3X1SA

Crystal structure of the nucleosome core particle
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1sA00
3REHD 3B0DC 1P3OD 3LZ1B 1P3KC 5B31D 2PYOD 5B1LB 5AY8D 3X1SB 3KWQB 2NQBA 3MVDD 3LELD 1M1AB 2LY8A 3VH6T 1KX5A 3AZLB 5DNNA 3AYWD 5BO0A 5B0YC 5AV8C 5B0ZD 3O62B 4Z66A 4NE5A 3TU4A 5B1MA 1BFMA 1P3GC 3UTAC 4WU8B 3AN2B 4R8PC 5CP6C 4H9RB 5AVBC 1P34A 3AZEB 1KX4C 5AVCD 3AFAB 3AV2B 1ID3C 3W97D 3W96B 5CPIA 1P3BA 2NZDC 3WKJA 3AZJC 5BNXA 3KUYD 1ZLAC 2FJ7A 4JJNB 3AZNC 3KXBB 5E5AA 3LZ1C 1M18A 5B1LC 4H9SA 5B24A 3X1SC 3KWQC 5GXQB 3MGRD 1P3PB 1M1AC 4CSRA 4QLCA 3WAAD 3AZLC 1P3AD 3AZMA 2CV5B 4M6BA 3C1BC 4J8UB 3LJAA 3O62C 3MGSB 1M19B 1AOIA 3AZFB 3UTBD 5AV5B 1BH8B 2JSSA 4XUJB 4WU8C 2BYKB 1TZYA 4ZUXB 3AZEC 3AV2C 3W96C 4WNNB 1U35A 4UUZA 4WU9B 4JJNC 2NQBD 1KX5D 4KUDA 5JRGD 2HIOA 3MGPD 2AROB 5DNND 3KXBC 5F99B 3W98B 5GXQC 3AZID 4Z66D 1P3MB 1P3PC 3TU4D 3X1VB 5B1MD 3C1CB 4J8WC 4H9QB 4J8VA 3B6FD 4ZBJC 5KDMB 1P34D 3LZ0B 4G91B 5B0YA 4J8UC 5AV8A 3A6NC 5B2ID 3MGSC 3WTPB 5CPID 3REJB 1M19C 4Z5TD 3WKJD 1P3IB 3AZFC 1Q9CA 5AV5C 1P3GA 3W99B 3UTAA 4XUJC 3VH6A 4R8PA 3AZKB 5CP6A 3X1UD 4ZUXC 5AVBA 1KX4A 5GT0A 1ID3A 4YS3B 4KGCB 3AV1B 2YFVA 1M18D 2NZDA 3B0CT 5B24D 3AZJA 4LD9B 3AZNA 2AROC 4QLCD 2F8NB 1BH9A 2F8NK 3LZ1A 3REIC 5F99C 3X1SA 1B67A 3KWQA 5B40C 1P3MC 1M1AA 1WWSA 2RVQC 4DRBA 5B32B 5DNMB 3X1VC 3NQUB 3C1CC 3AZLA 3REHB 1P3OB 4KHAB 1TZYD 3LZ0C 4G91C 3C1BA 2PYOB 5AY8B 5BT1C 3WTPC 3O62A 3REJC 1HTAA 1P3IC 3MVDB 3LELB 3W99C 5G49B 4WU8A 4KUDD 4H9RA 5GSUC 3AYWB 3AZEA 5CPJD 3AV2A 3W96A 4YS3C 4KGCC 4WZSB 3AV1C 5B31G 1P3FB 4LD9C 4XZQB 4JJNA 4E45A 4H9NA 3KXBA 5AVCB 3W97B 4J8VD 3AZGA 3AZHB 5B0YD 1S32C 5GXQA 3KUYB 1P3PA 5B32C 5CHLB 3VH5A 5DNMC 1HQ3A 1P3GD 4J8WA 3B0BA 3UTAD 4J8XC 3REHC 1WWIA 5BNVB 3UT9D 5CP6D 3VH6W 5AVBD 1P3OC 4J8UA 5GT0D 1KX4D 2PYOC 5AY8C 3A6NA 3MNNC 3MGSA 1M19A 2NZDD 3AZFA 3MVDC 3LELC 3MGRB 5AV5A 4XUJA 3WAAB 2YFWB 1P3AB 2BYKA 3AYWC 5B33D 4WNNA 1P3FC 3X1SD 3KWQD 4XZQC 3REKA 3UTBB 2AROA 3AZLD 1EQZA 5AVCC 4X23D 5B2JB 3W97C 3REIA 3AZHC 3B6GB 3C1BD 5AV6D 5B40A 3O62D 3KUYC 1P3MA 5GT3B 2NQBB 3X1VA 5JRGB 3C1CA 4YM6A 3MGPB 4H9QA 3AN2C 5DNNB 3LZ0A 3AZED 1N1JB 4DRAA 3AFAC 3RELA 5BS7A 3X1TB 4NE3A 3WTPA 3REJA 4G92B 1P3IA 3AZIB 3MGRC 3MGQA 3TU4B 1P3AC 5AV9B 5GSUA 3B6FB 4KGCA 3KXBD 3AV1A 1P34B 3NQJA 1P3KA 5B2IB 3AZGD 1KX3B 5CPIB 3WA9B 4Z5TB 4LD9A 3WKJB 5GXQD 3UTBC 1HQ3D 4J8WD 3VH5W 3X1UB 5B2JC 2CV5C 3B6GC 1S32A 3A6ND 4H9OA 1TAFB 5B32A 5GT3C 1P3BD 3V9RB 5DNMA 5JRGC 3MGPC 4XUJD 3R45B 4J8XA 3REHA 2FJ7D 1F66B 5DNNC 1P3OA 4KHAA 5AY8A 4CAYA 3X1TC 5E5AD 3MNNA 3AZIC 3MVDA 4AWLB 1ZLAA 4WU9C 3TU4C 3REKD 5AV9C 3AYWA 3B6FC 2IO5B 1EQZD 5CPKB 1TZYB 1P34C 3AZMD 5B2IC 1P3FA 5B1LA 1P3LB 3REID 1KX3C 5CPIC 3WA9C 4Z5TC 3WKJC 2CWEA 5B40D 3LJAD 3W98C 4XZQA 1P3MD 4UUZB 1AOID 1R4VA 3B0CW 1ULYA 3C1CD 4YM6D 3X1UC 5FUGB 5CPJB 3W97A 5AVCA 3AZHA 5JA4B 3RELD 5B31B 1U35D 1P3ID 5C3IB 3MGQD 3AN2A 1F66C 5BNVA 4NE6A 2HIOD 5GSUD 3AZKC 4J8VB 3AFAA 4KGCD 3AV1D 5B0YB 1P3KD 5B0ZB 4AWLC 4LD9D 2IO5C 3UT9B 5CPKC 1TZYC 5CP6B 5AVBB 5GT0B 1P3LC 2HUEB 2NZDB 5AV8D 1B6WA 1S32D 1JFIB 5B32D 1H3OB 5CPJC 4J8XD 5B2JA 2CV5A 4R8PD 1BH9B 5B33B 3B6GA 1ID3D 5B31C 4WV4B 3MNND 5GT3A 3AZJD 5C3IC 5JRGA 3MGPA 1ZLAD 1BH8A 2BYMB 3AZND 4X23B 4ZUXA 1N1JA 4J8VC 3X1TA 3C1BB 5AV6B 3LZ1D 5B0ZC 1P3FD 1F1EA 4H9PB 5B1LD 3AZIA 4EO5B 4WU9A 4E44A 4XZQD 1M1AD 5AV9A 3B6FA 3UT9C 5GT0C 5B2IA 3AZHD 2HUEC 3KSYA 5F99A 1KX3A 4Z5TA 3WA9A 3W98A 1KX5B 3X1UA 4HGAB 3AN2D 4H9NB 4WU8D 5B33C 5KDMA 3AFAD 3AV2D 3W96D 5BO0B 3AZGB 1TAFA 2L5AA 3V9RA 4Z66B 3W99A 3R45A 1HQ3B 3WAAC 5B1MB 4JJND 1A7WA 4J8WB 1F66A 3AZKA 3WTPE 4X23C 4ZBJB 4YS3A 1KU5A 5AV6C 3A6NB 4EO5C 1P3BB 5BNXB 1P3PD 4Z2MH 2FJ7B 2F8NA 5CPKA 5B2JD 2CV5D 1P3LA 5E5AB 3B6GD 4J8UD 1M18B 5B24B 3MGSD 3VH5T 1M19D 5GT3D 3REKB 3AZFD 2NQBC 1KX5C 3NQUA 5AV5D 5FUGA 4HGAC 4CSRB 4QLCB 5CPJA 4KUDC 1EQZB 3AZMB 5JA4A 4ZUXD 5B31A 2PYOA 3AZGC 3REIB 3X1TD 5B40B 3LJAB 4G92C 4Z66C 3LELA 2F8NH 1AOIB 4WU9D 5G49A 1HQ3C 5B1MC 4YM6B 5AV9D 2AROD 3RELB 5B0ZA 1KX3D 5F99D 3WA9D 1P3BC 1U35B 3W98D 3MGQB 2RVQD 2FJ7C 4KUDB 3X1VD 3UT9A 2HIOB 5GSUB 4Z2MG 3B0DB 5E5AC 3LZ0D 3NQJB 1P3KB 1M18C 4H9SC 5B24C 1JFIA 5BT1D 3WTPD 3KUYA 3REJD 3REKC 1H3OA 3W99D 4NFTA 4QLCC 1EQZC 1F66D 5B33A 3AZKD 3AZMC 4YS3D 5AV8B 3LJAC 1S32B 4H9OB 3MGRA 1AOIC 3WAAA 2BYMA 2YFWA 4YM6C 1P3GB 1P3AA 3UTAB 2F8NG 4X23A 4J8XB 2F8ND 4R8PB 5CPKD 1KX4B 3RELC 1ID3B 5AV6A 5BS7C 4CAYB 4H9PA 1P3LD 2YFVB 3MNNB 1U35C 3AZJB 5B32G 3MGQC 3UTBA 1ZLAB 5DNMD 3AZNB 2HIOC
