3X1NA

Nitrite-bound thermostable copper nitrite reductase at 320 k
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
298
structure length
298
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHAGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title High-temperature and high-resolution crystallography of thermostable copper nitrite reductase
pubmed doi rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
total genus 102
structure length 298
sequence length 298
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1nA00
3NJKA 4YSAA 1A3ZA 1J9QA 1GR7A 3CG8A 3N2JA 1GY1A 1IC0A 1SFHA 3GXUB 1DZ0A 2BP8B 3CVCA 3KW8A 5A7EA 2VMJA 1ETJA 5I5IA 1HAWA 1E5ZA 3ABGA 1RCYA 4HIPA 1CURA 3FPXA 1NWOA 2AZUA 1SFDA 2B3IA 2HZHA 2PCFA 2GB2A 2XV0A 3HB3B 1ADWA 4Q89A 5TK4A 3NP4A 1AS7A 4QKTA 5EHFA 4N8UA 4E9SA 1J5CA 1ZPUA 3JT2A 2IDUA 2H5UA 3PXLA 4Q8BA 1URIA 4G7RB 1EZLA 4GP5B 2Y1AA 4HCFA 1PLCA 7PAZA 2ZONA 4KO9A 2QPEB 2DYRB 3CDZB 2A3TA 3QQXA 4KOBA 3SQRA 1AAJA 2H47C 1SF3A 1N70A 4CSZA 1JVOA 1F56A 4F7KA 2PPCA 4PCYA 2J55A 1MDAA 2IAAC 5AFAA 2HXAA 2FQEA 3QJVB 5B7MA 4E9TA 2XLLA 3UACA 2FNWA 3FYIB 2VSKB 5I26A 3NSYA 1GW0A 1PCSA 1TKWA 3EH3B 3S3BB 2Y69B 5I6NA 1CC3A 2BO0A 3N55A 3TBCA 2J57A 3FYEB 2XYBA 1MZZA 3AG1B 4WKXA 2DV6A 2PCYA 1OCOB 1MG3C 2IWFA 2JXMA 2X87A 4JHUA 1GS7A 6PAZA 4YSCA 1AQ8A 4YSRA 3OMNB 2WSDA 1E65A 5B3SB 4DP1X 5I6KA 2DY2A 1BQKA 2FQDA 1E67A 2W8CA 3EF4A 1KDIA 1BAWA 4YSTA 3T6VA 1JZFA 4K9JA 3FU7A 4FA7B 4G72B 4BXSV 3PAUA 2BP0B 2YAPA 1KCWA 1BYOA 1ZIAA 3X1EA 1MG2C 2X88A 1E30A 1BQRA 3NJGA 1WS8A 4YSQA 2BHFA 4A2FA 3EH4B 2UXTA 3DIVA 4CSPA 1NDTA 1XB6A 1GYCA 3AZUA 1M9WA 3TU6A 3PCYA 4TXVB 2H3XC 1PMYA 4KOCA 4YSUA 2W88A 3ASNB 2HRGA 2PP7A 4HHGA 1AANA 2BWIA 4BWWA 1PNDA 4E9XA 5B1JA 1KBWA 3UABA 1XB8A 1AZNA 4E9YA 4YVUA 1AS8A 4A2EA 4NAJA 1BXAA 1RKRA 3WKPA 2DYSB 1I53A 4HCIA 3NJFA 1QHQA 1CYWA 3AG4B 4GP4B 1V55B 4A68A 1ET5A 1UATA 1SHXA 4WTQA 5PCYA 1ILUA 1CYXA 2BW4A 1BXVA 2YAMA 3AG2B 1NINA 2R7EA 1X9UA 1KYAA 2Q5BA 1DYZA 1QNIA 1V54B 3H4FA 2TSBA 1OE2A 3IEAA 4W9ZA 3X1FA 1GS6X 5I6OA 4BDVA 2UXFA 2IWEA 1M57B 3ERXA 3FSZA 3AY2A 3H4HA 2PPAA 3EHBB 3T6WA 1NWPA 1NPJA 1NIAA 1J5DA 3PAVA 3GYRA 4F2EA 4GYBA 5D4IA 3QJQB 2GSMB 2EINB 4KNSA 1JZIA 2PPDA 1YLBB 3PPSA 2HLEB 7PCYA 4YL4A 2EILB 1KGYE 2HX7A 3OMIB 4HALA 1OOWA 1SJMA 1PF3A 2YAFA 4UF7C 5B7EA 1A8ZA 2PPFA 2XXFA 1W8EA 2AFNA 2J5WA 3AW5A 3WNIA 1ET8A 1NTDA 2CALA 1AZCA 1PLAA 4AI7A 3QJTB 3S8FB 4E9RA 1A4BA 1XMEB 2XU9A 3T6ZA 1SDDA 5PAZA 3AG3B 3FPYA 4DPAX 5D4JA 3PAZA 3NJMA 2PP9A 2B08A 4GY4A 2XVBA 2HX8A 2AANA 4A66A 1SF5A 4NERA 1OE1A 3FU9A 3FQ2A 1JZEA 3OMAB 3HEIB 1ASOA 1WA2X 2BZCA 2WO2B 2ZWNA 3QPKA 2ZXWB 4UAHA 4YVNA 4FAAB 5F7AA 2YQBA 2FT7A 8PAZA 2UX6A 1BYPA 1A4AA 1VLXA 1PZBA 3NJLA 3WNJA 3S8GB 2YAQA 4YSPA 2PPEA 3S3CB 1PZCA 4KNTA 4BWUA 4KNUA 2FQFA 1KCBA 4G7QB 2AVFA 1NZRA 1SNRA 1OCCB 2GC4C 1ZV2A 1PNCA 2XUWA 4HAKA 3BQVA 3TA4D 4BWTA 3UADA 1IBYA 1FA4A 1NICA 3SBRA 2CUAA 1R1CA 3FSVA 5I6LA 3IN2A 1AZRA 1ASQA 1L9RA 3ZX1A 4AKOA 3JTBA 4GP8B 1L9QA 4DP0X 2WO3B 1A65A 2TSAA 1JOIA 5I6PA 1WAEA 3NYKA 3FQYA 2J56A 3NT0A 4QLWA 3QJUB 3WG7B 3FQ1A 2MTAA 1V10A 1B3IA 2PLTA 2XWZA 1AZBA 2OJ1A 2BP8A 4HZ1A 4PAZA 3T9WA 1W6WA 5TK2A 2MRYA 2FQGA 1ID2A 2FT8A 1GSKA 1N68A 3NSFA 5B1JC 2CCWA 3FS9A 2VSMB 1NPNA 2XX1A 5B1AB 1IKOP 2EIKB 5D4HA 5B1KA 1AR1B 2RACA 4P5RA 2E86A 1WA1X 1PAZA 3NJHA 1JXDA 1ILSA 2FT6A 4G7SB 1IUZA 1SHWA 3NJNA 1OV8A 5I6MA 2BW5A 2JFCA 2QT6A 2IDQA 3CDZA 3T71A 4DP8X 3ZBMA 1AG6A 1ET7A 2VM4A 1JXFA 1M56B 3NJJA 3NJIA 2YXVA 1KBVA 4G70B 1OCZB 2I7SA 2CBPA 2XV2A 4YSDA 4W1TA 3H56A 3BVDB 4HHWA 5LDUA 3NP3A 4X4KA 4L0PB 3S3DB 2FWLB 4AX3A 1KDJA 2BWDA 3X2QB 2AZAA 3WKQA 1BEXA 4YSEA 2YARA 2YAOA 4KO6A 4RH4A 1AG0A 3D12B 1T5KA 2LLNA 3MBWB 2IDTA 3SBQA 1AS6A 3MX0B 3FSWA 3ABLB 3UAEA 4F2FA 4M3HA 1TEGA 3OD3A 1A4CA 2IDSA 4BK5C 1NIBA 3TBBA 2VW6A 1MZYA 5AZUA 2UXVA 1OE3A 2IDFA 4G71B 3UGEA 3ZDWA 2DWSA 1GY2A 3RYMA 1AOZA 1IBZA 3PLYA 1L9OA 3X1BA 1J9TA 2BP0A 4DPCX 5I5MA 4N4YB 2XX0A 2VW7A 4AKPA 3CVBA 1XB3A 2VW4A 1HAUA 3OM3B 4P5SA 1CUOA 3ZIYA 1X9RA 1ZDSA 5B7FA 3GDCA 4A2DA 5ANHA 3FT0A 3DKHA 1JXGA 4M4RB 2GBAA 2DWTA 4DP7X 2R7EB 2GI0A 5B1BB 4A67A 1JVLA 4BDVB 4DP4X 3V9EA 1NIDA 3X1NA 1JZJA 2OV0A 5I28A 1WA0X 4E9VA 1W6LA 4JHVA 4ZK8A 4YSOA 2UXGA 3T6XA 5AKRA 4JKNA 1L9PA 5IY5B 1J9SA 2IH8A 2YAEA 3FSAA 2FTAA 1E5YA 6PCYA 2ZOOA 9PCYA 1RZPA 2FJSA 3IE9A 3DTUB 2GC7C 4YSSA 2EIJB 2UX7A 1QLEB 2GHZA 1FWXA 1JERA 2PP8A 2CJ3A 3V9CA 3U25A 1J9RA 3FU8A 1PZAA 3QJRB 4UANA 1ASPA 2QDVA 3EH5B 1AZUA 5I5JA 3X1GA 4KO7A 2IH9A 1HFUA 3WIAA 2VM3A 1JZHA 1JZGA 3CVDA 3SBPA 4MFHA 2NRDA 1PY0A 4HCGA 1NIFA 1SDDB 3ABKB 3ABMB 2QPDB 5F7BA 3OQRA 1L9TA 4KO5A 3IBOA 2XV3A 3IN0A 3UAAA 1ZIBA 2YXWA 2N0MA 2P80D 3C75A 1OCRB 4AZUA 1OF0A 1ZDQA 4BXVA 2XXGA 4E9QA 3WI9A 2I7OA 4DP2X 4NB7A 4E9WA 1PLBA 4ENZA 1BXUA 1L9SA 2VN3A 4AKQA 4A2GA 3TASA 1BQ5A 2I85A 3ASOB 2HX9A 1FFTB 3NSDA 3NSCA 4A2HA 1TEFA 3QJSB 4DP6X 2EIMB 4GXFA 3CZUB 1NIEA 3KW7A 5E9NA 1KV7A 2OCCB 1WS7A 2IWKA 1AACA 1EHKB 2QDWA 2CAKA 4DP5X 5FC9A 2YAHA 2HRHA 2GIMA 4DPBX 3L45A 3FU7B 1TU2A 2JKWA 4EF3A 2P80A 2Q9OA 1RZQA 1GS8A 2BZ7A 4DP9X 3G5WA 1AIZA
