3X1NA

Nitrite-bound thermostable copper nitrite reductase at 320 k
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
298
structure length
298
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHAGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-temperature and high-resolution crystallography of thermostable copper nitrite reductase
pubmed doi rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 102
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1nA00
4HCFA 4AKQA 2IWKA 3X1BA 4AX3A 2MTAA 1KGYE 1PLAA 3FU9A 2BO0A 1GYCA 2PCYA 2FQFA 2XUWA 2J55A 3NJMA 1AANA 1IBYA 2JKWA 2YAQA 4GP4B 4BK5C 4F7KA 1JVLA 4GXFA 1F56A 5B7EA 4YSCA 5LDUA 2UX6A 1PZBA 1BQRA 4W9ZA 1SDDA 2VW6A 1NIBA 3S8GB 2HX9A 1RZPA 3NJJA 4KNTA 3FYIB 1JVOA 1AZCA 5PAZA 2CCWA 3OMNB 3U25A 1KV7A 5AKRA 5FC9A 2RACA 4AZUA 1BXAA 6PAZA 1W8EA 4PCYA 4E9QA 2YAEA 4WTQA 1IKOP 2ZXWB 1W6WA 2IH8A 1BQKA 3FPYA 1N68A 4N8UA 3FPXA 3HEIB 3C75A 2BHFA 2QT6A 1A4CA 1PLBA 2EIMB 1PY0A 1BXUA 4UANA 2VW7A 4G7SB 4YSQA 1QLEB 3NJFA 3DKHA 3TASA 3CDZB 4F2FA 1B3IA 1ASPA 4RH4A 5D4JA 1CURA 1TU2A 1M56B 3QJQB 3H56A 1J9QA 4DPCX 4JHUA 2GI0A 1XMEB 2E86A 4YSTA 4QLWA 1L9OA 4GP5B 2HZHA 4P5RA 5F7AA 1AS6A 1WS7A 1XB8A 3UACA 3NJIA 2FJSA 1NIFA 2VMJA 1A3ZA 2ZONA 2XX1A 5E9NA 4BXSV 3T6VA 1KCWA 3TU6A 1AS7A 1BXVA 4FAAB 2VSKB 3X2QB 2YAMA 2CJ3A 1DZ0A 3WKQA 2QDWA 1V54B 1M9WA 1EHKB 4G7RB 4KO7A 5I6LA 2FT8A 2I7OA 2N0MA 2FQDA 2IDQA 2Q9OA 2GC4C 1GR7A 2GBAA 2IDTA 2YQBA 2YAOA 4A66A 2PCFA 1GS8A 4ZK8A 4YVUA 4JKNA 5B7MA 3T6XA 3N55A 2W88A 3H4HA 1SF3A 3QJTB 2CAKA 2DYRB 3FU7A 4HCGA 4GY4A 2IDFA 1ADWA 1J5DA 3ABGA 3ZIYA 5I6MA 1PMYA 1FWXA 3FQYA 5EHFA 1JZHA 2FT6A 8PAZA 1AQ8A 3AG2B 2HX7A 4TXVB 1ETJA 1OV8A 2R7EA 3IEAA 4G70B 3TA4D 4CSPA 3NJGA 2MRYA 1AZNA 1A4BA 1OOWA 3AW5A 2X88A 4KOCA 4NERA 5TK2A 4DP5X 1L9RA 2VW4A 3OMIB 4F2EA 3JT2A 3FU8A 4KOBA 5B1JA 3X1FA 1E5YA 1WS8A 5I5IA 4A2FA 3ZX1A 1NIEA 4E9WA 5B1JC 2VM3A 3OD3A 2BZ7A 9PCYA 1XB3A 2BP8B 4YSOA 7PAZA 4Q89A 1I53A 3WNIA 4QKTA 1L9PA 2YAPA 2UXFA 3CG8A 1J9RA 4AKPA 1TEFA 4M4RB 1A65A 1HAUA 3OM3B 1OF0A 2DWTA 4A2GA 4NAJA 1PF3A 1PCSA 1CC3A 1GY1A 1OE2A 1AR1B 3S3BB 2H5UA 2FWLB 2QPDB 3NT0A 4HAKA 2PPDA 2HX8A 2IH9A 1AZRA 3NP4A 4YSEA 1ZIBA 1ET8A 1NINA 2Y1AA 1CYXA 3T6ZA 2VN3A 3CVCA 4K9JA 4UAHA 2X87A 4A2EA 4WKXA 4UF7C 3OQRA 4HIPA 3FSWA 4E9XA 2IDSA 1KBVA 1TEGA 1L9TA 3IE9A 2I7SA 3ABMB 3QQXA 4BXVA 2YXWA 2PPCA 3MX0B 1IUZA 3EHBB 1KDJA 2XX0A 1JZIA 1JZFA 1BEXA 3GYRA 3CVBA 3GXUB 2IWFA 4DPBX 1KBWA 3L45A 4DP1X 1JXDA 2XV2A 3PLYA 3ZDWA 4AI7A 4YSSA 2FNWA 7PCYA 2OCCB 3EF4A 2PPFA 3X1GA 1W6LA 2YXVA 1PAZA 3GDCA 2BZCA 2QDVA 2YARA 3CZUB 3WI9A 1NIAA 5I5MA 4DP8X 2TSAA 4PAZA 1VLXA 2AFNA 2YAFA 2GC7C 3SBPA 3UABA 3MBWB 3PCYA 2AANA 3QJRB 1AAJA 3CDZA 3BVDB 4YL4A 4KO6A 4BWUA 4DP6X 2CUAA 2IAAC 2H47C 1TKWA 2CBPA 4DP9X 3UADA 1QHQA 2BW5A 3IBOA 5D4HA 1MZZA 1ID2A 3CVDA 1NZRA 2H3XC 3ERXA 4G72B 3AY2A 1AIZA 1OE3A 2FT7A 1KYAA 4YSPA 1JERA 1AS8A 1E67A 3IN2A 3NSCA 3QJUB 4YSUA 4BDVB 1FFTB 3H4FA 3N2JA 4G7QB 2BW4A 1A8ZA 2BP0A 4E9RA 1M57B 2NRDA 1ZV2A 3T6WA 5I6NA 3FSZA 1ET5A 1SFDA 2EILB 3NYKA 1BYOA 3S3DB 4KNUA 1HFUA 3X1EA 1YLBB 3T71A 3UAEA 4MFHA 3TBCA 2XVBA 2YAHA 1ZDSA 2CALA 4HALA 1QNIA 1X9UA 1L9SA 1ZPUA 1NICA 1AACA 3FU7B 1E5ZA 5B1BB 1SHWA 2DWSA 4W1TA 1SFHA 2BWDA 2XWZA 2HLEB 1V55B 4E9SA 5D4IA 2AVFA 1BAWA 3HB3B 3EH3B 3FQ1A 2QPEB 1PZAA 3QPKA 1J5CA 2XXGA 4HHWA 2AZUA 1E30A 1R1CA 3BQVA 3AG4B 3FT0A 3NSDA 4M3HA 5PCYA 2W8CA 3WKPA 5F7BA 1UATA 2EIJB 4GP8B 2GIMA 1AG0A 4YVNA 5I5JA 2J56A 3EH4B 2XV0A 2TSBA 3QJSB 3T9WA 4DP2X 2FQEA 1ZIAA 1AZUA 2XLLA 3EH5B 4P5SA 3TBBA 4DP0X 3KW7A 3S8FB 2HRGA 2BWIA 2VSMB 3WG7B 2B08A 2XV3A 2PP9A 4E9TA 1JZGA 4KO9A 1OCCB 2IWEA 1OCRB 1GW0A 5AZUA 1URIA 2GHZA 1E65A 1IBZA 3FSVA 5ANHA 4A2HA 1KDIA 1JZEA 1NWOA 1ZDQA 2EIKB 2GSMB 2I85A 3PAVA 2OV0A 3ASNB 1SHXA 4X4KA 1T5KA 1XB6A 1RKRA 2FQGA 1GS6X 2PP7A 1AZBA 2FTAA 4YSDA 3X1NA 2XU9A 2B3IA 3NJNA 2AZAA 4BWWA 3ABLB 4A68A 2JFCA 1MG3C 2HRHA 4GYBA 1PNDA 2UX7A 4G71B 3V9EA 5I6OA 4KNSA 1MZYA 1MG2C 5B3SB 1WA1X 5I26A 2WO3B 3NSFA 1PZCA 1NWPA 3FSAA 2DV6A 4HCIA 2J57A 1L9QA 4HHGA 1GY2A 3FQ2A 3NJLA 2PPEA 3NP3A 1MDAA 1OCOB 3AZUA 4JHVA 1ASQA 3DIVA 3WNJA 4KO5A 3G5WA 1WA2X 3ABKB 2UXTA 3SQRA 1SJMA 1OCZB 1J9SA 1ET7A 4AKOA 4FA7B 3D12B 1DYZA 4YSRA 5AFAA 1BQ5A 1SNRA 1A4AA 1CUOA 3ASOB 2OJ1A 1AG6A 2WO2B 1SF5A 2XXFA 4Q8BA 2ZWNA 3S3CB 2PP8A 2A3TA 2VM4A 1RCYA 4BWTA 4YSAA 1NDTA 2DY2A 1JXFA 2LLNA 1X9RA 5B1KA 1ILUA 4CSZA 2P80D 1PLCA 1GS7A 2HXAA 3RYMA 1WA0X 2UXVA 4N4YB 1ASOA 5I28A 4L0PB 1J9TA 3AG3B 3QJVB 1NIDA 2J5WA 3PXLA 5B1AB 5I6KA 1GSKA 3PAZA 4BDVA 5TK4A 2R7EB 2WSDA 4ENZA 1OE1A 2BP0B 4E9YA 2UXGA 1NPJA 1ILSA 3DTUB 1EZLA 1KCBA 1IC0A 2PLTA 1SDDB 3PAUA 2Q5BA 4E9VA 1BYPA 1JOIA 2GB2A 3FYEB 4DP4X 2EINB 3SBQA 4NB7A 1PNCA 2JXMA 3UAAA 1WAEA 5I6PA 5IY5B 3PPSA 3NJKA 4DPAX 2BP8A 1CYWA 2IDUA 3JTBA 1V10A 1JXGA 2PPAA 3NSYA 4DP7X 5A7EA 2Y69B 1RZQA 1AOZA 5B7FA 3NJHA 3UGEA 3FS9A 3WIAA 3AG1B 3SBRA 1N70A 1JZJA 3KW8A 2ZOOA 1FA4A 3OMAB 6PCYA 1HAWA 2XYBA 2DYSB 1NPNA 3ZBMA 3V9CA 4A2DA 4HZ1A 4A67A 2P80A 1NTDA 3IN0A 4EF3A
chains in the Genus database with same CATH superfamily