chains in the Genus database with same CATH superfamily
2RIQA 3REHD 3B0DC 1P3OD 3LZ1B 1P3KC 5B31D 2PYOD 5B1LB 5AY8D 2ZY5A 3X1SB 3KWQB 2NQBA 3MVDD 3LELD 1M1AB 2LY8A 3VH6T 1KX5A 3AZLB 5DNNA 2Y2PA 3AYWD 5BO0A 5B0YC 5AV8C 5B0ZD 3O62B 4Z66A 4NE5A 3TU4A 5B1MA 1BFMA 1P3GC 3UTAC 4WU8B 3AN2B 4R8PC 5CP6C 4H9RB 1T3UA 5AVBC 3AZEB 1P34A 5AVCD 3AFAB 3AV2B 1KX4C 1ID3C 3W97D 3W96B 5CPIA 1P3BA 2NZDC 3WKJA 3AZJC 5BNXA 3KUYD 1ZLAC 2FJ7A 4JJNB 3AZNC 3KXBB 5E5AA 3LZ1C 1M18A 5B1LC 4H9SA 5B24A 2XD5A 2G5HC 3KWQC 3X1SC 5GXQB 3MGRD 1P3PB 1M1AC 3EPHA 4CSRA 4QLCA 3WAAD 2Y2NA 3AZLC 1P3AD 3AZMA 2CV5B 4M6BA 3C1BC 4J8UB 3LJAA 3O62C 3MGSB 1M19B 1AOIA 3AZFB 3UTBD 5AV5B 1BH8B 2JSSA 2Y2LA 4XUJB 4WU8C 2BYKB 1TZYA 4ZUXB 3AZEC 3AV2C 3W96C 4WNNB 1U35A 4UUZA 4WU9B 4JJNC 2NQBD 1KX5D 4KUDA 2Y2OA 5JRGD 2HIOA 3F6TA 3MGPD 2AROB 5DNND 3KXBC 5F99B 3W98B 5GXQC 3AZID 4Z66D 1P3MB 1P3PC 2ZY3A 3TU4D 3X1VB 5B1MD 3C1CB 4J8WC 4H9QB 4J8VA 3B6FD 4ZBJC 5KDMB 1P34D 3LZ0B 4G91B 5B0YA 4J8UC 5AV8A 3A6NC 5B2ID 3MGSC 3WTPB 5CPID 3REJB 1M19C 4Z5TD 3WKJD 1P3IB 3AZFC 1Q9CA 5AV5C 1P3GA 3W99B 3UTAA 4XUJC 3VH6A 4R8PA 3AZKB 5CP6A 3X1UD 4ZUXC 5AVBA 1KX4A 5GT0A 1ID3A 2XD1A 4YS3B 3AV1B 4KGCB 2YFVA 1M18D 2NZDA 3B0CT 5B24D 3AZJA 4LD9B 3AZNA 2AROC 2JE5A 4QLCD 2F8NB 1BH9A 2F8NK 3LZ1A 3REIC 5F99C 3X1SA 1B67A 3KWQA 5B40C 1P3MC 1M1AA 1WWSA 2RVQC 2VQRA 4DRBA 5B32B 5DNMB 3X1VC 3KFUG 3NQUB 3C1CC 3AZLA 3REHB 1P3OB 4KHAB 1TZYD 3LZ0C 4G91C 3C1BA 2PYOB 5AY8B 5BT1C 3WTPC 3O62A 3REJC 1HTAA 1P3IC 2ZY2A 3MVDB 3LELB 3W99C 5G49B 4WU8A 4KUDD 4H9RA 5GSUC 3AYWB 3AZEA 5CPJD 3AV2A 3W96A 4YS3C 4KGCC 4WZSB 3AV1C 5B31G 1P3FB 4LD9C 4XZQB 4JJNA 4E45A 4H9NA 3KXBA 2G5IC 5AVCB 3W97B 4J8VD 2Y2KA 3AZGA 3AZHB 3P5JB 5B0YD 1S32C 5GXQA 3KUYB 1Z2CB 1P3PA 5B32C 5CHLB 3VH5A 5DNMC 1HQ3A 2DQNC 1P3GD 4J8WA 3B0BA 3UTAD 4J8XC 3REHC 1WWIA 5BNVB 3UT9D 5CP6D 3VH6W 5AVBD 1P3OC 4J8UA 5GT0D 1KX4D 2PYOC 5AY8C 3A6NA 3MNNC 3MGSA 1M19A 2NZDD 3AZFA 3MVDC 3LELC 3MGRB 5AV5A 4XUJA 3WAAB 2YFWB 1P3AB 2BYKA 3AYWC 5B33D 4WNNA 1P3FC 3X1SD 3KWQD 4XZQC 3REKA 3UTBB 2AROA 3AZLD 1EQZA 5AVCC 4X23D 5B2JB 3W97C 3REIA 3AZHC 3B6GB 3C1BD 5AV6D 5B40A 3O62D 3KUYC 1P3MA 5GT3B 2NQBB 3X1VA 5JRGB 2J8PA 4YM6A 3MGPB 3C1CA 4H9QA 3AN2C 5DNNB 3EPJA 1W2EA 3LZ0A 3AZED 1N1JB 4DRAA 3AFAC 3RELA 5BS7A 3X1TB 4NE3A 3WTPA 3REJA 4G92B 1P3IA 3AZIB 3MGRC 3MGQA 3TU4B 1P3AC 5AV9B 5GSUA 3B6FB 3A1IA 4KGCA 3KXBD 3AV1A 1P34B 3NQJA 1P3KA 5B2IB 2UWXA 3AZGD 1KX3B 5CPIB 3WA9B 4Z5TB 4LD9A 3WKJB 5GXQD 3UTBC 1HQ3D 4J8WD 3VH5W 3X1UB 5B2JC 2CV5C 3FDDA 3B6GC 1S32A 3A6ND 4H9OA 1TAFB 5B32A 5GT3C 1P3BD 3V9RB 5DNMA 5JRGC 3MGPC 1PZRA 4XUJD 3R45B 4J8XA 3REHA 2FJ7D 1F66B 5DNNC 1P3OA 4KHAA 5AY8A 4CAYA 3X1TC 5E5AD 3MNNA 3AZIC 3MVDA 4AWLB 1ZLAA 4WU9C 2Y2JA 3TU4C 3REKD 2JCHA 5AV9C 3AYWA 3B6FC 2IO5B 1EQZD 5CPKB 1TZYB 1P34C 3AZMD 5B2IC 1P3FA 5B1LA 1P3LB 3REID 1KX3C 5CPIC 2ZM5A 3WA9C 4Z5TC 3WKJC 2CWEA 5B40D 3LJAD 3W98C 4XZQA 1P3MD 4UUZB 1AOID 1R4VA 3B0CW 1ULYA 3C1CD 4YM6D 4DQYB 3X1UC 5FUGB 5CPJB 3W97A 5AVCA 3AZHA 5JA4B 3RELD 2Y2GA 5B31B 1U35D 1P3ID 5C3IB 3MGQD 3AN2A 1F66C 5BNVA 4NE6A 2HIOD 5GSUD 3AZKC 4UPKA 4J8VB 3AFAA 4KGCD 3AV1D 5B0YB 1P3KD 5B0ZB 4AWLC 4LD9D 2IO5C 3UT9B 5CPKC 1TZYC 5CP6B 5AVBB 2DF4C 5GT0B 1P3LC 2HUEB 2NZDB 5AV8D 1B6WA 1S32D 1JFIB 5B32D 1H3OB 5CPJC 4J8XD 5B2JA 2CV5A 4R8PD 1BH9B 5B33B 3B6GA 1ID3D 5B31C 4WV4B 3MNND 5GT3A 3AZJD 5C3IC 5JRGA 3MGPA 