chains in the Genus database with same CATH superfamily
1LO4L 3AY4C 1FPTH 3X3GL 3SJVD 1G43A 2VXSH 2X4OA 2X09A 4Y5YB 1AO7B 3BCFA 3MRIA 4Y4KC 3R18A 5KN5A 1KYDA 4OAWA 2N01B 3EYVA 1N5YL 2IJ0C 4HWZB 3UOAB 3CFBA 3A6BH 4BRJA 5B3NA 5I1LA 2XPGA 1E5CA 3FQWA 2VMJA 4IKLA 5FYKH 2OR9L 4S1SH 3U1PA 4XZ4A 1RCYA 4AYFB 2NX5E 1KYUA 1G6VK 1INQA 2HZHA 1FO0H 1D5MB 2PCFA 2GB2A 1MREL 3VVVA 2ZOUA 4MXQD 3MV7A 4JPVH 4YLQT 3B9KA 2EYTA 2JKNA 5CEZE 5CNHA 4OCSL 5C2UB 2R9HC 3IDIB 3EGDB 3HE7C 4FNUA 5T3ZH 5E0FA 4PWJA 1K5WA 1H5BC 1QFUH 1O6VA 3S2AA 4B9GA 1XGQB 3IYLW 3ESOA 1NFDB 2X1OA 3BP6B 3O4OB 3GZOA 4B41A 3NEEA 3Q8EA 2APFA 3SEPA 1YPZE 1FZOA 2O26U 3HLKA 3LQAH 4P2QE 3WJMB 4QO1A 3A0OA 4OGYH 4ODSH 1LD9A 5IB1A 4Z0BH 5LVEA 2C5DC 3GDBA 1JGIA 2F5BL 2OJZL 3M88A 4R4ND 2DAVA 5DQJA 1R3JB 1FGVH 4S10A 1T5XA 3S37L 3ZE1E 3OBAA 4NCDA 1IBDA 3S3BB 1G9NH 3VXPB 1AH1A 2JQZA 5SX4I 3LXCA 2J57A 4JY6B 3VFUB 1TENA 1PTZA 4UOW0 5HGBA 3WFBL 2P5EE 1LL1A 1HSBA 3NIDE 3FK3A 3JWNG 3M86A 3MKKA 3PGFH 4EKJA 1JBJA 3PWLA 1WEJH 2J1ZA 3BFOA 4NRZB 2DY2A 2NDGA 4W6XB 4H5SA 5D7LE 3OAUH 1VZIA 4ZJ9A 1V3LA 3BP4A 4U6TA 2YD0A 3VRJA 4Y19B 1SHSA 3OZ9H 4HZLB 4D0CA 5JPNA 3UG4A 2V8LA 1HNYA 3ZOAA 4NRYA 5DK2B 2HFGH 1S3KH 2XACC 4U1GB 3BRDA 1LEGA 4L3CB 3C6LD 1EMTL 5E8EA 3IB4A 3T0VA 4ZS7L 4ZFGH 3IDNB 3ELAT 3GJFB 3EYFB 3G6DL 2DIBA 5GRUH 4X7EC 3RWIB 4I1RA 3IKCA 4A2FA 5CBAB 1KN2L 1H3UA 4AJYV 3D0VB 2MHAB 1ZLWK 4NDMB 4CSPA 2R4RL 2GFBA 1IVTA 4DTGH 2AI0L 1KFGA 4XP6L 1W0WA 1DBJH 3TU6A 4UT9L 3FO2B 4WEBL 5DURD 2Q7NA 4NFBA 3RRQA 5FK9B 5D7SH 3BEWB 3ASNB 2NUTB 2HRGA 4MQSB 1W0VA 3WNMA 2R0LL 1NANH 3CFCH 3MLZL 4JRLA 1XGPB 3HKFA 3WKMH 5CF3A 4NQSB 1ED3A 1O5DT 4E9LA 4M5TA 3Q6GL 4UYPA 2Y36L 3NJFA 1H15A 1VFMA 2GW5A 2Q8AH 3GI8H 3BE1H 3APFA 3UTQA 4BQCA 2A77L 4F2MB 4A68A 1V05A 3AROA 2GITB 1DVTA 4GAJL 4BFIA 3AG2B 2PYED 3B2DC 4JG1L 4N0UB 4ZOAA 1BGXL 3F7LA 2IQ9H 4L4VA 3JWDL 4IEFB 1A7OH 5HBBA 1A9EA 2NY3C 4BDVA 3IRPX 5T8IA 4FQIH 2AP2A 1RY7B 3Q44A 1J5DA 5BVJA 1A14L 2OYMA 2AEQL 3B9KC 1NAMH 1QSZA 2Z35A 2CO4A 3GYRA 4Q0XH 5DC2A 1WAAF 2HJLA 2I07B 3RTQA 4ZQKA 1JV2B 2D7TL 5TDPB 4Q74A 5AAWA 3F04A 4WTXA 4LCIH 4NO5A 2WHVA 3KGRA 5IB3B 3VD7A 1CBJA 3D05A 5AD0A 1PF3A 4I4WB 4LFHD 4R2GD 3K0WA 5KOVC 2WXQA 4WDIB 4XAWL 5FYLE 1ET8A 2J1YA 5DJ6A 3NCJL 4KRPC 3WTTA 4JKWA 1UCTA 4PJGE 4X5PA 4CW1A 5AOLA 5DMKB 5ISZB 4KC3B 4LLMA 4DPAX 1VGEH 5DEJA 3AU0A 5F9DC 2NY6D 3FN0L 4WUUB 3QDAA 1PU0A 2VWEE 4F7MA 2AAAA 3BH4A 1OGAB 1W72H 3H9SB 3MUZ1 4I0CC 2BSED 3HI6H 5EOCJ 1T1YA 1E4WH 3FT2A 3KXFE 2MQ3A 3O3DB 4LDLB 4IRZL 4UAHA 1FBIH 2J1XA 5F7AA 3FH7A 1WBZB 4X0NA 4YBHA 2HRLA 4ZOBA 3NJLA 3VG0H 3LRHA 4GKSA 3S4SG 3N85L 1OF2A 2UY7A 3SZKC 4XVOA 5T1MB 1W16A 3OAZK 4ZFZB 4HAFA 2WW8A 3AGVA 2K6YA 3W57A 2GC4C 2EVJA 4P0DA 1OTSD 4BWTA 1D9KA 2UV3A 4O02B 4WW1A 1BZEA 1UM5H 5CZXD 5GISL 4ONFL 5J1SC 3RPBA 5J6HA 3KM2A 5DI8A 4HX1B 1LLAA 2ZAGA 5LN8A 2YGNA 1JZ4A 5CO1A 5HVGB 4J27A 1V10A 4Y5YA 1AO7A 2DM3A 3QNYB 4HEME 4HWZA 4M62H 4ODTL 3MODH 4YDVB 2JK5B 4ONHB 2PYFB 4TUKH 5KBNC 3DECA 1GSKA 5IBUG 1RFDH 1UD3A 4YR6B 5ERWB 3T1WA 4AYFA 4N5EC 1AKJD 2BNQE 3RPIB 1D5MA 4S1DC 3L3IB 3BH9A 4V1DB 2V5SA 2DIEA 4NGHL 1KYOK 1RJLB 4JEGB 1TKWB 5AB1A 4FC3E 4M5ZL 3IDIA 4PY8I 3EGDA 5IIEB 5CS7A 2PTTB 2KQNA 3FT9A 4EI5D 3BN9C 4O9HL 3ZDYE 2XN9E 3BHBB 2CO2A 3JV4B 4F1ZA 1XGQA 2JFCA 2HKHL 2DQIH 4R4FL 1CXHA 2NNXA 3CXHK 5JW4N 4DP8X 1IGJB 2XIBA 5CGYD 5HYSG 2MCAA 4ATTA 1NFDA 3BP6A 4RDQG 1DVFD 1TNNA 3PGDB 2JI2A 3QFJB 3P2BA 4H8UA 3WE1A 3WY4A 3WJMA 1WYJA 4JNXA 3NFNA 3Q2VA 4G11A 2X53A 4D3CL 1OAXL 3F3HA 3BIBX 3KWVA 1ZLSH 2IDCA 3B2UC 2FWUA 3MRCB 1OP5K 2XBZA 3FMGH 4PQXA 2JJUA 1R3JA 2C1OB 4B9FA 1CL7I 2CO1A 1H3GA 1NMAL 3ESVF 5KZCB 1BEXA 3VXPA 5ITBH 1WTLA 2R0KH 4MJID 1AG0A 4JY6A 3VFUA 1XZ0B 3VA6A 3AGWA 4JM4L 3UTOA 4IDJL 1KYOJ 3UYPB 1DBAL 1PPIA 2QSQA 4M5YH 5ABDE 4PTTB 4NRZA 2BSBA 3MBXH 4ANKA 1RLWA 4U2YA 1E5BA 1OP4A 3QDJD 4Y19A 1BJ1J 5TQ2L 4HZLA 4MKMA 3SQBB 3HC4H 2DWSA 1OB1B 5DK2A 1MCOH 2VN6A 1U8PB 2VKWA 3W0WD 1IT9H 4A1RA 2AXJA 4L3CA 4FFWD 4PIRF 2X9XA 2Y4SA 5SWSB 3HR6A 2GVYA 3IDNA 3GJFA 3X17A 2WLNA 3CSPA 4G6FD 4NKDB 5KW9H 3WFDL 5FA4B 1MFDH 4N2OA 5CBAA 3D0VA 4NDMA 5K9JH 4GG8B 1AFVL 2BVYA 4DETA 1CMOA 4PLNC 1OOAA 1WFTA 3BAXA 3W5NA 3FO2A 3BD3A 5FK9A 4KI5E 2GIXA 2RB8A 3BEWA 1F90H 1X5HA 4N3UA 2NUTA 1XAKA 4N87A 4YDIH 4KKCD 4RFNC 1KCSL 1TDQA 1QMUA 4F7EB 3HMWL 4WFED 2HP4A 1XGPA 5IEHB 1F4XL 4NQSA 3U6XS 2QQKL 1U92B 2K6ZA 1KGUA 3UC0L 4Y5YC 5FECB 5KJRH 2EIJB 1UACH 1I9JH 4F2MA 2F9BT 2JB6B 5C09D 5DD5H 4H88L 2OI9B 1DR9A 2GSGA 3O6KL 4HG4J 2I9LB 1N64H 5J06A 4N0UA 2A9DA 4KHTL 1EBAA 4N25A 5F9OL 2W94A 4U6YB 3RBSA 2A83B 4IEFA 4XE0A 4H0GA 2IH9A 4R97B 2XZAL 2EXWC 4OLVH 4BA0A 2ZNXA 1YQVH 4MFHA 5MHSD 1KXTB 4WZ9A 1NIFA 4PVLA 5EUKB 5HJGA 1CFTB 4HMEA 3RUGF 5DRXB 3IBOA 4X5WB 2E27L 2I07A 3FDWA 3L1OH 3LQZB 1WAAA 3F7VB 4LL4A 4LP8A 4Z3IA 1JV2A 4P2RD 3MV01 4IHBA 2P80D 5TDPA 1OCRB 4K71B 4ZSOB 4XVUD 3GS0A 1NCGA 4XCCH 2KZ1B 2NSMA 2L8AA 4JVPA 4R8WL 1PY9A 5IB3A 4PRBB 1U42A 3OTTA 4I4WA 5CILL 4XOBA 4WDIA 1XL6A 4N24A 3SKNB 4WHDA 1T0OA 3NSCA 4KH2A 3QJSB 1AGDB 5LXVA 5BZZA 1MNUH 2X2JA 5DMKA 