3W39A 3D1MC 3BKCL 3B9DA 1B4TA 5LGYA 4R4BB 3LNHA 1FVCA 5FYLE 1KGYE 1YNKL 3FU9A 3HLAB 3QAZB 1U3NA 4HS8H 2FQFA 5DFVC 3GRBA 12E8L 1IBYA 4TQIA 5T5NF 3IMSA 2XVGA 3C60D 3MJ6A 3DROA 4XBEL 1PY9A 1MFAH 3I6LE 4M61B 4ELKB 3GC3A 3BW9B 4IMLB 2EUVA 3S8GB 1ZD6A 3SDCA 1RZPA 3HIZA 4S1QL 5D96B 3I9IA 1AO7D 3B34A 1XCWA 3CFCL 4HX1A 4D0DA 4K8RD 3TA3B 5D8JH 2B2XH 3BUBA 4LLWB 3WTYA 4R6UA 2RACA 3RZCA 2ROYA 3U30C 5ADOL 2CKBB 2QKIB 4HUWB 2YA2A 1IKOP 1Q94A 1M9SA 3PWPB 3MROA 1F4WH 2CLZA 1FO0H 5J6SA 2EH7L 4WTZA 3RUGE 1E3ZA 1A6AA 1MPAH 5IM7A 3ZKMD 3LY6A 3T0BA 2ZNWA 5BZDB 3NFPA 3TEWA 3S0PA 4CC4C 1N7ML 4XVJL 5ICXA 2X40A 4XPTH 4JDVB 3N5AA 1ETZB 1OCWH 4MYWB 3DKHA 3LZFL 5D6DA 5CEYA 2EEFA 2VDMB 2V4LA 4LOUD 5I74C 1QPKA 2X4UA 4WNSA 4XXDA 1LEGB 4DPCX 3IXTA 3IU4H 2M8XA 1A0QH 1F1DA 5IHBA 3OV6A 5F7MC 1SN0A 1WS7A 5DI8A 5ECGA 1PAMA 3ZKQD 5L88L 1T0PB 4ZUWA 1P4IH 2A9CA 4C8XA 3Q6FA 5DRZA 5DMYA 1RZ7H 1U8JB 4AL8H 1BXVA 4BFKA 4HOMA 3IFPB 3DROB 4PRPE 1XGUB 3ZQ9A 3WKQA 5GGTL 2QDWA 3N9GH 4QT5A 4XNBA 1O9VA 1IBGH 1OARL 4G7RB 1N5AA 1K9TA 2CZNA 1EUUA 1RU9L 5BV7H 2N0MA 1TTGA 2Q9OA 3HZYB 1N5YH 3CVHA 5GGTA 3S4SB 3MRRB 5I1CH 4DN3H 2VN4A 4JKNA 2B59A 2Q1EA 4N2IA 2BIMA 3N55A 3T6XA 3KBHE 4P07A 3PHSA 4F15C 2HT4C 4QHPA 1WZ1H 3VI4E 4GY4A 1X6NA 2ZIDA 3CSTA 1MW1A 2HT4D 3LKSB 1VFAA 2WXIA 5D2NA 2XN9B 1JN6A 3VXRE 3ZSSA 5A1AA 3APNA 4PVMA 1OGSA 4CVWA 3VQ1C 2ED7A 1E2VA 1UXMA 4EE2A 4Z7VE 2FWOA 5DLLA 1LXMA 2HVBA 4JPIA 2WVSA 4L4TD 3TA4D 3GSXA 4XVOA 2MRYA 3D87B 6FABH 2DQJL 3E38A 5MENB 4JRXD 3N41B 4QRTA 4R7DB 5K9OB 1U36A 2VC2L 4L4VB 4F3FA 5C6TL 3RWJA 3G6JE 2RFXB 4Y89A 3EZJB 1E6OL 2AJ3B 4XGZB 3FZUD 4HUKB 3GSUA 4E2OA 3QRFM 2V9TA 4KZ0A 3APCA 3N0PB 3CZKA 4FZ8L 3GIZL 2Y7OA 3D33A 4V1DE 1NMBL 1IEBA 4YDJB 2MMXA 3NSXA 3AWGA 3P4NA 3UXFA 1HAUA 2AAAA 4RFOL 5D93C 4DQOL 3QRGH 4GNKB 4JM4L 1TCRA 2DYPB 3FFOA 1GY1A 2A83B 3SDDB 3QIUC 4ZOAA 3AREB 2B8OT 3B2PA 4X9GA 5A2FA 3FTYA 4Y4FB 4BA0A 4PJFE 5ERWB 4Z3GA 3VRJB 5FPIA 5IR1A 3W38A 1MWOA 5GS3A 3L3HA 3EJCA 3S98A 1X7QA 2HJLA 1F3JA 3RY5A 5GZNC 5HPMA 3BO8A 4OD3L 4LSTH 5BRQA 4WUUE 4NUJA 4J5VA 5HDLA 3K5RA 3C9NB 4P5KB 4PJ5E 4ZFFB 1HXMA 1JK8B 1QP1A 1J8HB 2A9NH 4YE4H 2B14A 4NZDA 2VLKD 2XX0A 1OB1B 4JZNB 1W72L 2PCPB 5AW5B 3OB0H 1CVSC 4G6AC 3BZEB 5F0PB 1JF5A 4XP9L 2XV2A 3DO7B 1R0AL 4U6VL 3P30L 4YBLC 2OBGA 1ZVHA 1JP5A 3AT8A 4GSRA 3EF4A 4IBLT 4N1EA 2F0CA 4F91B 1ERNA 2EC9U 3K7UA 3ZL4L 5KVEL 3LXAA 3OKLA 4A55A 1ZVYA 4DGYL 2D4FA 3KPSD 1AYRA 3WI9A 4PV1C 4C54A 5CAYB 4RMWA 2ICWA 3ULUL 3FQWA 1E2WA 2A9NL 5CILL 2CO3A 5C0RL 3QJRB 4WEEA 1PLGL 5MEPA 1N6QL 1UCBL 4BWUA 5ICYB 2ZWSA 1XF2A 4XOAA 3WS3B 3VFUA 1QRKA 2BNQB 2DQDH 3EYSH 1VGKA 3HUJF 4JY4A 1LP9B 4M4PA 5D4HA 3MRQB 5A3ID 4L2LA 5I9QC 2Q7AA 1MNUL 4X4YA 1R75A 5D2NC 5I15H 1KLGA 1O7DE 3BEVA 4PG2A 1XGYH 2UV3A 4ABQA 1QUPA 1MFVA 3E1F1 2Q8AH 1E67A 1SVBA 4ZTPL 1O0VA 4P3CH 3RGVA 5E99L 3CLWA 3LKRB 4QIRA 4P5KA 2OL3H 1XEUA 4PRNA 4ZUTB 4HKZA 1KXHA 4LLUA 5DHYB 5BRZD 4Z3HA 2OR9H 4O02L 2XN2A 5CXPA 3BUDA 4DQOH 5I1HH 1AFVL 4U7SA 3SPJA 1I1YB 1NCGA 3D0VB 3WFDL 1AGEA 4LLMB 5ANMA 3SJVA 4AEHL 3DMMA 3S3DB 3SDAA 4O2FB 2F54B 4XPAL 2JXMB 4XZUA 5KSAC 2AITA 1E42A 1BD2D 2E3VA 3MREB 4XCEB 1O9ZA 4LSRL 5DT1H 2CNZA 3MLXH 3UIZA 2X6AA 3QEUB 3MR9B 4NNXB 4XNDA 1AGBB 3SPVB 3LN4B 3QPQD 4F9LC 2X2YA 5JHDB 3OWEA 4HLZH 1FZOA 3GUFA 2C7UB 3FCTB 3CFBB 4QRRE 5GSRB 4B5EA 1YY9C 2C1OA 2XZAH 4MJJA 4HIEB 1WAAF 3ZE0F 5I1DB 3MKKA 2YR3A 1CD1B 1NBVL 2PXYA 4XMZA 1A6ZA 3ZOAA 1AC6A 1XAKA 3RHWK 3MNVB 1RK0B 4HIJA 2YPVA 2V5SA 5K9JH 3ATDA 3QPKA 1EJOL 1SZNA 3E8VA 3L9YA 4AIXA 4N1CA 4GBXA 1CQKA 2LAAA 2D3JA 1Z9SB 4LE8A 3G6JF 2Y07L 3MI6A 1YUKB 3JUZA 4NQEB 35C8H 2IQ9H 1Q8MA 2ERJC 3AROA 3TBSB 3VJ6A 5CN2A 1X9LA 5C2UB 5F6IC 4Y16D 4OSUH 2FHBA 3MUHL 2NY2D 4QGYA 1HEJC 1WFUA 4XVUD 1OAKH 2DWYA 4NN5B 2DJ4A 5EO0B 3I9GH 3ILDA 4N68A 3FO0H 4JN1H 4L23A 4NQXB 3FH5A 3IJSB 4U3CA 3MJWA 5KYXA 4QRSB 5CZVL 3QORD 3EO1A 1IVLA 1E28A 4UTAA 1URIA 3TVMD 1LO5A 1YEGL 1QWUA 1MCDA 3KVDD 2AQ1A 1QBLH 4PJFB 1TQVA 2A77H 4F33A 4ETQB 4ANVA 1U2HA 1BVZA 2ZXDA 4LBEA 2JK5A 4XCCL 1QYGL 1FIEA 5L88H 4PRPD 3PAVA 5I0WA 5F9JB 1FNEB 4NN7C 4FYQA 3W0WB 4EO5A 1YZZA 4OLWL 4JE4B 1BZOA 4LMQI 3MRIB 1XB6A 3VYPA 4YS4A 3LEVL 1KTLB 1LDPH 2ZX7A 4OGYL 4WFGD 3ZKND 1OIOA 2BNUA 4B53A 3EDEA 2C1OB 1U33A 1XMWA 2K6ZA 5HYJA 1DEEA 3KBFA 3TN0C 4FQLL 1UWEH 1CDIA 4KNQA 1SXCA 4S1RH 3STZA 1NGZB 2WGXA 1FO0B 4R83A 4J2XA 3K46A 3OXSA 3ARGC 4XTRD 4D8PA 4W81A 4NZ8A 3GSNA 4HS3A 4HULB 1UD3A 2AVGA 2GIXA 5DMJB 1ES0A 1H6UA 2TRHA 3L3IA 5BOZG 4LSRH 3TXAA 2GSIB 1OCOB 1QTYT 2VRAA 2R69A 4KKCD 1F45A 3IAPA 5HYQB 5AENA 1IIIA 3ZYJA 1JDAA 3ZDXB 1BX2A 4AEHH 2OZNA 5E6IA 4DGIH 2XETA 2VR7A 4PWIA 3SY0A 1GH7A 3ZDXF 5DYOA 3LPOA 5AFAA 2CO2A 1XFPA 1R6VA 1NLDL 1MFAL 5C0CB 3E80A 1YEIH 4NO5B 1Q0XL 2UUDK 3IETB 1J05B 2FHCA 2A9BA 4YSAA 3CUPB 1T4WA 3AY4C 4CSZA 1LWHA 4IIQC 1ZLVK 4ANWA 3I50H 2B1AL 5IV2A 3IJEB 4S0TD 5F3FA 2NCEA 2F5AL 4N4YB 5ENWB 1N4XH 4G9FE 5EG6C 3CHRA 3GDBA 5GRUL 4A6YH 3OF6A 3FUHA 4WQOA 3D39A 1UCBH 4BDVA 3A47A 5I1AB 2R7EB 5L7XL 3KYKL 1I8UA 5IMLA 2BIQA 3D08A 3HG5A 2XOTA 4E9YA 4UNVA 5AB0A 4LF3A 