1ZLAD 1BH8A 2BYMB 3AZND 4X23B 4ZUXA 1N1JA 3EPLA 4J8VC 3IP4C 3X1TA 3C1BB 5AV6B 3LZ1D 5B0ZC 1P3FD 1F1EA 4H9PB 5B1LD 3AZIA 4EO5B 4WU9A 4E44A 4XZQD 1M1AD 5AV9A 3B6FA 3UT9C 5GT0C 3H0LC 5B2IA 3AZHD 2HUEC 3KSYA 5F99A 1KX3A 4Z5TA 3WA9A 3W98A 1KX5B 3X1UA 2FFFB 3EG5B 4HGAB 3AN2D 4H9NB 4WU8D 5B33C 5KDMA 3AFAD 3AV2D 3EPKA 3W96D 5BO0B 3AZGB 1TAFA 2L5AA 3V9RA 4Z66B 3W99A 3R45A 1HQ3B 3WAAC 5B1MB 4JJND 1A7WA 4J8WB 1F66A 3AL0C 3AZKA 3WTPE 4X23C 2Y2QA 4ZBJB 4YS3A 1KU5A 5AV6C 3A6NB 2Y2MA 4EO5C 1P3BB 5BNXB 1P3PD 4Z2MH 2FJ7B 2F8NA 5CPKA 5B2JD 2CV5D 1P3LA 5E5AB 3B6GD 4J8UD 1M18B 5B24B 3MGSD 3VH5T 1M19D 5GT3D 3REKB 3AZFD 2NQBC 1KX5C 3NQUA 5AV5D 5FUGA 2F2AC 4HGAC 4CSRB 4QLCB 5CPJA 1EQZB 4KUDC 3AZMB 5JA4A 4ZUXD 5B31A 2PYOA 2Y2HA 3AZGC 3REIB 3X1TD 5B40B 3LJAB 4G92C 4Z66C 3LELA 2F8NH 1AOIB 4WU9D 5G49A 1HQ3C 5B1MC 4YM6B 5AV9D 2AROD 3RELB 5B0ZA 4WJ3C 1KX3D 5F99D 3WA9D 1P3BC 1U35B 3W98D 3MGQB 2RVQD 2ZY4A 2FJ7C 4KUDB 3X1VD 3UT9A 2HIOB 3H0MC 5GSUB 4Z2MG 3B0DB 5E5AC 3LZ0D 3NQJB 1P3KB 1M18C 4H9SC 5B24C 2W8SA 3A1KA 1JFIA 5BT1D 3WTPD 3KUYA 3REJD 3REKC 1H3OA 3W99D 2BG1A 4NFTA 4QLCC 1EQZC 1F66D 5B33A 3AZKD 3AZMC 4YS3D 5AV8B 3LJAC 1S32B 4H9OB 3MGRA 1AOIC 3WAAA 2BYMA 2YFWA 4YM6C 1P3GB 1P3AA 3UTAB 2F8NG 4X23A 4J8XB 2F8ND 4R8PB 5CPKD 1KX4B 3RELC 1ID3B 5AV6A 5BS7C 4CAYB 4H9PA 1P3LD 2YFVB 3MNNB 2Y2IA 1U35C 3AZJB 5B32G 3MGQC 3UTBA 1ZLAB 3H0RC 5DNMD 3AZNB 2HIOC
chains in the Genus database with same CATH topology
2RIQA 3REHD 3B0DC 1P3OD 3LZ1B 1P3KC 5B31D 2PYOD 5B1LB 5AY8D 2ZY5A 3X1SB 3KWQB 2NQBA 3MVDD 3LELD 1M1AB 2LY8A 3VH6T 1KX5A 3AZLB 5DNNA 2Y2PA 3AYWD 5BO0A 5B0YC 5AV8C 5B0ZD 3O62B 4Z66A 4NE5A 3TU4A 5B1MA 1BFMA 1P3GC 3UTAC 4WU8B 3AN2B 4R8PC 5CP6C 4H9RB 1T3UA 5AVBC 3AZEB 1P34A 5AVCD 3AFAB 3AV2B 1KX4C 1ID3C 3W97D 3W96B 5CPIA 1P3BA 2NZDC 3WKJA 3AZJC 5BNXA 3KUYD 1ZLAC 2FJ7A 4JJNB 3AZNC 3KXBB 5E5AA 3LZ1C 1M18A 5B1LC 4H9SA 5B24A 2XD5A 2G5HC 3KWQC 3X1SC 5GXQB 3MGRD 1P3PB 1M1AC 3EPHA 4CSRA 4QLCA 3WAAD 2Y2NA 3AZLC 1P3AD 3AZMA 2CV5B 4M6BA 3C1BC 4J8UB 3LJAA 3O62C 3MGSB 1M19B 1AOIA 3AZFB 3UTBD 5AV5B 1BH8B 2JSSA 2Y2LA 4XUJB 4WU8C 2BYKB 1TZYA 4ZUXB 3AZEC 3AV2C 3W96C 4WNNB 1U35A 4UUZA 4WU9B 4JJNC 2NQBD 1KX5D 4KUDA 2Y2OA 5JRGD 2HIOA 3F6TA 3MGPD 2AROB 5DNND 3KXBC 5F99B 3W98B 5GXQC 3AZID 4Z66D 1P3MB 1P3PC 2ZY3A 3TU4D 3X1VB 5B1MD 3C1CB 4J8WC 4H9QB 4J8VA 3B6FD 4ZBJC 5KDMB 1P34D 3LZ0B 4G91B 5B0YA 4J8UC 5AV8A 3A6NC 5B2ID 3MGSC 3WTPB 5CPID 3REJB 1M19C 4Z5TD 3WKJD 1P3IB 3AZFC 1Q9CA 5AV5C 1P3GA 3W99B 3UTAA 4XUJC 3VH6A 4R8PA 3AZKB 5CP6A 3X1UD 4ZUXC 5AVBA 1KX4A 5GT0A 1ID3A 2XD1A 4YS3B 3AV1B 4KGCB 2YFVA 1M18D 2NZDA 3B0CT 5B24D 3AZJA 4LD9B 3AZNA 2AROC 2JE5A 4QLCD 2F8NB 1BH9A 2F8NK 3LZ1A 3REIC 5F99C 3X1SA 1B67A 3KWQA 5B40C 1P3MC 1M1AA 1WWSA 2RVQC 2VQRA 4DRBA 5B32B 5DNMB 3X1VC 3KFUG 3NQUB 3C1CC 3AZLA 3REHB 1P3OB 4KHAB 1TZYD 3LZ0C 4G91C 3C1BA 2PYOB 5AY8B 5BT1C 3WTPC 3O62A 3REJC 1HTAA 1P3IC 2ZY2A 3MVDB 3LELB 3W99C 5G49B 4WU8A 4KUDD 4H9RA 5GSUC 3AYWB 3AZEA 5CPJD 3AV2A 3W96A 4YS3C 4KGCC 4WZSB 3AV1C 5B31G 1P3FB 4LD9C 4XZQB 4JJNA 4E45A 4H9NA 3KXBA 2G5IC 5AVCB 3W97B 4J8VD 2Y2KA 3AZGA 3AZHB 3P5JB 5B0YD 1S32C 5GXQA 3KUYB 1Z2CB 1P3PA 5B32C 5CHLB 3VH5A 5DNMC 1HQ3A 2DQNC 1P3GD 4J8WA 3B0BA 3UTAD 4J8XC 3REHC 1WWIA 5BNVB 3UT9D 5CP6D 3VH6W 5AVBD 1P3OC 4J8UA 5GT0D 1KX4D 2PYOC 5AY8C 3A6NA 3MNNC 3MGSA 1M19A 2NZDD 3AZFA 3MVDC 3LELC 3MGRB 5AV5A 4XUJA 3WAAB 2YFWB 1P3AB 2BYKA 3AYWC 5B33D 4WNNA 1P3FC 3X1SD 3KWQD 4XZQC 3REKA 3UTBB 2AROA 3AZLD 1EQZA 5AVCC 4X23D 5B2JB 3W97C 3REIA 3AZHC 3B6GB 3C1BD 5AV6D 5B40A 3O62D 3KUYC 1P3MA 5GT3B 2NQBB 3X1VA 5JRGB 2J8PA 4YM6A 3MGPB 3C1CA 4H9QA 3AN2C 5DNNB 3EPJA 1W2EA 3LZ0A 3AZED 1N1JB 4DRAA 3AFAC 3RELA 5BS7A 3X1TB 4NE3A 3WTPA 3REJA 4G92B 1P3IA 3AZIB 3MGRC 3MGQA 3TU4B 1P3AC 5AV9B 5GSUA 3B6FB 3A1IA 4KGCA 3KXBD 3AV1A 1P34B 3NQJA 1P3KA 5B2IB 2UWXA 3AZGD 1KX3B 5CPIB 3WA9B 4Z5TB 4LD9A 3WKJB 5GXQD 3UTBC 1HQ3D 4J8WD 3VH5W 3X1UB 5B2JC 2CV5C 3FDDA 3B6GC 