1RZKL 1F42A 4ZFQA 3BVNB 4WUUA 2G3NA 1DUYB 2D9CA 5BZWB 4ONGL 4B3EA 1OGAA 2R69L 3H9SA 4L8DB 1AACA 3V0FA 2WWKO 1C5BH 3FRPG 2YRBA 4GMTL 2FGZA 1P4IL 1RUAH 2E5EA 3O3DA 3FU7B 2PF6A 3CX2A 5I9QB 4LOEA 1WBZA 1JNNH 2JKWA 2OK0L 4WO4B 5AYTA 4PY8J 3QR1A 3SYQA 4AIEA 3H3PH 4FX5A 4ICWA 1T0PB 1GL4B 4DEUA 3WEMA 3FL7A 4W9HC 5T1MA 2Y3NA 2ENPA 4UOJA 4D9LH 3GXUB 4RMSA 3BPLB 4ZFZA 1D6VH 3K2MC 4Y2DD 3R0MA 3CVCA 5CSZB 3NCWA 5HXMA 2ZXDA 4U1GC 4O02A 1FRGL 1RIHL 4RMQA 1QZ1A 4GLRI 3RWJB 5ICXB 5GZOA 3MROB 4OQTL 5D1ZD 2AZUA 2IANB 4EJ1C 1E9QB 2XQYG 4AWJC 3GS7A 4XXWC 2QR0B 1YRKA 4E9SA 4N8UA 1R24B 1UOLA 4JFEB 1DQLH 2IDUA 4HX1A 5JW4R 4I0PB 3Q2NA 1BFTA 5IJBC 1CT8B 1V3KA 5L0QB 4KK6D 3QNYA 4HCFA 5T1LD 5JHLH 3VQMA 2RGSA 4YDVA 2JK5A 3VSQA 2Z7UA 4ONHA 3M1OA 2PYFA 3VGBA 3BT0A 5DO8A 1MF2L 3ECQA 5ERWA 4YR6A 4B9KC 1F56A 2H32B 3R8QA 1RMFL 2BFGA 3RPIA 1WGOA 3QG7H 4TULH 3L3IA 4V1DA 5FLUA 4UNVA 3VX0A 5F7LB 4BFFA 5B7MA 2J3SA 3SCMC 4M7LT 1RJLA 3U9PL 1TKWA 5LBVA 4M3KB 3GIVB 5IIEA 4U1MB 2DDQL 2F0CA 1TG8A 2PTTA 5T1KD 3NABL 3BHBA 2BDNL 3JV4A 1MEXH 3EH1A 4P57B 1IGJA 4PJ8D 4R0LC 4L5FL 1XR8B 3IFNH 3M7FB 4ONOA 3GRBA 3PGDA 4ETQB 5JIHA 3QIBB 3SE9H 4K3EL 2DZEA 3L3KB 3ILQC 1UXMA 3MRCA 2IG2L 4RISH 2C1OA 1NCAL 4K7PY 4N2KA 2XA8L 1FNFA 4UWQB 3INUL 5FWRA 4AM0Q 3MV9B 1KCWA 3PL6D 1ZIAA 3P0VH 1XZ0A 4FTVE 4UT6H 2QL1A 3ARED 2EVIA 4KQ4H 1DQMH 2V33A 4XN4A 1BQRA 2W0PA 3UYPA 4JRYD 4X8XA 3GIZH 2EDMA 1EK3A 4W9FC 4X9BA 3D30A 4PTTA 5LXGH 3LZQA 3CSTA 3F58L 3GTVA 3U0TB 2W65B 3WCYA 1MWAL 1QD0A 4TSBL 3QXAB 3P2DA 4NN5B 2VDOL 2EUXA 4JN2B 3KPNB 2CBQA 3QGVA 4FMVA 1UVQB 3BPNB 1MN4A 4OZFG 2YUXA 3SQBA 2WYIA 1FFOB 1OB1A 1V3MA 3TEXA 4KZEH 4I0KA 2FLRT 1U9KA 3UG3A 5TDNB 5SWSA 4QYOB 2K3HA 2HKFL 1KELH 3BMWA 4Q97A 2VITB 4NKDA 4MRBA 5FA4A 1RUMH 4TVPH 3ZIMA 2YK1H 1TZIB 4N8CH 1I8AA 1QLEL 2AVGA 5KJ4A 2VDPL 3OHMB 2BW4A 4GG8A 5DSCB 4X4ZA 2GIYA 4ZNEA 3FCGA 3IKKA 3EYQD 5TPWL 3X1FA 1OE2A 2C9AA 5GZOC 2TRHA 3NBNA 4XXCA 1P1VA 4H26A 4OLYH 2ZXGA 2G0KA 3BESR 2YN5A 2YPLB 4F7EA 4UDTB 3T4AB 2FBRA 1NGPL 5B38B 5IEHA 4PRAB 4G5AA 1NCCL 3GB7B 3GKZA 3H42L 1UM6H 1U92A 2VDQB 2YEVB 5FCUL 2G3MA 4PJFB 2I5YH 4JS7A 5GRZA 5FECA 2ZAIA 2FJGB 1U3HD 1ACYH 4KNSA 5AL0A 3QUYD 2JB6A 2PPDA 4TLUA 3WDHA 4X9HA 3AVEA 3QFGA 1JGLL 2CBOA 2I9LA 2PXYC 4PP1D 4XCFL 1GAFL 5DVKA 3RFZB 3IWVA 1QATA 2C9PA 2ICWB 4PYHA 1A8ZA 2A83A 4K3HA 4U6YA 3RA7L 2AFNA 2R1XB 4F3FB 4F8OA 4G9FD 3RNKB 1BX2B 4R6UA 4L1LA 2DD8L 3RVWC 4WWKD 1KXTA 3T6ZA 2XU9A 1FE8L 5EUKA 3EO0B 1CFTA 2OBGA 1IEBB 2X4NB 5DRXA 3VXRB 1ZY9A 4BM7A 4X5WA 4GY4A 2B1HH 4PJAB 1C5CL 3LQZA 3F7VA 2I24N 2XWCA 1BG1A 2ICES 2VZ1A 3TO2B 4ZSOA 2WZAA 4YXLH 4XO5A 4FAAB 2IALB 4IIQC 4OLUH 3STBA 1I31A 4X8JB 4W4NA 4DGVH 1BBJB 4HISA 3BGAA 4Y8DC 3QC5X 4ZTPL 2NY1C 4HVBA 1CF1A 3KGUA 3EO1B 2AAVA 3SE3C 3P69A 3SKNA 5JIKA 3PP4H 3SGEI 5I73B 2IAMD 3FUNA 3HG1D 1AGDA 4XMWA 3MRMB 3O3BB 4A39A 4NEHB 1BFSA 3LZOA 1I8IB 4NFDA 3BVNA 5CCKH 1DUYA 1PNCA 4HAKA 1X4XA 4JY4B 4L8DA 2WWMC 2XQ0A 2Z7YA 1IBYA 1SM3L 3AC0A 4WEUD 4DT2A 4MJ5B 2JI1A 5C6TL 5IQOA 1DQDH 2CUAA 3KPMB 2B5IC 4FQ1H 5IW1B 3WLBB 5I6LA 1JWUB 2WZ6A 2OL3H 4QHPA 4WY7H 1I7RB 2QJDA 1JNHB 1YEFL 2EJ1A 3FBQA 2VDRL 3IMVA 3PP3K 1DJXA 4WO4A 5I6PA 4IBTA 4CRPA 1OARL 2XFGB 3LRSB 2XZZA 3WNKA 1QRNB 4FFYL 4JHWH 3EYSH 5J8OA 4OZIE 1ID5I 4MAUL 4UBDC 2ZUVA 2QV2A 2AK4E 3DOHA 3L5XL 2MRYA 5CSZA 4LEEA 2AJUL 3ZKND 5EZJB 3DK2A 3RWJA 5ICXA 3MROA 4YE4H 2IANA 3EW3B 2EDBA 1E9QA 1GOHA 1IKOP 1EHLL 2QR0A 1RZIB 2NX5D 4HUKB 3T0WA 1Q0YH 1R24A 1OL0A 4JFEA 4OCXH 3S9DB 3FO1B 3RG1C 2BS71 4I0PA 4FA8A 1DO6A 5AVTB 4KVCH 1CT8A 1EAQA 5GZND 4LDCA 2AK1H 5CEZD 3D09A 3PWNB 4ZT1A 4XXCC 3EFOB 3MQIA 5E51A 1YEKH 5CEZL 3CGTA 3KWWB 4KK8D 4MQ7B 5DZNA 5E1AA 3MUY1 2H32A 4EBQL 4E36A 1NMBL 4JFVA 1KBVA 4YUEH 4Q7DA 5JQIB 3H56A 1TT6A 1SBBA 4P2QD 5LDUA 3MOQA 2BINA 5EBGA 3RTLA 5ALBL 4Y1AB 4RNRB 1RU9H 3GIVA 4PIBA 4UINH 1Z0NA 1JHLL 5DZVA 4U1MA 4BE5A 1KLUB 3VA2C 4CKVX 3N9GL 3EFDL 2LLNA 2DQHH 5I1HH 4P57A 3SBQA 2HTLD 4XAKE 5C9JB 3RGHA 1XR8A 1RJYB 2WCGA 5KTEL 1QNZH 4ETQA 2P5ED 3QIBA 4KXAA 5I1IL 3FSWA 1Q0XL 3FC8A 5KVDE 1BREA 5DWUL 1T1XB 3L3KA 3GK8H 3KYMB 1XSOA 3TBBA 4F37F 2VW6A 5D7LD 2ORBL 1ZK9A 3SDYL 3UGEA 1MI5E 1WJ3A 1YZZA 4DPCX 2FGWL 3HOGA 1QEWB 1IRAY 3MV9A 4Q6YA 4YDLC 3N1PC 4PJXE 5J9PB 1YEEH 4A6YB 1ITBB 2CJTA 3GJFK 3Q5OA 4ORGB 5HHME 4KXZI 1NAKL 3VFVB 1RUQH 1BF5A 3CIAA 4L29B 4JFTA 5TTRA 3U0TA 2W65A 3QXAA 5TF1H 4JN2A 2FD6L 3KPNA 4RMRA 2X4UB 4DGIH 2BS8A 3OKDB 4UQAA 2WUCH 1UUNA 1FFOA 4OSUL 5CJ8A 2Z9TA 3T04D 5I9QC 5I28A 3GSVB 2ARJB 3BX7C 4WO4C 2KLRA 3ZR6A 4YSOA 1SEQH 5TDNA 4QYOA 3RVXC 3ZMNA 4BGDA 4YK4B 2B7DT 1L9PA 3LIZH 4F80A 2IH8A 3ZDXE 4B9PA 2VITA 4MNHB 5EDXA 3QPQC 3AJ7A 1E5YA 1JGUL 1EXGA 1UGKA 2PMZA 1RZPA 2FJSA 4RIRB 1TZIA 4NHCL 2ICCA 5I2IB 2WUBH 5C0CB 5DSCA 5LHDA 1E5AA 4PV8B 4Z7UE 2FBOJ 4KU1A 3VSTA 3NMEA 4TLKA 3U9WA 4IS6B 5IT2L 1TTCA 4HJGB 1ONQB 1YEGL 3LD8C 5HDBE 3K2UH 1E4XI 4LMQE 2B14A 2B8OT 2HT4C 1N3NB 1EUUA 1BOGB 3UO1L 3LHPH 3WFCH 3CSGA 2YPLA 4UDTA 2P43B 3T4AA 3L8QA 5B38A 4PRAA 3GB7A 3V4UH 1JGVH 1OP3K 1S7UB 1XV8A 4I0PC 4OY9A 1J1XH 4PJFA 4OF6A 3ATEA 4FHBD 4WO0A 2A6KB 2FJGA 3K6DA 