 3RPKA 1CXHA 5H37G 4F7TA 2R23A 3UJTH 2HT3C 3F7VB 4U0RB 2M8XA 3K2UL 3QQ3B 3MV8A 2A83A 4AYPA 5I8CA 4JDTL 5BV7L 2UYLA 4NZRL 1U93A 2YUWA 5GSVA 5DD5L 5LG1A 3WNMA 2EDTA 1OTSD 1L0QA 1S7SB 4EN3A 4CNIA 1X44A 5JOPE 4WUUA 2BMKB 3RGVC 2WQ8A 2ARWA 4KKBC 2KBGA 5LBSL 3UC0H 3MA9L 4YZFE 4HCRL 1G7QA 3S36X 4BQCA 1DFBH 2VSCA 2CPCA 1PQZA 4GBXA 3TIDA 4OZGB 1FVDB 1NBVH 1DJSA 1Q9OA 1JF5A 4NQUA 3LRGA 1CLYL 4KK6D 1YEHL 4J8RB 2DQIL 1I8LA 1CDGA 3DUUA 3H9HA 32C2A 4L4TE 1FVCA 12E8H 1A9BB 3UEZA 4O9HH 2VDKL 4BSVB 2UVEA 1BREA 3EHBC 1OSZA 2VLJE 3VFRA 4Y4HB 3FONA 2DQEL 1QHOA 4ONOA 3QI9B 1ITBB 3V6OA 5CEXA 3A3VA 1XGTA 1KKTA 4WHTB 2DKMA 2ZKHL 5C7XH 4L0GA 5IFAL 1P2CA 4MNGA 5CD5D 3VRLF 4U2ZA 5TE6H 4KVNH 4I1NB 4PJ5E 2QR0B 3CC5A 4DVRL 4J3OC 5TFSL 2XPGA 5EU7E 3BHBB 4FS0A 3FB7A 3W7UA 3KJ6L 3JUYA 5IQ7H 4D0DB 1CLCA 4ONFH 3NZHL 4ORGB 1OL0A 4R0LB 1QBMH 2XKSA 3QXTA 2IPKB 3KPQA 4OCYL 3F7VA 4AL8L 3DIFA 2IF7A 3GSXA 3KPSB 4LEOA 3D1MC 3QDME 5INDB 3QG6B 3R1GL 2ZZRA 3QO0B 4GW1B 3CLFL 2XYCA 1CE6A 2DAVA 1HSBB 4NQCB 3EO9L 4Q2ZB 4XHQA 2HH0H 1NUFA 1YEFL 2UWEE 3CD4A 3HPLB 4ZTOH 4GW4B 2BSRB 3RENA 1MCIA 3FT3A 5ANMB 5CMAB 1QKZL 5HGAA 1WWWX 4R6UA 3RKDD 2G75B 5C9JB 4OD2A 2VC2H 5IIEA 1FL5A 5DHYB 5CLTA 4MAUH 4HWZB 5CCKH 1V3LA 3FHQA 2A6JA 3MLUH 4PRBB 4LK4A 1AKJD 5DJDA 3MLWL 4NQED 3BI9X 3SOBL 2YA2A 1HN1A 2VUYA 3D48R 3PHOB 5I1IL 2XTLA 5FYLE 4EN3B 4I4WA 1HWGB 4UAOB 5I73B 1HXYA 2V2TA 3OR6A 2OL3A 3X14B 1AD9B 4JFDB 4ZUSA 1AO7D 3SDAC 4TNVF 3ZE0F 5FO9B 1OAXH 1D5IL 1LK2B 2WWKO 4CVXA 1E0OB 5TDNA 3WHXA 3P77A 1MJUL 2GSGA 4C4KO 2OM5A 1F8TL 4JFXA 4FQLH 4OZFH 4PRHE 4N8VA 3TWCH 3LKNA 3UTPE 2ZG2A 2GJ6B 5EU6D 1IBGH 2HWZH 3D25B 5ABDE 1YC8A 4F9LC 1WEJH 1UCTA 5FFLA 1FG2A 4Z95L 3VXSA 4JY5L 3VA2C 2AJUH 4PRAB 1WUNT 5JIHA 1OGAB 4QRRE 5L6YH 2NY2B 4PJ7E 4QHUA 2OQJA 1EXUA 4FQIL 1DN0B 1EEYB 1PY9A 1K5NB 3MACH 1DQJA 5DQJB 2DM3A 5D1QB 3BP5A 2NY6D 3EO0B 1PGRB 2D7TH 1LO4H 1S9VB 3SGEH 5C0BD 5SWZB 1FAIL 1RU9L 3UJJH 4F7EA 5EA0H 4MSWA 1Q0YH 2CLVA 4Z7QE 4NOFA 1UG9A 1FAIH 1RU9H 3UJJL 1FFOA 1OTUC 1H15B 2R23B 2HFGH 1V7WA 1AKJB 1KN2H 1FV1B 1SVCP 2AK1H 3MZGB 2OBGA 1E6JL 1XGRA 4KI5C 2ZSVA 4L3ED 2W9EH 4NQCD 1XGQA 4PGCA 4JQVA 4P23D 3RQ3A 1WWAX 1BJ8A 2D4DA 5FO8A 4WW1A 3G6DL 5CJ8A 1R3IH 1Q0YL 3UBXA 1A0QL 3QHFL 4QXGH 3P77B 4PLOB 2PTUA 5HVGB 3QWOA 5AG8A 1BJMA 3V0VB 3CX2A 3V6ZB 2WQRA 2HMID 5ICZB 3U7YH 2BDNH 1RHHA 4GBXC 4ORZC 1LO2H 1XF3A 1I1AD 1NCDH 4YHKL 4KJQC 2VN4A 2XWJB 3DMMA 2GYSA 4IRSC 2VR5A 4XPTL 1U9KA 3RWIA 3H3PH 4TNWK 4YZFF 2Y7QA 3T8XA 2OJEA 5HI3C 4HHAB 1Y0LB 4JY5H 4N8CH 1KLGB 5BO1H 3IVKA 4Y4KD 1MPAL 4U6XB 3FRUB 1FFQA 4F33A 4DK3A 3SCMD 2XFGA 1RK1B 4M7ZB 3SCMA 5MI0C 4LIQL 1LILA 4OLUH 4FXGA 4AG4L 3QEQD 5LQBL 3MLWH 4ODTH 4O00A 3WO4B 3U2SA 2IAND 3O2VH 3BZ4A 1LVEA 3QI9A 1B9ZA 3FQNB 3VXRB 4F7EB 1R3HB 3Q1SH 3V5HA 4HJGB 4NWUL 1G84A 5DJ0A 1FLRH 1L1YA 2DL9A 2GJ6A 2AJUL 4PR5A 3V5DA 2FUZA 3TM6A 1F6LL 4U05A 4FQIH 5C0JB 3FB6B 1CL7L 1RFDH 3AY4A 3TO4B 3HAEA 3QG6A 1MFCH 4KMTH 1ETZA 5LGKA 3QQ4A 4X8JB 4F37F 3AB0C 2CIIB 4FQLL 1WJ3A 5D7LD 5FEBA 3MJ6A 1H8NA 1U95A 1TJHL 1BMGA 4QOKE 2A0LD 3QAZC 5IB5A 5GGQH 3F65A 4UBDD 5FV2A 5DT1L 5C8JB 1A5FL 3A6CH 4M48H 4OGYH 3JUZA 1J0IA 4G6KL 4HSQA 3RZCA 1H12A 1WC7A 4TN9A 