1S32A 3A6ND 4H9OA 1TAFB 5B32A 5GT3C 1P3BD 3V9RB 5DNMA 5JRGC 3MGPC 1PZRA 4XUJD 3R45B 4J8XA 3REHA 2FJ7D 1F66B 5DNNC 1P3OA 4KHAA 5AY8A 4CAYA 3X1TC 5E5AD 3MNNA 3AZIC 3MVDA 4AWLB 1ZLAA 4WU9C 2Y2JA 3TU4C 3REKD 2JCHA 5AV9C 3AYWA 3B6FC 2IO5B 1EQZD 5CPKB 1TZYB 1P34C 3AZMD 5B2IC 1P3FA 5B1LA 1P3LB 3REID 1KX3C 5CPIC 2ZM5A 3WA9C 4Z5TC 3WKJC 2CWEA 5B40D 3LJAD 3W98C 4XZQA 1P3MD 4UUZB 1AOID 1R4VA 3B0CW 1ULYA 3C1CD 4YM6D 4DQYB 3X1UC 5FUGB 5CPJB 3W97A 5AVCA 3AZHA 5JA4B 3RELD 2Y2GA 5B31B 1U35D 1P3ID 5C3IB 3MGQD 3AN2A 1F66C 5BNVA 4NE6A 2HIOD 5GSUD 3AZKC 4UPKA 4J8VB 3AFAA 4KGCD 3AV1D 5B0YB 1P3KD 5B0ZB 4AWLC 4LD9D 2IO5C 3UT9B 5CPKC 1TZYC 5CP6B 5AVBB 2DF4C 5GT0B 1P3LC 2HUEB 2NZDB 5AV8D 1B6WA 1S32D 1JFIB 5B32D 1H3OB 5CPJC 4J8XD 5B2JA 2CV5A 4R8PD 1BH9B 5B33B 3B6GA 1ID3D 5B31C 4WV4B 3MNND 5GT3A 3AZJD 5C3IC 5JRGA 3MGPA 1ZLAD 1BH8A 2BYMB 3AZND 4X23B 4ZUXA 1N1JA 3EPLA 4J8VC 3IP4C 3X1TA 3C1BB 5AV6B 3LZ1D 5B0ZC 1P3FD 1F1EA 4H9PB 5B1LD 3AZIA 4EO5B 4WU9A 4E44A 4XZQD 1M1AD 5AV9A 3B6FA 3UT9C 5GT0C 3H0LC 5B2IA 3AZHD 2HUEC 3KSYA 5F99A 1KX3A 4Z5TA 3WA9A 3W98A 1KX5B 3X1UA 2FFFB 3EG5B 4HGAB 3AN2D 4H9NB 4WU8D 5B33C 5KDMA 3AFAD 3AV2D 3EPKA 3W96D 5BO0B 3AZGB 1TAFA 2L5AA 3V9RA 4Z66B 3W99A 3R45A 1HQ3B 3WAAC 5B1MB 4JJND 1A7WA 4J8WB 1F66A 3AL0C 3AZKA 3WTPE 4X23C 2Y2QA 4ZBJB 4YS3A 1KU5A 5AV6C 3A6NB 2Y2MA 4EO5C 1P3BB 5BNXB 1P3PD 4Z2MH 2FJ7B 2F8NA 5CPKA 5B2JD 2CV5D 1P3LA 5E5AB 3B6GD 4J8UD 1M18B 5B24B 3MGSD 3VH5T 1M19D 5GT3D 3REKB 3AZFD 2NQBC 1KX5C 3NQUA 5AV5D 5FUGA 2F2AC 4HGAC 4CSRB 4QLCB 5CPJA 1EQZB 4KUDC 3AZMB 5JA4A 4ZUXD 5B31A 2PYOA 2Y2HA 3AZGC 3REIB 3X1TD 5B40B 3LJAB 4G92C 4Z66C 3LELA 2F8NH 1AOIB 4WU9D 5G49A 1HQ3C 5B1MC 4YM6B 5AV9D 2AROD 3RELB 5B0ZA 4WJ3C 1KX3D 5F99D 3WA9D 1P3BC 1U35B 3W98D 3MGQB 2RVQD 2ZY4A 2FJ7C 4KUDB 3X1VD 3UT9A 2HIOB 3H0MC 5GSUB 4Z2MG 3B0DB 5E5AC 3LZ0D 3NQJB 1P3KB 1M18C 4H9SC 5B24C 2W8SA 3A1KA 1JFIA 5BT1D 3WTPD 3KUYA 3REJD 3REKC 1H3OA 3W99D 2BG1A 4NFTA 4QLCC 1EQZC 1F66D 5B33A 3AZKD 3AZMC 4YS3D 5AV8B 3LJAC 1S32B 4H9OB 3MGRA 1AOIC 3WAAA 2BYMA 2YFWA 4YM6C 1P3GB 1P3AA 3UTAB 2F8NG 4X23A 4J8XB 2F8ND 4R8PB 5CPKD 1KX4B 3RELC 1ID3B 5AV6A 5BS7C 4CAYB 4H9PA 1P3LD 2YFVB 3MNNB 2Y2IA 1U35C 3AZJB 5B32G 3MGQC 3UTBA 1ZLAB 3H0RC 5DNMD 3AZNB 2HIOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REH D;  3B0D C;  1P3O D;  3LZ1 B;  1P3K C;  5B31 D;  2PYO D;  5B1L B;  5AY8 D;  3X1S B;  3KWQ B;  2NQB A;  3MVD D;  3LEL D;  1M1A B;  2LY8 A;  3VH6 T;  1KX5 A;  3AZL B;  5DNN A;  3AYW D;  5BO0 A;  5B0Y C;  5AV8 C;  5B0Z D;  3O62 B;  4Z66 A;  4NE5 A;  3TU4 A;  5B1M A;  1BFM A;  1P3G C;  3UTA C;  4WU8 B;  3AN2 B;  4R8P C;  5CP6 C;  4H9R B;  5AVB C;  1P34 A;  3AZE B;  1KX4 C;  5AVC D;  3AFA B;  3AV2 B;  1ID3 C;  3W97 D;  3W96 B;  5CPI A;  1P3B A;  2NZD C;  3WKJ A;  3AZJ C;  5BNX A;  3KUY D;  1ZLA C;  2FJ7 A;  4JJN B;  3AZN C;  3KXB B;  5E5A A;  3LZ1 C;  1M18 A;  5B1L C;  4H9S A;  5B24 A;  3X1S C;  3KWQ C;  5GXQ B;  3MGR D;  1P3P B;  1M1A C;  4CSR A;  4QLC A;  3WAA D;  3AZL C;  1P3A D;  3AZM A;  2CV5 B;  4M6B A;  3C1B C;  4J8U B;  3LJA A;  3O62 C;  3MGS B;  1M19 B;  1AOI A;  3AZF B;  3UTB D;  5AV5 B;  1BH8 B;  2JSS A;  4XUJ B;  4WU8 C;  2BYK B;  1TZY A;  4ZUX B;  3AZE C;  3AV2 C;  3W96 C;  4WNN B;  1U35 A;  4UUZ A;  4WU9 B;  4JJN C;  2NQB D;  1KX5 D;  4KUD A;  5JRG D;  2HIO A;  3MGP D;  2ARO B;  5DNN D;  3KXB C;  5F99 B;  3W98 B;  5GXQ C;  3AZI D;  4Z66 D;  1P3M B;  1P3P C;  3TU4 D;  3X1V B;  5B1M D;  3C1C B;  4J8W C;  4H9Q B;  4J8V A;  3B6F D;  4ZBJ C;  5KDM B;  1P34 D;  3LZ0 B;  4G91 B;  5B0Y A;  4J8U C;  5AV8 A;  3A6N C;  5B2I D;  3MGS C;  3WTP B;  5CPI D;  3REJ B;  1M19 C;  4Z5T D;  3WKJ D;  1P3I B;  3AZF C;  1Q9C A;  5AV5 C;  1P3G A;  3W99 B;  3UTA A;  4XUJ C;  3VH6 A;  4R8P A;  3AZK B;  5CP6 A;  3X1U D;  4ZUX C;  5AVB A;  1KX4 A;  5GT0 A;  1ID3 A;  4YS3 B;  4KGC B;  3AV1 B;  2YFV A;  1M18 D;  2NZD A;  3B0C T;  5B24 D;  3AZJ A;  4LD9 