3Q05A 1NBZB 2ITDB 4JKMA 4PRPB 5JIDA 4IU3B 3KPSE 3AUWB 1IKNA 4JQXC 1CDYA 4P8QA 5I18H 1I82A 4FQHB 3H6AA 3RFZA 2F7PA 5D2LF 5EIQA 2QSCL 2ICWA 1U2HA 4LIQE 1GZQB 5F9WB 5L88L 1MCPH 4KV5E 2I85A 4K4KA 2R1XA 4J3SA 3UPAA 3RNKA 1BX2A 3BZFB 1MFEL 4KGLA 4QWWC 2PTUA 5FYLD 3I9AA 1QKZH 1Z6JT 1SN5A 3EO0A 1KPUB 2VXQH 3FBKA 3L5HA 4LRNH 4NOFA 3M8OL 1IEBA 3S34H 2E0PA 1IIKA 2X4NA 1NC2B 3VXRA 5FYLL 2YGQA 4PJAA 1WZKA 3DX2A 5IJKC 1EAJA 4B0MB 1TITA 3N0AA 4LU5L 2A4CA 2CAKA 1MFBH 4UV7L 1MUJB 3B34A 3TO2A 5F0JB 4YHNB 2IALA 3GUTB 3L13A 3KXFD 4X8JA 2IOIA 2IEPA 1BBJA 1TJIH 2ZE0A 4JGJA 2GHWB 1R33A 4KUZH 3QIBC 5T33H 2AHIA 3EO1A 1X6LA 1K8IB 3P9WB 3MRMA 1CGYA 3O3BA 3TBVB 5G4NA 3MACL 1I8IA 4JY4A 3MO1B 5C86A 4YAQB 1KTBA 1ANUA 3V95A 2KMWA 3KPMA 4U3CA 3WLBA 5IW1A 3WXWH 1JWUA 1JNHA 3HB3B 5EU7E 1WIUA 2G2RB 4HKZB 1PFCA 4WI8A 3APMA 1INEL 1JJUA 3LRSA 1BFVH 4NYLB 2YBRB 2WNXA 4KTDH 1QRNA 4KTGA 3SE8H 4AMKH 3KR3H 2ENSA 4FQXD 1DE4B 4NN5C 5FOJA 5AEAA 2L7JA 4AENB 4YHKH 4ZI8A 4FG6C 2H0EA 3QRGL 2ARWA 1A02N 1IC5H 4Z7OE 5FWQA 1OSZB 3WAKA 5DS1A 4UYQA 4XN2A 5KEZA 1UURA 4TKWA 5EZLB 4JQIA 3L7EB 5EZJA 4CSZA 4LCCC 3L81A 5C0FB 2EE0A 1TVHB 5E2JA 4APQB 1IGYB 1XF1A 2VQTA 2ED6A 2WTPA 2HXAA 3ZKMC 5KSBB 1RZIA 5BMFL 2YSTA 1YMMB 2BNQD 4E9TA 1RIUH 1CLOL 1ETB1 4XTRC 3MV8E 3FO1A 1UA6L 2EZ0D 5DVMA 5E4EB 4X80L 1A25A 3MNMA 1C7TA 3QZWG 4XP4L 4U05A 3PWNA 1GKOA 4YNYA 1MKFA 4Y9EA 3UERA 5I8CB 3DRTB 4EZMA 5I8OL 5MP6L 5DZJA 3BUYA 3EFOA 2FHBA 3ASWA 1F2QA 2XN9D 3KWWA 5FX3A 3C5JB 4MQ7A 3LEVL 3ESMA 2EH7L 1EGJL 3OLIA 1PKQB 1NGQL 3CZJA 4HIEB 5HHOE 2AABH 2W9LA 1HQ4B 2VDKB 1QAWA 4WWPA 2XWDA 5AW4B 1MXDA 4JFZH 1KCVL 15C8H 1OZTG 5EC2B 2WBXA 3QPXL 1T04B 4Y1AA 1PLGH 4RNRA 1NEZG 3L1GA 4K8RD 1IKNC 2UWEB 5IQNA 2AW2A 1KLUA 3RFZC 3ARTA 4PMEA 4XP5H 3GRGA 5FHBL 2VXTH 2OKMA 3UYRL 1WS8A 5C9JA 1RJYA 5IREA 5CGMA 2XA3A 3CVIH 3EH4B 2OMZB 3IU3B 3S97C 4NHUB 1XSKA 4UI2A 1MHPL 1J8HB 3RWDB 1T1XA 3TF7C 3KYMA 2Q3XA 1MRFL 1X5MA 4ABWA 4O02H 4JKLA 5FHAH 4GUPB 3UEZA 2UYLB 2W88A 5C08B 1RZFL 3RBGA 1DO5A 2Y7LA 1IZJA 4B53A 1QEWA 5B1JA 1KBWA 1EV2E 4NAQA 1M2VB 5A2IH 3N91A 5EOTB 5J9PA 4A6YA 5I73C 2NT0A 3BKYH 2YIHA 4ORGA 2R4SH 3FO9B 3VFVA 2AC0A 1LK3L 1CYWA 2QMJA 2K8QA 3US9A 5PCYA 2K4AA 4L29A 5CM1A 4O4YL 4JB9H 6CGTA 4N2NA 2W59A 2RMNA 4N22A 4MXVF 3TS8A 3NCXA 5L4JA 1MLCB 3WFHB 4B5EA 2X4UA 4HS8H 1J0ZA 3OKDA 3ERXA 4CMHB 1F2XK 1Y7VA 3TM6A 1M6OB 4KI5D 3VFGL 4U1IB 3GSVA 2ARJA 4OI8A 4HJJL 3BKCL 4KDVA 4C58B 5L4MA 4L9LC 4MNHA 4TM9A 4ODVH 2COVD 4RIRA 3WO4C 1H6UA 2EINB 1RUPH 5I2IA 1QFWM 1BD2E 5JYLA 3LY6A 4FI8A 4Y0GA 5C0CA 3G6JB 4KFMA 5I1CL 4PV8A 1Y1UA 2WTRB 2LTQB 2C4FU 2XSKA 1QQDA 2QTVA 4OZGF 4IS6A 1E90A 1GIGH 3GINA 1DDHB 1ONQA 4HJGA 4UF7C 4U0RB 3ET9F 3NG5A 1D5IL 2APVA 2PPFA 4M02A 2F54D 2J8UE 3B8SA 1QR4A 1AZCA 4NM4H 4U6HA 1N3NA 3NEOA 1BOGA 3QJTB 4YX2L 5C07A 1SXSA 3A6BL 4AK2A 4QOKB 1IAIH 3BCDA 1S7UA 4BFOA 2DI9A 4G42B 4L4TB 2WGNB 3KLAB 1GGIH 3NIGE 1ESOA 5D7JB 2A6KA 4KMTH 3P4OB 2Q10A 1NBZA 1TTAA 2ITDA 4PRPA 3HEIB 5IF0B 3VFTB 1TNMA 1EFXD 5DJAB 5D7IE 3F7RA 4UDUB 1HCFX 3EJJX 4JPVL 4EDXB 1OTTD 2QFPA 2BNRE 4FQHA 3BQUB 4XHJD 5KVEH 4OIAA 3T3PF 3TFBA 5CP3H 3GRWL 1GZQA 2FX9H 2R51A 1AD9B 3KH4A 3QEGH 4U0QB 1V7ML 3CSYB 4ORZC 3VXSE 4LB8A 3BZFA 1P2CB 1QW9A 4N68A 4QXWA 1PSKH 2K4WA 3NQIA 1KPUA 4Q2ZB 3QUMB 1FC2D 4NWUH 4LAQL 1HCVA 1NC2A 4JMNA 3EGXB 5E8DL 3MLRL 4MA3B 3NCFB 2L4OA 4HKJB 1ZHBB 3ZT7A 1MUJA 4LPTA 5FUOL 4OI7A 1JCVA 2CG9X 3MRNB 3JSSA 1KUMA 1JGEB 1WH0A 4YHNA 3GUTA 1JK8B 4F5CE 1ZA6B 1FGVL 1L6ZA 2A2QT 2DW5A 5CEYB 3OKNB 3M07A 1G9NL 4P5MB 1K8IA 1E6OH 2GJZB 3CLEL 5E2WL 4RX4D 4DW2L 5C2BH 3TBVA 1PG7W 2PLTA 5I1AB 1KIUB 3SYOA 2OJ1A 5I1EH 1G1OA 2PO6D 3PGFL 1LEKB 4KFZC 3M1CA 3FNKA 1N10A 3SJVB 3V4PL 4AEHL 3MO1A 4YAQA 2EVGA 3GBNL 5B1JC 1DCEA 4HUCA 5IFAH 4LKCB 3EO9L 3H9YA 1FH2A 1CU4L 2G2RA 4HKZA 1YNLH 1ETZB 4K07A 4JG9A 2CNZA 3BEVB 2RACA 4NYLA 4WI0B 1U8KB 3JUYA 2YBRA 1PGRB 1YY9D 2DF3A 4JUSA 2ZF8A 1A6PA 1DE4A 3QCUL 4AENA 5FAAA 5GRUL 5AVSB 1MVYA 4LSSH 3WGUB 3CFNA 4LCWE 1T83A 1OSZA 4QNPF 3T71A 5EZLA 3L7EA 1EA9C 2L3BA 4KHXH 4DTGL 5C0FA 4PJ7E 4HWEH 5IMMB 1TVHA 4YK4C 1F13A 1IGYA 5F0LB 3KAAA 1CGSH 3LB6D 1YO4A 1Y6NR 3FO0L 5KSBA 1K4CB 1M9SA 2DPKA 1YMMA 3LV3B 5FF6B 5HDQH 4XNBA 1WUZA 4LP4A 1EPFA 3IGLA 5A6IA 3LPFA 4W70A 1A3RH 3U9UB 3RJDA 1KDJA 4BZ1A 5BO0D 2MPVA 3UMTA 4RH4A 5I8CA 3DRTA 2ADIB 3MBWB 2Q8AL 3VW3H 1DQQB 4ZX6A 3C5JA 4N2BA 1AS6A 3FHEA 3MX0B 2W9EL 1PKQA 4OZHE 4J3UA 4HIEA 4S1RH 3UL4A 1HQ4A 3LRKA 4F2FA 3OSKA 1TEGA 3SHSA 4AH2B 2Y23A 4HJ1A 5EC2A 5C0JA 1HQRB 4O00A 1T04A 2X6MA 2F61A 4H1LH 4L3FA 4ALAC 5BO1H 4AUYA 2UWEA 3PLYA 3CMOH 4P2OD 3JZ7A 3IAQA 2VUYA 5F9WC 2OMBA 4JN1L 4WV1C 1AXSB 2FNBA 1ECZA 4Y2LA 4FTVD 4MA7L 4LCIL 3WJJA 2W81C 2H41A 4GRMB 1KEMH 4ZS6D 3VO0A 2BY2A 3C6LB 3IU3A 1OSPL 2B9BA 4NHUA 3ZL4L 1DSFH 3T0BA 1J8HA 3RWDA 5BZXA 1RXLA 2R7EB 4NQCD 1L9NA 3KHQA 2CXGA 5B1BB 1A6UL 4XXDB 3FTSA 1QI5A 4GUPA 4Z3FA 3DX6B 2UYLA 4DP4X 2P7TB 2W80C 5DEGB 3TPKA 5FO7B 4PU2A 3Q48A 3PABB 4U7MA 5DURB 3ZDZF 1M2VA 3TBYB 5EOTA 1OCWH 4FQ2H 2AQQA 5T5FA 3II3A 3HI6L 4X4MA 3K6OA 3FO9A 2AQ3A 5CIPH 1EQWA 1G7MB 4YXKH 1FBIL 3A6OA 