3C5SA 4ZO8A 3WJJC 2XT1B 4U1MA 4G5ZL 1L7IH 1MCCA 3HE7D 3EO9H 2XWTB 4XPHL 1V05A 4Z7VE 1FDLL 4YUEH 3BXNB 3SN6N 4L8DB 2DDQH 3MBEB 5E2UH 2DQDL 5HDQL 4PJ8C 5I1IH 3EAKA 4CGTA 4XP9L 1HHJB 2ZBLA 1CDIA 1RZ8A 2I07A 4QWWC 4D8PA 5MP6H 2GTZB 4QKXB 4LNRA 1YPZB 5IEHA 4K94L 1P7QA 1G6VK 1NCAL 3QA3B 5TPWH 1OAXL 3VXUB 4YK4C 5IWLA 3C6LC 3LHPL 4PJCA 3G9VA 3T1FA 4LLVB 2OK0L 1CR9L 3H7BA 1T0PB 2HT2D 5EO0B 4DJMA 4OB5H 1PBYA 4U1LB 1L7TL 4CMMA 4NUGH 1CCZA 2E8YA 4KUCF 4NJ9H 5ID0B 2AEPL 2YS4A 4CUCA 4ZTPH 4QT5B 3B3IA 3FN0L 3Q48A 5GS1A 4JZJA 2WWMC 1GGIH 5BW7A 4PRHA 3WMSA 4M7JH 5E6ZA 4RAUA 1LO0L 1INEL 3H7BB 1KFGA 2N56A 1OSPH 3GFUA 3DROA 3LRSA 5BW7C 4OCMC 1INEH 1FBWA 5M94B 2PF6A 4EZMA 3ZTJG 2BHYA 3BFOA 3QYCA 4GS7B 4ODVL 3IETB 4KC3B 4M00A 1TNNA 3STZA 4PJFA 1BF2A 2VZUA 3EDJA 1EK3A 1F13A 5TF0A 4WUKL 4TSAH 3HC3H 3MXVH 2CK2A 4MX7A 4OT1L 4X7EC 5K9KA 4W68A 5JUEH 1U91B 2I9LA 4D0CA 1HHHB 3GSWB 4XNUH 3ZTNL 2AEQH 1KIPA 5DMIL 2L7UA 4H1LH 2K7QA 4OZFA 1IMHC 2FEDC 5DJ6A 3FO0L 5MERB 4XCEB 3U30B 1OAZH 2O61A 4WV1A 4UDUA 1IGYB 4HUWA 1MREH 4NKIH 1H3TA 4WY7H 5I1JL 4EUPG 4QOKD 4YFEA 1IRAY 3MJ7A 5C07A 4H26B 4JJ5A 1IS9A 3KG5A 4L3EE 1WBXB 4NM4H 1UA6L 1YYLH 4M6NH 3WJLC 4NN5B 3DECA 3EBAA 5A2KH 3IFPB 5HYQA 5FOBB 1T0MA 1D6EA 3WKIA 3C2AH 4KHXH 4G8FA 3WN5A 5JPMA 1QO3A 1ZVYA 4FZ8L 1C12B 1LO5A 3IJYA 2A9NH 1ZVSB 4YDKL 5JXEC 1G7PB 1RULL 3MFFA 2Q86A 4KWUA 1YNKH 5ESAB 2Q7NA 1X5IA 4NRXA 4F7TB 2R4RL 1FNEA 1IC4H 2HT2C 2YD7A 3BP6A 4KQ3L 4C83B 5FM5M 3SE3A 3C8HA 1XF2A 1NFDF 3SPVB 2J4WH 1BQHB 1JGVL 3SDYL 4NQSA 3O2DH 3RJQB 1CL7H 1RFDL 2UVFA 4UIMA 4AMKH 1BIHA 3ARGC 3O8XB 1C5BL 2VSDA 1OM3H 1JCKA 4KRNA 1INQA 1QLRB 1MIEL 4YHYC 4PJFB 4GAYB 1G7HA 4ZG8A 4JKPH 4K3EL 1IFHL 3HTLX 2ZNWA 3MGAA 4NWUH 4DQOL 5A2LH 3G5YA 1UB5B 5F7HA 5MEND 2V2WA 4PV8A 4G43B 1RMFH 5EU4A 4EL8A 5BS0A 3DUHA 2RI8A 3WV0A 5E6ID 1A6ZA 3GMLA 1I7ZA 3OXRA 4NHUB 1NCCL 4Z8FH 1KJ2A 3MRQB 3ARBB 5FA3A 5FKAA 5FGSA 1H3PL 1F97A 4U3HA 5L2JA 5CKAA 3CVHH 3LH2L 5LCVL 5F70A 4JDZB 4ZAKC 3ARGD 5E5UB 1ROWA 1NDMA 1OCWH 2GJ6E 2GK0A 4ODXB 4MNHB 4CVUA 4QOKB 3MV01 3S9DB 2BVEA 1SBSH 5F1NB 4NKDA 1GOGA 4PTUB 5F71A 2BNUB 4RFEB 2J8HA 1A4JA 2AJVL 4HIHB 3RNQB 5FKAB 1S7XA 4OCRH 3M17A 4MXWL 4QRRD 1UCBL 5IJVB 3QH3A 3QUYD 4QOKA 3K81A 2ZZUT 3TV3H 3CFDA 1VKXB 2DMKA 1E27B 5DI8B 3FHAA 1BIIB 1SQ2N 3HMXL 4R7DA 2Z92B 1FE8L 3FN3A 2G60H 4YPGA 5HXMA 1S7UA 1NMCB 4L8SC 4DEPB 1YNKL 4HQQH 1NJ9A 3ZE2E 2EH7L 1A1OA 4D3CL 4P2OD 4K9EC 3P0YL 1QQDB 4FQ1H 2CD0A 4XVTL 5CIPH 4ZSOE 5FUOH 4Z7QF 3VXDA 4YAQB 1GOHA 3L95B 4M4RA 1WLHA 1FBIH 1RK0B 3PGDB 4NQTA 3I50L 1WQVT 1QD0A 4K2UL 3ZYZA 2HKFH 4OCSH 3QUMA 3DOSA 2NXYB 4U7SA 5F1OB 1ONQA 1IQDB 5F93C 2GHWB 2PTTB 2BSED 3O3BB 5M7YA 4MB4A 4K8RD 4LP5A 4JVWA 4QYOA 4HUNB 4OLYL 2XRAL 3MROA 1NFIA 3P2TA 4WI5A 4HKXA 1OAZL 3ARBD 3S4SG 3TT3L 1B0GB 4EEEA 3PMMA 2GQHA 3TLRA 4P2RB 1JS4A 4JZJC 3RIAK 3L3HA 2X4NA 2DQTL 3T77B 3I02B 1ZLVK 3WKMH 2QSQA 1IAOA 1U58B 4YHMH 3S5LB 4A6YB 4MDJA 1N2RA 3BMVA 4QRQA 2R8SL 2DROA 5D6DC 3NA9L 3QQ9C 3EYSH 5IVOA 4BSJA 4M1CC 1HXYB 4OLWL 5I1JH 3FQXA 4LLAA 1ZGLP 4Y5VB 2CRYA 3WL9A 3K4ZA 3UTQA 4F2MB 3O9WD 1CDCA 3ULSA 1IGFH 3MNWA 3BDBA 3E0GA 3HMWH 2DMBA 3G6JE 5F6HI 2C7UB 1U91A 4M93B 1DQLH 2HTKD 2FBJL 