B;  3AZN A;  2ARO C;  4QLC D;  2F8N B;  1BH9 A;  2F8N K;  3LZ1 A;  3REI C;  5F99 C;  3X1S A;  1B67 A;  3KWQ A;  5B40 C;  1P3M C;  1M1A A;  1WWS A;  2RVQ C;  4DRB A;  5B32 B;  5DNM B;  3X1V C;  3NQU B;  3C1C C;  3AZL A;  3REH B;  1P3O B;  4KHA B;  1TZY D;  3LZ0 C;  4G91 C;  3C1B A;  2PYO B;  5AY8 B;  5BT1 C;  3WTP C;  3O62 A;  3REJ C;  1HTA A;  1P3I C;  3MVD B;  3LEL B;  3W99 C;  5G49 B;  4WU8 A;  4KUD D;  4H9R A;  5GSU C;  3AYW B;  3AZE A;  5CPJ D;  3AV2 A;  3W96 A;  4YS3 C;  4KGC C;  4WZS B;  3AV1 C;  5B31 G;  1P3F B;  4LD9 C;  4XZQ B;  4JJN A;  4E45 A;  4H9N A;  3KXB A;  5AVC B;  3W97 B;  4J8V D;  3AZG A;  3AZH B;  5B0Y D;  1S32 C;  5GXQ A;  3KUY B;  1P3P A;  5B32 C;  5CHL B;  3VH5 A;  5DNM C;  1HQ3 A;  1P3G D;  4J8W A;  3B0B A;  3UTA D;  4J8X C;  3REH C;  1WWI A;  5BNV B;  3UT9 D;  5CP6 D;  3VH6 W;  5AVB D;  1P3O C;  4J8U A;  5GT0 D;  1KX4 D;  2PYO C;  5AY8 C;  3A6N A;  3MNN C;  3MGS A;  1M19 A;  2NZD D;  3AZF A;  3MVD C;  3LEL C;  3MGR B;  5AV5 A;  4XUJ A;  3WAA B;  2YFW B;  1P3A B;  2BYK A;  3AYW C;  5B33 D;  4WNN A;  1P3F C;  3X1S D;  3KWQ D;  4XZQ C;  3REK A;  3UTB B;  2ARO A;  3AZL D;  1EQZ A;  5AVC C;  4X23 D;  5B2J B;  3W97 C;  3REI A;  3AZH C;  3B6G B;  3C1B D;  5AV6 D;  5B40 A;  3O62 D;  3KUY C;  1P3M A;  5GT3 B;  2NQB B;  3X1V A;  5JRG B;  3C1C A;  4YM6 A;  3MGP B;  4H9Q A;  3AN2 C;  5DNN B;  3LZ0 A;  3AZE D;  1N1J B;  4DRA A;  3AFA C;  3REL A;  5BS7 A;  3X1T B;  4NE3 A;  3WTP A;  3REJ A;  4G92 B;  1P3I A;  3AZI B;  3MGR C;  3MGQ A;  3TU4 B;  1P3A C;  5AV9 B;  5GSU A;  3B6F B;  4KGC A;  3KXB D;  3AV1 A;  1P34 B;  3NQJ A;  1P3K A;  5B2I B;  3AZG D;  1KX3 B;  5CPI B;  3WA9 B;  4Z5T B;  4LD9 A;  3WKJ B;  5GXQ D;  3UTB C;  1HQ3 D;  4J8W D;  3VH5 W;  3X1U B;  5B2J C;  2CV5 C;  3B6G C;  1S32 A;  3A6N D;  4H9O A;  1TAF B;  5B32 A;  5GT3 C;  1P3B D;  3V9R B;  5DNM A;  5JRG C;  3MGP C;  4XUJ D;  3R45 B;  4J8X A;  3REH A;  2FJ7 D;  1F66 B;  5DNN C;  1P3O A;  4KHA A;  5AY8 A;  4CAY A;  3X1T C;  5E5A D;  3MNN A;  3AZI C;  3MVD A;  4AWL B;  1ZLA A;  4WU9 C;  3TU4 C;  3REK D;  5AV9 C;  3AYW A;  3B6F C;  2IO5 B;  1EQZ D;  5CPK B;  1TZY B;  1P34 C;  3AZM D;  5B2I C;  1P3F A;  5B1L A;  1P3L B;  3REI D;  1KX3 C;  5CPI C;  3WA9 C;  4Z5T C;  3WKJ C;  2CWE A;  5B40 D;  3LJA D;  3W98 C;  4XZQ A;  1P3M D;  4UUZ B;  1AOI D;  1R4V A;  3B0C W;  1ULY A;  3C1C D;  4YM6 D;  3X1U C;  5FUG B;  5CPJ B;  3W97 A;  5AVC A;  3AZH A;  5JA4 B;  3REL D;  5B31 B;  1U35 D;  1P3I D;  5C3I B;  3MGQ D;  3AN2 A;  1F66 C;  5BNV A;  4NE6 A;  2HIO D;  5GSU D;  3AZK C;  4J8V B;  3AFA A;  4KGC D;  3AV1 D;  5B0Y B;  1P3K D;  5B0Z B;  4AWL C;  4LD9 D;  2IO5 C;  3UT9 B;  5CPK C;  1TZY C;  5CP6 B;  5AVB B;  5GT0 B;  1P3L C;  2HUE B;  2NZD B;  5AV8 D;  1B6W A;  1S32 D;  1JFI B;  5B32 D;  1H3O B;  5CPJ C;  4J8X D;  5B2J A;  2CV5 A;  4R8P D;  1BH9 B;  5B33 B;  3B6G A;  1ID3 D;  5B31 C;  4WV4 B;  3MNN D;  5GT3 A;  3AZJ D;  5C3I C;  5JRG A;  3MGP A;  1ZLA D;  1BH8 A;  2BYM B;  3AZN D;  4X23 B;  4ZUX A;  1N1J A;  4J8V C;  3X1T A;  3C1B B;  5AV6 B;  3LZ1 D;  5B0Z C;  1P3F D;  1F1E A;  4H9P B;  5B1L D;  3AZI A;  4EO5 B;  4WU9 A;  4E44 A;  4XZQ D;  1M1A D;  5AV9 A;  3B6F A;  3UT9 C;  5GT0 C;  5B2I A;  3AZH D;  2HUE C;  3KSY A;  5F99 A;  1KX3 A;  4Z5T A;  3WA9 A;  3W98 A;  1KX5 B;  3X1U A;  4HGA B;  3AN2 D;  4H9N B;  4WU8 D;  5B33 C;  5KDM A;  3AFA D;  3AV2 D;  3W96 D;  5BO0 B;  3AZG B;  1TAF A;  2L5A A;  3V9R A;  4Z66 B;  3W99 A;  3R45 A;  1HQ3 B;  3WAA C;  5B1M B;  4JJN D;  1A7W A;  4J8W B;  1F66 A;  3AZK A;  3WTP E;  4X23 C;  4ZBJ B;  4YS3 A;  1KU5 A;  5AV6 C;  3A6N B;  4EO5 C;  1P3B B;  5BNX B;  1P3P D;  4Z2M H;  2FJ7 B;  2F8N A;  5CPK A;  5B2J D;  2CV5 D;  1P3L A;  5E5A B;  3B6G D;  4J8U D;  1M18 B;  5B24 B;  3MGS D;  3VH5 T;  1M19 D;  5GT3 D;  3REK B;  3AZF D;  2NQB C;  1KX5 C;  3NQU A;  5AV5 D;  5FUG A;  4HGA C;  4CSR B;  4QLC