4MJJA 4L1TA 3G5YB 2O6EA 3WSQH 4EPSA 1XZWA 2ZKYA 3F62A 2CZNA 3MJ9A 4XCEB 3U25A 3K72B 4Z5RB 3LKNB 1MLCA 3BYYA 3WFHA 2BVPB 2H32H 1MFVA 5HJ3B 3C6EA 4XMUA 3J7HA 2PYEB 4C57C 3U82B 1M6OA 3SBPA 2F53E 1XCWA 4U1IA 1O0VA 1TFHA 1SXAA 5K69A 5TE7L 1TYRA 1WZMA 2MOVA 5KANG 5ADOL 4QKXB 1OT1A 4XZUB 5FM8A 3K6SB 1UM5L 3EJZC 3KCPB 1WV7T 5F7FA 4OJEH 3RHWF 1DJYA 3LH8A 1T83C 3QK0A 4LAJH 2WTRA 4ZPVB 2P5WE 3MCG1 2BHZA 1DDHA 2VSDA 1MAJA 2QPSA 5DD6B 1HS6A 2NYYD 2WQ8A 4I18B 5E03A 4UOZA 2FX7H 2HFFB 4CGTA 5FGSA 4ANXA 4R2GB 4QOKA 2Q87A 3KDPB 3QNFA 4HWBL 1HYSD 3IAGC 3QZNA 4G42A 4L4TA 2IWKA 3KLAA 5E4EC 3KGSA 2AXFB 4WLCA 4LOUD 5D7JA 2QDWA 5AYUL 3P4OA 5LGKA 3O9WD 4HW6A 1Z66A 2NY6B 4TNEA 5DJAA 4FFVC 1JK9B 3VFTA 2DTSA 4X5XB 4UDUA 4EDXA 1GZPB 4MJ2A 1P5UC 3BQUA 2LV4A 1AD9A 2XIDA 1AIZA 4G7RB 3CSYA 3V0WL 5E5RB 4O5LL 4PWEA 4OD1L 1P2CA 4YSAA 5HYIA 1J9QA 2XKNB 3SYCA 2FUQA 2NZ9D 3NFSH 2LW3A 2ZOLB 4Q2ZA 3QUMA 3SO5A 4ZYKB 4FD0A 5FYJH 3EGXA 1M4KA 4MA3A 5F8QC 2J6WA 4HKJA 2Y7SA 4WW2F 2IFFH 4WW2B 1ZHBA 3SKJL 1ZSHA 2FH6A 3MRNA 1Q9KB 5EEXA 1JGEA 3L3HB 1ZVHA 1JK8A 5KYUB 2QLYA 1ZA6A 3WJJC 2Z8RA 3NP4A 5EHFA 5GJSL 2R56L 3CK0L 5CEYA 3EJUA 2QGCA 2H5UA 3OKNA 4GQ9H 1TQTA 4P5MA 8FABB 5ESVB 1B2YA 2GJZA 3MCYA 4OJYA 5E1QA 3D48R 3TT1H 5I1AA 3VQ2C 1KIUA 1QEXA 2Z6FA 3MZGB 1LEKA 5GGVH 1GH7A 4HPOL 2DQJL 4RRPM 4XMLH 5HJDA 3SJVA 3MBXL 3QR2A 4LNRB 1T66D 2AK4D 4AGPA 2UZYB 3ULVF 3O2VL 3QULB 1K2DB 3CHQA 2EXSA 2CO3A 1UD2A 2FK9A 1FL3B 4LKCA 2IAAC 3TJEH 3ZRFC 3EJYC 2EVHA 1GJWA 4OFYD 1ETZA 1CDGA 3BEVA 5F7HA 4TQHA 2VZOA 4WI0A 1U8KA 3UROR 1AKJB 1CC3A 1DBMH 5LBSL 1A9VA 1CDUA 1WBYB 4G8FB 2ZX5A 4GFXA 5SWZE 3BDYH 4Q14A 4UILL 5KW9L 1MZZA 1R6VA 2E76C 5FCSH 1AQ8A 3RU8L 5F3BB 4JO4L 4EI5B 1F02I 2D2OA 2VLKB 4A7QA 5IMMA 3RIAF 1L4IA 3G3LA 4YIQB 1R34A 1VF5C 4OCRH 3F85A 2EVFA 3ARWA 1K4CA 2W8CA 2XTJE 3MU3A 1BAWA 3LV3A 5FF6A 3QQ9D 2CXKA 2ROYA 1LO0H 2HFEB 5L6YH 1MCIA 3U9UA 1OTUC 2LTQC 1OY3B 4LVEA 3SBWC 4Z7WB 4ZODA 4MS8D 1UWGH 5D70L 4UM8B 4U0RC 2DLFL 4U2ZA 1X7QB 2ADIA 3MBWA 1H9VA 4LESA 1DQQA 1I9JL 2BHFA 5SX5K 4MJIB 5DD5L 2PWDA 4NZ8A 3MX0A 5E1HB 5BUGA 3CPLA 3WN5B 5HYFA 4AH2A 3BT2L 5D7JC 3FF8A 4PV9B 1ODAA 1XH1A 1HQRA 3FQTB 2O5ZL 1T6VN 2WXKA 2Z65C 3ULUE 3VXME 2LLLA 1RIVH 5KVDL 2FO4B 2Z31D 1S9VB 3QDJB 1ITCA 3O3AB 1MI5D 1YEDB 2EE3A 5EU5B 1IM9D 4OBSA 1AZNA 1JGDB 1OAJA 4V2CB 3QYMA 1AXSA 2MH4A 1S8DB 2DYSB 2E74C 4XCCL 2HT2C 3W0WB 4AIXA 3NEXA 4GRMA 3F7QA 3C6LA 5HHMD 3QUZD 3GTTA 2MEJB 1DN0B 4G6FB 2Y6SC 3TVMB 3WMPA 2R7EA 1X9UA 3HZVB 4JQIH 1Y18B 2YXMA 1QNIA 3UBGA 5AAMA 4HULB 4N2HA 4JAMB 4XXDA 1GS6X 1U3NA 1J5OL 4OW6A 1K6QH 4UT9A 1IC7H 3DX6A 4GSQA 2IWEA 2P7TA 3AY2A 2WCPA 4LSPL 5DEGA 5FO7A 1UOWA 4DEPB 2OW7A 5HI5C 3PABA 4G80B 4D94A 3BKMH 4QHLB 1E42A 4ZD3H 3TBYA 2ZKHH 3HFMH 4XC3H 2QGDA 3QW9A 3SPIA 3JV0A 2GSMB 2BFVL 1G7MA 3CZFB 2OCJA 4QDGA 1HC1A 1RZJC 3G5YA 4FQCL 4GXUM 5I17B 1REIA 2HT3C 3MRPB 4XCEA 3K72A 3LKPB 4JFPB 4Z5RA 3LKNA 4ZO6A 4ZTOH 4Z7VF 2BVPA 2A6IB 5HJ3A 5C09B 4D9LL 2PYEA 1OT2A 1KB9K 1KCUH 2NY5C 2VLRE 5IBTL 3BMVA 5HVWA 4XZUA 3MOAH 4U1KB 1N12A 3K6SA 4WGWB 3BOVA 4BK5A 2DYPB 2B15A 4PJBF 4NERA 4PJBB 1OE1A 3KCPA 1EJFA 3ZQWA 5FFOA 3BW9B 1W8NA 4KROD 2DQTL 3MCLH 4DKTA 2BZCA 2WO2B 4ZPVA 5SX5H 4P2RB 8PAZA 4JFFE 4HSAC 3A23A 3KPSD 5DD6A 5KBPA 1PEWA 1YHPA 4I18A 2G3XA 4PHXA 5DJ8B 2G2NA 4FNTA 4HS3B 3WY3A 5DHVB 2HFFA 3LZPA 5JHLL 2WPGA 3RNQB 2FQFA 4XMPL 2AVFA 4LIQL 4FYRA 1J86A 3E1ZA 1T89C 2VKXA 4F1SA 1CXIA 2AXFA 1FA4A 1TZOA 1GPOL 5KVFH 3QG7L 4HUWB 1QFHA 2EDJA 2CCLA 3IN2A 1JK9A 3SPCA 4X5XA 1L9RA 4GP8B 5CZRA 5FW7A 4X6CF 5I82A 1GZPA 3KVPA 4X6CB 2WO3B 1IGIL 4XMKH 1JOIA 2BSEA 3V55A 4HUMB 5MEPB 3B9DA 4N2FA 4BH8B 2A1WL 5DQDH 3L9EA 1LVEA 2XKNA 3CDFA 1OP9A 2F19H 5D6CB 1A6WL 4XPFH 5JPMB 2YD3A 2ZOLA 3G5ZB 1ZWIB 4ZYKA 4WI3A 3RFRA 2MOQA 4PGEB 1ID2A 1ICTA 2E47A 2FT8A 3I9GL 4PSPA 1N6QH 1J1PH 2R0WH 4WW2A 4HS6B 4Y2DB 3ZHLA 1T2QH 1Q9KA 2NY2D 1FZMB 2ROXA 3L3HA 4G1EB 1Z9PA 4A2LA 3ILDA 4OZ4B 5KYUA 4N2MA 1CD8A 3LCYA 3C6LC 5D4HA 2BX5A 1X9QA 4GIOA 5ESVA 2IGFH 3IAPA 3P0VL 4KVNH 4X42A 4XO9A 2IVFC 4KQ4L 1GGBL 3UP6A 3NJNA 4H8WH 3PIQB 5AAMC 3A47A 2CGYA 4YQXL 2BW5A 2KQMA 3CN4A 3I85A 3ZBMA 5LXGL 3N41B 4LSVL 1ZS2A 4LNRA 1BW8A 2UZYA 4Z9KB 4YE0A 3QULA 3QZLA 1K2DA 5T1LB 2MPAL 4XNZB 2NNCA 1FL3A 2K9FB 3F00A 3FQUB 2H1PH 3VD9A 1NEUA 4XPAH 4DGYL 2BHYA 3NP3A 3BIKB 1FGNH 1AKJA 3GHBH 3LEYL 4AVJA 2V4LA 4BSJA 3MV8D 4YSEA 2YAOA 4PRID 5HSFA 1WBYA 4G8FA 3DUUB 4NKOB 1RUML 1YQ2A 5C0RH 2XRAH 2C9XA 4NQTA 5EBWB 2HRPH 3VGAC 5F3BA 1HEZB 1QX1A 4M6NH 5T1KB 4EI5A 2VLKA 1L7TH 4LHUD 3K80A 1E9OB 3K6IA 3ABLB 3MA7B 4YIQA 1JYVA 2WXRA 5DUMH 2AJSH 1USZA 3MLYL 4YBQC 4PJ8B 2BIIA 1U8OB 4XWOD 4EUPB 1PIGA 4BK5C 1ZV5A 3V0DA 1P7QB 1J0IA 3L3OC 4WSJA 3BVUA 4TS6A 4YH6A 2HFEA 5F1KC 4J8QA 1DBBL 4ZPTB 4Z7WA 4XI5C 4UM8A 1UM6L 2XX0A 3HVDA 5DFVC 1S7SB 3S4SB 4ZMPA 1X7QA 4I18C 5CR1A 4YEFA 1MY7A 3E8UL 1HAUA 5JIIA 1GGYA 1ZPLA 2X5PA 3ZIYA 4MJIA 1T0MB 3D25B 3PL6B 4R2GC 3DXAE 3N06B 2DLEA 3AREB 5DGQA 1JI1A 1NCTA 2K0RA 2HVJB 2FJHB 3WN5A 4XNMB 4HF5L 1JXGA 5TF0A 4FZEH 4RGMB 1MCBA 3GHEL 3KE0A 1MWAB 2GI0A 3DJZA 4PV9A 2VDOB 1CF8H 2G2PA 1ZTXH 2RH0A 