3W7XA 3MGTB 2CIKA 1CWVA 1KACB 3EQAA 5KTEL 4ONGL 1BP3B 5GSRA 3QIWD 1H5BA 1L0XA 2FGWH 2RCSL 4IMKC 1FGNH 4FQQB 2X4UB 1CFTA 3IF1B 1ACZA 4WV1B 1GGCL 1MVFA 1AH1A 4NC1E 5GGTH 1A14H 2AI0H 2AJ3A 5GY3A 4LHJB 4UT6L 1F3JB 1P4IL 5LGHL 5T3ZD 4GS7C 1CGSL 3RZWA 3EOTL 4QRPA 1LEKB 2EEBA 3BSZH 3D3VB 4R26H 4ZNEE 1N59B 3S37H 4X6DF 1P6FA 5ETUA 2R0WL 5DFWH 1QEWA 2P43B 2Y07H 5KSUB 5C2BH 2IAMA 3VFOA 5H37H 1KF9B 3QNYA 1FJ1A 1U8KB 3CFBB 3VH8A 4J2XA 3VWKC 1G7IA 1M7IA 2WK2A 1JP5A 1E27A 5DI8A 3SY0A 5JW5A 1QKZH 1U3HD 1Y6NR 4X7DC 4NO0A 4Q9BA 4WO4D 3F5WB 2CLVB 2BC4B 4NYLB 1Q9LA 5DSCB 5KSAC 2JJVA 4WUUE 2IQAB 4OT1H 1XGPB 3V8CA 3WUXA 2VLJB 4HLZG 1SY6A 1JHTB 2Y4SA 2R56L 5TGBB 1IKNC 3B5GA 3OG6B 5CJXC 3SDAD 3FL7A 2NY5L 4LHUG 5D1XB 1XIWB 1YJDL 4L4TA 4NKOA 2MPAL 4DUVA 5KSBE 1PQZB 3KJ6H 5IQ7L 5F8RC 1NGXB 5D1XC 3ZL4L 2ZG3A 2XI9A 4DKFL 4UU9B 1JF1B 2VTFA 4R4FL 5EU4B 3C5ZA 2I07B 4O02L 5CIPA 4WV1C 1NUNB 3IDYC 4WFGE 2HMIC 1A6WL 4ZOEA 3RI5F 1T1ZB 4XMLL 2VZ1A 1CR9H 4MNGE 2EC8A 5KTEH 2X4UA 1N0LA 3RIAF 2J88H 1A4KA 3D69A 5I1DB 4AY0A 1FNSH 4X6FB 3FOMA 1RZKL 3QBTB 4L4JA 4NHUA 5TE4L 3HUJA 5MP6L 5EO1B 5DDHA 5CEYB 4QRSB 2Y6SD 1SJXA 3OX8B 4UDTA 2IALB 3EFFB 3SGKC 4R4FH 4S1DD 1EFQA 1Q9WA 5F96L 3SDCD 2JJBA 1T2QL 3QUML 4JR9L 5E4EB 4ZTOL 2YUXA 4N0RA 5JXEA 5EO9A 3RTQA 3N1GC 3V5HB 5I15H 4IIQC 2VR4A 4JM4H 3KPLA 1A6AB 3HMXH 3RWJB 2YD9A 4L4VB 1YEEH 3KR3L 4F7CB 4OLYH 3A6CL 4X4ME 4TOYL 4OF7A 1PSKL 3VXSD 4K3HA 1AGFA 4PPTA 3MRFA 2VAAA 3QH3B 1A7OH 4G8FB 3ANKA 3DTXB 1P4LB 5EPMB 3OB8A 1EBPA 3S37L 2AJVH 1R0AL 4PUBH 4HIIA 3U7YL 2BOBB 5JIIA 1JBJA 4EBQH 3LN4B 3QUXA 1SJVA 4HKJA 3I3EA 3IU3A 2Q76B 3KYKL 4RSVA 1FBIL 1YQVL 3G5VB 5BRZB 3HR5B 1JWMB 4GG8A 1DQML 3MUGB 3OJDA 5CUSH 4G6ML 1I7TA 4NPYB 2R1XA 4APQA 5ISZB 2G5BB 1DBKH 2W0LA 4BM7A 2AK4E 4HXAH 4FTVE 1OGAA 1NC4B 1KBGL 5D2NB 4GH7B 3FQWA 4TTDC 3T2NH 2W91A 2VLRE 2BP3A 3LKOB 2YK1H 2C4FU 4XNZB 4CAGA 4M5ZH 4PGJA 5SWQB 4R26L 3ANIA 4KPHH 1BPVA 4WW2A 2ATKA 4K55A 5KKBA 5EH1A 3D0LA 1Q0XH 4LPCA 1IC7H 4OLUL 3WFHA 4AG4H 2JF4A 5C08E 3HNTH 2PYEA 1QTYT 3OL2A 4AYFA 1FVEB 4HWNA 4TUJB 2XWBB 3B9KC 1UWGH 3WSQL 2A9MH 1AD9A 3KJ4B 4CRPA 4OCRL 2YZ8A 3SDYH 3KXFE 3MACL 3FZUD 2ITCB 2A1WH 5EU7C 1DTUA 2XNAB 3CFJA 3KYNA 5KSVA 1C5DB 3TT1H 3LDBB 3LEXA 2CJUL 1VACB 1AKJA 3S8WA 5FKPB 4YHKH 3QEHB 1N5AA 3B3IB 4XB7A 3WHE1 4LMQE 1F4XL 3WXWL 2VXSL 3HZMA 5JW4N 2RFXA 2CMRH 4U33A 1FAKT 3TWCL 1QVOB 1YEKH 3V0WL 4LFHG 2G5RA 4KZEH 2VLME 1T1WA 3MGTA 1WZLA 2VLKE 3RGVB 1V8HA 4HKJB 1RD6A 2F19L 3OKOB 1IFHH 4Y4HA 5HHXH 3L7EA 5EBLB 3U9PH 5D1QA 2PO6B 1RZJL 3E1F1 3GRWH 3ARGB 3O8XC 5FYJD 1F4WL 2XACC 1V3KA 4HIJA 4HUUB 2Q8AL 5I8EA 2FATH 3VXQB 1IJ9A 4GKZB 3DX8A 5GZOD 5E70A 4UILL 5HI4D 3E8UL 5FDWA 1BAFL 1OF2B 4R2GB 1PKQA 1SEQL 3MBXL 3WFCH 5J3HD 4N0YH 3W7SA 1D5BA 1HE7A 4YEFA 1WTGT 3ARFA 4KGJA 1WITA 2QEJA 3T0BA 1HOCB 3F6LA 4MMZC 2Z91B 4UB0H 4KDTA 2UZIL 3TVMC 3VWJA 2HN7A 3CU7A 1JGVH 1OT2A 4NN6B 2C5DC 4WU5A 1DBMH 5L7XL 2L7JA 1MLBB 2R0LL 3R8QA 3VRJB 3LN5B 3DX9B 1V3JA 3B9KD 3FFCB 1N7MH 3TO4A 1MCHA 1NGPH 4PJHB 4HKBA 3MLZH 3T08A 4P4RB 1CE1L 5C92A 5SWSD 1KREA 2LAGB 4PLJC 4JG0L 3BJ91 5CP7A 3C5ZB 3C5JB 4DZ8A 3OGOE 3JTSA 3MFFB 4L4TB 3PWLB 5FF6A 2X4SA 4J5TA 4CVZB 4M62L 3MRJB 5D7SH 