B;  5CPJ A;  4KUD C;  1EQZ B;  3AZM B;  5JA4 A;  4ZUX D;  5B31 A;  2PYO A;  3AZG C;  3REI B;  3X1T D;  5B40 B;  3LJA B;  4G92 C;  4Z66 C;  3LEL A;  2F8N H;  1AOI B;  4WU9 D;  5G49 A;  1HQ3 C;  5B1M C;  4YM6 B;  5AV9 D;  2ARO D;  3REL B;  5B0Z A;  1KX3 D;  5F99 D;  3WA9 D;  1P3B C;  1U35 B;  3W98 D;  3MGQ B;  2RVQ D;  2FJ7 C;  4KUD B;  3X1V D;  3UT9 A;  2HIO B;  5GSU B;  4Z2M G;  3B0D B;  5E5A C;  3LZ0 D;  3NQJ B;  1P3K B;  1M18 C;  4H9S C;  5B24 C;  1JFI A;  5BT1 D;  3WTP D;  3KUY A;  3REJ D;  3REK C;  1H3O A;  3W99 D;  4NFT A;  4QLC C;  1EQZ C;  1F66 D;  5B33 A;  3AZK D;  3AZM C;  4YS3 D;  5AV8 B;  3LJA C;  1S32 B;  4H9O B;  3MGR A;  1AOI C;  3WAA A;  2BYM A;  2YFW A;  4YM6 C;  1P3G B;  1P3A A;  3UTA B;  2F8N G;  4X23 A;  4J8X B;  2F8N D;  4R8P B;  5CPK D;  1KX4 B;  3REL C;  1ID3 B;  5AV6 A;  5BS7 C;  4CAY B;  4H9P A;  1P3L D;  2YFV B;  3MNN B;  1U35 C;  3AZJ B;  5B32 G;  3MGQ C;  3UTB A;  1ZLA B;  5DNM D;  3AZN B;  2HIO C; 
#chains in the Genus database with same CATH topology
 2RIQ A;  3REH D;  3B0D C;  1P3O D;  3LZ1 B;  1P3K C;  5B31 D;  2PYO D;  5B1L B;  5AY8 D;  2ZY5 A;  3X1S B;  3KWQ B;  2NQB A;  3MVD D;  3LEL D;  1M1A B;  2LY8 A;  3VH6 T;  1KX5 A;  3AZL B;  5DNN A;  2Y2P A;  3AYW D;  5BO0 A;  5B0Y C;  5AV8 C;  5B0Z D;  3O62 B;  4Z66 A;  4NE5 A;  3TU4 A;  5B1M A;  1BFM A;  1P3G C;  3UTA C;  4WU8 B;  3AN2 B;  4R8P C;  5CP6 C;  4H9R B;  1T3U A;  5AVB C;  3AZE B;  1P34 A;  5AVC D;  3AFA B;  3AV2 B;  1KX4 C;  1ID3 C;  3W97 D;  3W96 B;  5CPI A;  1P3B A;  2NZD C;  3WKJ A;  3AZJ C;  5BNX A;  3KUY D;  1ZLA C;  2FJ7 A;  4JJN B;  3AZN C;  3KXB B;  5E5A A;  3LZ1 C;  1M18 A;  5B1L C;  4H9S A;  5B24 A;  2XD5 A;  2G5H C;  3KWQ C;  3X1S C;  5GXQ B;  3MGR D;  1P3P B;  1M1A C;  3EPH A;  4CSR A;  4QLC A;  3WAA D;  2Y2N A;  3AZL C;  1P3A D;  3AZM A;  2CV5 B;  4M6B A;  3C1B C;  4J8U B;  3LJA A;  3O62 C;  3MGS B;  1M19 B;  1AOI A;  3AZF B;  3UTB D;  5AV5 B;  1BH8 B;  2JSS A;  2Y2L A;  4XUJ B;  4WU8 C;  2BYK B;  1TZY A;  4ZUX B;  3AZE C;  3AV2 C;  3W96 C;  4WNN B;  1U35 A;  4UUZ A;  4WU9 B;  4JJN C;  2NQB D;  1KX5 D;  4KUD A;  2Y2O A;  5JRG D;  2HIO A;  3F6T A;  3MGP D;  2ARO B;  5DNN D;  3KXB C;  5F99 B;  3W98 B;  5GXQ C;  3AZI D;  4Z66 D;  1P3M B;  1P3P C;  2ZY3 A;  3TU4 D;  3X1V B;  5B1M D;  3C1C B;  4J8W C;  4H9Q B;  4J8V A;  3B6F D;  4ZBJ C;  5KDM B;  1P34 D;  3LZ0 B;  4G91 B;  5B0Y A;  4J8U C;  5AV8 A;  3A6N C;  5B2I D;  3MGS C;  3WTP B;  5CPI D;  3REJ B;  1M19 C;  4Z5T D;  3WKJ D;  1P3I B;  3AZF C;  1Q9C A;  5AV5 C;  1P3G A;  3W99 B;  3UTA A;  4XUJ C;  3VH6 A;  4R8P A;  3AZK B;  5CP6 A;  3X1U D;  4ZUX C;  5AVB A;  1KX4 A;  5GT0 A;  1ID3 A;  2XD1 A;  4YS3 B;  3AV1 B;  4KGC B;  2YFV A;  1M18 D;  2NZD A;  3B0C T;  5B24 D;  3AZJ A;  4LD9 B;  3AZN A;  2ARO C;  2JE5 A;  4QLC D;  2F8N B;  1BH9 A;  2F8N K;  3LZ1 A;  3REI C;  5F99 C;  3X1S A;  1B67 A;  3KWQ A;  5B40 C;  1P3M C;  1M1A A;  1WWS A;  2RVQ C;  2VQR A;  4DRB A;  5B32 B;  5DNM B;  3X1V C;  3KFU G;  3NQU B;  3C1C C;  3AZL A;  3REH B;  1P3O B;  4KHA B;  1TZY D;  3LZ0 C;  4G91 C;  3C1B A;  2PYO B;  5AY8 B;  5BT1 C;  3WTP C;  3O62 A;  3REJ C;  1HTA A;  1P3I C;  2ZY2 A;  3MVD B;  3LEL B;  3W99 C;  5G49 B;  4WU8 A;  4KUD D;  4H9R A;  5GSU C;  3AYW B;  3AZE A;  5CPJ D;  3AV2 A;  3W96 A;  4YS3 C;  4KGC C;  4WZS B;  3AV1 C;  5B31 G;  1P3F B;  4LD9 C;  4XZQ B;  4JJN A;  4E45 A;  4H9N A;  3KXB A;  2G5I C;  5AVC B;  3W97 B;  4J8V D;  2Y2K A;  3AZG A;  3AZH B;  3P5J B;  5B0Y D;  1S32 C;  5GXQ A;  3KUY B;  1Z2C B;  1P3P A;  5B32 C;  5CHL B;  3VH5 A;  5DNM C;  1HQ3 A;  2DQN C;  1P3G D;  4J8W A;  3B0B A;  3UTA D;  4J8X C;  3REH C;  1WWI A;  5BNV B;  3UT9 D;  5CP6 D;  3VH6 W;  5AVB D;  1P3O C;  4J8U A;  5GT0 D;  1KX4 D;  2PYO C;  5AY8 C;  3A6N A;  3MNN C;  3MGS A;  1M19 A;  2NZD D;  3AZF A;  3MVD C;  3LEL C;  3MGR B;  5AV5 A;  4XUJ A;  3WAA B;  2YFW B;  1P3A