3X1SA

Crystal structure of the nucleosome core particle
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 28
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1sA00
1P3AB 1AOIC 3VH5A 1WWIA 3W96D 3AV1B 1P3FB 2IO5B 2YFWA 3W96C 1M18A 5F99D 1ID3B 1P3KD 4QLCD 5B2JB 3UT9B 1P3GC 4YM6B 3KXBA 3B0CT 5G49A 3TU4A 2LY8A 4H9OA 1M18C 4XZQD 3O62D 4ZUXA 1P3BB 3X1VD 4KUDA 3O62C 3MVDC 3LZ1A 5AY8C 3AZMD 5B1LC 1BH9A 5C3IB 4DRAA 5GT0C 3W98C 1P3GD 5B24A 4QLCC 3WTPD 5JA4B 4WNNA 3AZHB 1P3KC 5CPIB 3NQUB 2BYMB 5AVBC 3WAAB 2NZDA 3MGPD 4CAYA 3UTAA 2L5AA 5B33A 3X1SB 5B33D 5B0ZD 4NE3A 5AV6B 1P34D 3REKC 2HIOC 3REKD 5GSUB 5B24D 4KHAA 3MGRB 3REHC 1EQZB 4H9PA 1P3MD 3MGPC 5B32A 4J8UB 5AVBA 4QLCA 4H9RA 5BNXA 5E5AC 5GT3D 4Z66B 3VH5T 5JRGC 3MGQB 3B6FB 3AZFA 3W97B 5B31D 3TU4D 5BT1D 5AY8D 4J8VA 3RELC 1P3IB 2CV5D 5AV5B 3LZ0B 5GXQD 4Z5TD 2NQBB 5F99A 2RVQD 5AV8D 4XZQC 5B0ZA 1TZYD 3AV2B 3MGSB 5AVCB 3TU4C 3W99C 3KUYA 4J8XB 1F66A 1BH8B 3UTBD 4H9SC 4LD9A 5BO0A 1HQ3A 5AV9D 3A6ND 3REJC 1P3FD 3AN2D 4WU9D 5F99C 4G92C 1N1JB 4G92B 4H9NA 5B2JD 4J8VC 2NZDC 3AZJB 2F8NB 1R4VA 1P3KA 4E45A 3REIA 1KX3A 5B2ID 1TZYC 1P34C 1P3BD 3LJAB 1B6WA 3AZJA 3AZNB 2CV5C 5BT1C 5CPID 3W98D 5GT0D 1BH8A 1HTAA 5B1LD 1F66B 4WU9A 3MGSA 1HQ3D 4H9QB 5AV9A 3A6NA 3B0CW 2AROC 5B0ZB 3R45A 5B24C 3AZKB 3LELB 5CPJB 2HIOD 1EQZD 2PYOA 4YS3B 5AY8A 4J8VD 4J8UD 3X1UB 1M1AC 5AVBB 3AZGA 3WTPE 4Z66D 4WU9C 5AV9C 3A6NC 3REJD 4KGCD 3W99B 4H9PB 1KX5D 2CV5B 1S32A 3AZMC 1H3OB 3MVDB 1A7WA 5AV5D 3LZ0D 3B6GD 2NQBD 3AZGC 1TZYB 3VH5W 5AVCD 3RELD 1P34A 4J8XD 3AZFC 1TZYA 5CPIA 4XUJC 1S32D 4WNNB 3WAAA 2NZDB 1ID3C 1H3OA 3MVDA 4WU8D 3O62A 3AZJD 5DNNB 1AOID 3KWQD 3AZLC 3MGRC 4UUZB 1P3MC 4EO5B 3REHD 3AZMA 3MGSC 3LZ1D 1JFIA 4H9OB 4E44A 3X1UA 3LJAD 3X1SC 2AROB 4XZQA 5B0ZC 3AZND 4G91B 5B33C 3W96A 4J8WC 4HGAC 2PYOB 3B0DC 5CPJA 5DNMA 1KX4D 3LELA 5CPKB 3AZKA 3AV1A 3W98B 5B1MB 3UTBA 1F66D 5B0YA 1U35D 3WKJD 5DNMC 5B32C 4Z5TA 1M19D 4ZUXC 3X1VC 5B0YB 4KUDC 3AZKD 5CPJD 5GSUC 5B1MA 4J8WA 4YS3D 5CPKA 3UT9C 1BFMA 5DNMB 4WV4B 4CSRB 5GT3A 1KX3D 3LJAA 3W96B 3UTAC 5CP6C 4JJND 5B1MC 3REJB 1P3OD 1P3KB 1P3OA 4YM6D 2F8NG 2F8NA 3AFAA 5B40C 4H9NB 3C1CD 4UUZA 3KUYD 3O62B 3AZED 5BO0B 4LD9B 3KWQA 5AVCA 3AV2A 4AWLC 3W97C 5CP6A 5KDMB 5DNNC 3KXBC 4WZSB 3AYWC 3WAAD 1P3IA 2IO5C 3AYWB 3W97A 3AZFB 1KX4A 2CV5A 3REHB 2CWEA 4Z66A 1ZLAC 2FJ7C 5AV6D 3KSYA 4H9RB 3VH6T 3MNND 5B0YC 3X1TD 3WA9C 5B32B 3AZGB 1KX5A 1EQZA 4R8PD 1KX4B 1P3PD 3AZHC 3AZIC 3AZIB 1P3PC 5CP6D 3MGQD 3B6FD 3X1SA 3B0DB 4X23D 4CAYB 3UTAB 3R45B 3NQJA 3WKJB 2HIOA 1P3ID 5B0YD 3X1TC 3AV2D 1M19C 1ZLAB 5DNMD 3AFAD 5GT0A 1B67A 3AN2B 3AV1C 1P3OB 5G49B 1P3LC 4Z2MG 1P3AC 3C1BD 1KU5A 2F8ND 5B2JA 4J8WD 3AZNC 4CSRA 4H9SA 4LD9C 3KUYC 3AZEB 4NE5A 4LD9D 1N1JA 3VH6A 1U35A 5B40B 2FJ7D 2JSSA 1P3AD 4J8XA 2HUEB 3C1BC 5GXQA 4JJNC 1P3LD 5FUGA 1P3LA 3REIC 5F99B 3AYWD 1ID3D 3W98A 3LZ0A 3UT9D 5B31A 4YS3C 3AFAC 4XUJB 4J8XC 3LELC 3MNNB 1TAFA 3LELD 2AROA 4XZQB 3MGQA 5BNXB 3AZGD 3X1VB 5BNVB 5B32G 1U35C 4R8PB 1JFIB 1P3IC 3AZMB 3REID 3X1UD 4KGCC 5DNNA 5JRGB 3MGQC 3MGRA 3AZID 5E5AB 3AZHD 5GSUA 1P3MA 4KGCB 4X23B 1AOIA 4J8UC 5AV6A 3MGPB 4HGAB 2PYOC 1KX3C 3X1SD 4G91C 5B33B 3B6GB 3WTPA 1Q9CA 1P34B 3B6GA 3REKB 5GSUD 5CPJC 5JA4A 3MGPA 5B24B 3AZKC 1P3MB 4KGCA 1S32B 1BH9B 3X1TA 1F66C 3W99A 4WU8B 3C1BB 4R8PA 5DNND 2YFVA 3V9RA 3W97D 5AVCC 5BNVA 3TU4B 3X1VA 3AV2C 5AY8B 4YM6A 4YS3A 3LZ0C 1ID3A 3B6GC 4XUJA 1M18B 3C1CC 2PYOD 3MGSD 4X23C 3B6FC 4Z66C 2FJ7A 4YM6C 5FUGB 4H9QA 5AV9B 3A6NB 1P3LB 1P3OC 4WU9B 5B1MD 4ZBJC 5AV8A 1P3FC 3B0BA 3X1UC 4R8PC 1M1AB 1U35B 4XUJD 1S32C 1M19B 3AZEA 3AZNA 5B2IB 5AV8C 2RVQC 4Z5TC 5CHLB 4ZUXD 4KUDD 1KX3B 3REIB 5B31C 4ZBJB 5B2IA 5JRGD 3WAAC 3KXBD 5BS7A 4JJNB 5E5AD 3AN2A 1M19A 5GT0B 5C3IC 1KX4C 5B1LB 1ZLAA 1HQ3B 3C1CB 3LJAC 3KUYB 3AZEC 3WA9D 4DRBA 2HIOB 3MNNC 3NQJB 3WKJA 1P3GA 2NQBA 5AV5A 1P3PA 3AZJC 5B2JC 3KWQC 3AZLD 3AZIA 4J8VB 3RELA 4WU8C 3AV1D 3AN2C 2F8NH 5AVBD 3B6FA 3WTPC 5CPIC 3UTBC 4QLCB 2HUEC 3W99D 2YFVB 2BYKB 3V9RB 4J8UA 4AWLB 3AZFD 1KX5B 3C1BA 2BYKA 4WU8A 3MVDD 3X1TB 4KHAB 2NQBC 5B32D 3REHA 1M18D 5AV5C 3RELB 3AYWA 4NFTA 4Z2MH 3REKA 1P3PB 2NZDD 4NE6A 1P3GB 5KDMA 3WTPB 5CP6B 2BYMA 3NQUA 1M1AD 3AZHA 3UTAD 2F8NK 1AOIB 3KWQB 4X23A 3C1CA 4M6BA 1EQZC 5E5AA 5B1LA 3LZ1B 5JRGA 3LZ1C 4ZUXB 5AV6C 1P3BA 1ZLAD 4KUDB 5GXQC 4JJNA 2AROD 3MGRD 3AFAB 1ULYA 1HQ3C 3REJA 3WKJC 3KXBB 1TAFB 5CPKD 3MNNA 3UT9A 5GT3C 5GT3B 5CPKC 5B31G 2YFWB 1P3FA 5B31B 4J8WB 1P3AA 3AZLA 1M1AA 1P3BC 5GXQB 4Z5TB 5BS7C 3WA9B 1WWSA 5AV8B 5B2IC 3WA9A 5B40A 1F1EA 1KX5C 5B40D 4EO5C 2FJ7B 3VH6W 3AZLB 3UTBB