1NGXA 1VFUA 3GSQA 1A7RH 4G6AD 4XMKH 4QRTB 1OW0A 5JUEL 3H42H 3HRZB 4X99A 3QO1B 1YMHA 4HPOH 2FJHB 4GMSH 2VKWA 4AIZA 1TVBA 4F33B 1YY9D 2DMCA 4G9FE 4J3SA 4X5WA 5JDSA 2D7NA 3O6ML 5BMFL 1FSKB 3STBA 3ZT6A 4OKDA 4KVNL 4FXKA 3AROA 4EI5A 4XHJC 4M61B 3P3YA 3VI3F 1NFDA 5BVJB 1GA2A 4L8DA 1JNNL 2NTFB 2PO6D 1V7MH 4ZXBA 1MVUA 3DV6B 4N0CC 3UTPD 2EZ0C 3QDAA 1NAMA 5KSAA 4RMRA 5GRJH 2DKSA 5CCKL 3RDTB 2EABA 1JUFA 2DWEA 4D9LH 4YE4L 4J3VA 1T6VN 3RU8H 2FGZA 5J6GB 1K4CB 2Y25A 3G08A 2DQUL 1RZKC 4GRLA 2NTFA 4MJIB 4DUWA 3EGSB 4XAWH 3OXRB 4HUXA 4CMHC 5E95B 1J11A 2QR0A 3CC5B 1J05B 2EDFA 3GHEL 4JO2H 5C09D 3VA6A 1H5BB 4JY4A 4XAKD 5ICXA 5LBSH 4XNQA 4NRYA 3KPRA 2KKQA 1EGJL 2XN9B 4JEGB 1WIPA 4ISVA 3LQAL 1JTTA 3G5VA 5DJZA 5CZKA 3C5ZC 9CGTA 2AGJH 2EYSB 1AI1L 2Q8BL 4Z7VA 4ODSH 1TQCB 4ZO9A 5AUMA 4PRDA 1TETH 4OZ4A 5KVEL 1EJOH 1SEBA 3RKDC 4F9PC 3QXVA 2BXYA 4YIQA 5B8CC 2VLRA 1F4HA 3ZSTA 4N5EC 3GM8A 3O81A 4MA8H 3FTGA 1IC7L 3KDMA 3V0WH 4WI3A 3IT8D 4HJ0D 1X4YA 4LCYA 1U92A 5EZLB 35C8H 2C3XA 1ZV5A 5IFAH 2BSSB 3P0GB 5KVGH 4F7PB 1YEDB 2FIKB 2C1PA 4KVCL 5DMIH 1URLA 2N7BA 3L5XH 3RTQC 5IOPA 3HFMH 1B4JH 3S4AA 3MOAH 2BNQA 3K1DA 4YAQA 1ONQB 3W5NA 3WKGA 3VH8G 5EZIH 5FAAA 5HYJE 3IU4L 4GQPH 3NTCH 5DC4B 5FYLD 3O3BA 1LO3H 3PHQB 1GYAA 5F7NC 4D9LL 1MCFA 5CAYB 5DYOB 3WHXB 4QXUH 3TPKA 2DQJH 3MRGA 3CDYA 2XTJE 4WFED 1P69B 3IDMA 3P2CA 4I3RH 2CQSA 2P5WA 5C6WH 3DURB 3QHTC 5DMKB 3QUZA 4U1HB 4KTYA 1ZAGA 4D2NA 2OL3L 4QO1A 1T1WB 4K23H 2D7MA 5IB3A 3RZCD 4FNLH 3CX5J 4WWKC 5EU6E 4HS8L 5GIRB 3EJYC 1KIQA 4KXZI 1PDKA 2F54D 2VXQL 4UTAL 5TE7H 5J11B 3RDTD 2YWYA 2ESVD 4GFTB 1FQ9C 1U36A 1WAAF 5L88H 2QHRH 4N9GA 4BZ2L 4A2LA 4ODTL 43CAA 1KLFA 1LMKA 1ACYH 4PJ8B 5DUBB 3E2HB 3QIWA 4RA3A 1W72H 1ACYL 5D7IB 1MF2H 4H8WC 1HKLL 3QIWC 4CN1A 5CGTA 3KR3H 2HJLA 1FZMB 3BEWA 5DRNA 2H3NA 4NO2B 3S4SA 5EC2A 1K72A 1IAIH 1DLFL 2VB5A 1U8KA 3PUCA 1M71B 2A1WL 3ZKSD 3WFHB 3KPSE 2O5YH 2X42A 3BEVA 4ZFOB 3BKJH 5ACZA 1T80A 6CGTA 4MS8C 1C08A 1JYXA 3BHBA 5FM4A 1G0DA 3LEYL 4U3XA 4TOYH 2V5YA 3QIBC 1FBOA 3LEYH 3QHFH 4C83A 1E4WH 4F58L 4KY1H 3TH4T 1BQHG 2A73B 3QQ9D 3EYQC 3TZVB 5IR1A 5JOFA 5FYJL 1IKFL 1G0XA 5TH2B 1Q1JH 2OR7A 4FFZL 5ECJE 3V6OE 5E2JA 5FF6B 2XQBL 4YXKH 2VLKB 3FCTA 4IM8A 3JTSB 4WU0A 3U46A 3Q1SL 2W9DL 4HXAL 3PL6A 2GSIB 2WINB 3NFPB 4LLDA 4UU9A 3TPUA 2APTA 2MMXA 4P59H 4Y8AA 4LSVH 5JQHC 5LQBH 4OZHA 1X5GA 4RFNC 5SX4H 3V6FB 1IM9B 1QUNA 2XZQL 1WWBX 1P7KB 4Z95H 5HI5C 5T1KB 3QULA 1MRCL 3IAQA 1LGVA 2ICWI 1A6WH 1TDQA 5JTWA 1V3MA 1JN6A 3HUJF 3MUHL 3I2CH 3GHBL 1FL5B 5DHYA 5HHMD 3VE0B 5C71A 1I1RA 5GS2D 3UYRH 5MENB 3BRGC 3HRPA 5IBTH 3SDCB 2H6PB 4MCYB 1MHPL 4KFZC 3TJEH 3MOBL 2PTTA 4OLVH 2V17H 4O51A 3QUZB 2WUBL 1TTFA 4X6EA 5FXCH 1IQDA 1KRFA 4LCWA 3U2SB 3MROB 5C08B 3ILQD 4PRPA 3DBXA 3BGFB 4HAGA 2FV0A 4NCDA 5MEOB 1NGQL 3SDDD 1QVOA 3LQAH 3KPNA 3RHWF 5KVDL 4PREA 4K7PH 5K93A 2GJZB 5D72H 3ULVF 1F90H 3KPRE 5T3XL 5FYJE 4GJTB 1BVLA 3DETC 2QADB 1CZ8H 1R3KB 1AD0B 3PABB 4RIRA 4XXDB 1GPOL 4W81A 5DK2B 1VB9A 3C6LD 5E8NA 5JQ6L 5ESVA 3THML 4W6YB 2C3WA 2ZPKH 3GGWB 1OT1A 2VE6B 5GGTA 1GHFH 2PYFA 1CBVL 3DRTB 1K85A 2DIAA 3W7WA 3BEWB 5DRNB 3L95A 1ZHLB 3BGMA 3O4LD 5FYKE 5D71H 1DQLL 3QXAB 3HLAA 3CDGB 4HZAA 4FQPA 2X2YA 