B;  2BYK A;  3AYW C;  5B33 D;  4WNN A;  1P3F C;  3X1S D;  3KWQ D;  4XZQ C;  3REK A;  3UTB B;  2ARO A;  3AZL D;  1EQZ A;  5AVC C;  4X23 D;  5B2J B;  3W97 C;  3REI A;  3AZH C;  3B6G B;  3C1B D;  5AV6 D;  5B40 A;  3O62 D;  3KUY C;  1P3M A;  5GT3 B;  2NQB B;  3X1V A;  5JRG B;  2J8P A;  4YM6 A;  3MGP B;  3C1C A;  4H9Q A;  3AN2 C;  5DNN B;  3EPJ A;  1W2E A;  3LZ0 A;  3AZE D;  1N1J B;  4DRA A;  3AFA C;  3REL A;  5BS7 A;  3X1T B;  4NE3 A;  3WTP A;  3REJ A;  4G92 B;  1P3I A;  3AZI B;  3MGR C;  3MGQ A;  3TU4 B;  1P3A C;  5AV9 B;  5GSU A;  3B6F B;  3A1I A;  4KGC A;  3KXB D;  3AV1 A;  1P34 B;  3NQJ A;  1P3K A;  5B2I B;  2UWX A;  3AZG D;  1KX3 B;  5CPI B;  3WA9 B;  4Z5T B;  4LD9 A;  3WKJ B;  5GXQ D;  3UTB C;  1HQ3 D;  4J8W D;  3VH5 W;  3X1U B;  5B2J C;  2CV5 C;  3FDD A;  3B6G C;  1S32 A;  3A6N D;  4H9O A;  1TAF B;  5B32 A;  5GT3 C;  1P3B D;  3V9R B;  5DNM A;  5JRG C;  3MGP C;  1PZR A;  4XUJ D;  3R45 B;  4J8X A;  3REH A;  2FJ7 D;  1F66 B;  5DNN C;  1P3O A;  4KHA A;  5AY8 A;  4CAY A;  3X1T C;  5E5A D;  3MNN A;  3AZI C;  3MVD A;  4AWL B;  1ZLA A;  4WU9 C;  2Y2J A;  3TU4 C;  3REK D;  2JCH A;  5AV9 C;  3AYW A;  3B6F C;  2IO5 B;  1EQZ D;  5CPK B;  1TZY B;  1P34 C;  3AZM D;  5B2I C;  1P3F A;  5B1L A;  1P3L B;  3REI D;  1KX3 C;  5CPI C;  2ZM5 A;  3WA9 C;  4Z5T C;  3WKJ C;  2CWE A;  5B40 D;  3LJA D;  3W98 C;  4XZQ A;  1P3M D;  4UUZ B;  1AOI D;  1R4V A;  3B0C W;  1ULY A;  3C1C D;  4YM6 D;  4DQY B;  3X1U C;  5FUG B;  5CPJ B;  3W97 A;  5AVC A;  3AZH A;  5JA4 B;  3REL D;  2Y2G A;  5B31 B;  1U35 D;  1P3I D;  5C3I B;  3MGQ D;  3AN2 A;  1F66 C;  5BNV A;  4NE6 A;  2HIO D;  5GSU D;  3AZK C;  4UPK A;  4J8V B;  3AFA A;  4KGC D;  3AV1 D;  5B0Y B;  1P3K D;  5B0Z B;  4AWL C;  4LD9 D;  2IO5 C;  3UT9 B;  5CPK C;  1TZY C;  5CP6 B;  5AVB B;  2DF4 C;  5GT0 B;  1P3L C;  2HUE B;  2NZD B;  5AV8 D;  1B6W A;  1S32 D;  1JFI B;  5B32 D;  1H3O B;  5CPJ C;  4J8X D;  5B2J A;  2CV5 A;  4R8P D;  1BH9 B;  5B33 B;  3B6G A;  1ID3 D;  5B31 C;  4WV4 B;  3MNN D;  5GT3 A;  3AZJ D;  5C3I C;  5JRG A;  3MGP A;  1ZLA D;  1BH8 A;  2BYM B;  3AZN D;  4X23 B;  4ZUX A;  1N1J A;  3EPL A;  4J8V C;  3IP4 C;  3X1T A;  3C1B B;  5AV6 B;  3LZ1 D;  5B0Z C;  1P3F D;  1F1E A;  4H9P B;  5B1L D;  3AZI A;  4EO5 B;  4WU9 A;  4E44 A;  4XZQ D;  1M1A D;  5AV9 A;  3B6F A;  3UT9 C;  5GT0 C;  3H0L C;  5B2I A;  3AZH D;  2HUE C;  3KSY A;  5F99 A;  1KX3 A;  4Z5T A;  3WA9 A;  3W98 A;  1KX5 B;  3X1U A;  2FFF B;  3EG5 B;  4HGA B;  3AN2 D;  4H9N B;  4WU8 D;  5B33 C;  5KDM A;  3AFA D;  3AV2 D;  3EPK A;  3W96 D;  5BO0 B;  3AZG B;  1TAF A;  2L5A A;  3V9R A;  4Z66 B;  3W99 A;  3R45 A;  1HQ3 B;  3WAA C;  5B1M B;  4JJN D;  1A7W A;  4J8W B;  1F66 A;  3AL0 C;  3AZK A;  3WTP E;  4X23 C;  2Y2Q A;  4ZBJ B;  4YS3 A;  1KU5 A;  5AV6 C;  3A6N B;  2Y2M A;  4EO5 C;  1P3B B;  5BNX B;  1P3P D;  4Z2M H;  2FJ7 B;  2F8N A;  5CPK A;  5B2J D;  2CV5 D;  1P3L A;  5E5A B;  3B6G D;  4J8U D;  1M18 B;  5B24 B;  3MGS D;  3VH5 T;  1M19 D;  5GT3 D;  3REK B;  3AZF D;  2NQB C;  1KX5 C;  3NQU A;  5AV5 D;  5FUG A;  2F2A C;  4HGA C;  4CSR B;  4QLC B;  5CPJ A;  1EQZ B;  4KUD C;  3AZM B;  5JA4 A;  4ZUX D;  5B31 A;  2PYO A;  2Y2H A;  3AZG C;  3REI B;  3X1T D;  5B40 B;  3LJA B;  4G92 C;  4Z66 C;  3LEL A;  2F8N H;  1AOI B;  4WU9 D;  5G49 A;  1HQ3 C;  5B1M C;  4YM6 B;  5AV9 D;  2ARO D;  3REL B;  5B0Z A;  4WJ3 C;  1KX3 D;  5F99 D;  3WA9 D;  1P3B C;  1U35 B;  3W98 D;  3MGQ B;  2RVQ D;  2ZY4 A;  2FJ7 C;  4KUD B;  3X1V D;  3UT9 A;  2HIO B;  3H0M C;  5GSU B;  4Z2M G;  3B0D B;  5E5A C;  3LZ0 D;  3NQJ B;  1P3K B;  1M18 C;  4H9S C;  5B24 C;  2W8S A;  3A1K A;  1JFI A;  5BT1 D;  3WTP D;  3KUY A;  3REJ D;  3REK C;  1H3O A;  3W99 D;  2BG1 A;  4NFT A;  4QLC C;  1EQZ C;  1F66 D;  5B33 A;  3AZK D;  3AZM C;  4YS3 D;  5AV8 B;  3LJA C;  1S32 B;  4H9O B;  3MGR A;  1AOI C;  3WAA A;  2BYM A;  2YFW A;  4YM6 C;  1P3G B;  1P3A A;  3UTA B;  2F8N G;  4X23 A;  4J8X B;  2F8N D;  4R8P B;  5CPK D;  1KX4 B;  3REL C;  1ID3 B;  5AV6 A;  5BS7 C;  4CAY B;  4H9P A;  1P3L D;  2YFV B;  3MNN B;  2Y2I A;  1U35 C;  3AZJ B;  5B32 G;  3MGQ C;  3UTB A;  1ZLA B;  3H0R C;  5DNM D;  3AZN B;  2HIO C; 