chains in the Genus database with same CATH superfamily
1P3AB 2ZY3A 1AOIC 3VH5A 1WWIA 3W96D 3AV1B 1P3FB 2IO5B 2YFWA 3W96C 1M18A 5F99D 1ID3B 1P3KD 4QLCD 5B2JB 3UT9B 1P3GC 4YM6B 3KXBA 3B0CT 2JCHA 5G49A 3TU4A 2LY8A 4H9OA 1M18C 4XZQD 3O62D 4ZUXA 1P3BB 3X1VD 4KUDA 3O62C 3MVDC 3LZ1A 5AY8C 3AZMD 5B1LC 1BH9A 5C3IB 4DRAA 5GT0C 3W98C 1P3GD 5B24A 4QLCC 3WTPD 5JA4B 4WNNA 3AZHB 1P3KC 5CPIB 2BYMB 3NQUB 5AVBC 3WAAB 2NZDA 2ZY5A 3MGPD 4CAYA 3UTAA 2G5HC 2L5AA 5B33A 5B33D 3X1SB 5B0ZD 4NE3A 5AV6B 1P34D 3REKC 2HIOC 3REKD 5GSUB 5B24D 4KHAA 3MGRB 3REHC 1EQZB 2JE5A 4H9PA 1P3MD 2Y2JA 3EPLA 3MGPC 5B32A 4J8UB 5AVBA 4QLCA 4H9RA 2ZY4A 5BNXA 5E5AC 5GT3D 4Z66B 3VH5T 5JRGC 3MGQB 3B6FB 3AZFA 3W97B 5B31D 3TU4D 5BT1D 5AY8D 4J8VA 1Z2CB 3RELC 1P3IB 2CV5D 5AV5B 3LZ0B 5GXQD 4Z5TD 2NQBB 5F99A 2RVQD 5AV8D 4XZQC 5B0ZA 1TZYD 3AV2B 3MGSB 5AVCB 3TU4C 3W99C 3KUYA 2Y2GA 4J8XB 1F66A 3EPJA 1BH8B 3UTBD 4H9SC 4LD9A 2Y2PA 5BO0A 1HQ3A 5AV9D 3A6ND 3REJC 1P3FD 3AN2D 4WU9D 5F99C 4G92C 1N1JB 4G92B 4H9NA 5B2JD 4J8VC 2NZDC 3AZJB 2F8NB 1W2EA 1R4VA 1P3KA 4E45A 3REIA 1KX3A 5B2ID 1TZYC 1P34C 1P3BD 3LJAB 1B6WA 3AZJA 3AZNB 3AL0C 2CV5C 5BT1C 2XD1A 5CPID 3W98D 5GT0D 1BH8A 1HTAA 5B1LD 1F66B 4WU9A 3MGSA 1HQ3D 4H9QB 5AV9A 3A6NA 3B0CW 2AROC 5B0ZB 3R45A 5B24C 3AZKB 3LELB 5CPJB 2HIOD 1EQZD 2PYOA 4YS3B 2UWXA 5AY8A 4J8VD 4J8UD 3X1UB 1M1AC 5AVBB 3AZGA 3WTPE 3EG5B 4Z66D 4WU9C 5AV9C 3A6NC 3REJD 4KGCD 3W99B 4H9PB 1KX5D 2ZM5A 2CV5B 1S32A 3AZMC 1H3OB 3MVDB 1A7WA 5AV5D 3LZ0D 3B6GD 2NQBD 3AZGC 2Y2IA 2Y2LA 1TZYB 3VH5W 5AVCD 3RELD 1P34A 4J8XD 3AZFC 1TZYA 5CPIA 4XUJC 1S32D 4WNNB 3WAAA 2NZDB 1ID3C 1H3OA 3MVDA 4WU8D 3O62A 3AZJD 5DNNB 1AOID 3KWQD 3AZLC 3MGRC 4UUZB 1P3MC 4EO5B 3REHD 3AZMA 3MGSC 3LZ1D 1JFIA 4H9OB 4E44A 2ZY2A 3H0RC 3X1UA 3LJAD 3X1SC 5B0ZC 2AROB 4XZQA 3AZND 4G91B 5B33C 3W96A 4J8WC 4HGAC 2PYOB 3B0DC 5CPJA 5DNMA 1KX4D 3LELA 5CPKB 3AZKA 3AV1A 3W98B 5B1MB 3UTBA 1F66D 5B0YA 2Y2NA 1U35D 3WKJD 5DNMC 5B32C 4Z5TA 1M19D 4ZUXC 3X1VC 5B0YB 4KUDC 3AZKD 5CPJD 5GSUC 5B1MA 4J8WA 4YS3D 5CPKA 3UT9C 1BFMA 5DNMB 4WV4B 4CSRB 5GT3A 1KX3D 3LJAA 3W96B 3UTAC 5CP6C 4JJND 5B1MC 3REJB 1P3OD 1P3KB 1P3OA 4YM6D 2F8NG 2F8NA 3AFAA 5B40C 4H9NB 3C1CD 4UUZA 3KUYD 3O62B 3AZED 5BO0B 4LD9B 3KWQA 5AVCA 3AV2A 4AWLC 3W97C 5CP6A 5KDMB 5DNNC 3KXBC 4WZSB 3AYWC 3WAAD 1P3IA 2IO5C 3AYWB 3W97A 3AZFB 1KX4A 2CV5A 3REHB 2CWEA 4Z66A 1ZLAC 2FJ7C 5AV6D 3KSYA 4H9RB 3VH6T 3MNND 5B0YC 3X1TD 3WA9C 5B32B 3AZGB 1KX5A 2Y2KA 1EQZA 4R8PD 3A1IA 1KX4B 1P3PD 3AZHC 3AZIC 3AZIB 1P3PC 5CP6D 3MGQD 3B6FD 3X1SA 3B0DB 4X23D 4CAYB 3UTAB 3R45B 3NQJA 3WKJB 2HIOA 1P3ID 5B0YD 3X1TC 3AV2D 1M19C 1ZLAB 5DNMD 3AFAD 5GT0A 1B67A 3AN2B 3AV1C 1P3OB 5G49B 1P3LC 4Z2MG 1P3AC 3C1BD 1KU5A 2FFFB 2F8ND 5B2JA 4J8WD 2DF4C 3AZNC 4CSRA 4H9SA 4UPKA 4LD9C 3KUYC 3AZEB 4NE5A 4LD9D 1N1JA 1PZRA 3VH6A 1U35A 5B40B 2FJ7D 2JSSA 3IP4C 1P3AD 4J8XA 2HUEB 3C1BC 2XD5A 5GXQA 4JJNC 1P3LD 5FUGA 1P3LA 3REIC 5F99B 3AYWD 1ID3D 3W98A 3LZ0A 3UT9D 5B31A 4YS3C 3AFAC 4XUJB 4J8XC 3LELC 3MNNB 1TAFA 3LELD 2AROA 4XZQB 2RIQA 3MGQA 5BNXB 3AZGD 2J8PA 3X1VB 5BNVB 5B32G 1U35C 2DQNC 4R8PB 4DQYB 1P3IC 1JFIB 3AZMB 3REID 3X1UD 4KGCC 5DNNA 5JRGB 3MGQC 3MGRA 3AZID 5E5AB 3AZHD 5GSUA 3P5JB 1P3MA 4KGCB 4X23B 1AOIA 4J8UC 5AV6A 3MGPB 4HGAB 2PYOC 1T3UA 1KX3C 3X1SD 4G91C 5B33B 3B6GB 3WTPA 1Q9CA 1P34B 3B6GA 3REKB 5GSUD 5CPJC 5JA4A 3MGPA 5B24B 3AZKC 1P3MB 4KGCA 2Y2HA 1BH9B 1S32B 3X1TA 1F66C 3W99A 4WU8B 2VQRA 3C1BB 4R8PA 5DNND 2YFVA 3V9RA 3W97D 5AVCC 5BNVA 3TU4B 3X1VA 3AV2C 5AY8B 4YM6A 4YS3A 3LZ0C 1ID3A 3B6GC 4XUJA 2W8SA 1M18B 3C1CC 2PYOD 3MGSD 4X23C 3B6FC 4Z66C 2FJ7A 4YM6C 5FUGB 4H9QA 5AV9B 3A6NB 1P3LB 1P3OC 4WU9B 5B1MD 4ZBJC 5AV8A 1P3FC 3B0BA 3X1UC 4R8PC 1M1AB 1U35B 4XUJD 1S32C 3H0MC 1M19B 3AZEA 3AZNA 5B2IB 5AV8C 2RVQC 4Z5TC 5CHLB 4ZUXD 4KUDD 1KX3B 3REIB 5B31C 4ZBJB 5B2IA 5JRGD 3WAAC 3KXBD 5BS7A 4JJNB 5E5AD 3AN2A 1M19A 5GT0B 5C3IC 1KX4C 5B1LB 1ZLAA 1HQ3B 3C1CB 3LJAC 3KUYB 3AZEC 3WA9D 4DRBA 2HIOB 3MNNC 3NQJB 3WKJA 1P3GA 2NQBA 5AV5A 1P3PA 3AZJC 5B2JC 3F6TA 3KWQC 3AZIA 4J8VB 3AZLD 3RELA 4WU8C 3AV1D 3AN2C 2F8NH 5AVBD 3B6FA 3WTPC 3A1KA 5CPIC 3UTBC 4QLCB 2HUEC 3W99D 2YFVB 2BYKB 3V9RB 4J8UA 4AWLB 3AZFD 1KX5B 3C1BA 2BYKA 4WU8A 3MVDD 3H0LC 3EPKA 3X1TB 4KHAB 2NQBC 5B32D 3REHA 1M18D 5AV5C 3RELB 3AYWA 4NFTA 4Z2MH 3REKA 1P3PB 2NZDD 4NE6A 1P3GB 2Y2QA 3WTPB 5KDMA 5CP6B 2BYMA 3NQUA 1M1AD 3AZHA 3UTAD 2F8NK 2Y2MA 1AOIB 3KWQB 4X23A 3C1CA 4M6BA 1EQZC 2BG1A 5E5AA 5B1LA 3LZ1B 5JRGA 3LZ1C 2Y2OA 4ZUXB 5AV6C 1P3BA 1ZLAD 4KUDB 5GXQC 4JJNA 2AROD 3MGRD 3AFAB 1ULYA 1HQ3C 3REJA 3WKJC 3KXBB 1TAFB 5CPKD 3MNNA 3UT9A 3EPHA 4WJ3C 5GT3C 5GT3B 5CPKC 5B31G 2F2AC 2YFWB 2G5IC 1P3FA 5B31B 3FDDA 4J8WB 1P3AA 3AZLA 1M1AA 1P3BC 3KFUG 5GXQB 4Z5TB 5BS7C 3WA9B 1WWSA 5AV8B 5B2IC 3WA9A 5B40A 1F1EA 1KX5C 5B40D 4EO5C 2FJ7B 3VH6W 3AZLB 3UTBB