5EO9A 3A23A 4G3YL 2V3DA 2GJ6A 5E8DH 2A6KB 4HK0B 5EF1A 1FYTE 1CFQB 2W0FB 1PY4A 1U95B 2OMVB 1FNGB 3JTSB 4UT9L 5J1AB 2W65A 4JCWA 3QWOB 3QUMH 4TF4A 5FW7A 3RB7A 3B7YA 3VXMA 1IEAA 4TNWK 5CJBA 4NI3A 4JFQB 3SO3B 5DZ9A 3LKNA 5GRZA 4MKMA 3PWNA 2EKSB 3DOIA 2F74A 1YAZA 1KG0A 3WEOA 2WZ5A 1HOCA 2D7PA 3QHFH 1J1OH 4H2AA 3JTBA 2K3HA 1BIIA 2JKXA 4YZWA 1JXGA 4KJQC 1U0QA 2YC1A 5GJTL 5A7EA 4BIKA 3UBXG 5IFAL 2FYYA 4M4RA 1RZQA 3L48A 2LTQC 5ESVA 2WWMC 4MJ5B 1BGXH 4UT6H 4LAQH 3HI6H 3AG1B 5GISH 1KB9K 5TE6H 4DK3A 1QR1B 2AHIA 4NO5A 2ICWJ 1NCAH 1S8DA 2DYSB 5AKVA 1VFBA 3GB7B 2C9VA 1J88A 2HLAA 3WTVA 3K72A 3OAUH 1RURL 3EYUL 1TJXA 3ML9A 4EF3A 5EU4B 3ULUD 2FX8L 1GGYA 1WRFA 2XJKA 3K1DA 4PJBA 4MBOA 4DPRA 5IB3B 5K9KB 4JDZA 4CNIA 2ESVA 3U36A 2Y6SD 4PJAB 5I16B 2ESVD 3GSNL 5AW3B 4GXFA 3KH3A 4JG1L 5B7EA 5K33A 5ADPL 5LN8A 2ETWA 4QRPB 5DD6A 1U95A 3MLPA 3HAEH 5DRXA 3MLVL 2ZKYA 1JVOA 1CDUA 1DLFL 3BUIA 4WJKB 4EUPG 5AAWC 2EC8A 4FFVD 3ZTCC 3IDMB 4KX7A 2Y25A 2YGNA 2Y36H 4URTB 3OX8A 4R97B 4UT7H 4MXVE 3V7AG 5KANG 1W6WA 5CUSH 4ZFQA 4WAFA 2NLJA 3QG7L 3NCEB 3ARPA 3FPXA 5KAQF 5GHWL 4MD0A 3U1SL 1MJ7H 2N4IA 4I87A 3VG0H 1RZJL 1PSKL 2WUCL 3JTTA 4G7SB 3VFWB 2OI9B 1ITBB 4AGMA 5FGCE 1E7VA 4F8QA 3Q9QA 3OMZA 5D72L 4WUUB 2HLAB 4W9CC 3ULVE 1PIGA 3PE9A 3RNKB 1XMEB 4GW4A 4L3EB 3MNWA 3NRPA 3H3BC 1QEWB 4A2LA 2LE9A 2XZCL 4G6MH 3UACA 1HKLH 4L8DA 4Z5RB 1R5WB 4GW5B 3RNQB 1UD6A 5F1KC 3OXRA 4M7JL 3O6FB 1UA6L 2FL5B 1P9MC 2C9QA 4B9KC 3ZTJH 3DJRA 5BQ7A 2MJWA 1BHGA 1I75A 4KKQA 4OGAC 4ABWA 4WV1B 4E41B 2HTKC 3SQBA 4EQ3A 1E9OA 4AYSA 2YAMA 4XPHH 3D6GA 4BELD 1EHKB 2C1PA 1BBJB 4PY7B 5EFIB 1PG7L 3HC0B 4LRNH 4NDMB 4MVBC 4PJBF 3UERA 5K9QI 1ODUA 2IDQA 1ED3B 4ORGB 3A6CL 4JREC 2YAOA 2ALAA 4HSCX 1N59B 4HUUB 3GLZA 1V3LA 1WBZA 4UMSA 2FX9L 3SO5A 3VUAA 3DWTA 5CGMA 1R3HA 4H8HA 4CDHA 2CBMA 3RUGF 5AEAA 4XCYB 1M2OA 4U3SB 3FU7A 3QZMA 2GFBB 4YDIH 3HNSH 4JQIL 1CG9A 3SDDD 3JTTB 4J3OD 2YPLA 2DH2A 1XZWA 2HVJB 3VFWA 5C70A 1GXEA 2WTRB 5AVWB 3L2MA 3O8XC 4QRRB 4W4OC 1IBFA 4XR8C 4Y4FD 1T22A 4ZS7L 5EOQL 2AJXH 1LTXA 2F19H 1HCZA 4YUEH 4HUXA 1AZNA 4XVJH 2BSDA 2DLFL 1CGUA 5CJQH 2FB4H 5EUOF 4HPYL 1OANA 3ECBB 5CSZA 3MRKA 2Q8BL 4XN4A 4XB7A 3EOTH 4LLYA 1TF4A 2ZSWA 2Y2TA 3I6KA 2BIIA 5FHBL 1OAXH 5AZEH 1JYWA 1TZGL 3HFMH 1H6EA 4LPVA 5TDPA 4F8OA 3O4LA 4BEIA 4HZAA 4K3HA 5JOEA 2VDPL 4M48H 1WWCA 1DE4B 4G6AD 5D8JL 4BM7A 4X9BA 2AQQA 1XIWB 4AKPA 1T1WA 1BBJA 4EN3A 4AVHA 2FGWH 2YGPA 3PP4H 5GGSB 4AGLA 1RD6A 2W38A 3DI2B 1EFQA 5D72H 4J3BA 2DIAA 3T3ME 4WU5B 2UY7B 1QMUA 2V7HB 2XG4A 4FCAA 1AVAA 5E2UL 3V0AC 5D93B 4HOXA 1QLRA 4ZAKC 1J1PH 1JUFA 3QIUD 1NINA 4ZAKB 4OIIL 4F8LA 3V79C 1RZJH 2AQRA 4HBQA 3AS0A 3SE3A 4QY8B 4UUJB 4GG6B 3ILQC 3PP3K 1RJZA 4WKXA 2N7AA 5AAPA 1EZVY 1E9QB 3ATAA 3INUL 3MLTB 3P3RA 1G9MH 4YHZL 5DZJA 5BUPA 5C9JA 2WTRA 3QPXL 4OCMC 3VXSE 2QGDA 4IQHA 1FL6A 1QHPA 2QADD 3HN3A 3I6GB 3H9HB 2DBLL 3SDXE 4Z7QB 5CMAA 2FBRA 4ZFZA 1B9KA 5IVNA 4XAKE 4DEPB 3KLDA 3FB8A 1ODAA 4PLJC 4U1IB 4FLOA 1C16B 4GO9A 4QRFA 1T0NB 3CBKB 4A63A 1FN4A 3TA3A 1AO7A 1QHOA 3Q2LA 4XNQA 3WU1A 1MJJA 3W9EB 4GSDH 3P4LA 2DKSA 4W6WB 1ORSA 1QW9A 2ZG1A 4TUOA 2GCYB 3D9AH 3EO0B 2YXVA 1T1XB 5E24E 1MH5A 3QQDB 2DWDA 1NUDA 1JDDA 3RVTD 5C3IA 3CZUB 1EAPA 2R2BB 3PDOB 4N8PA 3QCUL 4LO9A 5D7JD 1NKOA 4BFOA 3GMOA 4IBUA 3OAYH 3QA3A 3QI9C 4MNHB 3W11D 4UYPA 1KPUA 3G5YA 1KYOJ 2P5EB 3RDTA 1LE9A 1XR8B 3TJEL 3ARZA 4NKMA 5TE6L 3P02A 2J1WA 4KKAC 1P4BL 2EYSB 2KPWA 5GS1C 5C08D 3R7QA 1MZZA 4PGZA 2VDLB 2H3XC 4QO1A 2IMNA 3KCPA 4WLCA 5D7SH 5IQ9A 2IDCA 3T4YA 2WLYA 2YD7A 4G5ZL 4KDVA 1GMEA 4W70A 5D6CA 1M4KA 5TF0A 3DUHA 3FO1A 4LDOB 3B8YA 4Q6YA 2BVTA 2Z31A 2FX7H 2CHZA 2OA9A 1T7VA 2QQNL 3SEPA 1HL4A 4Z7UB 3IDYB 1DJSA 3AGVA 1KIPB 2KUTA 2NZ1A 3LTVA 1MOEA 1Z0NA 3VMPA 1FVEB 2IGLA 1T0MA 1J5IA 3DYOA 4FQPA 3A67L 3QDGE 4IOFD 1CGTA 1JFQH 2NY3D 5B39A 5B38B 1WE5A 1M05A 2NY2B 5T3XL 3GMMB 3UAFA 4I1NB 4HUVB 4X0KB 1GGIL 1NFIA 4XP5H 3KPPA 1GKOA 1LDSA 2XC8A 4ZSOA 1I3GL 1MWAH 1FI8C 1XAUA 3KHOA 2Z91B 3QZWA 5ALBL 1AACA 1M6OA 5G4OA 1E5ZA 4F7CB 2FJGB 4J3OH 3BJLA 4NX0A 3HG2A 5FECA 1A7OL 4KV5E 2CWRA 2VZTA 4ZNCD 1W15A 1BEYL 4LLQA 1CIDA 2UZXB 1VZGA 3CVHL 3RFRA 2H1XA 1BWWA 1V55B 1R24A 5C0GB 3ECWA 2F19L 4X6CA 2AJXL 4PD4K 4WVRA 4CU8A 4PB0L 1Q9LB 1SXNA 2APSA 3CSYB 3F01A 1X4ZA 3MNMA 2ZP0T 5H94B 4FNLH 1BJMA 4LDLB 1MLBB 1DJHA 2H1PH 4HVBA 1LE5A 4KMLB 4EKJA 4TRPH 5HD8D 2AJZA 4OF8A 5L8LB 1DJYA 3OJDA 3UTSE 4IJTA 3IFLL 1QX1A 3KYOA 2AEPH 1OWRM 3GRWH 4QNPF 3QC5X 3EH4B 5GGVH 5E4IA 1N64L 3WEMA 3UG4A 3T9WA 2XTSA 3B56A 2WHVA 3A6CH 3FO9A 3VXME 2K6YA 3CN0A 1X5ZA 1U8KB 5G5DB 5KBKA 2P5EE 2HRGA 3QXDB 1T04B 2RJMA 1T2QL 4E9TA 5HGAB 3BE1H 1YEWA 2Z7YA 1KPRA 4G9DB 4ZO7A 1UACL 1D7BA 1E8YA 3DX7A 3UBFA 1BMZA 2PTVA 1FL5A 3OKKA 4GG6E 1WH0A 2XQYG 1FNFA 4M5TA 1NH6A 1I7UB 1DHKA 1ZDQA 3TFKC 4N3UA 4X6FB 5DK3A 1FNLA 1SHXA 2AEQH 4FFZA 4G42A 4Q6IA 2ORBH 5ERWA 5IR1B 2CDEB 2H26A 4PRBA 3VFNA 1Z9PA 4JGUA 5JHLL 4O51B 1LGVA 4I1PA 3SQOH 1AQKL 2GUOA 4LL9A 2DM7A 3BIBX 1Q0YH 3EUDA 1QSFD 2GYSA 5HGDA 5GGUB 5FYKL 4D9RE 3LQAH 3RDTC 1FORL 4IBSA 2YN5A 1FP5A 4ELDA 3OHXC 3L3JB 5HVGB 3W9DA 1SEBB 3TBWA 3NH7L 