4QF1A 3B43A 4DTGL 1AYXA 2F53B 1TJGL 4XNXL 2MPAH 1Z0NA 5K9OA 2GKIA 2AV1A 2EDHA 3PGCA 5J57B 4CL7A 5SWSE 1OWWA 3NA9H 3D9AL 4MD0B 4X80L 3DRQB 4X4YB 4OBRA 5HHOB 1A3RL 4GKSA 4YDVB 3MV7D 1KCRL 1C8PA 1IGJB 5F9OH 3QNXB 1J0ZA 5DRZB 1HINH 4JPIB 3BWUC 2FSEB 5IBTL 3I6KB 5IB1A 1SYSB 1TZIB 3FB7B 1Q9LB 4MQXD 4P2QE 1KJ3H 3TJHD 4A6YH 4JQXC 1YUHB 5JORA 2Z4QA 1OD7A 3QCTH 4Z4LA 1SY6H 1WIOA 3UX9B 3MLVL 1KJ2L 4Y16D 5KW9L 4HIXL 4JQXA 1EEZA 1KG0A 5BZWB 3ULUE 2W60B 1I9RH 2Y36H 3NZ8A 3DX7B 4HWEL 3CVIH 3TT3H 3BIAX 3CLEL 4X5XB 3BYTA 3NMEA 3Q2CA 4M9PA 4HJ0C 3MCG1 4CW1A 4NBYB 2CDFB 2NY2C 2HJKA 3QISA 3VG0L 1F3DH 3OKNB 4XNYH 5KN5A 1HILA 1J8KA 3GIVA 1VGEL 1WZMA 1QBBA 1CXEA 1JWSB 5JMOC 5J1SC 2A74B 3LCYA 3LKQB 4XVUD 2HT4D 3VFUA 3MOQA 3RP1A 3UJIH 5I1GH 3QCUH 1S7RB 2P8MA 3UO1L 1R3HA 4POZD 2K1MA 3CIQA 4AT6B 1MFDL 1VFOA 2ADFL 5DGQA 4U1JB 3D6GA 4KKCC 4Z77B 5B39G 4POUB 3SE9L 2BSTA 1N5YL 4F7PA 1NPUA 4UDTB 3UTSA 4MXQD 1WBXA 5CINH 4BFBD 3BZ4B 3GSNH 3RWEA 5TFSH 5ACMA 3P40A 5D9SB 2DQHL 1MIMH 3E3QC 4DGYH 5ID1B 5DRXA 5TDPB 1EO8L 5GZOC 1S3KL 5KSBA 3EJJX 3FO9A 4EJ1C 4Y19B 2P47B 1YEJL 4U6HB 3I6LE 2CUIA 5C2BL 1J8HE 4GG6E 4JDTH 1TFHA 2RIKA 1F5WA 4WGWB 5DVOA 4EXPX 2M1KA 4QLRA 1U8NA 1S7TB 3HAEG 3HI6L 3TC9A 3IXAB 4I3GA 5FCSH 1YN6A 2OP4L 2JIXD 3C60C 3P4LA 3BQUB 3CVHB 4FQXB 1I75A 4PTTB 4DVRH 1MQKH 4N9OB 5E08L 2OLDA 3HUJE 3OF6A 3OF6D 5FA4A 1GZQA 3QO0A 1OAKL 1UYWL 3K8LA 5I0DA 1AQDB 4LAQL 2NY7H 3HZYA 4YHZL 1RURL 1RZ7H 2Z31D 4L8CB 2F5AL 2Z8VC 1TVHA 3SBWC 4PP2B 4E9LA 4MHHI 3DXAB 1VPOH 2YPKB 4KJYB 5EFIB 2PXYB 2FJHA 1IVLA 2UY7A 1G9NC 1F00I 4LBEA 3ZTNH 2EKSA 4AIOA 2PO6C 2ZUYA 4NNPH 4YHML 5BV7C 2QJDA 3UTOA 5DUPH 4Q9QL 1KJ2B 1I85C 5BXFA 3QIBD 1UM5L 2HVKB 5TJWK 5C0CB 4LBEB 4X6EB 3KS0H 4U1HA 5IHZA 1D9KB 1T04B 4HWBA 4KI5E 2E6JA 1BFOB 1H8OA 5LAXA 1DLHA 5DK2A 5IFHH 5F7YC 1WISA 2ITCA 2NNAA 3OKNA 4KV5E 2Q20A 3BPLB 3IKKA 4H0GA 2ZSWB 1EHLH 3S34L 4Y5XC 4TNWF 4Z8FL 4HGMA 1ZGLA 4DGYL 3C2AL 3J7HA 5E8NB 3CSYB 4WGVB 5F3BA 1KNOA 1U8QA 2GSGB 3IFOB 4CN6A 4YHNB 4G7YL 3OWEA 3ARTA 2MFNA 4EBQL 1KC5H 3V7MA 1CD1A 5DVMA 2X1QA 2XA3A 1RJZA 4V1DA 4PJCE 4KTRA 2DYPD 4YBQD 1SY6L 4EI6A 1NDGA 1NUDA 4JO1L 1NLDL 3AFJA 5EULV 5I74C 1HYSD 1MCWW 3MCKB 4NP4L 4JHWL 5L9DH 3RJDA 4H1LB 3DMMC 4DKEL 3VWJD 2MHAB 5D8JH 2AXGB 2MWCA 2ICWA 2EACA 1YEJH 2BVQA 2ZUTA 4LSUH 3GKZA 1BOYA 5EBLA 5TQ0H 1EUUA 1I7UA 3NFNA 4JDVA 3AXLA 3ARQA 2CKBA 1A6UH 3PV6B 4P2OB 5DQ9B 2PXYD 2V5RA 5DXWA 2RGKA 5BV7B 2F5BH 2NY1B 4IJ3C 4DKDC 4HWEH 3CVIL 4LVOB 4Z7UB 3TBYA 4KAQH 1Z5LB 5IB2B 4JRYE 4XRCA 3MBXH 3X3FH 3ZZ1A 1U58A 2GUOB 2K7PA 1PLGL 3VXPA 1DQDH 5IT2L 1HNFA 4Q0XL 5DQDL 3FCTB 3D85B 4RBPK 2KL6A 1IGTB 5ELIA 5C09E 2H2SD 2CDGA 4XAKE 1M7DB 4OIAA 4WDIA 4WY7L 1HH6B 5EC1B 4CNIB 3SE8L 1BFTA 5IROC 4HCRA 4I8DA 4Y4FC 1DBJL 3NOIA 5HHQB 3LIZH 3CSYA 4U1KA 3H2WA 3T2OA 3GK8H 3TH3T 1AD0A 5ICZA 4TVPD 3REVA 5EORL 7CGTA 4U1IB 5EWIL 2VLMD 1ZLUH 3EYUL 2HJKB 5GIRA 2F8VA 5IBUG 3EZ8A 1G9MC 2VAJA 4MA3A 2BVPA 3MV8E 1IC5L 1PKQE 5C0RL 5DA4A 3EZJB 3HC4L 3QWOB 5E8PB 5FM5O 5GRYA 1BD2A 1TLKA 3FFDA 5J9PB 4OI9A 5HDBE 5JR1L 2EDWA 4A6YL 3B4NA 1T83C 1DR9A 1F90L 3O6KH 2YPVL 2EDRA 3T0EC 5E94B 4G6KH 5EZOL 5D9SA 2W0FA 5F7LB 1FZMA 3HC0B 3KPTA 1BWWA 2BRRL 