chains in the Genus database with same CATH topology
1P3AB 2ZY3A 1AOIC 3VH5A 1WWIA 3W96D 3AV1B 1P3FB 2IO5B 2YFWA 3W96C 1M18A 5F99D 1ID3B 1P3KD 4QLCD 5B2JB 3UT9B 1P3GC 4YM6B 3KXBA 3B0CT 2JCHA 5G49A 3TU4A 2LY8A 4H9OA 1M18C 4XZQD 3O62D 4ZUXA 1P3BB 3X1VD 4KUDA 3O62C 3MVDC 3LZ1A 5AY8C 3AZMD 5B1LC 1BH9A 5C3IB 4DRAA 5GT0C 3W98C 1P3GD 5B24A 4QLCC 3WTPD 5JA4B 4WNNA 3AZHB 1P3KC 5CPIB 2BYMB 3NQUB 5AVBC 3WAAB 2NZDA 2ZY5A 3MGPD 4CAYA 3UTAA 2G5HC 2L5AA 5B33A 5B33D 3X1SB 5B0ZD 4NE3A 5AV6B 1P34D 3REKC 2HIOC 3REKD 5GSUB 5B24D 4KHAA 3MGRB 3REHC 1EQZB 2JE5A 4H9PA 1P3MD 2Y2JA 3EPLA 3MGPC 5B32A 4J8UB 5AVBA 4QLCA 4H9RA 2ZY4A 5BNXA 5E5AC 5GT3D 4Z66B 3VH5T 5JRGC 3MGQB 3B6FB 3AZFA 3W97B 5B31D 3TU4D 5BT1D 5AY8D 4J8VA 1Z2CB 3RELC 1P3IB 2CV5D 5AV5B 3LZ0B 5GXQD 4Z5TD 2NQBB 5F99A 2RVQD 5AV8D 4XZQC 5B0ZA 1TZYD 3AV2B 3MGSB 5AVCB 3TU4C 3W99C 3KUYA 2Y2GA 4J8XB 1F66A 3EPJA 1BH8B 3UTBD 4H9SC 4LD9A 2Y2PA 5BO0A 1HQ3A 5AV9D 3A6ND 3REJC 1P3FD 3AN2D 4WU9D 5F99C 4G92C 1N1JB 4G92B 4H9NA 5B2JD 4J8VC 2NZDC 3AZJB 2F8NB 1W2EA 1R4VA 1P3KA 4E45A 3REIA 1KX3A 5B2ID 1TZYC 1P34C 1P3BD 3LJAB 1B6WA 3AZJA 3AZNB 3AL0C 2CV5C 5BT1C 2XD1A 5CPID 3W98D 5GT0D 1BH8A 1HTAA 5B1LD 1F66B 4WU9A 3MGSA 1HQ3D 4H9QB 5AV9A 3A6NA 3B0CW 2AROC 5B0ZB 3R45A 5B24C 3AZKB 3LELB 5CPJB 2HIOD 1EQZD 2PYOA 4YS3B 2UWXA 5AY8A 4J8VD 4J8UD 3X1UB 1M1AC 5AVBB 3AZGA 3WTPE 3EG5B 4Z66D 4WU9C 5AV9C 3A6NC 3REJD 4KGCD 3W99B 4H9PB 1KX5D 2ZM5A 2CV5B 1S32A 3AZMC 1H3OB 3MVDB 1A7WA 5AV5D 3LZ0D 3B6GD 2NQBD 3AZGC 2Y2IA 2Y2LA 1TZYB 3VH5W 5AVCD 3RELD 1P34A 4J8XD 3AZFC 1TZYA 5CPIA 4XUJC 1S32D 4WNNB 3WAAA 2NZDB 1ID3C 1H3OA 3MVDA 4WU8D 3O62A 3AZJD 5DNNB 1AOID 3KWQD 3AZLC 3MGRC 4UUZB 1P3MC 4EO5B 3REHD 3AZMA 3MGSC 3LZ1D 1JFIA 4H9OB 4E44A 2ZY2A 3H0RC 3X1UA 3LJAD 3X1SC 5B0ZC 2AROB 4XZQA 3AZND 4G91B 5B33C 3W96A 4J8WC 4HGAC 2PYOB 3B0DC 5CPJA 5DNMA 1KX4D 3LELA 5CPKB 3AZKA 3AV1A 3W98B 5B1MB 3UTBA 1F66D 5B0YA 2Y2NA 1U35D 3WKJD 5DNMC 5B32C 4Z5TA 1M19D 4ZUXC 3X1VC 5B0YB 4KUDC 3AZKD 5CPJD 5GSUC 5B1MA 4J8WA 4YS3D 5CPKA 3UT9C 1BFMA 5DNMB 4WV4B 4CSRB 5GT3A 1KX3D 3LJAA 3W96B 3UTAC 5CP6C 4JJND 5B1MC 3REJB 1P3OD 1P3KB 1P3OA 4YM6D 2F8NG 2F8NA 3AFAA 5B40C 4H9NB 3C1CD 4UUZA 3KUYD 3O62B 3AZED 5BO0B 4LD9B 3KWQA 5AVCA 3AV2A 4AWLC 3W97C 5CP6A 5KDMB 5DNNC 3KXBC 4WZSB 3AYWC 3WAAD 1P3IA 2IO5C 3AYWB 3W97A 3AZFB 1KX4A 2CV5A 3REHB 2CWEA 4Z66A 1ZLAC 2FJ7C 5AV6D 3KSYA 4H9RB 3VH6T 3MNND 5B0YC 3X1TD 3WA9C 5B32B 3AZGB 1KX5A 2Y2KA 1EQZA 4R8PD 3A1IA 1KX4B 1P3PD 3AZHC 3AZIC 3AZIB 1P3PC 5CP6D 3MGQD 3B6FD 3X1SA 3B0DB 4X23D 4CAYB 3UTAB 3R45B 3NQJA 3WKJB 2HIOA 1P3ID 5B0YD 3X1TC 3AV2D 1M19C 1ZLAB 5DNMD 3AFAD 5GT0A 1B67A 3AN2B 3AV1C 1P3OB 5G49B 1P3LC 4Z2MG 1P3AC 3C1BD 1KU5A 2FFFB 2F8ND 5B2JA 4J8WD 2DF4C 3AZNC 4CSRA 4H9SA 4UPKA 4LD9C 3KUYC 3AZEB 4NE5A 4LD9D 1N1JA 1PZRA 3VH6A 1U35A 5B40B 2FJ7D 2JSSA 3IP4C 1P3AD 4J8XA 2HUEB 3C1BC 2XD5A 5GXQA 4JJNC 1P3LD 5FUGA 1P3LA 3REIC 5F99B 3AYWD 1ID3D 3W98A 3LZ0A 3UT9D 5B31A 4YS3C 3AFAC 4XUJB 4J8XC 3LELC 3MNNB 1TAFA 3LELD 2AROA 4XZQB 2RIQA 3MGQA 5BNXB 3AZGD 2J8PA 3X1VB 5BNVB 5B32G 1U35C 2DQNC 4R8PB 4DQYB 1P3IC 1JFIB 3AZMB 3REID 3X1UD 4KGCC 5DNNA 5JRGB 3MGQC 3MGRA 3AZID 5E5AB 3AZHD 5GSUA 3P5JB 1P3MA 4KGCB 4X23B 1AOIA 4J8UC 5AV6A 3MGPB 4HGAB 2PYOC 1T3UA 1KX3C 3X1SD 4G91C 5B33B 3B6GB 3WTPA 1Q9CA 1P34B 3B6GA 3REKB 5GSUD 5CPJC 5JA4A 3MGPA 5B24B 3AZKC 1P3MB 4KGCA 2Y2HA 1BH9B 1S32B 3X1TA 1F66C 3W99A 4WU8B 2VQRA 3C1BB 4R8PA 5DNND 2YFVA 3V9RA 3W97D 5AVCC 5BNVA 3TU4B 3X1VA 3AV2C 5AY8B 4YM6A 4YS3A 3LZ0C 1ID3A 3B6GC 4XUJA 2W8SA 1M18B 3C1CC 2PYOD 3MGSD 4X23C 3B6FC 4Z66C 2FJ7A 4YM6C 5FUGB 4H9QA 5AV9B 3A6NB 1P3LB 1P3OC 4WU9B 5B1MD 4ZBJC 5AV8A 1P3FC 3B0BA 3X1UC 4R8PC 1M1AB 1U35B 4XUJD 1S32C 3H0MC 1M19B 3AZEA 3AZNA 5B2IB 5AV8C 2RVQC 4Z5TC 5CHLB 4ZUXD 4KUDD 1KX3B 3REIB 5B31C 4ZBJB 5B2IA 5JRGD 3WAAC 3KXBD 