2WUCH 4YR6B 2F53B 1D6VH 1TMQA 1WBXB 5B8CA 1WA1X 4UOQA 5IVXF 3MRLB 3RRQA 1OAYH 3SPHA 4HCIA 1EHAA 5HHPB 5I8KL 2XRAH 3BAWA 1WWBX 4MXWH 1XIWC 3NJLA 4B0MB 1OWWA 4FADA 3PWJB 3TNMB 4KY1H 1ASQA 4NKOA 1V5JA 1HHIA 2OQJB 1WA2X 1F6FB 3NZUA 3TBTB 3L81A 1I4FA 2PO6D 4UU9A 3BSHA 5AOKA 4Y8DC 5F9WB 4AV5A 1BG9A 1UOVA 3QEGL 3UTTD 1UQSB 5KVEE 1SNRA 5EZJA 4C4BA 1EJOH 4UNUA 2XXFA 1N0LA 5ADPH 1HC1A 3CZNA 1LEIB 1UD8A 1HHKA 4C59B 5DU7A 1UD2A 3VFUB 1UJTA 2LLNA 1MLCB 2VTFA 3FFCB 2C9RA 3CZEA 2Y3NA 4CMMB 1TETH 4M8RA 1J9CT 4PRBB 4F7EB 4PRAB 5E1HB 1PDKB 3S4SG 2WXFA 2ZXGA 3KWUA 4XCNA 3V2AR 2TRYA 2ZXCA 3FXIC 4G8GE 3PL6C 1IB5A 2VN7A 5IK3A 5L9DL 3V4VH 1CXKA 4ZUTA 1B0GA 1WIPA 4XP4L 1BGXL 3WIIH 4D0CA 1KY7A 1W80A 4AQ1B 3BIKB 4JK0D 4LEBA 5MEOB 5IIEA 5E2TL 4NQED 3RPIB 4GRWH 1J1OL 5CP7B 1GC1C 4KJPC 5E6ZA 2F54A 3RWJB 4DUWA 2D3VA 4LCIH 2UZYB 1NCWL 5AL8A 4LB8A 2A9AA 2DF3A 3VXSD 3NG5A 2XTLA 2WOYA 1G9MC 3HRZA 3QNXA 1J7VR 4MD4B 4WUKL 2WYIA 2CO6A 2I07B 4I89A 1AHWA 3NSYA 1U2YA 2DLHA 3D85B 2Y69B 5IG7A 1DBML 2X6CA 3JV4A 3HI1B 1JGLH 3FS9A 3FN9A 4PGBA 1DFXA 4EVNB 3MRHA 1FA4A 1MFDL 5L7XH 4N24A 3SDDA 1UB5A 4GLRH 5HYSB 2Y23A 1C1EH 5C0RH 1P4LA 3CN2A 2JQAA 3ZHNA 4I77H 1N4XL 3CFUA 3HUJA 4QXTA 3OG6B 2B1AH 4AMKL 4AX3A 4YZFF 1F3JB 2F68X 4OLVL 2BO0A 2LU4A 4XCNB 1KIQB 2XUWA 1ZHKB 4XBGB 1IC5H 3ZT7A 3BZDA 5EF3A 4Y9CA 3CK0L 4IRJB 3GT6A 4O4YH 1NLDH 2GITA 4XWOC 2QGCA 5HHQB 4QRSA 1X5AA 3VMNA 4FQ2L 2F8VA 4YXKH 1VGEL 2JJWA 4JFXB 4PFEA 1U8HA 1X5JA 5AKRA 5FC9A 5J6HA 1UJ3C 1RJYA 1SBBA 4NUPA 1HK6A 4JQXA 4Z7VB 5FUCC 4GI8A 3MRNA 2YAEA 1KENH 2ZXQA 4TLKA 3TVMA 4PJ8D 2XTJB 2IH8A 1FE8L 1PQZB 1RZKH 4HUNB 3SIKA 2ZNXA 4AVJA 1I7TA 2VJ0A 2DMKA 2WNWA 3DOSA 5E5LA 1X5YA 3NPSB 3MGOB 4PBVC 4JKMA 4AW4A 2BY1A 2UYLA 4LU5L 3P9MB 2CG9X 2QPFA 2ADIA 3H3KA 3M17A 4XB3A 1F4YH 2VLRE 2X41A 1GMIA 5EEWA 1AXSB 4CVXB 4EZKA 5IMMB 1CE6A 1YMMA 3STLA 1T1ZB 4ZOBA 3S5LA 5JXED 1FSKB 2G5UA 4HAFA 1HCVA 3GZKA 1SUJA 3LEVH 5E03A 1DN2A 4B7IA 4FQHB 1NDMA 2VLME 1SOXA 3IDGB 2BVQA 4K71C 3QBTB 5IROC 3DV6A 4MB4A 4ZQKA 4ZW8A 1MWAB 3X11B 4GXVH 3WY1A 4KHTH 3S34L 5GZOD 1A3ZA 2LGNA 3HPLB 4MMXB 3QIBC 1JGEB 2BNRD 1AGFB 4C56E 5BS0E 4RMQA 3UPRA 5BPPA 2Q3XA 3C60A 2K45A 4KY1L 2R69H 5J5EA 3ZVVA 2NQDA 5DLMH 1NCOA 1N2RA 1MHPL 2WLHA 3L16A 1OF2A 2Y5TA 2KS0A 2HJFB 1IT9H 5E8OA 5CZVH 2EYTB 4S1SL 1AGEB 4LLMA 5ANMB 3S97C 2VWEC 1WAAE 2N1TE 2HP4A 6FABL 3FO0L 4JFDE 1IQWL 1GR7A 3NH7H 3O6ML 4XRCA 3MLSL 1OAKL 1BD2A 1GS8A 3GSOA 5BO0D 1TQBB 5IGXL 1HHHA 3CFEA 4MRCA 3UP1A 2ATAA 1ZK9A 4F7PA 1NCJA 1GJWA 1Q0YL 3T2LA 4FRWA 3J2PA 1XSJA 5C86A 4NZTL 1S7UB 3UZQB 4ENED 2XACC 2DYRB 1MJUH 1G9EA 5IM7B 3QARA 5J4MA 3ZIYA 4KGLA 1IAII 1QUNA 2GG1A 1VADA 2XWTB 3QIWD 3QQNA 8PAZA 3SKOA 4WWOA 4GQRA 3O2DH 1EIBA 2JB6B 4ZAKD 4DN3L 2G9HA 5AVQB 1CE6B 1YMMB 1ADQA 1I8LC 1NCBL 2NY4D 2P52A 3OLGA 3QEQD 3R1GH 3A4EA 1IQWH 4K7PL 4M5ZL 5FA4A 4EZLA 3CJJA 4JG0H 3RX8A 3BE1L 2E74C 1NJ9B 3V5KA 2XTJE 3BFWA 2BDNH 4ZUUB 3X11A 4L48A 1XZ0A 4PM1A 2JCCF 2UVEA 4KOBA 5CJXA 4CKVX 5F88A 1E8WA 4ZO6A 2V9QA 4A7SA 3EDDA 3QDGA 1USQA 4Z7WE 2P47B 3IRZA 1IQDA 1H3TA 1KCLA 1I53A 2P8LB 3HI5H 5FM5M 2OTUA 5GIRB 1Z6JT 1FIGL 1NCHA 4BSVB 3NMEA 3RFZC 2DQFB 1P6FA 3S96B 2H3KA 2H9GA 3DOHA 3GBMH 4GRLD 3K6DA 3RWCB 3H6JA 1S78D 2BIOA 4WWKD 5LXGH 4MNGA 1VAHA 3GSOB 2DTML 5T1KD 2V2TA 1TTUA 1KJMA 1D6EA 5DD0H 4C56B 2ZOTA 2Z35B 4X4XA 2E7HA 2R0LL 2HJKB 2EZ0C 5E5RB 4K15A 3QO0B 4OT1H 2VE6B 4YHKL 2EO7A 4AIZB 3B9KC 1VEOA 4MJHA 2P45B 2IGFH 3ULVH 1VFAB 4FZEH 1GIGH 3RLSA 3OQRA 4GG8B 4HIPA 3N06B 2AMUA 5DK2A 4K71B 4M7LL 4FYRA 1GA2A 2HFTA 1GGIH 4HSQA 5F1IB 3HB3C 3IXAB 5BUAA 1PL3A 1KDJA 4ANXA 4I18A 1KTKE 4XNZB 5FO2A 4AK2A 4S1QH 4CADB 2VDKB 4B96A 4FQ2H 2YMXL 3VNYA 3P54A 2YA1A 3MTRA 5CFAA 2ZPKH 1PJWA 2EDDA 3C60C 4KK5D 4OB5H 5EEVA 2VCOA 3QORB 4JPSA 3SOTA 2GSIA 4UM9B 2ZUXA 3TA3C 3GXTA 1A9EA 3OX8B 1JTTA 1W6LA 4QHUA 3B37A 2EE2A 3VWKA 4FXKC 4X7TB 3X17A 5BJTA 1B2YA 1ML0A 3CDCA 3T04D 4NUGL 1KEMH 3BPNC 4Z18A 1WV7T 2VQTA 1JPTL 3N3EA 4TUJB 2WXMA 2IADB 1MRCH 1X4YA 1DVFB 4A38A 2QVIA 2V17H 1DVFC 3NTCL 4P2OA 3MRMA 4NQCA 3E8UL 4LSTL 3TNNA 1PTZA 3QCVL 5KVFH 3VD9A 2E7LC 1IFRA 4OD3H 1U8IB 5TDOA 3IJEA 4TTDC 3ERXA 4JFTA 4M6ML 1ZJAA 1BBDL 4HJGB 5I1LA 1R5WA 3RNQA 4ONHB 4PJDB 1JE6A 2K70A 1MEXH 4TV3A 3D9AL 4BBWA 1ZGLA 1T7WA 4MMZA 1L7TL 1Q9KA 4K3EH 2KL6A 3G5ZA 3L7FB 3QG6B 4QWWD 3ZQWA 5IMKA 3T65A 5T1JA 2A6IA 2NY5H 5F1IA 4LP8A 5LAXB 4L4VD 2X4RA 3MNZA 3QRGL 4CSSA 4I18B 4OIFA 5E8NB 2X4NB 5CJXC 1FHGA 2C1PB 4PY7A 5EFIA 1SYVB 5L2KE 3WIHH 1CU4L 3VXMB 4KNUA 3BUTA 5DS2A 1OZTG 4JRLA 1MF2H 3MV9D 4TUKH 2GJJA 2NZ9C 4Z7OF 2RHEA 2X2IA 5TFSH 4C4UA 2Y2WA 43CAA 4R2GD 4YFDB 4Y88A 1IC1A 1GPOH 3BGMA 2XN1A 5EN3A 1SDYA 4B6ZA 4KMTH 4PGCB 3PJSA 2YC1B 5D7KE 5HHVH 4Y7OC 3EBGA 4QF1B 3KNBA 3NAAL 1YY9D 3AABA 3BMWA 4N28A 5IW1A 5E2UH 4Y5XB 2JTDA 2XBTA 3TCLA 1ZOXA 4OZHA 3HB3B 3EH3B 3QQ3A 3W3BA 2AKRB 5DEGB 2BNQA 4RSYA 2YSSA 1GTNA 2GUYA 3GIVA 5FYJD 2G3ZA 3C2SA 2MHAA 4TMPA 3QUZA 1J0HA 3F7QA 5T8IA 1EAOA 5I1IL 3MJ9H 4W9KC 5AVYB 5BRZA 3DYMA 4JW3A 4N0CD 2V5YA 2APFA 1I82A 1DQLH 2FEJA 5IMKB 4N0CC 5FV2A 4K7PY 4HKZB 4LLUB 2JH2A 1XH0A 3MNZB 