2OR9H 3IGAB 2VABA 1FPTH 3UZQA 4JQIL 3WNOA 3L1OL 3AU1B 4G3YH 3WS3A 4JM2F 1N3NA 1RVFH 2EXWD 3LD8C 4CMMB 1L9MA 1P4BH 3I6LD 1KOAA 1J8HD 2VLJA 3FO9B 1A0QH 4PJHA 1T1XA 4LCIH 4X6BA 5BVPH 5T3XH 4KMTL 1N0XL 3W11D 1Z3GL 5CSZA 2FDBP 1KSDA 3WUZA 3IAGC 1TQBC 5I71B 5EN2B 1MPAH 1ZHKA 2MHAA 3WFDH 4QGYA 2DQDH 5I1CH 3ACSA 1XGYH 3I75B 2DJUA 4JFEE 4LSTH 4AM0A 4S1RL 4J23A 3BMWA 1FFPB 4MJIE 3S35H 2B5IC 3WNPA 1BBJB 2O5XL 3LKNB 4XI5C 4DOEA 1NFDE 3SE8H 1IKNA 2CLRB 3RWDB 1ZHLA 3BGMB 1DVFD 4JFZH 1EAJA 4LQFH 5I6XB 1PG7X 4RISL 3CMGA 2X1WL 3O3DB 1JHKH 2YRLA 2CQVA 5F3HA 5JHLL 1T5WA 1F4YL 4M1GL 1WC7B 2BNQD 5HSFA 5GHWL 4KTDL 5T1LA 5T1LD 5DS8B 3QDMA 2YC1A 3MQIA 1A9EA 4RWYH 1IEAA 3GI9H 2RQ8A 4YFDB 3O45A 3ZDYE 4MB5A 4GXUN 2R2EA 3OJMB 3HE7B 4R4BA 2Q3ZA 1YEDA 2FIKA 4XGZA 5KOMC 3MMEA 3QPXH 4NC1C 1U3ZA 3S88L 4GMTH 1KFAL 5C86A 2R1WA 5I15L 5BXFB 3DPBA 3C9NB 1LP9E 4WI2A 4E42B 3RAJH 4IHOA 3QDMD 4PJHF 3OMZA 5KANI 3VFWA 4ZSOA 4JY6A 1QNZL 2DQFA 4FXLA 1Y0LA 3I02A 1NXCA 1NLDH 4HK0A 3HAEH 1A1MB 3UBXI 4K71B 3WO3B 4P57B 2I24N 2BVOA 3GKWH 3DETD 2DDQL 4R0LC 1GC1L 3NZ8B 4HFUH 5ID0A 1N8ZA 1U3HA 1UJ3A 3GNML 4K8RL 5E56A 2EXWC 2Z0BA 1MCEA 2IEPA 3TA3A 1HH9A 1ZANH 5JLZA 1DQMH 4QXWA 1T20A 3IDMB 3ULVC 4ZFFB 1H8SA 1OCWL 1LEGB 3GMPA 3H7LA 1LF9A 3RNKA 1MCRA 2JK5B 1W72A 3MGOB 3FT4B 1G7HB 2BVUA 3NABL 1I9IL 5HGGS 3QPQD 2KZ1B 4ZO7A 2YD3A 2V2WB 2WUCH 4PV8B 3ZO0A 4Z7UE 2X4OA 1F3JA 2FB4L 3U6RB 5HYJA 4JFFB 4MZ2A 2NXYC 1TZHA 5L88L 1NEZB 2BNQB 1M7IB 4GKOA 3V5KB 5J12B 4WTWA 5EBMB 2FD6H 2P8LB 4ELKB 4C57C 3SKOA 1T1YB 2QADD 3TCLA 1LNUB 2KUTA 3MOAL 5KSUA 1QLFB 3B5TA 3M1BB 1QBAA 4ZS6D 3VGAC 5IESH 4OM1H 3H0TB 4Z78B 2F53A 1FLRL 2P5WE 5A1AA 1CDYA 3QPXL 4R96B 5I2IB 2R1YA 4HDIA 4RMSA 3F7QA 3S3SA 5HYSA 3PP3K 2CR3A 2EYRA 2IADB 4MAYC 1XF1A 3PWLA 2VUOA 1ZK9A 5F6HJ 1MIEH 4ZUWB 1OGTA 4AH2B 4BZ1L 3BH8A 2X4QB 4P57A 5IHLB 5J6HA 2Z91A 4KRMB 3ARVA 1N2RB 5F9JA 3DVNA 1PG7W 4XUVA 4FQJL 1UZ6F 3GBLA 3F12B 4DKFH 4K3JL 2DJSA 5GSVB 4PJIF 5I1KH 4YFLI 3TO2A 5GGUB 1A6TB 1ZHBB 3KWWB 3Q6FB 1S5HA 1S7SA 1BOGA 5JNYA 4DK6A 2A74A 3IFNH 5SX5H 4IRJB 2GSIA 5GGUA 2XQYG 3OKLA 3U6RA 2I26N 3Q5OA 5ITBL 1DLHB 5L2KD 1PKQB 5IWLC 4G6AC 3LPGA 2NZ9D 2CK0L 1MRDL 2FBOJ 5AZ2H 1KPRA 5DJXB 5TDNB 1QBLL 1DZBA 4PJHE 3FAXA 2R4RH 4CU8A 5TDOA 2FEDD 4J1UA 3RI5K 1VADB 2B39A 4XWOC 4G8GB 5ITFB 3EJYD 3M8OL 1DBAL 4ELMA 5F88B 4X98A 4YHPA 3RNKB 1FYHB 4KKBD 4KHTH 4J3WA 4AM0B 2EAEA 2YOCA 3S97C 1YDPA 2BZDA 4LL9A 5FUZH 4OZHE 3O3EA 1HCFX 3PDOA 4GMSL 1Z9MA 5L8JB 4ZDHA 4WWKB 1I8MB 1R5VA 3W9DB 3WIRA 5FYKL 3ZE1F 2X4SB 1A8JH 1UFUA 2DRQA 2QTEA 2V2XA 4WJ5B 3C5JA 1AGBB 4M43L 5ISZA 4U1MB 3CSBA 1G0YR 5D1ZD 1V7ML 4OQTA 1VGKA 2D9QB 4O2CB 3KPRB 3GGWA 4FQXA 4D0BA 1JHTA 1FIGH 3QIUC 3GJEB 1R5IB 4LPTA 1MIML 1A64A 5HGHA 1SM3L 4R4BB 1FIGL 1F42A 2H1PL 3LN9A 3LZFH 4LCWE 4UQ2A 3MRRA 2OYPA 3GHEH 2YMXL 4P99A 5FM8A 4PRPE 4PG9A 2JJUA 3VFTB 3DLQR 1S7VB 1MCPL 4YX2L 3GZKA 3VFPB 2FJFB 1NGYA 2DWEB 4LRIC 4NWTH 4P5TA 1OARH 4HK0B 1SM3H 1YQ2A 3MLZL 4M6MH 2HFEA 1CE1H 2AK4A 2BY1A 5DQDH 3NAAH 4XP1L 5F6IB 1NAML 3DXAD 3VXRA 1BZ9B 2RJMA 2AV7B 2ZCHH 3STLB 1J0HA 3I50H 5DEGA 1P84K 4M62H 4MAUL 1A7QH 1LK2A 2LU3A 2ICCA 2R4SH 3U4AA 3PXJA 4PJCF 2XKNA 4JFDA 3TF4A 1JFQH 