5BS7A 4JJNB 5E5AD 3AN2A 1M19A 5GT0B 5C3IC 1KX4C 5B1LB 1ZLAA 1HQ3B 3C1CB 3LJAC 3KUYB 3AZEC 3WA9D 4DRBA 2HIOB 3MNNC 3NQJB 3WKJA 1P3GA 2NQBA 5AV5A 1P3PA 3AZJC 5B2JC 3F6TA 3KWQC 3AZIA 4J8VB 3AZLD 3RELA 4WU8C 3AV1D 3AN2C 2F8NH 5AVBD 3B6FA 3WTPC 3A1KA 5CPIC 3UTBC 4QLCB 2HUEC 3W99D 2YFVB 2BYKB 3V9RB 4J8UA 4AWLB 3AZFD 1KX5B 3C1BA 2BYKA 4WU8A 3MVDD 3H0LC 3EPKA 3X1TB 4KHAB 2NQBC 5B32D 3REHA 1M18D 5AV5C 3RELB 3AYWA 4NFTA 4Z2MH 3REKA 1P3PB 2NZDD 4NE6A 1P3GB 2Y2QA 3WTPB 5KDMA 5CP6B 2BYMA 3NQUA 1M1AD 3AZHA 3UTAD 2F8NK 2Y2MA 1AOIB 3KWQB 4X23A 3C1CA 4M6BA 1EQZC 2BG1A 5E5AA 5B1LA 3LZ1B 5JRGA 3LZ1C 2Y2OA 4ZUXB 5AV6C 1P3BA 1ZLAD 4KUDB 5GXQC 4JJNA 2AROD 3MGRD 3AFAB 1ULYA 1HQ3C 3REJA 3WKJC 3KXBB 1TAFB 5CPKD 3MNNA 3UT9A 3EPHA 4WJ3C 5GT3C 5GT3B 5CPKC 5B31G 2F2AC 2YFWB 2G5IC 1P3FA 5B31B 3FDDA 4J8WB 1P3AA 3AZLA 1M1AA 1P3BC 3KFUG 5GXQB 4Z5TB 5BS7C 3WA9B 1WWSA 5AV8B 5B2IC 3WA9A 5B40A 1F1EA 1KX5C 5B40D 4EO5C 2FJ7B 3VH6W 3AZLB 3UTBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3A B;  1AOI C;  3VH5 A;  1WWI A;  3W96 D;  3AV1 B;  1P3F B;  2IO5 B;  2YFW A;  3W96 C;  1M18 A;  5F99 D;  1ID3 B;  1P3K D;  4QLC D;  5B2J B;  3UT9 B;  1P3G C;  4YM6 B;  3KXB A;  3B0C T;  5G49 A;  3TU4 A;  2LY8 A;  4H9O A;  1M18 C;  4XZQ D;  3O62 D;  4ZUX A;  1P3B B;  3X1V D;  4KUD A;  3O62 C;  3MVD C;  3LZ1 A;  5AY8 C;  3AZM D;  5B1L C;  1BH9 A;  5C3I B;  4DRA A;  5GT0 C;  3W98 C;  1P3G D;  5B24 A;  4QLC C;  3WTP D;  5JA4 B;  4WNN A;  3AZH B;  1P3K C;  5CPI B;  3NQU B;  2BYM B;  5AVB C;  3WAA B;  2NZD A;  3MGP D;  4CAY A;  3UTA A;  2L5A A;  5B33 A;  3X1S B;  5B33 D;  5B0Z D;  4NE3 A;  5AV6 B;  1P34 D;  3REK C;  2HIO C;  3REK D;  5GSU B;  5B24 D;  4KHA A;  3MGR B;  3REH C;  1EQZ B;  4H9P A;  1P3M D;  3MGP C;  5B32 A;  4J8U B;  5AVB A;  4QLC A;  4H9R A;  5BNX A;  5E5A C;  5GT3 D;  4Z66 B;  3VH5 T;  5JRG C;  3MGQ B;  3B6F B;  3AZF A;  3W97 B;  5B31 D;  3TU4 D;  5BT1 D;  5AY8 D;  4J8V A;  3REL C;  1P3I B;  2CV5 D;  5AV5 B;  3LZ0 B;  5GXQ D;  4Z5T D;  2NQB B;  5F99 A;  2RVQ D;  5AV8 D;  4XZQ C;  5B0Z A;  1TZY D;  3AV2 B;  3MGS B;  5AVC B;  3TU4 C;  3W99 C;  3KUY A;  4J8X B;  1F66 A;  1BH8 B;  3UTB D;  4H9S C;  4LD9 A;  5BO0 A;  1HQ3 A;  5AV9 D;  3A6N D;  3REJ C;  1P3F D;  3AN2 D;  4WU9 D;  5F99 C;  4G92 C;  1N1J B;  4G92 B;  4H9N A;  5B2J D;  4J8V C;  2NZD C;  3AZJ B;  2F8N B;  1R4V A;  1P3K A;  4E45 A;  3REI A;  1KX3 A;  5B2I D;  1TZY C;  1P34 C;  1P3B D;  3LJA B;  1B6W A;  3AZJ A;  3AZN B;  2CV5 C;  5BT1 C;  5CPI D;  3W98 D;  5GT0 D;  1BH8 A;  1HTA A;  5B1L D;  1F66 B;  4WU9 A;  3MGS A;  1HQ3 D;  4H9Q B;  5AV9 A;  3A6N A;  3B0C W;  2ARO C;  5B0Z B;  3R45 A;  5B24 C;  3AZK B;  3LEL B;  5CPJ B;  2HIO D;  1EQZ D;  2PYO A;  4YS3 B;  5AY8 A;  4J8V D;  4J8U D;  3X1U B;  1M1A C;  5AVB B;  3AZG A;  3WTP E;  4Z66 D;  4WU9 C;  5AV9 C;  3A6N C;  3REJ D;  4KGC D;  3W99 B;  4H9P B;  1KX5 D;  2CV5 B;  1S32 A;  3AZM C;  1H3O B;  3MVD B;  1A7W A;  5AV5 D;  3LZ0 D;  3B6G D;  2NQB D;  3AZG C;  1TZY B;  3VH5 W;  5AVC D;  3REL D;  1P34 A;  4J8X D;  3AZF C;  1TZY A;  5CPI A;  4XUJ C;  1S32 D;  4WNN B;  3WAA A;  2NZD B;  1ID3 C;  1H3O A;  3MVD A;  4WU8 D;  3O62 A;  3AZJ D;  5DNN B;  1AOI D;  3KWQ D;  3AZL C;  3MGR C;  4UUZ B;  1P3M C;  4EO5 B;  3REH D;  3AZM A;  3MGS C;  3LZ1 D;  1JFI A;  4H9O B;  4E44 A;  3X1U A;  3LJA D;  3X1S C;  2ARO B;  4XZQ A;  5B0Z C;  3AZN D;  4G91 B;  5B33 C;  3W96 A;  4J8W C;  4HGA C;  2PYO B;  3B0D C;  5CPJ A;  5DNM A;  1KX4 D;  3LEL A;  5CPK B;  3AZK A;  3AV1 A;  3W98 B;  5B1M B;  3UTB A;  1F66 D;  5B0Y A;  1U35 D;  3WKJ D;  5DNM C;  5B32 C;  4Z5T A;  1M19 D;  4ZUX C;  3X1V C;  5B0Y B;  4KUD C;  3AZK D;  5CPJ D;  5GSU C;  5B1M A;  4J8W A;  4YS3 D;  5CPK A;  3UT9 C;  1BFM A;  5DNM B;  4WV4 B;  4CSR B;  5GT3 A;  1KX3 D;  3LJA A;  3W96 B;  3UTA C;  5CP6 C;  4JJN D;  5B1M C;  3REJ B;  1P3O D;  1P3K B;  1P3O A;  4YM6 D;  2F8N G;  2F8N A;  3AFA A;  5B40 C;  4H9N B;  3C1C D;  4UUZ A;  3KUY D;  3O62 B;  3AZE D;  5BO0 B;  4LD9 B;  3KWQ A;  5AVC A;  3AV2 A;  4AWL C;  3W97 C;  5CP6 A;  5KDM B;  5DNN C;  3KXB C;  4WZS B;  3AYW C;  3WAA D;  1P3I A;  2IO5 C;  3AYW B;  3W97 A;  3AZF B;  1KX4 A;  2CV5 A;  3REH B;  2CWE A;  4Z66 A;  1ZLA C;  2FJ7 C;  5AV6 D;  3KSY A;  4H9R B;  3VH6 T;  3MNN D;  5B0Y C;  3X1T D;  3WA9 C;  5B32 B;  3AZG B;  1KX5 A;  1EQZ A;  4R8P