4YX2H 4M00A 3LS4H 4PJ8C 5HJGA 4OD2B 5IJBC 1A6PA 2VLMD 1QBML 3K8KA 3BP4B 2NX5E 2BWQA 5GGSA 4AQZA 4JN2A 1MCIA 2QVMA 2I5YH 3Q6GL 4P99A 2WO4A 1OGAE 1CBVL 3UFIA 2VN6A 4OLXL 4XCFH 1VEMA 3GTNA 4ZDHB 4MZRA 2AJYL 3QDME 2QPUA 4MQTB 2GT9A 3GSWB 1TPXB 1VB9A 1ZS2A 1TENA 1NKGA 2IPKB 4JQIH 4B0MM 4X4KA 3KNBB 5GRJL 1JGVH 3VH8G 4LGPB 1GS6X 4KX9A 3U4BL 3AU0A 1Y6KR 2EAEA 4N9GB 1SGKA 2WLLB 4HA1A 3ABLB 3ATEA 4XXCC 4A68A 1F4XL 2OJEA 2HRHA 2ODHA 4NC1C 1EO5A 3KXFB 3B2DC 3QUYC 2CO7A 4JZJC 2WXJA 1M42A 1U30A 1A7PL 3SGDI 1FPTL 3KL0A 3WLBA 1F90H 1IGYA 1RZ8A 4JO2H 3UPCA 3HE7D 4GW5A 1U21A 3GI8H 3EW3B 2J8UF 2ZOKA 4J2QA 2Z9TA 2QPSA 4RBPH 3VD7A 4AG4H 5B3JE 3WJJA 1HXKA 3GMPA 4O2EA 3QUGA 5JQIB 3FAXA 2ZX6A 4ZX3A 4OGXL 5EZIH 2IH3A 3L4XA 4WWID 4M43H 3MBXL 3OTTA 1A02N 2V5TA 1UGKA 1AC0A 4KU1A 4G6ML 2D03L 3KM2A 4ORZC 5DR5L 5F6HI 5KWYC 2CE6A 2OJ1A 5D7IA 1JV2B 4JG5A 12E8H 2VAJA 5SX4I 3WCYA 2GT9B 1I1AA 5CCGE 3DVGB 2AV1B 4UIMB 1BEYH 3FT3A 2VR8A 5DMKB 1PIFA 3DTXB 1B4JH 4I2XA 3WLWC 1ASOA 1SY6L 5C0BA 1NFDB 4QXGL 3JVGC 2LU7A 3R0MA 3GUTB 1AQDB 2W9DH 1ETA1 2UXGA 3U9WA 4ELMF 4UTAH 3VGDA 5AYQA 4X7CC 2P5WB 5AQ0A 1ZE3H 3MOAL 1P1ZA 5DTFA 4OCRH 3C2AH 3C5JA 3PL6B 4HWNA 4KPHH 3AB0C 1RIVL 3QUKA 3FUNA 2GW5A 4IRJD 4X0KA 4ZX6A 2IOMA 4QYAA 4FCHA 5K1NA 3G6JB 3CXHK 2WAHA 2H32H 1FJ1A 3CX2A 1DQDL 3UTSD 3BDXA 1LP9F 1XH2A 1MAKA 3HRZC 1Z9MA 3UGEA 1C5BH 3L1EA 3VE0B 2Z4QA 3SE8H 2WJ7A 4OZIA 2XTJD 2WP3O 3O4OC 2ZOOA 3B8SA 4BE6A 1TYEB 4R7VA 4MDIB 4PR5B 4A2DA 1A9BB 3V8OA 1I1AB 3P3UA 3WJLA 1OAJA 4FQXB 1DL7H 3F62A 1G94A 1AD0A 2ERJB 4Q2ZB 2AJZB 4HKBB 1MHHB 3IGLA 3SCMC 2V2XB 4LPTA 4ODXA 3PWLB 4DFHA 4TQEL 3PHQA 3KYOB 4P46D 3SCMD 4EDXA 3WEXA 4NCC2 3AMKA 4G8EA 3S37X 3WFEL 4DGWC 2J1KA 4Y1AB 5I19H 4AE0A 1AGCA 3GPEA 5DS8A 4NJAL 3LNIA 5DMIH 1BQRA 3MVSA 1OEZW 2EO1A 3C5JB 4KAQH 4HKJB 1QSEE 1D5ZA 4UT9H 4IKNA 5PAZA 3BFQG 3VXNA 3OMNB 4HLJA 2XICA 3MA7A 3ZZSA 3WL9B 5DD5H 3MXWL 2LAGB 3IMRA 2NW3A 2DBLH 4HLZG 1LHZA 32C2B 1L3NA 2Z65C 5IB1B 3Q44A 3ZHFA 1DDHA 4NP4L 4WHDA 3G9VA 1BMGA 2P5PA 1N68A 1NDGB 5CM1A 1SY6H 4G42B 4Q6IB 3TVMC 1AKJA 1A4CA 4L3EE 2OMXB 1BAGA 4BQ8A 3ULUC 4XP6L 3VXUA 1TFHA 3ZY7A 1A4JB 5E7BA 1YEFL 3IDJA 1WCBA 1KGWA 2DQEH 4FX5A 2FWOB 4H44C 5ESQA 4AGPA 5KSVB 3U2JA 1J48A 1QLEH 2NY1C 2X3AA 5EOCH 3L3JA 2AMGA 4PREA 1IO4C 2CBTA 3PJLA 4JHUA 3QDJE 4HLEA 1PBYA 1HQRA 1T21A 2F53A 4J3UA 2ICES 1Z5YD 1SLXA 3ME0B 4ZSOE 4P59L 3JWOL 1QRNA 3QDMB 3QZOA 4GBXD 1S3KL 4PWFA 5CHNB 3LAFA 5IHUL 5EZIL 2VXUL 2X4OA 4FQ1H 4Q4EA 4BXSV 3FO1B 2H0FA 5LO7A 1HJCA 2NY4C 5HY9B 5FFGA 3BLPX 3ZTJG 3QJHA 4HK3N 5HPOA 5D1XC 4FAAB 1DQKA 1LEKB 1BOYA 1UT1A 4PW9A 4FTVD 3HN5A 3X12B 3V0WL 2Q8BH 3ROLA 3TP4A 3P4NB 5B22A 3S9DB 1EXHA 2FT8A 1NGPH 3DHUA 4OCSL 4HX1B 4U1MA 1FZKA 1JS4A 2FDBP 2GBAA 4PW4A 3WFBH 1U42A 5FUOH 1UKTA 5DJYB 1HHKB 5D7JB 4ZS7H 5ICZB 1OSZB 5TE4H 2PTTA 4PVLA 1NKRA 3IGUA 4RZCB 5DJCA 4KRLB 4NJ9L 2VDOH 4MBRA 3QZWB 2XA8H 1KCSH 3MAWA 4NRYB 4F7CA 3V6FB 2R9HC 1JGVL 2BMKB 4QKXB 1GSMA 3HVDA 3SE4C 5H37H 3FO2B 5SV4A 3QAZC 1EDYA 1TEYA 1QYGH 5HPMB 3GKWL 1P5UB 2FJHB 5CEYB 4Y4HD 2FX9H 3DX9B 5H4ZA 1OV8A 3VW3H 2ZYIA 3C9NA 4WW2F 4PREB 3KLAA 2ITCB 2YRZA 3CZGA 5JPNC 1UUNA 1A6UL 4DP5X 1JNLH 1PG7H 1YN6B 5INCB 4GAAA 4K5LA 2XY2A 2X1PA 4LOFA 3RPIA 3MRDA 3X1FA 5EOTB 3GINA 3K91A 2OK0L 4HV8B 1P7KA 4OI8A 3ISWA 1AKPA 4O02A 4BH8A 1CDJA 1I8IA 3B2VH 4K7FA 5AALA 1W72B 2LU5A 1W0WA 1JV5B 3RWDA 3QUMA 4Q89A 3SYOA 1MCPL 4V1DD 4GRWB 3SB3A 3DETD 3MJ9A 3OKLB 4QKTA 1J9RA 3UJJH 1LNUB 1TEFA 3TZVB 4AQOA 3HC0A 4U1JA 4R96A 2B7DT 2BVEA 4JEGB 5IESL 1ED3A 4X6CF 3U82B 2CH8A 3HZVA 1PCSA 3S4SA 3ROOB 3D25A 4W9DC 1NBQA 1ZEAL 4LK4A 1VA9A 1NBVH 2PPDA 2DJMA 2V7NA 4ZX5A 4BZ1H 2XDHA 5C07A 2VXSH 5EIIB 4LIQE 3N1FC 4IU3A 4Y19E 2AK4E 2WMPB 2YPVH 4TSCH 4P2AA 3U1SH 3MRPB 3LKSA 2WBXA 1D5XA 1KGCD 1WFTA 1J0JA 5C6PB 2CCVA 1IJNA 2WXPA 5E4EC 5EUOA 3UYPA 3HLAA 3FSWA 3NCWA 1IKFH 1J87A 3RGVB 2H6PB 2I7SA 5HHNB 1U58B 4F7TA 3M45A 1HYSD 1Y6NR 5KS9B 1DCLA 2IQAB 4X6DF 1AE6H 2JIXB 3FT2B 4RGNB 3ZTEA 2D0FA 1U8MA 4I1RA 5JO5B 1MSPA 3WFHA 1O5PA 3O9WD 2DOCA 4XX1E 4D0DB 3CLFH 1MJ8H 2HFEB 1EO8L 4O02B 4S1DD 3T2PA 3GSUB 5IW3A 1DTUA 1TIUA 1CFNB 3GSNH 4Y4KC 5E2WL 3SSGA 4NO2A 4WNQB 5SWZE 3PWPA 2JF1A 1XGQA 1A7QH 1DE4A 3QI9B 4NKIL 1A6AB 1IEBB 1AGBA 1MVUB 4R97C 3SPVA 1K8IA 2E9IA 4CC4A 3CHPA 5IMOB 1G6RA 1AGDA 3ZZQA 4K5OA 1AP2A 2F6AA 3RWIA 5D6DC 4ZYKB 3PCYA 4RRPG 4LBAA 2K8MA 2HKHH 3BAIA 3GBNH 4HC1A 2X4UB 4NYLA 1B0WA 3KS0J 5LG1A 3GK8H 2CLVA 3IBOA 4P2OC 4UT6L 1SQMA 1JPTH 5JORA 1OZUA 4AV4A 3ULAB 1R5IB 3MFGB 4MGXA 1D9KA 1AIZA 1ID5I 3DGDA 2YUZA 3MV7B 2D0HA 3U7AA 3AWFA 3BWSA 1J5HA 2X70B 1MY5A 3BO8B 4UV7H 2O5YH 4DFIA 5JOFA 2G9KA 2K9UA 5CZXD 3SGJA 1YYLL 3FUFA 5IJKA 3P30H 1OGPA 1Q1PA 5H37G 2BXYA 4G1EB 4N20A 4IDJH 2Z8RA 1CLOL 3HW7A 4NXKA 3BSZL 1CZ8L 4O2CB 4ZTEA 3FCSA 4LEXL 2EDJA 3PGCB 1U41A 3BAKA 1BYOA 3H0TB 4JZOA 4L4TE 4MJ6A 3T0EC 1KZQA 3FMGL 3H2PA 4LPYA 4OIBA 3D06A 1K4DA 3Q48A 4XWGL 1YLBB 2CNYA 4WW1A 3TBCA 4LHQB 5IEKB 3AMLA 2VAAB 2WM0A 4FC3E 4KH9A 3JWNE 4FKHA 3G04A 4FMFA 1F02I 5F89B 1ZPUA 5FOBB 2LVCA 4Y5VC 3QUXC 3Q3GB 5EIVA 3O4OB 1TQCB 3VM7A 2VN5A 