4BKLB 4KKAC 2PYEE 4FQHB 2EH7H 4XB8A 4KGLA 4ALAL 2GY7B 3ZHLA 1BAFH 5C0FA 3MRPA 2OX5A 1U2HA 3GSNB 2WWKT 3QDGE 3ZMRA 1RZFL 3IDGA 4OZ4B 3GMQA 1JZ5A 3BN9C 2P24B 1X5XA 2VKXA 4G9DB 1MELA 4JREC 3IKCB 3BKYL 2P8LA 3O4LA 3T4YB 3QJHB 2VABB 2VLRB 4LDLB 1H3VA 1XFPA 4JKMA 1OAYH 1ODAA 4BUHA 4GMTL 4OGXH 1FZKB 1B2WH 4JFFA 1WVZA 5IOPB 5T1MB 2J8UF 3B83A 4ZAKA 1D5BB 5JA8B 4QY8B 4ENED 3AREB 4Y1AD 4I3SH 4L29B 4PRIB 1NEUA 2BSRA 3FT3B 3N50A 1IARB 1KELH 1EO5A 1S7UB 2NR6C 1CQKA 2COQA 2XTJB 2KQMA 3PIQB 1KJMB 2DTML 1M05A 2UZYB 4NM8H 4PJAA 5JW5B 3QDEA 3KLAB 1T1XB 1ZT4B 1XMWA 3RWGB 2C9AA 1AFVL 3MRDB 2Q8AH 5E4IA 1YY8A 4AEIL 4Z76A 1MFBH 2NW2B 4IIQA 2VL5B 3V2AR 3G5XA 4N8VG 1EO8H 2Z9TA 4TULH 4K3JH 5KSAD 4XPTH 1ADQA 3CDCA 5KSBB 3R4DA 3VG9B 3NGBC 2GEEA 4GW5A 3EJZC 4UINH 1ZHNB 2AK1L 5T3ZL 4WDIB 2FX8H 4QRUB 4Y5YB 3JWOH 5DUMH 3WUWG 1ZSDB 1P6AB 2DN7A 1NBVL 1MFDH 4MVBD 3MYJB 3MLYH 4PRHD 4H0HB 1HQRA 2KPNA 2EECA 3RRSA 2GY5A 3DO7A 3L3OB 1JVKA 1NANI 1TNMA 4UIKH 4P9HL 2J7LA 2OJEB 5BS0B 1CLZH 1T7WA 1UWXH 3HPLA 1OTUD 3QO1A 2E3VA 1U3YA 2ARJA 4C55A 5D6CA 1RIVL 1AY1L 1SBBA 2FCBA 5I8OL 4BSWA 1MVUB 1JL8A 3T4AA 3X13B 3VFNB 5D93B 2DQGL 3HUJB 1LE9B 5DJYB 2ADGB 5T3XE 4HLJA 1N64L 1O5DT 1UT9A 3JWOC 3AC0A 1WV7T 2CQTA 4HKXB 3RPIB 1LO0H 5JXED 2J88L 4P2RD 3T0AA 2AJ3B 4WTZA 3HAEB 5EOTA 2AERT 1AHWB 3TNNB 1YN6B 4MJ2A 5HDQH 1FYTB 5AYUH 2X89A 5K59E 4YR6A 3QSPA 4FFVD 1OY3B 1UKSA 4GRMB 4FFZH 3QNZA 1DBJH 1XGTB 2W07A 3ZL4H 3QEGH 1ZA3B 4OM0L 4OIBA 5H94A 3Q5YA 4Y2OA 4I5BB 1YQVH 2H9GB 2CLZB 5DRXB 3IDJA 4WI8A 2A0LC 4U1NB 1XT5A 2AABH 1U8QB 4JPKL 4LPVA 4Q0XH 4H25B 5I1LA 5JOPD 5A2IH 3GIZH 3BAEL 4LSPH 2FV1A 2NTSP 1FNSL 4G3YL 4MQ7B 3PF2A 1Z0MA 4OI7A 3ILPA 2PR4H 2DS4A 1HHGB 3QULB 4LCYB 4X6CF 4X7CC 4QHUB 5GRWA 4MB3A 3KDMB 3V5KA 4KRLB 4PJGE 3KS0J 4HJJH 4LEOB 5D1QC 4H88H 2D9CA 3C8DA 5F96H 1ZLVH 3O6KL 4OD3H 3WYRA 5HYSB 5D93C 5F9AC 2B1HL 5FGCE 2CSPA 1IL1A 3WEXB 1B4JL 2AS5M 4Y89A 3T4AB 3X13A 5B39B 1MAKA 4P5TB 4ZUUA 3U36A 2DICA 1JPST 3GI8H 2I60L 5TF1H 1QFOA 5KW9H 1DANT 4PJ9A 5L9DL 1AGEB 1GZPB 4KJPD 3VXRE 1RK0A 3PGDA 5C0DA 3QHZL 5B4MC 3L3GA 5JO5A 3IXTB 1IL1B 1Z3GH 2R56H 1N0XH 5C0EA 1I1YA 1FDLH 4YUEL 4KDTC 4NT6A 4XMLH 5I1DA 1UACH 3CH1B 3TYFB 4OKVA 4S1SH 1QSVA 4PJBE 1MAJA 3C2SA 1KPVB 1GGCH 1QR1B 1I1AB 4Y4KB 5INCB 5D2LE 5A3IC 2JCCB 3GMQB 1H9VA 3RVWC 5T5FH 2XY2A 3QDGA 3VCLB 2F54B 2R0WH 3KPMB 3W9DA 2E9IA 2OMBA 4I13B 1IGFL 3MLRL 4M6OL 1MUJA 4M1GH 2FNBA 4X5WB 2V2XB 3I85A 1G6RL 3LAFA 2Y06H 1A14L 2AI0L 4YH6A 3L3DB 5A43C 2J5LC 4JQIH 3V4PH 4P59L 5F1IA 1R24A 3UDWA 3NH7H 3D2UB 2PW2A 2VNCA 2FGWL 2RCSH 3ZTJH 3VI4E 4JKWA 4PJDE 3SY0B 2IBZX 5EORH 1FO0L 1MY7A 2QSCH 4O2EB 1BFVL 1Q94A 4PJAE 5EU6A 4AEHH 3FRPA 4JHWH 2BFVH 1B4RA 1G1YA 4L3CB 3O2VL 5HHPA 4R2GD 5CZLA 2AABL 1QACA 1RIUL 3BPLC 5FDWB 4K2UH 3EYFB 4QRPE 4IRZH 1NC4A 3OAUL 4MA8L 1JRHH 3DX8B 1MWAL 4EDWL 3VW5A 1ES0A 3OKEB 2FX8L 1QEWB 1IAMA 4Q6IB 1NGQH 2EYTB 8FABA 5J0BA 2LABA 3L1OH 1J0JA 5HBBA 1F9OA 1L9NA 1ZT1A 3BP7A 3HS0B 3BO8B 4I48B 5E8EB 1D6EB 3QUKA 1QQDA 1EO7A 5LGJB 1P4LA 5EPMA 4JJJA 1ZOXA 1BQHA 2WBKA 1JF1A 5FV1L 3QUZD 4KK9C 1KUMA 1JTOA 3BH8B 3DX7A 2ERJB 5C0AA 5BV7H 2D03L 5JMRA 1M4KA 1I9JH 4Y5VA 4Y8DC 5I1AB 1IBGL 2DI9A 1G7JB 3NPSB 