D;  1KX4 B;  1P3P D;  3AZH C;  3AZI C;  3AZI B;  1P3P C;  5CP6 D;  3MGQ D;  3B6F D;  3X1S A;  3B0D B;  4X23 D;  4CAY B;  3UTA B;  3R45 B;  3NQJ A;  3WKJ B;  2HIO A;  1P3I D;  5B0Y D;  3X1T C;  3AV2 D;  1M19 C;  1ZLA B;  5DNM D;  3AFA D;  5GT0 A;  1B67 A;  3AN2 B;  3AV1 C;  1P3O B;  5G49 B;  1P3L C;  4Z2M G;  1P3A C;  3C1B D;  1KU5 A;  2F8N D;  5B2J A;  4J8W D;  3AZN C;  4CSR A;  4H9S A;  4LD9 C;  3KUY C;  3AZE B;  4NE5 A;  4LD9 D;  1N1J A;  3VH6 A;  1U35 A;  5B40 B;  2FJ7 D;  2JSS A;  1P3A D;  4J8X A;  2HUE B;  3C1B C;  5GXQ A;  4JJN C;  1P3L D;  5FUG A;  1P3L A;  3REI C;  5F99 B;  3AYW D;  1ID3 D;  3W98 A;  3LZ0 A;  3UT9 D;  5B31 A;  4YS3 C;  3AFA C;  4XUJ B;  4J8X C;  3LEL C;  3MNN B;  1TAF A;  3LEL D;  2ARO A;  4XZQ B;  3MGQ A;  5BNX B;  3AZG D;  3X1V B;  5BNV B;  5B32 G;  1U35 C;  4R8P B;  1JFI B;  1P3I C;  3AZM B;  3REI D;  3X1U D;  4KGC C;  5DNN A;  5JRG B;  3MGQ C;  3MGR A;  3AZI D;  5E5A B;  3AZH D;  5GSU A;  1P3M A;  4KGC B;  4X23 B;  1AOI A;  4J8U C;  5AV6 A;  3MGP B;  4HGA B;  2PYO C;  1KX3 C;  3X1S D;  4G91 C;  5B33 B;  3B6G B;  3WTP A;  1Q9C A;  1P34 B;  3B6G A;  3REK B;  5GSU D;  5CPJ C;  5JA4 A;  3MGP A;  5B24 B;  3AZK C;  1P3M B;  4KGC A;  1S32 B;  1BH9 B;  3X1T A;  1F66 C;  3W99 A;  4WU8 B;  3C1B B;  4R8P A;  5DNN D;  2YFV A;  3V9R A;  3W97 D;  5AVC C;  5BNV A;  3TU4 B;  3X1V A;  3AV2 C;  5AY8 B;  4YM6 A;  4YS3 A;  3LZ0 C;  1ID3 A;  3B6G C;  4XUJ A;  1M18 B;  3C1C C;  2PYO D;  3MGS D;  4X23 C;  3B6F C;  4Z66 C;  2FJ7 A;  4YM6 C;  5FUG B;  4H9Q A;  5AV9 B;  3A6N B;  1P3L B;  1P3O C;  4WU9 B;  5B1M D;  4ZBJ C;  5AV8 A;  1P3F C;  3B0B A;  3X1U C;  4R8P C;  1M1A B;  1U35 B;  4XUJ D;  1S32 C;  1M19 B;  3AZE A;  3AZN A;  5B2I B;  5AV8 C;  2RVQ C;  4Z5T C;  5CHL B;  4ZUX D;  4KUD D;  1KX3 B;  3REI B;  5B31 C;  4ZBJ B;  5B2I A;  5JRG D;  3WAA C;  3KXB D;  5BS7 A;  4JJN B;  5E5A D;  3AN2 A;  1M19 A;  5GT0 B;  5C3I C;  1KX4 C;  5B1L B;  1ZLA A;  1HQ3 B;  3C1C B;  3LJA C;  3KUY B;  3AZE C;  3WA9 D;  4DRB A;  2HIO B;  3MNN C;  3NQJ B;  3WKJ A;  1P3G A;  2NQB A;  5AV5 A;  1P3P A;  3AZJ C;  5B2J C;  3KWQ C;  3AZL D;  3AZI A;  4J8V B;  3REL A;  4WU8 C;  3AV1 D;  3AN2 C;  2F8N H;  5AVB D;  3B6F A;  3WTP C;  5CPI C;  3UTB C;  4QLC B;  2HUE C;  3W99 D;  2YFV B;  2BYK B;  3V9R B;  4J8U A;  4AWL B;  3AZF D;  1KX5 B;  3C1B A;  2BYK A;  4WU8 A;  3MVD D;  3X1T B;  4KHA B;  2NQB C;  5B32 D;  3REH A;  1M18 D;  5AV5 C;  3REL B;  3AYW A;  4NFT A;  4Z2M H;  3REK A;  1P3P B;  2NZD D;  4NE6 A;  1P3G B;  5KDM A;  3WTP B;  5CP6 B;  2BYM A;  3NQU A;  1M1A D;  3AZH A;  3UTA D;  2F8N K;  1AOI B;  3KWQ B;  4X23 A;  3C1C A;  4M6B A;  1EQZ C;  5E5A A;  5B1L A;  3LZ1 B;  5JRG A;  3LZ1 C;  4ZUX B;  5AV6 C;  1P3B A;  1ZLA D;  4KUD B;  5GXQ C;  4JJN A;  2ARO D;  3MGR D;  3AFA B;  1ULY A;  1HQ3 C;  3REJ A;  3WKJ C;  3KXB B;  1TAF B;  5CPK D;  3MNN A;  3UT9 A;  5GT3 C;  5GT3 B;  5CPK C;  5B31 G;  2YFW B;  1P3F A;  5B31 B;  4J8W B;  1P3A A;  3AZL A;  1M1A A;  1P3B C;  5GXQ B;  4Z5T B;  5BS7 C;  3WA9 B;  1WWS A;  5AV8 B;  5B2I C;  3WA9 A;  5B40 A;  1F1E A;  1KX5 C;  5B40 D;  4EO5 C;  2FJ7 B;  3VH6 W;  3AZL B;  3UTB B; 
#chains in the Genus database with same CATH topology
 1P3A B;  2ZY3 A;  1AOI C;  3VH5 A;  1WWI A;  3W96 D;  3AV1 B;  1P3F B;  2IO5 B;  2YFW A;  3W96 C;  1M18 A;  5F99 D;  1ID3 B;  1P3K D;  4QLC D;  5B2J B;  3UT9 B;  1P3G C;  4YM6 B;  3KXB A;  3B0C T;  2JCH A;  5G49 A;  3TU4 A;  2LY8 A;  4H9O A;  1M18 C;  4XZQ D;  3O62 D;  4ZUX A;  1P3B B;  3X1V D;  4KUD A;  3O62 C;  3MVD C;  3LZ1 A;  5AY8 C;  3AZM D;  5B1L C;  1BH9 A;  5C3I B;  4DRA A;  5GT0 C;  3W98 C;  1P3G D;  5B24 A;  4QLC C;  3WTP D;  5JA4 B;  4WNN A;  3AZH B;  1P3K C;  5CPI B;  2BYM B;  3NQU B;  5AVB C;  3WAA B;  2NZD A;  2ZY5 A;  3MGP D;  4CAY A;  3UTA A;  2G5H C;  2L5A A;  5B33 A;  5B33 D;  3X1S B;  5B0Z D;  4NE3 A;  5AV6 B;  1P34 D;  3REK C;  2HIO C;  3REK D;  5GSU B;  5B24 D;  4KHA A;  3MGR B;  3REH C;  1EQZ B;  2JE5 A;  4H9P A;  1P3M D;  2Y2J A;  3EPL A;  3MGP C;  5B32 A;  4J8U B;  5AVB A;  4QLC A;  4H9R A;  2ZY4 A;  5BNX A;  5E5A C;  5GT3 D;  4Z66 B;  3VH5 T;  5JRG C;  3MGQ B;  3B6F B;  3AZF A;  3W97 B;  5B31 D;  3TU4 D;  5BT1 D;  5AY8 D;  4J8V A;  1Z2C B;  3REL C;  1P3I B;  2CV5 D;  5AV5 B;  3LZ0 B;  5GXQ D;  4Z5T D;  2NQB B;  5F99 A;  2RVQ D;  5AV8 