3FQTA 4BINA 4MTMA 2JCCE 1TZHB 2OV0A 2FO4A 1J88A 1S9VA 3QDJA 3O3AA 4TRPL 1YEDA 3AM8A 5EU5A 4ZK8A 3VYOA 3N42F 3N42B 3QT2A 1JGDA 4K0OA 4HK3N 2FTAA 3BJ91 4IU2B 4MAYD 1S8DA 4UAOB 5AOIA 2ZXQA 3NCBB 5IFHH 3W0WA 3FZUD 5D5MF 5D5MB 1AOHA 4OLUL 5GRYA 1QLEB 3FH5A 4JO2L 1DLFH 2CA4A 1DJWA 3OPZH 4DGVL 2VDPB 3O3UN 2H6UA 3TVMA 2BVTA 1TZGH 5SV3A 2FAUA 4ELMF 3HZVA 4WW2C 1Y18A 3PP4L 4ELMB 1CFBA 2BPBA 4PB0L 2H1XA 4JAMA 1A3LH 5L9DH 1OTSC 4LKXB 4X7CC 3ARVA 3IGFA 3ILEA 1MFUA 4G80A 4QHLA 1TJGL 2VL4A 4URTB 3ARBC 1J8KA 1WHOA 1UFUA 2OMVB 3UAAA 3B5GA 3AWFA 1FH5H 4X9IA 4BZ1H 4HD9A 1BVNP 1SRDA 7CGTA 5KS9E 2O6CA 1F97A 1NMCB 2OL3L 3CZFA 4WY7L 1BHGA 2WP3T 4NPKA 5DEZA 5JO5A 3T09A 1DL7L 1G7LB 3WI9A 4A7UA 5T3XE 5I17A 4RDQF 4G5ZH 4MYPA 2IBZY 5CKGA 1V7NH 1CN4A 3MRPA 3MRLB 4BSWB 1BD2D 1E4KA 2MTPA 1DQTA 3LKPA 4JFPA 1U3HB 2N56A 3ULVC 3QUYB 2J7LA 5GGSY 3TASA 1NUNB 5DHXB 5C09A 4C47A 2N1TE 5F21B 2KT6A 4Q9CA 1OSEA 5L8LB 5JMRA 3ZJAA 1KXQA 4X6DE 1F58H 2CD0A 5LO7A 5CCGE 4HC1L 4N6QA 2XQBL 4G9FB 4U1KA 1RZ8B 4WWKB 2DYPA 2H0JA 4PJBA 2YMXL 4AG4L 2G9KA 2BMKB 1F6AB 4F58H 3BW9A 2C4FT 5IF0A 1JFQL 1UEYA 2ZUTA 5JR1H 1FNEB 4P2RA 2P80A 4PWKA 1NGZB 1UB6B 3D0AA 2BJMH 1ILSA 1A0QL 4UTAL 2BNRD 2QGEA 5EIIB 5EZPA 5DJ8A 4HS3A 5DHVA 4CMMA 2FJUB 4QRQB 3CQFA 5CGYC 2ZICA 3WLWD 2DBLL 2LU5A 1HESA 2VISB 3N2JA 3RNQA 1D5XB 1YUKB 3KYAA 3RZCC 3VXSD 5K9QI 5BS0E 3H7BB 2NY7H 3LXUX 4L05A 2CJUL 1XSJA 2IAMB 5CJOL 3HG1B 1MCRA 4N28A 4JFQB 5CSGA 1KXVA 1SLUA 4HUWA 2A5UA 3OMZA 3NVQA 5T5FH 2OMTB 3TWCH 5AW9B 3U6XA 4X6CA 3T0DA 4TTDD 1RU9L 2VDRB 4H8HA 4UINL 5I74B 5MEPA 4B95C 4JMXA 4W4OA 4BH8A 3AXIA 3L2MA 4NCC1 3WN5C 3ARGD 5K1JA 1JFHA 3X13B 5D6CA 3K4ZA 1PZDA 2NSXA 5JPMA 3G5ZA 1ZMYA 3CLFH 1ZWIA 3HRZB 3VI3B 2DYRB 4Y5XB 1QNZL 1GKEA 3Q8AA 3ARQA 4PGEA 4X5QA 2YD9A 4HS6A 4Y2DA 4QGTA 4J28A 1P0SE 2RA1A 3GK8L 3OJDB 3MLPA 5G55A 3WUWB 1DFBH 2J55A 1FZMA 3NA9L 4G1EA 4OVUA 4OQTA 3P3TA 4OZ4A 1MW0A 3DYMA 2MJWA 3LS4H 2ICEB 3S88L 3NH7H 2E9WA 4DFIA 4J1UB 2F7RA 3TVMC 2M8XA 1DANU 4XNXH 3VCLB 5B3JF 1KENH 3PIQA 4KI1A 1KF9B 3DPDA 3Q8CA 2DQUH 3U2IA 1MCJA 1JZDC 1QBML 1QPPA 2XYBA 5D7HA 5DWPA 1SMDA 1G5GA 1S5IL 1WVZA 3WNOA 5INDB 1RUQL 2AERT 6PAZA 4DEPC 3JV6B 4Z1PA 5EA0H 1YSOA 3O6FC 5T1LA 4OD3H 3V0EA 4M03A 3O0RH 1S7XB 1E8XA 5TF1L 2CLZB 5ADPL 1JZ5A 1WLHA 3FQUA 4Z95H 5KUMA 4G82A 3ATBA 2QVFB 3EF4A 1M42A 4RAVB 2WUCL 2FEEL 3BIKA 4BA8A 4HT1L 3H8NA 5BUAA 1SEQL 3RVTD 4HZAA 4FABH 1YPZB 3LIZL 3JV5A 3O8XD 3MKGA 4NKOA 3DUUA 5FR3A 1MFNA 1SXBA 5EBWA 3VWJA 4PVMA 1G0DA 2E75C 4ADGA 3TEZA 1HEZA 1A5FH 5T1KA 3ZE1B 2AF2A 2BY0A 3Q3GB 1HCYA 5GGRY 2Y06H 3ATAA 3D4CA 2PR4L 4HFWB 2DRUA 1E9OA 3MA7A 3NGBC 3AZUA 1M9WA 4EUPA 4PJ8A 6FABH 1U8OA 2ZUUA 1LTXA 4JJOA 3K2UL 2X1PA 3RIFF 5A2BA 5JNYB 1Z9NA 2WM0A 2P5EB 1E6JL 1P7QA 3BWUF 3NIDB 1E27B 3LHPL 2C9VA 3JWNC 2XV6B 3Q43A 3TONA 4GJTB 1VGKB 5ANME 2XG5B 1EEQA 4ZPTA 5T1DH 1S7VB 4OF0A 5FKAB 2W9DL 5D7LB 3S4SA 1H3XA 3IBEA 1S7SA 3IFPB 4ZMNA 4AY0A 3V52L 2CR0A 1YEHL 2Y7MA 4LPWA 3UZVB 3VH8B 3X3GH 3R0NA 3D25A 3W11D 3PL6A 4WF7A 1VENA 3AREA 5I18L 1LMKA 3DV4B 1NBQA 1RZKC 1ZVNA 4AGQA 2HVJA 4QXTB 4ZUTB 2FJHA 5F9JB 4LLYB 4XNMA 1N5YH 35C8L 1JVKA 2QPFA 1MWAA 2IXQB 4W9ZA 4XMTA 4AVIA 1KLGB 2GEQA 1CICD 3HHMA 2V17L 5EMYA 1KJMB 1TZHA 2VXQL 5IJDC 3HPLB 4XVTH 1MREH 1T7VA 3UTPE 3PRZA 1MFBL 4IU2A 2AJYL 5D1XE 3AXHA 4OCSH 1BEYH 3KYNB 5JPMC 5D5MA 1JZIA 2BWQA 5CR8A 5BW7A 3D7PA 1TJIL 2HX7A 4KUZL 2ZYSA 5T33L 4ELMA 4QUOA 3CCHB 1SDAB 1KBPA 2XXFA 3NPZB 4ZZFA 3EDFA 2QKIB 2G4EA 2ADGB 5C0BE 2C7UB 4LKXA 3S8FB 3JQOB 1IZKA 3H3KA 3QP3A 5EU6E 3ZTJH 1TXKA 2WAHA 3FPYA 2F5BH 2F53D 2OJZH 5ABAA 5JDSB 3ZE2F 3VXNB 3UC2A 3WELA 3US0A 2J5LC 2ZKMX 2HA1A 1EHXA 1SF5A 1U2YA 4GEJA 1OALA 2WQSA 4C54A 1G7LA 3H85A 1EDHA 1M2OA 1BPLB 1UM4L 4BSWA 2DBJA 3MRLA 4D9RE 3RHWK 3UJJL 2QFRA 1BFVL 3WFBH 1E8ZA 3UPRB 1BYPA 1U3HA 3KJ4C 2H2SD 4AMKL 1XGZA 4QY8B 3QUYA 4WGKA 3KR3L 3CHOA 2P5WD 5E7FA 1O9WA 4FDWA 3M6DA 3OZLA 3TH3T 2MMXA 1O9ZA 1Q72L 4ICXA 3CHRA 4I9XA 1FSKB 2NZ1A 3UZEA 4WWID 4G9FA 4NJAL 2XWXA 1ZLEA 2WBJC 5DMJB 2HAZA 1RZ8A 4WWKA 5KBLA 4NAMA 2R1YB 4L0YA 4PJGF 3MLUL 2BMKA 3KZ8A 4PJGB 1F6AA 1S7QB 1LWJA 4MNGE 3BRGC 3JYBA 3VWJC 1ASQA 5EBLB 3MXVL 1GC1L 4MCMA 4ZS7H 1K4DB 4DP0X 1FNEA 2MWCA 3DVNB 5BOPA 3G6DH 2EDWA 1UB6A 5EIIA 1KN2H 4MBOA 1UEMA 3V6OA 1Y6KR 4AW4A 1HHJB 4NT6B 1T03L 2R4RH 1CDHA 4PJ8C 4QRQA 3KXFB 4DPRA 4J4PD 2VISA 1WE5A 2AI0H 1HCZA 1D5XA 4OZFB 5IROD 3IT8D 3DX3A 3H7BA 5HHPB 3FKUS 2X6AA 3AAZB 4UT9H 5EUOF 4EKXA 2IAMA 1LNUB 2EDFA 2DJUA 2FQGA 3HG1A 4FNSA 2AABL 3KL5A 3OAYK 4JFQA 3GZQA 1YNTB 3EJTA 3GSRB 3NSFA 3TA3D 4ZMWA 5EEVA 4KJPD 2D7OA 4F33B 1PVHA 3MLZH 4JFZL 3WFEH 1WBXB 3C60D 5FUCC 2UZIL 4HOMA 15C8L 3SDCD 2OMTA 2Y6TE 4F15C 3VNYA 2J8OA 2X10A 1X5GA 4AEFA 1W80A 2YRPA 3Q6GH 2Y36H 1UYWL 3AREC 4P5RA 5KG9B 1OLLA 2A77H 4BHUA 2D3JA 3NJHA 4GAJH 3X13A 4FFYA 2VC2L 4OM1L 5HI4C 1GYWA 5AVYB 2WXNA 2VXTL 1LK2B 5D9SB 3IGUA 3OKYA 5HI3C 1BGXH 3HRZA 3JWDH 3VB8A 2Z0UA 3RI5F 2NY0D 2JXMB 1J5IA 2D0HA 4FQXB 4K9EC 1U21A 2PCPB 1E2VA 3ZZLA 3T2LA 1R17A 2Z92B 1MAKA 4Y4HC 1J48A 3OJDA 3WUWA 2AEQH 5EU4B 3FFCE 1D7DA 4BFKA 3CN3A 5H37A 2VL5B 5EN3A 