3TO2B 2A38A 1A3QA 2DQGH 1MQ8A 1OOAA 1MLCA 3LQZA 5FKPA 1IM9A 1CG9A 4JPKH 3BP4A 4X4XA 1ZS8A 1MJ8L 3VJ6A 4OSUH 5IHZB 4MA7L 4JVPA 5DVKA 5JHDB 1VA9A 1VPOL 5GGSB 1FYTE 5GGVL 5F9WB 1Z9OA 2AJZA 3AREC 2QL1A 3L7FB 3T0XA 3RL2A 4QHKI 4TUJA 4N0CD 1KLUB 1MHHA 4W6XB 1CDHA 4XCEA 1BD2B 5D7LE 4HULB 4YHLL 4JFEA 1Q72H 3MZTA 4JPWH 5M7QA 5CWSB 1YNLH 4MJIA 4OCSL 3IRPX 3EO1A 1MQKL 1INDH 3C8KB 1X5KA 1EAPA 3MRGB 1YEGL 2IQ9L 2D31A 4BK5A 1AGCB 3E6HB 1JUFB 1T5XB 4WVBA 1H0DA 2EDNA 3EHBD 2VERN 1JWUA 5I30H 4CMHB 5IKCB 3P4OB 3DRTA 1SBSL 4Q2BA 5HHME 4Z7WF 2W0PA 4RAUB 4XXDA 1I4FB 2QHLA 2VE6A 4APQB 1KJ2H 2ED7A 4ZDHB 4NSKB 1YMMB 3CVHL 3LH2H 1RIHH 1WZ1L 1HDMA 3BD5A 1A1OB 1S3KH 1WT5A 5FGCB 5MEQA 3D18A 1BZ7A 1IEHA 2VQUA 2QQQA 2ADJB 4MXWH 1V5DA 3GMOB 3AGVA 3C60B 4HBCL 4QY8A 5ESAA 4RMUA 1Z2KA 1FN4B 4DVBA 1OP3K 5CS7A 1EVTC 1KJVB 1KCUH 1KCVH 1F8TH 3QXAA 4NFCA 5IB5B 1RURH 4PJGA 1DVFB 1LDPL 1FH5H 3QCVL 1U8JA 1CFNA 2P7TB 4JO1H 1LP9A 5CSGA 1BM3L 4FQXD 4X0KB 5B21A 2ZWLT 2XN9E 4TVPL 1EXUB 3LQZB 2R69L 2WLZA 25C8L 4YBLC 3SGEI 4U6VH 2VDRL 3C08H 1V7VA 3E8UH 5KVEH 4PJ5D 3BPCB 4PJGF 4JREB 1IGYA 4FTVA 2MSPA 2EDXA 2PTVA 4MA1C 3OV6A 2N4IA 4LFHD 4ODSL 3JSSA 1NFIB 5DMGC 3G5XB 3QR2A 4TUOB 3SBWA 3LSOB 1JZ8A 5C07B 2CO7B 3VXME 1JZ6A 1F2XK 3MV8D 1L6XA 2YC1B 2DWDB 4Y0GA 4HEME 1MCBA 1XCQA 3MRNA 4A6YA 5D7IF 1QHPA 3O8XD 2FO4B 3CXHK 4P3DA 4E0RA 2W60A 2HG5B 1UZ6E 4NRZB 2H26A 2JJWA 5C08A 4KHXL 3QJFB 3FO2A 4PJBA 1I9RL 5JORB 5GJSH 2CK0H 4TUKL 1F2QA 1MAMH 5IR1B 5JOFB 4JLRB 5DUPL 3Q6GH 3QXDB 4H20H 1KNOB 3MXVL 1RJZB 4PJBF 3OKOA 3NCJL 3T3PE 1NMBH 6FABL 4K94C 1DBAH 4W6WB 1FCCA 5EUOB 1G9GA 4LPXA 4PJFF 5E00B 2QQKH 1K9TA 4CDGC 3GSNA 2BHUA 1EFXD 4EI5C 4P2QA 5JIKA 1OSPL 4MQTB 2O26U 3V0VA 4WFGD 2F53E 4J3TA 1OAKH 4L4VD 5IVZA 1R24B 5I76A 4U1JA 1IM3B 1RJYB 3L3DA 5MEHA 1N6QL 1KTRL 4K3DH 43CAB 1RJLA 4NUGL 2EIZA 1SJEA 4KJQD 4IRZL 4M6NL 5F1NA 1FGVL 2HLFD 4LRNH 5I17A 4Z7UF 3WJJA 3F8UB 3RGHA 3MLRH 3RUGB 4XPFL 2Y5TB 4M5ZL 3RWHA 3QG0A 1AE6H 1NLBH 2NR6D 4LKXA 3ULVD 1SEBB 5DFVD 4K94H 3M45A 3EYOB 3MRCA 4HS3A 5D7IA 3TVMB 2QSCL 3P4MB 1X5AA 5HY9B 5E94A 2CUHA 1L7IL 4DOHB 1QBLH 5FYKH 1WK0A 1S9KC 3HC0A 5CUSL 2SEBA 5DGRA 3PABA 1L7TH 1ZEAH 3SGJC 4Z76B 3MV7A 3BT2L 3F5WA 3QT3A 3LDBC 4I48A 1IKFH 2H32H 4YPJA 3MRCB 4HS3B 5IVXF 1A7BA 5CFHA 3AB0B 4D9RD 4OQTL 3ARFB 1U6AL 1JYWA 4YDJB 3V52H 4U1IA 3MR9B 4K71C 4Q9CA 4PG2A 3U7WL 5DA0B 5IHBA 3OTTA 4OTXL 3O11B 5AD0A 1AXTH 1B90A 1MFCL 3BP4B 3N06B 4NRXB 5HYFA 4MA1B 1GAFH 2BXZA 1E6OL 3J8F7 1OP5K 3VXNB 4WI7A 4YC2C 1T2QH 3QUMH 3QFDB 4P2QB 5L0QB 3DUUB 3H9HB 4WO4C 3VFMB 5B3JF 4P3WA 3BE1H 2ERJC 1P7HL 4MD0A 5HYSG 4C59B 1FVDA 2VOTA 43C9B 3BWAA 5C1MB 1DVFC 3HG1B 5GGSA 4M48L 4OGYL 1HCVA 1UQSA 3CLEH 3MNVA 4AZ8A 1OP3H 1U42A 4TSCL 1W72L 1CDJA 3MREB 3S3PA 3WKNA 5DZLA 4G9FA 1IGMH 2Q6WB 5FGRA 2I27N 4WCYL 2CDEB 3LPWA 1A6VH 3MJ9L 3SDCC 4QRSA 3CJJA 2FATL 1JMZA 4XMPL 3SDDA 3L5WA 3LB6C 2FWOB 1PFCA 2GCYA 5LVEA 5T33H 4HLZH 1NC2A 1SJHB 4RX4D 1CBVH 2AV7A 2VDRH 4N8VB 4PJEB 3RTQD 4PJIB 4NZUL 3W2DL 3W0WE 5KZCD 5C2UB 1AQKL 1JPGA 4F3FB 1FORH 5IV2A 3WJLA 1IQWL 4JFED 4ZUVB 2FX9H 3Q0HA 3C60A 5D5MA 5DTFA 3D39B 4OLZL 3IFOA 1TQBB 4GRLB 3BP7B 5IGXL 3NCBB 3H9SD 3HNTL 1S9YB 3GI9L