D;  4XZQ C;  5B0Z A;  1TZY D;  3AV2 B;  3MGS B;  5AVC B;  3TU4 C;  3W99 C;  3KUY A;  2Y2G A;  4J8X B;  1F66 A;  3EPJ A;  1BH8 B;  3UTB D;  4H9S C;  4LD9 A;  2Y2P A;  5BO0 A;  1HQ3 A;  5AV9 D;  3A6N D;  3REJ C;  1P3F D;  3AN2 D;  4WU9 D;  5F99 C;  4G92 C;  1N1J B;  4G92 B;  4H9N A;  5B2J D;  4J8V C;  2NZD C;  3AZJ B;  2F8N B;  1W2E A;  1R4V A;  1P3K A;  4E45 A;  3REI A;  1KX3 A;  5B2I D;  1TZY C;  1P34 C;  1P3B D;  3LJA B;  1B6W A;  3AZJ A;  3AZN B;  3AL0 C;  2CV5 C;  5BT1 C;  2XD1 A;  5CPI D;  3W98 D;  5GT0 D;  1BH8 A;  1HTA A;  5B1L D;  1F66 B;  4WU9 A;  3MGS A;  1HQ3 D;  4H9Q B;  5AV9 A;  3A6N A;  3B0C W;  2ARO C;  5B0Z B;  3R45 A;  5B24 C;  3AZK B;  3LEL B;  5CPJ B;  2HIO D;  1EQZ D;  2PYO A;  4YS3 B;  2UWX A;  5AY8 A;  4J8V D;  4J8U D;  3X1U B;  1M1A C;  5AVB B;  3AZG A;  3WTP E;  3EG5 B;  4Z66 D;  4WU9 C;  5AV9 C;  3A6N C;  3REJ D;  4KGC D;  3W99 B;  4H9P B;  1KX5 D;  2ZM5 A;  2CV5 B;  1S32 A;  3AZM C;  1H3O B;  3MVD B;  1A7W A;  5AV5 D;  3LZ0 D;  3B6G D;  2NQB D;  3AZG C;  2Y2I A;  2Y2L A;  1TZY B;  3VH5 W;  5AVC D;  3REL D;  1P34 A;  4J8X D;  3AZF C;  1TZY A;  5CPI A;  4XUJ C;  1S32 D;  4WNN B;  3WAA A;  2NZD B;  1ID3 C;  1H3O A;  3MVD A;  4WU8 D;  3O62 A;  3AZJ D;  5DNN B;  1AOI D;  3KWQ D;  3AZL C;  3MGR C;  4UUZ B;  1P3M C;  4EO5 B;  3REH D;  3AZM A;  3MGS C;  3LZ1 D;  1JFI A;  4H9O B;  4E44 A;  2ZY2 A;  3H0R C;  3X1U A;  3LJA D;  3X1S C;  5B0Z C;  2ARO B;  4XZQ A;  3AZN D;  4G91 B;  5B33 C;  3W96 A;  4J8W C;  4HGA C;  2PYO B;  3B0D C;  5CPJ A;  5DNM A;  1KX4 D;  3LEL A;  5CPK B;  3AZK A;  3AV1 A;  3W98 B;  5B1M B;  3UTB A;  1F66 D;  5B0Y A;  2Y2N A;  1U35 D;  3WKJ D;  5DNM C;  5B32 C;  4Z5T A;  1M19 D;  4ZUX C;  3X1V C;  5B0Y B;  4KUD C;  3AZK D;  5CPJ D;  5GSU C;  5B1M A;  4J8W A;  4YS3 D;  5CPK A;  3UT9 C;  1BFM A;  5DNM B;  4WV4 B;  4CSR B;  5GT3 A;  1KX3 D;  3LJA A;  3W96 B;  3UTA C;  5CP6 C;  4JJN D;  5B1M C;  3REJ B;  1P3O D;  1P3K B;  1P3O A;  4YM6 D;  2F8N G;  2F8N A;  3AFA A;  5B40 C;  4H9N B;  3C1C D;  4UUZ A;  3KUY D;  3O62 B;  3AZE D;  5BO0 B;  4LD9 B;  3KWQ A;  5AVC A;  3AV2 A;  4AWL C;  3W97 C;  5CP6 A;  5KDM B;  5DNN C;  3KXB C;  4WZS B;  3AYW C;  3WAA D;  1P3I A;  2IO5 C;  3AYW B;  3W97 A;  3AZF B;  1KX4 A;  2CV5 A;  3REH B;  2CWE A;  4Z66 A;  1ZLA C;  2FJ7 C;  5AV6 D;  3KSY A;  4H9R B;  3VH6 T;  3MNN D;  5B0Y C;  3X1T D;  3WA9 C;  5B32 B;  3AZG B;  1KX5 A;  2Y2K A;  1EQZ A;  4R8P D;  3A1I A;  1KX4 B;  1P3P D;  3AZH C;  3AZI C;  3AZI B;  1P3P C;  5CP6 D;  3MGQ D;  3B6F D;  3X1S A;  3B0D B;  4X23 D;  4CAY B;  3UTA B;  3R45 B;  3NQJ A;  3WKJ B;  2HIO A;  1P3I D;  5B0Y D;  3X1T C;  3AV2 D;  1M19 C;  1ZLA B;  5DNM D;  3AFA D;  5GT0 A;  1B67 A;  3AN2 B;  3AV1 C;  1P3O B;  5G49 B;  1P3L C;  4Z2M G;  1P3A C;  3C1B D;  1KU5 A;  2FFF B;  2F8N D;  5B2J A;  4J8W D;  2DF4 C;  3AZN C;  4CSR A;  4H9S A;  4UPK A;  4LD9 C;  3KUY C;  3AZE B;  4NE5 A;  4LD9 D;  1N1J A;  1PZR A;  3VH6 A;  1U35 A;  5B40 B;  2FJ7 D;  2JSS A;  3IP4 C;  1P3A D;  4J8X A;  2HUE B;  3C1B C;  2XD5 A;  5GXQ A;  4JJN C;  1P3L D;  5FUG A;  1P3L A;  3REI C;  5F99 B;  3AYW D;  1ID3 D;  3W98 A;  3LZ0 A;  3UT9 D;  5B31 A;  4YS3 C;  3AFA C;  4XUJ B;  4J8X C;  3LEL C;  3MNN B;  1TAF A;  3LEL D;  2ARO A;  4XZQ B;  2RIQ A;  3MGQ A;  5BNX B;  3AZG D;  2J8P A;  3X1V B;  5BNV B;  5B32 G;  1U35 C;  2DQN C;  4R8P B;  4DQY B;  1P3I C;  1JFI B;  3AZM B;  3REI D;  3X1U D;  4KGC C;  5DNN A;  5JRG B;  3MGQ C;  3MGR A;  3AZI D;  5E5A B;  3AZH D;  5GSU A;  3P5J B;  1P3M A;  4KGC B;  4X23 B;  1AOI A;  4J8U C;  5AV6 A;  3MGP B;  4HGA B;  2PYO C;  1T3U A;  1KX3 C;  3X1S D;  4G91 C;  5B33 B;  3B6G B;  3WTP A;  1Q9C A;  1P34 B;  3B6G A;  3REK B;  5GSU D;  5CPJ C;  5JA4 A;  3MGP A;  5B24 B;  3AZK C;  1P3M B;  4KGC A;  2Y2H A;  1BH9 B;  1S32 B;  3X1T A;  1F66 C;  3W99 A;  4WU8 B;  2VQR A;  3C1B B;  4R8P A;  5DNN D;  2YFV A;  3V9R A;  3W97 D;  5AVC C;  5BNV A;  3TU4 B;  3X1V A;  3AV2 C;  5AY8 B;  4YM6 A;  4YS3 A;  3LZ0 C;  1ID3 A;  3B6G C;  4XUJ A;  2W8S A;  1M18 B;  3C1C C;  2PYO D;  3MGS D;  4X23 C;  3B6F C;  4Z66 C;  2FJ7 A;  4YM6 C;  5FUG B;  4H9Q A;  5AV9 B;  3A6N B;  1P3L B;  1P3O C;  4WU9 B;  5B1M D;  4ZBJ C;  5AV8 A;  1P3F C;  3B0B A;  3X1U C;  4R8P C;  1M1A B;  1U35 B;  4XUJ D;  1S32 C;  3H0M C;  1M19 B;  3AZE A;  3AZN A;  5B2I B;  5AV8 