4N87A 1ONQA 3FU5A 4W1TA 1QSED 1E90A 3H1ZA 5D4IA 5DD0L 4MNHA 3LRLA 4Q4IA 4L8CA 2XBZA 2Y1VA 4RAUA 4DT2A 1LD9A 1KN2H 1PZAA 1IKNA 1J5CA 1ULVA 3KYAA 4HHWA 1HZLA 4U05A 1FNHA 4IEFA 2W8CA 4ZW5A 5HHOB 5K9OA 4DGIL 2A0LC 1CFMA 4WO4B 5E2JA 3KJ4C 5DC9B 3EJYC 4FI8A 3QJSB 5LBGA 3HHSA 1R3KA 3OKMB 4PV8B 3QORC 5K1VA 1OW0A 1FVEA 5KSUB 4G1EA 2X9ZA 2WB7A 3IS0X 1TZOA 4PJDF 3PGCA 3BVTA 5AZ2H 3VXRD 2X3CA 3X13A 2A4EA 1EGJA 3CSPA 3RVXC 4XMWA 3ZDXE 3ZKMC 3DK0A 5AVRB 2ZUVA 3PG2A 1INDH 1EVUA 3ESPA 4MJID 1YQVH 4HUWA 3CNKA 4C56A 4NNPH 2DEYX 3T1FB 2VKWA 3FTZA 1KCKA 3HZMB 2HJKA 2CLZB 4N2GA 4H4NA 1LDPL 2MH4A 1MJUL 1TQTA 1RZJC 4NZTH 3FFCD 3RDTD 5KN5B 5J13B 5HYJD 3L1OL 3OKYA 1K6QH 1EEYA 2AZAA 3B2MA 2JI3A 1KXTA 4RAUB 4X5QA 3MNVA 1SUHA 1LO0L 3I75A 2VMEA 5J11C 3IGAA 4I7ZC 3TO4A 3QP3A 1MW2A 1MRFL 4IHBA 3U46A 3QUYA 4CDGC 2ZX8A 3E9UA 3LS5L 4JZJA 4PLKC 4ZS6C 5AAMC 5GRVL 4QTHB 1IM9D 1CLVA 2LLGA 3VU2A 5AW9B 3SGJC 1PFOA 4LP5A 4L37A 4UM9A 4U6HB 1RZ7L 1A9EB 5I0XA 1N2RB 2UXTA 3DMMD 4XOCA 2NR6C 1SQ2N 1JPFA 1ZK5A 2WVVB 4KHTL 3WKYA 2ZF8A 3MV9A 3P0VH 4OCYH 4N8CL 3T0EA 4MJIA 3QH3A 4LIQH 4KQ3L 3OR6A 4MAYC 4GIPD 1B88A 4Q8BA 3A24A 2DD8H 4NWUL 5E9DD 4Q97A 1CF8H 5FW6A 3AACA 2Q2EB 3IU3B 3G08A 3PS6A 2DIBA 2XZAL 2XWBA 4N90E 1BREA 1UT9A 1S7UA 3UTPE 5GGQH 5BNXD 4OFQA 3R06B 1EAJA 1C9SA 4I9XA 2WQAA 5EORL 4RFEA 2ZKHH 3KPLB 3PXLA 3U36B 1ZSDA 3DURA 3C08H 3PAZA 3LKRA 3ENEA 4L3AA 3WMQA 4OQTA 5TF1L 2G3MA 3JVGA 2HT3C 3FZUC 5I6XB 1SEBA 1L0YA 5DD6B 2F5BL 3NEEA 2R29L 4UI2A 3DA0A 5B8CB 1KT2A 4AH2A 1Z9NA 3V5KB 2YFNA 3GSNB 4HS3B 1JF6A 3T5WA 4O02H 2XN0A 3QQ4B 5DJZB 4H26A 1A14L 2G2RA 3CK0H 3D0LB 3FFDA 3S37L 3F7YB 5C0EA 4J4PD 4LEOA 1TTCA 1D7CA 1HJBC 3C09C 3IPEA 4W9LC 1JK9B 4OLVH 4LAJH 3MCLH 1A8JH 4DH2A 4DP7X 3WUZA 3RZCC 3LN4A 4TOYH 1MCOH 5J3HD 5I1EH 4ADJA 3TURA 3U6RB 2EDBA 3NJHA 4J3WA 3QFDB 5HI5D 4F80A 1N70A 3HE6D 1G1YA 4U1SA 3L5IA 3KPOA 4Z0XB 4PGEB 1KJMB 3BEWA 5AL0A 3IETA 1HU8A 1MFBL 4QR7A 4UANA 3EXJA 3T2OA 1JZ8A 3ULUH 4A7TA 5ES4B 5E4EB 4P9HL 2RQEA 3BZFB 4HCFA 4HH8A 4E42B 4WJ5B 4NFCA 4TSCL 3IJ7A 2CK0L 1FC2D 2HJLB 4JRFA 2J5LC 4LDCA 3Q8CA 4QTFA 1GYCA 4Z8FH 2PCYA 3ZL4H 1MXGA 3EFOB 3D39B 1JVLA 1WQVT 3ZR5A 4DGUA 4HWBH 2AQNA 1S3RA 1B0GB 1JXJA 2A6KA 4HK0A 1R0AH 3TO4C 1FNGA 3MZGB 4PJEB 1DJXA 1NM9A 5AW6B 3L9RB 3JWNH 1DN0A 2CCWA 2VIRA 3U25A 2X0WA 1JHTB 2ZYSA 3EOAB 5IJCC 1LO4H 3U7YH 2F15A 4KFMA 4P9ML 5ID0B 1KCVL 4AXWA 1KEGH 1TTAA 3F7YA 4ETQA 3C5ZB 4PP2A 5IVZA 2A38A 2CO6B 2I07A 5F9JA 1OPGH 3O41A 4KI5F 1TETL 2FJFA 1QFWI 1GYVA 3N42B 1BXUA 3HI1A 4MAYA 3GO1L 4YGVA 1PZ2A 4PGBB 3SGDH 1XGPB 3VX0A 4XVSL 4E0RA 4RH4A 2VQ1A 1CFVH 3VVVA 1TU2A 4OV5B 1UB5B 1UFUA 3C6LD 5AOIA 3ULVD 5DZAA 4H1LG 1J9QA 4AM0Q 3BUYB 5FLUA 5IBUB 1CI5A 5IB2B 2V2WB 1AD9A 3VI3A 3FRPB 1F58L 3BZFA 2OSLA 1R3IL 1AS6A 3CQQA 4NBYB 3BSGA 1XB8A 5I74B 1RZKC 3BJ91 3QULA 1ZS8A 2W0LA 1OKEA 2VLLA 3II3A 4PJAA 5AYUL 2HTKD 1A6TB 2WWKO 1MI5A 2C3VB 3K71A 3LQZB 2NUPA 3SPIA 4IRJA 1A3LH 2UWEA 1DZ0A 4MXWL 4MWFA 1OM3H 1V54B 4FG4A 5D1XD 3O3DB 4OZHE 1QASA 4BCZA 2ZWLT 4N22A 1PEZA 1ZMYA 1KNOB 2IXQB 3P3TA 4JFEE 3IAQA 1DQJA 3L3DB 2E27L 1WVZA 3RX7A 4PVBA 1W16A 1CR9L 4QHMA 4WHCA 1KBPA 2ZSVB 4F5CE 3I9PA 3RTQA 1J05A 1A5FH 1RMFH 2VM9A 3AY4A 3F6JA 3H4HA 4WIQA 2EIEA 4NNXA 4LASL 1O6SA 3U2IA 3JWOH 4HCGA 4C83B 1BJ1J 2J6EL 4MD0B 2B4CH 1BFOB 1J5DA 4NGHH 4UNIA 2IALA 3CFBA 3QR2A 2DQHL 3FQYA 3H9YA 3HS8A 5EHFA 1CE1L 5INDB 1RV6X 1U2CA 4L1SA 2A0LD 1Y6MR 1R3LA 3KLHD 1ETJA 4QDGA 4OV5A 2DQEL 2YIHA 4G6KL 4CSPA 3ZQXA 3IF1A 1UACH 1F6AA 2P7TA 2WBJA 4JBSA 4Z3EA 3FB8B 2OSLB 1QFOA 1XTMA 2R1XB 3FRPG 4AE1A 5BV7L 1L0XA 4LNRA 5FUCE 1Z9SA 3GBEA 4XPFH 1GZQA 1QSZA 5JPNA 5I5IA 1OQXA 4X5RA 2QV2A 3E2HC 2Q20A 1G7MB 1UD4A 4BD4A 4NKDA 5FWQA 1CFTB 5DZPA 4M8QA 5DGQA 4B9FA 4D3CL 3G6JA 2DQGL 2FEDD 2BP8B 3VRIB 5FGCB 1FJ1B 2V37A 4YOKA 2D7NA 2VSCA 1GJIA 2X4SA 3O9WB 4FJ6A 4TVPD 5T1DL 3L5HA 4EDWL 4KJPD 4N8VA 5FM4A 2CBOA 2AXGB 1DSFL 4IGBD 3IJYB 1B0RB 2EDRA 4HIXH 3OM3B 4WWKC 2SEBA 4GKSB 4BKSC 1QG3A 3H3PH 1PF3A 3B43A 1KBBA 1UA3A 4KZEH 2VWEE 2Z0BA 4HAKA 1N0XH 2ZSVA 3VXTA 2F08A 5F9DC 1HT6A 2JTYA 4LBEB 3QNYA 4GT7A 4XCYA 4YSEA 3V7AE 4C4KO 2IGTA 1F4AA 3EFDL 1OY3B 3INOA 4N0UA 3TH4T 5E08H 4RISL 1SVZA 1T03L 1I9JL 4A2EA 3CMOL 1YC7A 1NEPA 3LZRA 1C08A 3GSQA 2I24N 4E9XA 4X7EC 4ZUVB 3TTSA 2C7FA 2YZ1A 1JF1B 4XP5L 3V0FA 2VZSA 3L4UA 4DOHE 4F8NA 1IUZA 4HEPA 1S9WB 3MV7D 2CLRA 1BQSA 1XQ4A 3CFCH 4BFRA 2R1XA 4MS6A 1FLRH 2DM4A 4H5SA 3RL2B 5JDSA 3IYLW 2NY3B 1M05B 1YYML 4PS4H 4DKFL 2G75A 5KOVC 1CT8B 3REVA 4F57L 2ZICA 3RZCB 4YDZA 4NSKA 4XBEH 2QQNH 4MRBA 2OCCB 5I0DA 2QKIA 4JDTH 1XT5A 2NXYB 1MREH 2Z91A 2BZCA 4X6EB 1HWHB 2H0EA 3U2SB 2VGLM 2DI9A 3OKNB 2AXGA 4LLQB 1EFXA 2YEVB 4LL4A 1N8ZB 3UTZB 1E3XA 4X6CB 5MERB 2VDML 3CDZA 3TJHD 1HE7A 4JUTA 5FO7A 3X1GA 4AW7A 5CLWA 1UCTA 2CBPA 4XMVA 2JVUA 1H8OA 3DVGA 3Q01A 3K2UH 3TL5A 3CAFA 3FT3B 3CC1A 5DHMC 1BVKA 3KWVA 1QRNB 4LVNB 3CC5B 3MU3A 4MAUH 1J8HE 3QEQB 5CD5D 3IJ8A 4P46A 4KUZL 3C5SB 3DJZA 2W60A 4GQZA 1FFTB 4WV1A 3RIFK 3H9HA 3FO9B 4APXB 4E41A 3MRFB 4P4KB 1JWSB 1M57B 3QJOA 1IGIL 4ODWA 1NGWA 2NRDA 4FHJA 3TIEB 2CLRB 3NRFA 4FXLA 