1TZAA 4QRPE 5CLXA 1M1SA 2D7TH 4MMXB 1WUNT 2ICEA 4DZBB 3ZTNH 1X5XA 5BW7C 2FWLB 4KUCD 4X6BB 4J1UA 5HHNB 4KTYA 1S9WB 1KGJA 4YDKL 3I3DA 3JVFC 3MRKB 4FYTA 3WKQA 3W2DL 3BKYL 4K3GA 4KZ0A 2HJFB 4I87A 5F2FA 3QHFL 5LGYA 4XAWH 4KQ0A 2V6HA 5GZNA 3JV6A 4M93B 1NOAA 3GPEA 3NCJH 4GSXA 2CA3A 4JB9L 1MJ7H 4WAFA 3ZRSA 4AZ8B 1QWUA 1S7XA 3FOLB 1VZGA 3UTTA 5H4YA 2CLZA 3ECVA 5C92A 3RIAK 2XN9B 2AJVL 2V7HB 3FN0H 4NQUA 4HS8L 2ZIDA 3HR5B 4FMFA 4CAGA 4RAVA 4XC1L 1F41A 4KJQD 2XTJD 3N40F 3HAEH 3QA3B 3RLSA 1KJ3L 2Y24A 3MV7E 1J9TA 1YPZA 4IRZH 3BZ5A 1RUKL 3VE0B 4YDMA 5TGBB 2VW7A 3CN0A 3I75B 5B38G 1Z2KA 3VFSB 4FXLA 1RUPL 1KN4H 4HAGA 3N85H 3HE6D 3Q3GA 1QYGL 3BD5A 1R47A 3UZEC 4G6AC 4FLHA 3QDME 4OF5A 1GIGL 3L3JB 4M1DL 3B8YA 3OAYH 1YJDC 5FM4A 4MYWB 5JNYA 2QPUA 2EEXA 2P5EA 1KJ2H 4TQPA 1U8NB 4KY2A 4MB5A 2X2UA 1VGKA 2XZCL 2XG5A 1S7VA 1FN4B 1CR9H 2FH8A 5FKAA 1JDDA 1S3RA 1W6LA 1E2WA 1WWBX 1XCXA 3KBFA 5DO2D 3IFPA 3VXMD 4QJ4B 2JLLA 4ONFH 3DV6B 4CN1A 1J9SA 4KMTL 3VFWB 4J8RB 3P54A 3HG4A 5D71L 3UZVA 3VH8A 4R5VA 1AQKL 4WU5B 2BVEA 3DV4A 4TV3A 4QXTA 2BXYA 4ZUTA 5F9JA 4LLYA 4ZMYA 5ES4B 1LMIA 4PM1A 1ZS8B 4MD5B 1PYWB 2IXQA 5IG7B 4K7FB 3VRLE 5IQ7L 3EH5B 5LNGA 1KLGA 3QUXC 1VZHA 1KJMA 1TZ8A 5DZAA 3QARA 3CVDA 3ARUA 5F9AC 2AV7B 3HPLA 4E42B 2E7CA 2XN0A 2ED7A 3QNXB 5IVXF 1U58B 3KBPA 3OQRA 1ORQB 3PE9A 4NGHH 4P3CL 5IM7B 1TQBB 1ZIBA 4H0LC 2YXWA 2N0MA 2VB5A 4LBAA 3KYNA 1N4XL 4PCKA 4QXGL 2ZG1A 4RFEB 3HRZC 4O9HH 4XVSL 5JLZB 4GG6F 3C87A 4G2AA 4GG6B 2HKHH 4R4FH 1CGVA 3OJMB 3UDWA 3I9IA 1M3JA 2VN3A 1DVUA 2WP3O 4F20A 5C2BL 1E6OL 4L9DA 2QKIA 3UJIL 3VWKD 2ADGA 3FT3A 1ZA3B 3KLKA 1FFTB 2C7UA 2AS5M 1QPKA 3KPQB 1Z9OA 4D3CH 1OAXH 4XBGB 1NM9A 4NZDA 2F54B 2ICEC 5I15L 3RJOA 5JDSA 2X6CA 3UAFA 3GM0A 3VXNA 4J3BA 4BQBA 2L04A 1GHFH 5IFAL 3RGBA 4PJ9D 3RKPA 1OHQA 4ZMXA 4CU8A 1JCKA 1ZT4B 2WVUA 4LVHC 1QA9B 3N3EA 4DPBX 3L45A 4ZUSB 1E8WA 1QSEE 5AKSA 3V5DB 2Y5EA 3DGGB 4IDJH 3UPRA 1DSWA 1DBAH 3F8UB 4QRUB 4QY8A 1X44A 5I1DB 4FXTA 3RVUD 1EFXB 2A9NL 2X3AA 3FN9A 2VN7A 1NGWB 4JFFD 5JMOC 1UZGA 5J1AB 4L4VE 4LSSL 1CQYA 1IC0A 1IKFL 2GEEA 1N18A 2RFXB 3SGKC 1NCWH 3QIUD 2JB5L 5TQ2H 4ZXBC 3HUJE 4C56D 3G9AB 2R1YA 3B9EA 1CGSL 1X5ZA 1SOQA 3W39B 4PJGA 1S7QA 5EBLA 1Q1PA 3V7MA 1K4DA 3ISWA 5IZ7A 3DVNA 4P4KD 2JKXA 1IBGL 1HHJA 4NT6A 2X6VA 4P5TD 3KXFA 2F8IA 3EYOB 3K3QA 4M3JA 4C4UA 3IMWA 1BV8A 2Y1AA 4OZFA 2DH3A 2ZYHA 1CO1A 5HHPA 4HV8B 4JG0L 3BWUC 3AAZA 2D3NA 2ZONA 4OIFA 3CUPB 4I89A 1LNUA 3V4PB 1TTUA 1YNTA 3GSRA 1KCSH 1MCSA 2XOTA 2PO6B 3B43A 3HMWH 4BIKA 3BN3B 4F33A 3N1QC 2XIIA 1WBXA 1FIGL 3CDYA 1F4XH 2VJ8A 2QQKH 3RB5A 2FQEA 1G9MH 5AOKA 1QLRB 2R39A 1DTUA 4QXUL 4U6XB 3UC0H 2VR8A 5ECGA 5KG9A 5I26A 2AXHA 3EH3B 1DJZA 3BO8B 3NSYA 1UTDA 2NMSA 3MBED 4H88H 2EAEA 2AEOA 3BUDA 3O6KH 1Z7JA 4E0RB 3IDGB 1LK2A 5D9SA 3KL0A 5F9OH 4WKXA 1ZLVK 5FIEA 4JFOB 3FXIC 2OMXB 2W92A 2JXMA 4M1GH 3MV11 4FQXA 4DKDC 2XZAH 5C6WH 2PCPA 3V6BR 3EJRA 2Z92A 1S78C 4JREB 4S1QH 3T3ME 4HEMA 5EU4A 5AVXB 5CFHA 1VCAA 4Z77B 2E27H 5EEZA 2VL5A 3LKRB 4PJIE 5IP4A 1FNGB 3CJJA 4QT5B 1IU1A 3FTZA 4HSQA 4MMXA 4DZBA 4X6BA 4NX0A 3U79A 1S9WA 3IS1X 4XWGL 3MRKA 4PCSA 2EDHA 2BRRL 4M4PA 4FQ2L 5BQDA 4M56A 4XX1E 2OM5A 1AJ7L 2HJFA 3MN8A 4JLRB 1YC8A 4MWFB 3X1EA 2X88A 5A6MA 3THMH 3VGFA 2BSRB 5DHVH 4I3RL 5BVPL 3LZFH 5I1KL 2LVCA 3CFTA 1U41A 4LDOB 4AZ8A 1EGJA 3FOLA 2WKLA 2O6DA 4QCIB 1PJWA 2XN9A 1WWCA 2V7HA 4DZ8B 3HR5A 3SDAD 4C55A 3QBTB 2IOMA 4PPTA 1FNLA 2R69H 4MZIA 3HNTH 1J0JA 3QFDB 2QEJA 4Y7OC 3NZSA 4GMTH 1MNNA 3QA3A 4GAYB 4AJVA 5KBDA 1HEHC 1PIFA 4BWWA 2J43A 1BQHG 2CR6A 4JFXB 3VE0A 1NAMB 5TGBA 3TNMB 2VT0A 2V5YA 3RVVC 2HKAA 3AQXA 3I75A 4NAJA 3VFSA 3OWRA 2WZPD 3KLDA 2AMUA 2JQMA 4P2OB 2F5AL 2O61B 3IRCA 2FIRT 3FCBA 3TEUA 5I1GL 4K2UL 4WTQA 3L3JA 3DXAD 5CFAA 4FTVB 4BHUI 4WHCA 1LDPL 1TPXB 5E2UL 2DMGA 3K8LA 5HDOA 3G08B 1U8NA 2Z7WA 1FRGH 1G87A 1RIHH 3I50L 3I6LE 3LX9A 1D5RA 2F74B 5T5NG 1FN4A 4J3VA 1HU8A 3QUGA 4CILA 1KWGA 3BP7B 4NQCB 1QACA 3ILPB 3LKOB 3D69B 3DV6A 3Q0HA 3VFWA 4J8RA 3TTSA 4F2EA 2J21A 2G0LA 1IAOB 2J88L 3NK3A 4AV5A 4WU5A 1IGTA 2FEDD 1ZLVH 2X4PB 4IGBD 3HMXL 3KD4A 3SO3B 2HB0A 4BUQA 1ZS8A 4JO8A 4MD5A 1PYWA 4EQ2A 5IG7A 2DMCA 4K7FA 5IJCC 4GW5B 3AW5A 4J39A 3QIWC 4N8VB 1F45A 3NFSL 1CB4A 1RMFH 4UMSA 2AV7A 4E42A 3QNXA 2X7LB 3TO4D 1U58A 1KXHA 3UGXA 3PAZA 1ORQA 3U2SB 2VQ1B 4WNJA 4MMZB 5IM7A 2EEFA 1JI2A 2AANA 2HX8A 2WN2A 3FHAA 4LSRL 4XHQA 4A66A 4DQOL 3RDTB 1OD7A 2ATPA 2FUTA 4PJDF 4Q56A 5DUJA 2DDQH 3S35X 4BFBD 5B39B 5EF3A 3VDAA 4RFEA 1PG7X 1ASOA 2BDNH 3QPKA 5GGRB 4CC4A 5I30L 4XODA 5JLZA 4GG6A 1B88A 1TYEB 4AIOA 2YBGA 5AKVA 4GQ9L 1NKOA 5T3XD 3LMJH 3V7AE 1BYNA 4IMLB 1LP9E 3WNNA 1ZA3A 1OGPA 3S3CB 4ISVB 5T3XL 3Q01A 1IC4L 3Q9PA 5GPRA 2R0ZL 2DKMA 3N50A 1KCBA 3INOA 3KPQA 1SDYA 5GGVL 1NEZB 3NDYE 1M7IB 4XBGA 5FOBB 4MMXC 2F54A 3CFUA 1U36A 1CE6B 2IG2H 1NCAH 3VXQB 2XETA 2XA8H 4W68A 2VSCA 3G5VB 1BM7A 3SDDC 1ZT4A 1XF4B 3DURA 1QA9A 1SOSA 2EZ0C 2CWRA 4ZUSA 2Z34A 3DDGA 3V5DA 4HJ0D 3DGGA 4BFGA 4QRUA 5I1DA 3EDDA 3O9WB 3GRWA 1EFXA 1NGWA 3CHXA 3VMNA 1J12A 3FQ1A 3F58H 5J1AA 2YKLL 4N0YL 1MWAH 1HXMB 2FJFB 3HN5A 4TSBH 2VDOH 2RFXA 4A55A 2ATKB 4PI2A 4RBPK 