C;  2RVQ C;  4Z5T C;  5CHL B;  4ZUX D;  4KUD D;  1KX3 B;  3REI B;  5B31 C;  4ZBJ B;  5B2I A;  5JRG D;  3WAA C;  3KXB D;  5BS7 A;  4JJN B;  5E5A D;  3AN2 A;  1M19 A;  5GT0 B;  5C3I C;  1KX4 C;  5B1L B;  1ZLA A;  1HQ3 B;  3C1C B;  3LJA C;  3KUY B;  3AZE C;  3WA9 D;  4DRB A;  2HIO B;  3MNN C;  3NQJ B;  3WKJ A;  1P3G A;  2NQB A;  5AV5 A;  1P3P A;  3AZJ C;  5B2J C;  3F6T A;  3KWQ C;  3AZI A;  4J8V B;  3AZL D;  3REL A;  4WU8 C;  3AV1 D;  3AN2 C;  2F8N H;  5AVB D;  3B6F A;  3WTP C;  3A1K A;  5CPI C;  3UTB C;  4QLC B;  2HUE C;  3W99 D;  2YFV B;  2BYK B;  3V9R B;  4J8U A;  4AWL B;  3AZF D;  1KX5 B;  3C1B A;  2BYK A;  4WU8 A;  3MVD D;  3H0L C;  3EPK A;  3X1T B;  4KHA B;  2NQB C;  5B32 D;  3REH A;  1M18 D;  5AV5 C;  3REL B;  3AYW A;  4NFT A;  4Z2M H;  3REK A;  1P3P B;  2NZD D;  4NE6 A;  1P3G B;  2Y2Q A;  3WTP B;  5KDM A;  5CP6 B;  2BYM A;  3NQU A;  1M1A D;  3AZH A;  3UTA D;  2F8N K;  2Y2M A;  1AOI B;  3KWQ B;  4X23 A;  3C1C A;  4M6B A;  1EQZ C;  2BG1 A;  5E5A A;  5B1L A;  3LZ1 B;  5JRG A;  3LZ1 C;  2Y2O A;  4ZUX B;  5AV6 C;  1P3B A;  1ZLA D;  4KUD B;  5GXQ C;  4JJN A;  2ARO D;  3MGR D;  3AFA B;  1ULY A;  1HQ3 C;  3REJ A;  3WKJ C;  3KXB B;  1TAF B;  5CPK D;  3MNN A;  3UT9 A;  3EPH A;  4WJ3 C;  5GT3 C;  5GT3 B;  5CPK C;  5B31 G;  2F2A C;  2YFW B;  2G5I C;  1P3F A;  5B31 B;  3FDD A;  4J8W B;  1P3A A;  3AZL A;  1M1A A;  1P3B C;  3KFU G;  5GXQ B;  4Z5T B;  5BS7 C;  3WA9 B;  1WWS A;  5AV8 B;  5B2I C;  3WA9 A;  5B40 A;  1F1E A;  1KX5 C;  5B40 D;  4EO5 C;  2FJ7 B;  3VH6 W;  3AZL B;  3UTB B; 
#chains in the Genus database with same CATH homology
 1P3A B;  2ZY3 A;  1AOI C;  3VH5 A;  1WWI A;  3W96 D;  3AV1 B;  1P3F B;  2IO5 B;  2YFW A;  3W96 C;  1M18 A;  5F99 D;  1ID3 B;  1P3K D;  4QLC D;  5B2J B;  3UT9 B;  1P3G C;  4YM6 B;  3KXB A;  3B0C T;  2JCH A;  5G49 A;  3TU4 A;  2LY8 A;  4H9O A;  1M18 C;  4XZQ D;  3O62 D;  4ZUX A;  1P3B B;  3X1V D;  4KUD A;  3O62 C;  3MVD C;  3LZ1 A;  5AY8 C;  3AZM D;  5B1L C;  1BH9 A;  5C3I B;  4DRA A;  5GT0 C;  3W98 C;  1P3G D;  5B24 A;  4QLC C;  3WTP D;  5JA4 B;  4WNN A;  3AZH B;  1P3K C;  5CPI B;  2BYM B;  3NQU B;  5AVB C;  3WAA B;  2NZD A;  2ZY5 A;  3MGP D;  4CAY A;  3UTA A;  2G5H C;  2L5A A;  5B33 A;  5B33 D;  3X1S B;  5B0Z D;  4NE3 A;  5AV6 B;  1P34 D;  3REK C;  2HIO C;  3REK D;  5GSU B;  5B24 D;  4KHA A;  3MGR B;  3REH C;  1EQZ B;  2JE5 A;  4H9P A;  1P3M D;  2Y2J A;  3EPL A;  3MGP C;  5B32 A;  4J8U B;  5AVB A;  4QLC A;  4H9R A;  2ZY4 A;  5BNX A;  5E5A C;  5GT3 D;  4Z66 B;  3VH5 T;  5JRG C;  3MGQ B;  3B6F B;  3AZF A;  3W97 B;  5B31 D;  3TU4 D;  5BT1 D;  5AY8 D;  4J8V A;  1Z2C B;  3REL C;  1P3I B;  2CV5 D;  5AV5 B;  3LZ0 B;  5GXQ D;  4Z5T D;  2NQB B;  5F99 A;  2RVQ D;  5AV8 D;  4XZQ C;  5B0Z A;  1TZY D;  3AV2 B;  3MGS B;  5AVC B;  3TU4 C;  3W99 C;  3KUY A;  2Y2G A;  4J8X B;  1F66 A;  3EPJ A;  1BH8 B;  3UTB D;  4H9S C;  4LD9 A;  2Y2P A;  5BO0 A;  1HQ3 A;  5AV9 D;  3A6N D;  3REJ C;  1P3F D;  3AN2 D;  4WU9 D;  5F99 C;  4G92 C;  1N1J B;  4G92 B;  4H9N A;  5B2J D;  4J8V C;  2NZD C;  3AZJ B;  2F8N B;  1W2E A;  1R4V A;  1P3K A;  4E45 A;  3REI A;  1KX3 A;  5B2I D;  1TZY C;  1P34 C;  1P3B D;  3LJA B;  1B6W A;  3AZJ A;  3AZN B;  3AL0 C;  2CV5 C;  5BT1 C;  2XD1 A;  5CPI D;  3W98 D;  5GT0 D;  1BH8 A;  1HTA A;  5B1L D;  1F66 B;  4WU9 A;  3MGS A;  1HQ3 D;  4H9Q B;  5AV9 A;  3A6N A;  3B0C W;  2ARO C;  5B0Z B;  3R45 A;  5B24 C;  3AZK B;  3LEL B;  5CPJ B;  2HIO D;  1EQZ D;  2PYO A;  4YS3 B;  2UWX A;  5AY8 A;  4J8V D;  4J8U D;  3X1U B;  1M1A C;  5AVB B;  3AZG A;  3WTP E;  3EG5 B;  4Z66 D;  4WU9 C;  5AV9 C;  3A6N C;  3REJ D;  4KGC D;  3W99 B;  4H9P B;  1KX5 D;  2ZM5 A;  2CV5 B;  1S32 A;  3AZM C;  1H3O B;  3MVD B;  1A7W A;  5AV5 D;  3LZ0 D;  3B6G D;  2NQB D;  3AZG C;  2Y2I A;  2Y2L A;  1TZY B;  3VH5 W;  5AVC D;  3REL D;  1P34 A;  4J8X D;  3AZF C;  1TZY A;  5CPI A;  4XUJ C;  1S32 D;  4WNN B;  3WAA A;  2NZD B;  1ID3 C;  1H3O A;  3MVD A;  4WU8 D;  3O62 A;  3AZJ D;  5DNN B;  1AOI D;  3KWQ D;  3AZL C;  3MGR C;  4UUZ B;  1P3M C;  4EO5 B;  3REH D;  3AZM A;  3MGS C;  3LZ1 D;  1JFI A;  4H9O B;  4E44 A;  2ZY2 A;  3H0R C;  3X1U A;  3LJA D;  3X1S C;  5B0Z C;  2ARO B;  4XZQ A;  3AZN D;  4G91 B;  5B33 C;  3W96 A;  4J8W C;  4HGA C;  2PYO B;  3B0D C;  5CPJ A;  5DNM A;  1KX4 D;  3LEL A;  5CPK B;  3AZK A;  3AV1 A;  3W98 B;  5B1M