4EUPB 2QQLL 3DVNA 1NLBH 5IJKC 1SFDA 2EILB 3LB6C 5IHZB 1OAUL 3MBXH 5KYYB 4TSAL 3OZKA 1A1OB 1JBJA 5T1DH 3V0DA 1GC1L 4IK7A 2NX5B 2WWMD 4WZ9A 1CXLA 4ZXBD 4AG4L 4N6RB 3HE6C 3ECVA 2HLFC 3FTVA 1G9ML 4OF0A 4BZ2L 3UO1L 3LMJL 1Q9OA 2K7PA 4K3GA 1BVLA 3FU7B 1OSYA 1FPTH 2XCMC 4F27A 5D5MB 4M7KH 3NZ8B 3VSTA 4N0FA 2IBBA 3RVUC 2BPBA 3BKYH 2EDXA 1JZ6A 1TLMA 2FO1A 2BS8A 2WQXA 5EO1B 2VZVA 5HHMB 1CXIA 4NQSB 3NA9L 4PG2C 4DZBB 4NQCB 4TSBH 5DHDA 4X83A 1XR8A 2QPEB 1E4XI 5AVZB 2XWXA 3QQ9D 2Q2LA 4QWWC 1E6JH 2AZUA 3FT0A 4J8QA 4P2QA 4YC2C 3ZXAC 2YWZA 3A4DA 3W39B 3KDMB 3ZRCC 4PGJA 5C2BL 4RRPA 1IKNC 4X8XA 1OGTB 5FA3B 4M9PA 3TFBA 2RMNA 2OSXA 1S6NA 2EDHA 1A2YB 4ODHH 2AJ3A 4XGZA 5FKPB 1HYRC 4KK6D 2VDNH 5D1QB 1YSOA 5F7DB 2X4PB 2P26A 3WGVB 2JV6A 5I24A 3EH5B 3TBBA 4DP0X 3KW7A 4GMSL 1D2PA 1SXSA 3L9EA 3QIBB 5JR1L 4J28A 4L2YA 3GEWB 4ERSL 3GKZA 2XV3A 4PJHB 3W0WE 2LVEA 3QDJB 5L4FA 1A3LL 2GHZA 4DKDC 1KFGA 2CDFB 1DDTA 2CKBA 5J0BA 4MYPA 4RFNB 4IJ3C 3KR3L 2V7HA 5DUML 1P53A 4NHCH 1DJIA 4PJ9C 5J8OA 1TZ8A 3FONB 5D2LF 1SRDA 4XAWH 4QY8A 3IJ9A 3DTDA 1LL1A 5LNEA 4MAYD 3TJPA 3CZJA 4FQXD 3G7TA 3UYPB 1XH1A 3LIZL 2VRKA 4DERA 2PWFA 4KRPC 5KJRH 2WKGA 4PJ7A 1KF9B 4XC3H 3KDPB 3T0VA 2GJZA 2LV4A 3QQ3B 3SCMB 3L9BA 4AYFB 3BKYL 4AJYV 3IFOB 3GXFA 3RDJA 2RIKA 3GIVB 4MAZA 4JZNA 4EBQL 1BLIA 1NGQL 2NOYA 3F7RA 3P3YA 4HU2A 5EZPA 2GTZB 2EYRA 2L3BA 1A22B 5TJWK 4FJYA 4KMTL 1F97A 1CS6A 3FQ2A 3DUSB 2WKOF 3EGXB 1Y07A 4WNJA 5BOJA 5AAMA 4HQQL 3DV4B 5KVDH 4IGBC 3QWRD 3RURA 1IL1B 3VCLA 4M1CC 2DQUL 1VHPA 2BRQA 2XZCH 4IOIA 3D12B 2BSBA 5JMRA 3RIAF 5A2LH 4M1CD 5DXWA 5EV7A 2WO2B 2QFPA 1HHJB 2GTWB 43C9B 3DX8B 1WWAX 1NAKL 2ID5A 3VFRB 2FH8A 4JKWA 1U8PB 3O3AA 1NDTA 3JQOB 1QVOB 3Q2NA 5LXVA 1AHKA 2DL9A 2WZ0A 3BD4A 3CIQA 4EI5B 3FOMA 1R5IA 4TL4A 2BH0A 4OZGF 5FKAB 5T3ZH 3BVXA 4HEME 5I28A 2P8MB 1J9TA 1MFBH 3B9KD 5D1ZC 3PFQA 4HETA 5CUSL 2FJHA 3MLYH 5I66B 1X3DA 4U1HA 1SMAA 4JPWH 2GJ6D 4M61A 4NLHA 4HBCL 2CO7B 4NUMA 5CR8A 1NMCB 1YNTF 5MENA 1G9HA 5I1EL 4R26H 2OYKA 3VG9C 1D5MA 4GKOA 5IZ7A 4NUGH 2GTZA 3LH9A 3GMMA 4NQEE 1HXYB 1TVBA 4FP8L 1LQBC 5FYLL 4D8OA 1QABA 4K2UL 4PJEE 3DUSA 2DWXA 4LCCB 3EGSA 2OMZA 3MV8E 4WW1B 2ED8A 2VDKH 1JV5A 2HB0A 3QJXA 4D0BB 4YHML 4WHYH 2IH3B 4DKFH 2YMXH 3FH8A 4ES9A 4K9EL 5FOBA 1KB5H 1OLZA 2XZZA 3RVWD 2FX8H 3NFPB 1EUTA 3PGDA 1NA8A 5ICXB 4YHNB 3N1GC 3W57A 4OGZA 3EYUH 3OAUL 3ARFD 2BS71 1IJ9A 2WKLA 3C09B 1DQVA 1EHLH 2FWSA 1ZXQA 1AR1D 2VXQH 1WP6A 1NPNA 4L5FH 2XKNB 4PJ9A 3V9CA 2KLSA 3BN9C 3F7VA 3NSDA 2CGRL 3ESOA 3KL3A 4Y4HA 2KBGA 1YMME 1FZJB 4UM8B 4AKQA 4UUJA 5E08L 1XF1A 2X4QB 5TTRA 1TO5A 2F1AA 2OP4L 2OTWA 1JRHL 3LEYH 1HHGB 2VR9A 5BO1H 5F96L 4PJXE 4TTGA 4TQPA 4BK5C 4KZEL 2HUEA 3MHZA 4PJGB 4FFWC 4ETYA 4OM0H 3WD5L 1FG2B 3II1A 3WHXB 1OF2B 4LIQL 1I9EA 3OAZH 2IEPA 3OKEB 4RVBA 1W0YT 1DSFH 5ACZB 1H15A 1IAIL 3P0VL 1P9MA 5DJXA 1GHFL 3PGFL 1FN4B 1HINH 5CP7A 4EUPH 2FYVA 1X7SA 4TPRL 4KK8C 2CHDA 3IB4A 3W9EA 3AFLA 3N91A 4QRPE 3OPZL 1IGTA 2AJVL 2X7LA 4WI5A 4WNQA 3HCVB 4IGBA 1BQKA 3LKPB 4AENA 2D7OA 4XPFL 3BLBA 4LARH 4R7NB 1N6VA 1RJLB 1T1YB 4A7QA 4HMEA 4PJ5A 1M7DB 3CX5J 3S8WA 2VLKE 4MMYA 3CX5K 4JDEA 1Y7VA 2BNUB 5ACLA 2WWOA 4FFYA 2ED9A 2VLRD 4AQAA 4WY7H 4NM8L 5HYSA 3ARBB 2Q6WA 1P4LB 1CICB 3KCWA 1LO2L 1XXFC 4MQXC 5ACMA 1DBAH 4HFWA 1CGXA 3D18A 3O8XA 4RIRA 2V2XA 3MV7A 4JZJB 1CGWA 1EXUB 4ODUA 4HJUA 4X7SL 5JOFB 4KROD 4W6XB 3R4RA 2B39A 4U4BA 4UM9D 3ULSA 1RSFA 3R8QA 2E59A 2OTUB 4APQC 1WZMA 4S1SH 2DQFA 1A1NB 2CPUA 3P4OA 1J0KA 1WC7B 1I7ZA 3S96A 4U6XB 4NQDD 3FW6A 1CD8A 4XX5A 4KZCA 4H8UA 2EVHA 2PCFA 3O6KL 2YGOA 4X8GA 5KSAA 1IFGA 3WUWG 1RP8A 3IU3A 4OFVA 2PABA 3TVMB 1RUKL 2YKLL 2ITFA 3BPCA 3IE4A 1WBYB 4M9OA 1JNHB 3ILPA 3K8MA 2DYPD 1U8OB 4R4NC 4TVSa 3RTQC 1R3IH 2VDRH 2XWJA 1PDKA 1R24B 4KXZH 3OWRA 1H3PL 3TIDB 4MS8C 2XT1B 3STLB 1FAIH 1YEGH 4K07A 1JK8A 3OAYK 4BUQA 1ZVSB 1HQRB 2BHYA 3N44B 1ZV9A 3RGVD 4GUPB 2GI7A 2VW4A 4LVOC 3LH8A 2WXQA 4ZFGH 3KPRD 2WBJC 1FE8H 1RZKL 4LLDA 3BPLC 2CMRH 3TBSA 1Z5HA 1IV8A 5IEHB 3IPBA 1F8TH 3VM5A 1KENL 3LKNB 4KKCC 1VACB 5E56A 1NIEA 3PWNB 2JELH 3S36H 1KCVH 1KG0B 3MBEB 4QYOB 4XMUA 4FG6C 4K5NA 5DVKA 3TBYA 4Z3FA 7PAZA 1KCUL 2Y5TB 4X7TA 2FEDC 1CGYA 3BH8A 5F7KC 5E6YA 1BOGA 1L9PA 4QOKD 2Y07H 2IOIA 2J4WL 4XO4A 1EHNA 5SWZB 5AVUB 1GZHC 3QWRA 3VB8A 1OTUC 2X6VA 3EDJA 3BSZH 2EYTA 2CJTA 1MAMH 5HDRA 3TEZA 5FF6A 5IVXA 1LO2H 2XWDA 4LPWA 2HN7A 4YPJA 3PU7A 2BVOA 3DK2A 3QR0A 4PV9A 4WWKA 3T8MA 1VFBB 3GB7A 3MUUA 4F33B 4QPEA 2IH9A 3O3BB 5IP4A 5J56B 4NQCE 1C5CH 5DUPH 1UKQA 2HAZA 3V6OE 3CVCA 2NDGA 3VWJB 5F8QC 1MIML 2CBQA 4I77L 3IS1X 4OLYH 1P6WA 5HGDB 1Y1UA 3KPQA 3D4ZA 2WWKT 1TJMA 1OQOA 1G7LA 3LRMA 2X3BA 3VGAC 5DHYA 2DMHA 2J1YA 4H20H 1KB5A 4QRTB 3GRGA 3CVBA 2YEZB 1GZPA 1YPZE 3D0VA 3QHTC 2R27A 1JXDA 3BHBB 3DO4A 4WUKH 3RQ3A 5F70A 1QI3A 4DEPC 3MCKA 4Z7VA 4G7VL 3QDHA 5DDHA 1KLFA 2IWGA 3MRNB 4NKOB 1A25A 2K0RA 5F9WC 2OQJA 5AG8A 3HBGA 1WGOA 2Q3ZA 3GDCA 2H1LM 1TO4A 1I7TB 5C0AE 1MVYA 3WMSA 1UWGL 5FYLD 2ZUYA 3BPNB 3V7MA 2GK2A 1A6VL 1ZY9A 5GQBA 2PNDA 3T0EB 3FCTA 2D7QA 1D5BB 3OR7B 3JZ7A 1DR9A 1D7FA 3EYSL 2X09A 1TCRB 2DYPA 4HIEA 2A83A 4M6AA 3TV8A 