3AS3A 5TK2A 3QE5A 2R2EB 1CJYA 5DJYB 4AYID 3ORJA 5BS0D 2HLFD 5EH1A 2J25A 3RL1B 2YLHA 4PB9L 4QPEA 3GS4A 3W39A 4G7VL 2GSIB 4K8RC 5EOCL 2XDHA 3CVHH 2HKFH 5B1AB 1LO0L 5L6YL 4K94C 3V0VB 1QLEH 3L7FB 3HC2A 2VDPH 2O4EA 1KTLB 3EYOA 3DHMA 3SN6N 2FT6A 1KFAH 1RPQA 4A7VA 4HV8A 3H1ZA 1LO3L 1ZLUK 1UZ8B 2QT6A 4MNQE 4R26L 3CUPA 3TFKD 3BUBA 4RX4A 3OHXA 3V4PA 5BUPA 3V0JA 4WHYH 4YHLL 2PO6A 2M83A 4AYDC 5E6IC 3ZUCA 1NGPH 3H9SE 1SUJA 1NCCH 3H42H 2AK4B 1QLRA 4PWFA 2ARJQ 4U6XA 5CJXA 3B2MA 3QORD 1HNFA 1RURL 5EF1A 2IO5A 2GT9B 3S3DB 3Q2LA 3BO8A 3HZ3A 3QI9D 4X9GA 3MRRB 3BWAB 1UJTA 3RL2B 1ZJBA 2W60B 4R7NB 5FYKE 2JJSA 1JGLH 4MSWB 3RWFB 4E0RA 3IDGA 4XCFH 1GAFH 1KZYA 3D12B 2QKSA 3KS0H 3ZN6A 4R84A 4JFOA 1E28B 3RA7H 3ARFB 2OMXA 1TJHH 1JNJA 3OX8B 4CJ0A 2ZX7A 5A7BA 1T4KB 4H0HB 4EIBA 4FQJL 2DD8H 1PD6A 4UM9D 1FE8H 3DO3A 2ENQA 2EE2A 2VMFA 3D9AL 1TQBC 4PS4L 4Z77A 4WEEA 1C5CH 3LKRA 3SD5A 5AB2A 1FNGA 5IGXH 3GSXA 3HS0B 3QEQD 4QT5A 3ZDWA 3IPBA 3BKML 1QFWI 2QELA 4ZD3L 3T0EC 4B9ZA 3WTUA 2HYMA 1L6PA 5AW6B 4WJ5B 3HFML 1ZGLB 4JLRA 4MWFA 3HZYB 1VKXB 2FYYB 4JPQA 2BSRA 4HOZA 3S5LB 1XHHA 1Y6MR 4MASA 4EZLA 1X9RA 1YEJL 5F0PB 2EYSB 4RBPH 2B39A 4UIMB 4AL8L 4BKSC 4GBXD 4QCIA 4XBPB 3UJTL 1T6BX 1T0NB 4IYKA 4DZ8A 3RZWA 2BVUA 1SM3H 1JPSH 3QFDA 3RIFK 1JVLA 1JIBA 1G0XA 1HHIB 1TO4A 4GAYA 4HGKC 2OYLA 3WYRA 5LQBL 2WV3A 5CJQH 4JFXA 1YEFH 1NAMA 3KHOA 1N5AB 5EC1B 2OZ4L 2VDRH 4L3EB 5DD1L 3TNMA 4JRXD 1U93B 1OARH 3L4CA 2EIZB 4QRSB 2G5UA 3CE1A 2Z31B 2B20A 5KBKA 4J3OH 4J3XA 4P2OA 1MI5B 3DTUB 2O61A 4BEIA 4P5KB 1IM9B 4M48L 1IGFL 2B1AH 1KTCA 1JERA 1UXSB 4LEXL 2CJ3A 1GGUA 1NPUA 2JKLA 4FTVA 4PJXB 1N0XL 1OSYA 4ZRGA 3L5XH 5G4OA 5I75B 4TSAL 5AB0A 2AJUH 2X0WA 3DSNB 3LQAC 3G08A 3QUZB 2M1KA 1HDMB 3JXAA 4IJTA 5E6ZA 5HHMB 5I5JA 3W9DB 1DQIA 2F74A 4L8BB 1ZXQA 3VSVA 1A7NL 5H37H 2PKDA 3BP7A 4NQCA 1EHLH 3ILPA 3ZT6A 3LKOA 3D69A 2DM7A 3SPJA 5KVFL 1G9NC 3DETC 3DMMC 4LASL 1IAOA 2R83A 4AZUA 1FCGA 5D1XD 2X4PA 5JIQA 4XMKL 2CIIB 3E3QE 5DLLA 4UZUA 2BCKB 4IOIB 3OHXC 1BXUA 5M7QA 3ZDXB 5D2NC 1L9SA 5DQDL 2CDFB 4GS7B 4KRLB 1HXKA 2PO6C 1EZVX 4GW5A 4I3GA 4N8VA 3SGDH 5F93C 4EBQH 2HX9A 2E7LA 1NMBH 1TEFA 1JZ7A 1PZ3A 3BUPA 1B2WL 5F6IB 4M7ZC 4Z7UB 5CJXC 2X7LA 3KW7A 5GS1C 5C0BD 2QV4A 1N6QL 1UUSA 1J1PL 3ARDC 2Y1VA 3U2SA 2VQ1A 5EU6D 5TD4A 4MMZA 1MRCL 5ALBH 3GI9H 5HDBB 1VADB 2C3WA 1MCKA 2JJSC 3CFEB 2G9HB 2WQWA 4P23C 3RDTA 4DKEH 5B39A 1NC4D 4HIIB 3N9GH 1SZNA 3EFDH 1YY9C 1IJNA 5GGRA 2W0KA 5E8PB 2ESVE 2R27A 4JQVC 3ZPDA 2RCSL 1GS8A 1MCDA 4KVNL 2E56A 1L7IL 3K81A 4KROB 5KTEH 2Y9RT 4IMLA 5FB8B 3P9LB 4ISVA 5I1IH 1Q0XH 3PHSA 1KSRA 1QBAA 3P4LA 3HE7D 1NEZA 3KPSB 1M7IA 5FOBA 1DZ0A 1CE6A 3BLKA 2ORBH 3LPWA 2OSXA 1GGTA 4HWBA 1SY6L 3NSJA 4PLJC 3VXQA 4PJCF 2GJ6D 3G5VA 5I8EB 1I1AC 4HIXL 4HXBH 1XF4A 2H1PL 3FPXA 4KDTC 5J11C 1CIUA 1U8JB 3BGFB 3ETBF 5TK4A 5AVRB 1NAKH 1X7TA 3C08L 5DVLA 1JAEA 3O9WA 3VD2A 4D7PA 3ZTJG 3JT2A 1URZA 4DF9A 3T2NH 3TP4A 3QXWA 3O3EB 1HXMA 2FJFA 4FZ8H 1XEDA 4YEEA 4F7PB 2FD6H 2ATKA 5ESQB 2J44A 5DJYA 2R2EA 3GXNA 4R7VA 3RL1A 4OSUH 4GSRA 3QHZH 4KKBD 5DMGD 3RUGE 2OXHB 2GSIA 4EI0A 4F7KA 2ADYA 4ETYA 4PCYA 5AFAA 1VA9A 4NPYA 4IMKC 1WZAA 2XCMC 1JGUH 4XT1C 1YN7B 2N7AA 3I3EA 4NHCH 3L7FA 3V0VA 1DDTA 2NY2B 1B9ZA 2BXZA 5JOFB 1KTLA 4JCMA 5E6RB 1TPXC 1UWXK 3U6RB 4BV1A 1WO2A 2WXHA 2MCPH 3B83A 3TBCA 3GKWL 1SXZA 3S98A 1EVUA 1YEGH 1UZ8A 4JGUA 4HPYL 2VR3A 3KPLB 1USQA 1QBBA 3RI5K 2WSDA 2CNYA 3EOTL 4TNVF 3KGTA 2WLMA 1IBHA 1XH2A 4LVOB 4AGMA 1CLVA 4TSCH 3BPOB 3HHRB 1NGXB 2AK4A 3T6VA 3FFCD 5DA4A 4K9JA 4EI6B 1CL7L 2CGRL 2GT9A 3EDJA 4O51B 4QRPD 3HPJB 2MQCA 3BSGA 3MRRA 3BWAA 3RL2A 3RWFA 1E5UI 2W60A 4OFYA 4R7NA 4CBPA 5KYXB 4MSWA 4YLBA 4F9LA 1XO8A 5LBSA 4PFEA 1RAMA 3I74A 3QDGE 2LGNA 5L88H 1E28A 3ARFA 4CGUB 1B4LA 2WN3A 3MV8B 3OX8A 1AC6A 3HBQA 3OPZL 1Q9WB 1T4KA 1P1ZB 1MFEH 4PRIB 1VACB 1JE6A 5IHWA 3BRFA 1WT5A 4GAGL 5AVUB 5J5EA 1AZZC 1TZGL 5MERB 5IWLA 3Q2CA 1O75A 3M8OH 4MMZC 1B4TA 3MNVB 4GPVA 5FYLH 4JUTA 3IVKB 1A3LL 1DQKA 3RDTC 3OKMB 4EQ3A 3HS0A 4LHUB 5LWYH 4G9DB 4UV7H 2CCVA 2XWTB 1GSMA 5TE6L 2I32A 4WJ5A 5F72S 1ZGLA 3HZYA 1VKXA 1AS8A 2B0SL 1P84K 1BXAA 5AB9A 3AB0C 1TSHA 4ODBD 3S5LA 3MFFB 2X70B 4BSVB 3GC3A 1R3LB 7TAAA 5F1OB 3AG4B 2OR7A 1V7NL 2NYYC 2EYSA 4UIMA 3D07A 4OCWL 4XBPA 5CHNB 1XMWA 1T0NA 4F9PA 3QDMD 4Y4FB 2DOCA 4DSYA 5JXEC 4AYEC 5IUCA 5AW5B 4MCYB 1HHIA 3LYRA 1VFUA 3FSZA 2ZUQB 1F58L 4UB0L 1AGEB 5A2FA 3RIKA 4KRPD 1N5AA 4Q52A 5EC1A 4LFHG 1RZ7L 1EWHA 3DJRA 3PAVA 4KKRA 2JI3A 1U93A 2DTML 4L3EA 5E1GA 4WSKA 1INEH 4QRSA 2EIZA 3LKSB 5HY9B 2NT1A 4GYBA 2Z31A 2CDEB 1ZVYA 3QJQB 1MI5A 3V5KB 4P5KA 3HC0B 1IM9A 1VIWA 2HVKB 2Q2EB 4Z7NF 4Z7NB 5K93A 3P3SA 2VZVA 4MAYB 1UXSA 3QRGH 3NJVA 3HAEG 4PJXA 5BOZG 1P84J 4HGWB 4IKNA 2AXWA 4XR8C 2GJRA 3E2HB 4HALA 5KUKA 5BZDB 4TF4A 1G0YR 3DSNA 5B7EA 3QUZA 1HDMA 3BUTA 3W9DA 2FCBA 4L8BA 1N9PA 2JE8A 1P69B 4E9RA 4GH7B 5BMFH 4ERSL 3MFGB 2KKQA 3NSXA 5D4JA 2IBBA 1CLOH 4PJ6A 3NJMA 1XGYH 3NCEB 5EF2A 3MLXL 1R3KB 1VHPA 3OAWA 5CINL 2X89D 5AOMA 5AW7B 3HLAB 4OBRA 1A4KB 2OL3B 3TWCL 3HS9A 4XP4H 4WTZA 4UZGA 5B1CA 5MP6H 2A0LC 4FFZL 1F3DH 2BCKA 4IOIA 4LBEB 4NOBA 1EAPB 1NANI 3MHZA