B;  3UTB A;  1F66 D;  5B0Y A;  2Y2N A;  1U35 D;  3WKJ D;  5DNM C;  5B32 C;  4Z5T A;  1M19 D;  4ZUX C;  3X1V C;  5B0Y B;  4KUD C;  3AZK D;  5CPJ D;  5GSU C;  5B1M A;  4J8W A;  4YS3 D;  5CPK A;  3UT9 C;  1BFM A;  5DNM B;  4WV4 B;  4CSR B;  5GT3 A;  1KX3 D;  3LJA A;  3W96 B;  3UTA C;  5CP6 C;  4JJN D;  5B1M C;  3REJ B;  1P3O D;  1P3K B;  1P3O A;  4YM6 D;  2F8N G;  2F8N A;  3AFA A;  5B40 C;  4H9N B;  3C1C D;  4UUZ A;  3KUY D;  3O62 B;  3AZE D;  5BO0 B;  4LD9 B;  3KWQ A;  5AVC A;  3AV2 A;  4AWL C;  3W97 C;  5CP6 A;  5KDM B;  5DNN C;  3KXB C;  4WZS B;  3AYW C;  3WAA D;  1P3I A;  2IO5 C;  3AYW B;  3W97 A;  3AZF B;  1KX4 A;  2CV5 A;  3REH B;  2CWE A;  4Z66 A;  1ZLA C;  2FJ7 C;  5AV6 D;  3KSY A;  4H9R B;  3VH6 T;  3MNN D;  5B0Y C;  3X1T D;  3WA9 C;  5B32 B;  3AZG B;  1KX5 A;  2Y2K A;  1EQZ A;  4R8P D;  3A1I A;  1KX4 B;  1P3P D;  3AZH C;  3AZI C;  3AZI B;  1P3P C;  5CP6 D;  3MGQ D;  3B6F D;  3X1S A;  3B0D B;  4X23 D;  4CAY B;  3UTA B;  3R45 B;  3NQJ A;  3WKJ B;  2HIO A;  1P3I D;  5B0Y D;  3X1T C;  3AV2 D;  1M19 C;  1ZLA B;  5DNM D;  3AFA D;  5GT0 A;  1B67 A;  3AN2 B;  3AV1 C;  1P3O B;  5G49 B;  1P3L C;  4Z2M G;  1P3A C;  3C1B D;  1KU5 A;  2FFF B;  2F8N D;  5B2J A;  4J8W D;  2DF4 C;  3AZN C;  4CSR A;  4H9S A;  4UPK A;  4LD9 C;  3KUY C;  3AZE B;  4NE5 A;  4LD9 D;  1N1J A;  1PZR A;  3VH6 A;  1U35 A;  5B40 B;  2FJ7 D;  2JSS A;  3IP4 C;  1P3A D;  4J8X A;  2HUE B;  3C1B C;  2XD5 A;  5GXQ A;  4JJN C;  1P3L D;  5FUG A;  1P3L A;  3REI C;  5F99 B;  3AYW D;  1ID3 D;  3W98 A;  3LZ0 A;  3UT9 D;  5B31 A;  4YS3 C;  3AFA C;  4XUJ B;  4J8X C;  3LEL C;  3MNN B;  1TAF A;  3LEL D;  2ARO A;  4XZQ B;  2RIQ A;  3MGQ A;  5BNX B;  3AZG D;  2J8P A;  3X1V B;  5BNV B;  5B32 G;  1U35 C;  2DQN C;  4R8P B;  4DQY B;  1P3I C;  1JFI B;  3AZM B;  3REI D;  3X1U D;  4KGC C;  5DNN A;  5JRG B;  3MGQ C;  3MGR A;  3AZI D;  5E5A B;  3AZH D;  5GSU A;  3P5J B;  1P3M A;  4KGC B;  4X23 B;  1AOI A;  4J8U C;  5AV6 A;  3MGP B;  4HGA B;  2PYO C;  1T3U A;  1KX3 C;  3X1S D;  4G91 C;  5B33 B;  3B6G B;  3WTP A;  1Q9C A;  1P34 B;  3B6G A;  3REK B;  5GSU D;  5CPJ C;  5JA4 A;  3MGP A;  5B24 B;  3AZK C;  1P3M B;  4KGC A;  2Y2H A;  1BH9 B;  1S32 B;  3X1T A;  1F66 C;  3W99 A;  4WU8 B;  2VQR A;  3C1B B;  4R8P A;  5DNN D;  2YFV A;  3V9R A;  3W97 D;  5AVC C;  5BNV A;  3TU4 B;  3X1V A;  3AV2 C;  5AY8 B;  4YM6 A;  4YS3 A;  3LZ0 C;  1ID3 A;  3B6G C;  4XUJ A;  2W8S A;  1M18 B;  3C1C C;  2PYO D;  3MGS D;  4X23 C;  3B6F C;  4Z66 C;  2FJ7 A;  4YM6 C;  5FUG B;  4H9Q A;  5AV9 B;  3A6N B;  1P3L B;  1P3O C;  4WU9 B;  5B1M D;  4ZBJ C;  5AV8 A;  1P3F C;  3B0B A;  3X1U C;  4R8P C;  1M1A B;  1U35 B;  4XUJ D;  1S32 C;  3H0M C;  1M19 B;  3AZE A;  3AZN A;  5B2I B;  5AV8 C;  2RVQ C;  4Z5T C;  5CHL B;  4ZUX D;  4KUD D;  1KX3 B;  3REI B;  5B31 C;  4ZBJ B;  5B2I A;  5JRG D;  3WAA C;  3KXB D;  5BS7 A;  4JJN B;  5E5A D;  3AN2 A;  1M19 A;  5GT0 B;  5C3I C;  1KX4 C;  5B1L B;  1ZLA A;  1HQ3 B;  3C1C B;  3LJA C;  3KUY B;  3AZE C;  3WA9 D;  4DRB A;  2HIO B;  3MNN C;  3NQJ B;  3WKJ A;  1P3G A;  2NQB A;  5AV5 A;  1P3P A;  3AZJ C;  5B2J C;  3F6T A;  3KWQ C;  3AZI A;  4J8V B;  3AZL D;  3REL A;  4WU8 C;  3AV1 D;  3AN2 C;  2F8N H;  5AVB D;  3B6F A;  3WTP C;  3A1K A;  5CPI C;  3UTB C;  4QLC B;  2HUE C;  3W99 D;  2YFV B;  2BYK B;  3V9R B;  4J8U A;  4AWL B;  3AZF D;  1KX5 B;  3C1B A;  2BYK A;  4WU8 A;  3MVD D;  3H0L C;  3EPK A;  3X1T B;  4KHA B;  2NQB C;  5B32 D;  3REH A;  1M18 D;  5AV5 C;  3REL B;  3AYW A;  4NFT A;  4Z2M H;  3REK A;  1P3P B;  2NZD D;  4NE6 A;  1P3G B;  2Y2Q A;  3WTP B;  5KDM A;  5CP6 B;  2BYM A;  3NQU A;  1M1A D;  3AZH A;  3UTA D;  2F8N K;  2Y2M A;  1AOI B;  3KWQ B;  4X23 A;  3C1C A;  4M6B A;  1EQZ C;  2BG1 A;  5E5A A;  5B1L A;  3LZ1 B;  5JRG A;  3LZ1 C;  2Y2O A;  4ZUX B;  5AV6 C;  1P3B A;  1ZLA D;  4KUD B;  5GXQ C;  4JJN A;  2ARO D;  3MGR D;  3AFA B;  1ULY A;  1HQ3 C;  3REJ A;  3WKJ C;  3KXB B;  1TAF B;  5CPK D;  3MNN A;  3UT9 A;  3EPH A;  4WJ3 C;  5GT3 C;  5GT3 B;  5CPK C;  5B31 G;  2F2A C;  2YFW B;  2G5I C;  1P3F A;  5B31 B;  3FDD A;  4J8W B;  1P3A A;  3AZL A;  1M1A A;  1P3B C;  3KFU G;  5GXQ B;  4Z5T B;  5BS7 C;  3WA9 B;  1WWS A;  5AV8 B;  5B2I C;  3WA9 A;  5B40 A;  1F1E A;  1KX5 C;  5B40 D;  4EO5 C;  2FJ7 B;  3VH6 W;  3AZL B;  3UTB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...