1IKFL 1OTTD 4FYTA 1TU2B 1E27A 5JHDD 4HXBH 4JFHD 4UQAA 4ADIA 2A1WH 4N8VG 3CUPA 3ARDA 1IGFL 4HFUH 4IOSD 5BVJB 5C97A 3A4FA 1F2QA 3CVDA 2F7RA 4P2QD 5E8EA 2KLTA 4M7ZB 4GRMA 1G7JB 1HIMH 3OJVC 3IJHA 3HPLA 4GAJH 4RFEB 1KN4L 1Q0EA 1TQSA 4X7DC 3NSCA 1CF8L 3WN5A 3N2JA 2DD8L 2OMYA 2BW4A 3GZQA 4MNQD 5EO0A 4H8VA 2DQIL 5D4QA 5IESH 4NRZB 1OB1A 5KYXB 1ZV2A 2JIXA 5LNDA 4XN5A 2EH8H 3VA6A 3TEXA 4O58H 3DDGA 1QFPA 1JWMA 3X3FH 1YA5A 3R0NA 1MCPH 3X1EA 5IHLB 1CL7H 2OLDA 4RGOL 5DDHB 1UB6A 3BRFA 1NCCL 4BSJA 4QXUL 2WYHA 5TQ0L 1AR1C 1LM8V 4F37F 4AY0A 2Z92B 1X4XA 3L95B 4HXAL 4PJIB 2GQHA 4X5WB 5DRNA 3SBWA 3MRIA 3EH1A 1O5DT 1O7SA 3U6RA 2HKFH 1H9DA 4BH7A 5C0IA 3VW3L 1BCIA 1NAKH 5JXEC 5FYKH 1NEUA 3L6FA 2NXZC 2NY0C 1TYRA 3ECUA 4B60A 1S7QA 1F6LL 4JM4H 1ND0B 5BVJA 3HUJB 1RL1A 3BQVA 5F7BA 4OFKA 5TDNA 3FQXA 1ZT1A 3ARQA 2W1NA 1U8CA 4L3ED 5I5JA 3WHE0 5A6LA 2QR0A 2J56A 1OK0A 4H1LH 4M5YL 2F2HA 2H3NA 4DTGL 4A7GF 1E4WH 4OLUH 3HS0A 5C71A 4QRQA 4V1DB 1OSPL 2VDPB 5FUOL 3G5VB 2WCPA 4L1TA 2ZG3A 4NBXB 3LHPL 4NRZA 3SDAD 5E6IB 4UZSA 5DRXB 1XIWA 3BI9X 4GKZB 2VSMB 2Z6FA 3HG1B 4KY2A 4PJEA 4ZW6A 5KEZA 2HG0A 3KPTA 2PWHA 3KAAA 1P7QB 4KO9A 1GW0A 1KTJA 2IPTL 4OD1L 4Z77A 1IBZA 1IAKB 1IC7H 4PBXA 1UZGA 4NI6A 4WGKA 3Q9PA 4CJ1A 4PRDB 1TJHH 3P2TA 3EGDB 3DRTA 1SOSA 2NSMA 4PP2B 4XMKL 5D7LA 1WD9A 2VMDA 2YXMA 4G1MB 2GSGA 3G04B 1U92A 2ESVE 3NCYP 3BH9B 4CBZA 2OXHA 1WZ1L 1EJ8A 4LCVA 1A3RH 4UINL 3IRPX 4KI5E 4Y1TA 4YGVB 1FNAA 2BXZA 1NEZA 5ICUA 2Z34A 5I18H 1QLEL 5DC4B 1A6ZB 1WAPA 3WSQH 3TCLB 1T3FA 5CJ8A 1YEFH 1AZVA 4RGND 4CMHB 3D09A 4I18C 3NIFF 4WO4C 3B5HA 3I84A 2ZCKH 1SJHB 5B3SB 1P1ZB 2Q10A 3V10A 1FHNA 3PL6A 2MNUA 4N0RA 1NWPA 3FSAA 4ZQTA 2N59A 1I3GH 3PV6B 1R9FA 4FTDA 3OPZH 3QXWA 1X5KA 2PCXA 4XWGH 1KTDB 1F11B 3QEHA 5AVTB 1MI5B 1T5WA 2VDNL 5BQ7B 4Q9QL 4U6YB 3FMGH 1K5WA 4R0LC 4XI5D 1MH5B 5CGYD 1P4IL 1HDMB 3O3DA 4O00A 1N3NA 1LK2A 4PMEA 2EE6A 4FA7B 5A7BA 2PW2B 3IU4L 2IADA 3R18A 1AG6A 3CHOA 4S0HA 3CN1A 5F7FA 1SF5A 2WXGA 3WD5H 2ZWNA 3Q2VA 4OZGE 1RPUA 5E23A 3ILEA 3WFEH 4ZDHA 1J0ZA 1ZLWK 2A3TA 4Z76B 1IMHC 4PGDA 4N2DA 4TQEH 2FIKB 3ARED 1FYTB 3SGKA 4DEUA 3A5VA 1QSEB 5A16B 3N43B 2XZQH 2RCSL 2Y2YA 3KJ6L 4EZMA 3RYMA 2MEJB 2WNGA 4UQEA 1Z0MA 1DL7L 3QIUB 4UZGA 4ZZFA 4ONHA 4PJDA 3N43F 5JQ6H 4MMZC 1BA9A 3IMUA 1KPVB 4ATWA 3BN9D 3GBNL 4MMZB 5B1AB 5IWLC 3L7FA 2WSDA 4KUCD 3VQMA 3T65B 1EGJH 3VSUA 4LKXB 1UH2A 1S7TA 3DTUB 4ELKA 1M2VB 1JYVA 3NEOA 4HOZA 4GO6B 4IMLA 4FNPA 2WQ8A 3IDUA 4XNYL 5D1QC 3WUWA 1NLBL 4POUB 4DK5A 1B9ZA 1BZ7A 2VLJB 2EDEA 4U0RC 4ZMPA 4KV5F 3U6XA 4KKBD 5IY5B 3PPSA 1DVYA 1ZLUH 5FGRA 1NCUA 1Z5LB 3CHQA 3WNOA 4NQDA 3PJSB 4RDBA 1G7IA 4JFYB 5DO2C 3M1BA 4BSVA 5FUZL 2R4SH 2OXGA 4J39A 1XCQA 1YDPA 4MJIB 2MNJB 1PS3A 5KG9A 5D7IB 3LV3B 5EO1A 1BFVL 4Z78A 1XV8A 3QNZB 4TLTA 4AGOA 2J6WA 1CLYL 1JHLL 1QFWH 4PJCF 4ZAKA 7FABH 1FH5L 2YPKB 5C7ZA 2MCAA 4XP1L 3VFVA 2AQTA 2MTAA 4HIHB 1UKSA 1MRDL 1E9QA 1RIUH 1Q38A 3V6OC 1RIHL 5C9JB 3LPGA 4R8WL 5FKPA 4FMVA 5DRZB 5K69A 3I6SA 1FFNA 2SODB 5E1IA 2YGVA 2APVA 1CFQA 1PZBA 2OMVA 2CR0A 4KHXL 2BJMH 2WKOA 4OIAA 1VF5C 3QIBA 1KT2B 5TPWL 4NN5C 3WJMB 1UT2A 3K2MC 4NHUB 3GGWA 3G6AA 1FC1A 4JKPL 4XBPA 2VLJA 3MNDA 1KV7A 4ORGA 1YPZB 4PRHB 5EIIG 2BLFA 5HVHC 4HUUA 5IF0B 1A4KA 4JFEB 1P69B 5I8EA 4UQ2A 1FL5B 4GLRI 2WUBH 1OSZA 3MCG1 4L4JA 3V5DA 2OSWA 4K94H 2HT2C 3VWKB 4YDNA 4NQDB 4IKJA 2HKAA 5T5NG 1FZMB 2ATKA 5EC1B 4CVZA 2RR3A 5F1NA 2EIMB 3EFDH 5AKTA 2DLFH 4EBQH 3QT2A 3CH1A 4L18A 2JKSA 4UDUB 4Q7DA 5IT2L 3UTQA 3CDZB 1HZKA 1AY1H 4QRRA 2L7UA 1QAWA 4R90H 1S8DB 2ZKXA 1M56B 2Y0SA 3UC0H 1ZANL 3WNKA 3GI9H 1TTRA 4Y5YC 1QPPA 4Y5YB 1RJCA 4WK0B 2YPKA 4K73A 1YN6A 3Q13A 4ZMQA 3T4YB 5IQ9B 3H9SA 2YJLA 5I1LB 2QV4A 3O8XD 4NJ9H 4X6DA 2AXJA 4HAGA 2ZOKB 1URZA 2OZ4A 4BH8B 2E9JA 4HWZA 2BRRL 4K8RH 3TU6A 3QG6A 2YBRA 5DS1A 5DQJA 1RZFL 3M88A 1FFNB 1XWVA 3B2UD 1NL0H 4PJIE 5C0ND 3X2QB 2CJ3A 1O6TA 2IIJA 3KPRB 4ODWB 5F3HA 5AB2A 4YDJA 4J4PA 4KO7A 4LRNL 1DUZA 5IHZA 4IOIB 1MCRA 4FABL 5JR1H 2I7OA 3ULUF 2EUXA 3NN8A 4FLRA 4JFUA 5LBSA 3WS6C 1DQLL 4N2FA 4Z7QE 2P48B 4MA7H 5D7EA 2H0JA 3AAZA 2HRPL 4ODHL 4JS7A 3VH8B 4PMFA 1S3KH 1HCYA 1SF3A 1NC4D 1A3RL 1QO3A 1QQDB 5IHUH 4PRPA 4QF1A 5GPRA 4LCWA 3P4MA 2GBUA 5D5MA 4LSPH 4FL4B 1PMYA 1W9XA 1C7SA 1NPUA 2YEQA 4NNYB 2NY0B 5CIPB 5IROA 5I66A 5FM5O 3K6FA 5AW4B 4XN7A 4IRZH 1FL6B 3T8VA 4EIGB 3L7EB 3NIFE 4WUUA 3B9KA 1S9YA 4ZFZB 4JM2D 2IQAA 3NGBB 4R5VA 2Z1PA 5A6MA 4MZIA 4B27A 5B1JA 3WFHB 4BK8A 5DD1L 3O45B 4IBVA 4FA6A 1DLHB 4DGVL 3VXOA 1A6TA 2YUWA 1KIRA 4X98A 2Y36L 2X4PA 2R23B 2VISB 5DD5L 2Z3FA 3QQDA 2WLKA 5FO9A 2QVFB 2JKIS 2NXYC 3HLKA 3POHA 5HVHB 2APBA 2QTEA 1EAPB 3MLVH 5JDJA 5I73C 1E5AA 1D5IL 1F58H 5J12C 1IGIH 3QDJA 1IBHA 4MDRA 2WZ6A 3OAZK 4JFFE 4W9IC 1N59A 5EUKB 5ESAB 4A6YA 2NY1B 2DI8A 3P9LB 1UXSB 1NC4A 1ZA6A 4D2NA 1IZKA 3WS3A 5IUSA 2Z1KA 4PI0A 5HHMD 4NPKA 4IK6A 4UQ3A 1FZJA 4UM8A 1QLFB 5JOPD 1CFSA 2X87A 2OTWB 4E68A 3IKCB 4AVKA 4EDXB 3MO1A 3R7RA 3K2KA 3ISRA 1N12A 1KBVA 2VLRB 1CL7L 2L7QA 3FTXA 4TTDD 1AGCB 1L9NA 2ITCA 2G3XA 5DK0A 3ZKXB 5HHQA 4H88H 3DX3A 5J57B 4RZKA 3N44F 1LMKA 4H0LC 2N01B 2Z7UA 1I1YA 5INCA 4Y2LA 2MOGA