#chains in the Genus database with same CATH homology
 2RIQ A;  3REH D;  3B0D C;  1P3O D;  3LZ1 B;  1P3K C;  5B31 D;  2PYO D;  5B1L B;  5AY8 D;  2ZY5 A;  3X1S B;  3KWQ B;  2NQB A;  3MVD D;  3LEL D;  1M1A B;  2LY8 A;  3VH6 T;  1KX5 A;  3AZL B;  5DNN A;  2Y2P A;  3AYW D;  5BO0 A;  5B0Y C;  5AV8 C;  5B0Z D;  3O62 B;  4Z66 A;  4NE5 A;  3TU4 A;  5B1M A;  1BFM A;  1P3G C;  3UTA C;  4WU8 B;  3AN2 B;  4R8P C;  5CP6 C;  4H9R B;  1T3U A;  5AVB C;  3AZE B;  1P34 A;  5AVC D;  3AFA B;  3AV2 B;  1KX4 C;  1ID3 C;  3W97 D;  3W96 B;  5CPI A;  1P3B A;  2NZD C;  3WKJ A;  3AZJ C;  5BNX A;  3KUY D;  1ZLA C;  2FJ7 A;  4JJN B;  3AZN C;  3KXB B;  5E5A A;  3LZ1 C;  1M18 A;  5B1L C;  4H9S A;  5B24 A;  2XD5 A;  2G5H C;  3KWQ C;  3X1S C;  5GXQ B;  3MGR D;  1P3P B;  1M1A C;  3EPH A;  4CSR A;  4QLC A;  3WAA D;  2Y2N A;  3AZL C;  1P3A D;  3AZM A;  2CV5 B;  4M6B A;  3C1B C;  4J8U B;  3LJA A;  3O62 C;  3MGS B;  1M19 B;  1AOI A;  3AZF B;  3UTB D;  5AV5 B;  1BH8 B;  2JSS A;  2Y2L A;  4XUJ B;  4WU8 C;  2BYK B;  1TZY A;  4ZUX B;  3AZE C;  3AV2 C;  3W96 C;  4WNN B;  1U35 A;  4UUZ A;  4WU9 B;  4JJN C;  2NQB D;  1KX5 D;  4KUD A;  2Y2O A;  5JRG D;  2HIO A;  3F6T A;  3MGP D;  2ARO B;  5DNN D;  3KXB C;  5F99 B;  3W98 B;  5GXQ C;  3AZI D;  4Z66 D;  1P3M B;  1P3P C;  2ZY3 A;  3TU4 D;  3X1V B;  5B1M D;  3C1C B;  4J8W C;  4H9Q B;  4J8V A;  3B6F D;  4ZBJ C;  5KDM B;  1P34 D;  3LZ0 B;  4G91 B;  5B0Y A;  4J8U C;  5AV8 A;  3A6N C;  5B2I D;  3MGS C;  3WTP B;  5CPI D;  3REJ B;  1M19 C;  4Z5T D;  3WKJ D;  1P3I B;  3AZF C;  1Q9C A;  5AV5 C;  1P3G A;  3W99 B;  3UTA A;  4XUJ C;  3VH6 A;  4R8P A;  3AZK B;  5CP6 A;  3X1U D;  4ZUX C;  5AVB A;  1KX4 A;  5GT0 A;  1ID3 A;  2XD1 A;  4YS3 B;  3AV1 B;  4KGC B;  2YFV A;  1M18 D;  2NZD A;  3B0C T;  5B24 D;  3AZJ A;  4LD9 B;  3AZN A;  2ARO C;  2JE5 A;  4QLC D;  2F8N B;  1BH9 A;  2F8N K;  3LZ1 A;  3REI C;  5F99 C;  3X1S A;  1B67 A;  3KWQ A;  5B40 C;  1P3M C;  1M1A A;  1WWS A;  2RVQ C;  2VQR A;  4DRB A;  5B32 B;  5DNM B;  3X1V C;  3KFU G;  3NQU B;  3C1C C;  3AZL A;  3REH B;  1P3O B;  4KHA B;  1TZY D;  3LZ0 C;  4G91 C;  3C1B A;  2PYO B;  5AY8 B;  5BT1 C;  3WTP C;  3O62 A;  3REJ C;  1HTA A;  1P3I C;  2ZY2 A;  3MVD B;  3LEL B;  3W99 C;  5G49 B;  4WU8 A;  4KUD D;  4H9R A;  5GSU C;  3AYW B;  3AZE A;  5CPJ D;  3AV2 A;  3W96 A;  4YS3 C;  4KGC C;  4WZS B;  3AV1 C;  5B31 G;  1P3F B;  4LD9 C;  4XZQ B;  4JJN A;  4E45 A;  4H9N A;  3KXB A;  2G5I C;  5AVC B;  3W97 B;  4J8V D;  2Y2K A;  3AZG A;  3AZH B;  3P5J B;  5B0Y D;  1S32 C;  5GXQ A;  3KUY B;  1Z2C B;  1P3P A;  5B32 C;  5CHL B;  3VH5 A;  5DNM C;  1HQ3 A;  2DQN C;  1P3G D;  4J8W A;  3B0B A;  3UTA D;  4J8X C;  3REH C;  1WWI A;  5BNV B;  3UT9 D;  5CP6 D;  3VH6 W;  5AVB D;  1P3O C;  4J8U A;  5GT0 D;  1KX4 D;  2PYO C;  5AY8 C;  3A6N A;  3MNN C;  3MGS A;  1M19 A;  2NZD D;  3AZF A;  3MVD C;  3LEL C;  3MGR B;  5AV5 A;  4XUJ A;  3WAA B;  2YFW B;  1P3A B;  2BYK A;  3AYW C;  5B33 D;  4WNN A;  1P3F C;  3X1S D;  3KWQ D;  4XZQ C;  3REK A;  3UTB B;  2ARO A;  3AZL D;  1EQZ A;  5AVC C;  4X23 D;  5B2J B;  3W97 C;  3REI A;  3AZH C;  3B6G B;  3C1B D;  5AV6 D;  5B40 A;  3O62 D;  3KUY C;  1P3M A;  5GT3 B;  2NQB B;  3X1V A;  5JRG B;  2J8P A;  4YM6 A;  3MGP B;  3C1C A;  4H9Q A;  3AN2 C;  5DNN B;  3EPJ A;  1W2E A;  3LZ0 A;  3AZE D;  1N1J B;  4DRA A;  3AFA C;  3REL A;  5BS7 A;  3X1T B;  4NE3 A;  3WTP A;  3REJ A;  4G92 B;  1P3I A;  3AZI B;  3MGR C;  3MGQ A;  3TU4 B;  1P3A C;  5AV9 B;  5GSU A;  3B6F B;  3A1I A;  4KGC A;  3KXB D;  3AV1 A;  1P34 B;  3NQJ A;  1P3K A;  5B2I B;  2UWX A;  3AZG D;  1KX3 B;  5CPI B;  3WA9 B;  4Z5T B;  4LD9 A;  3WKJ B;  5GXQ D;  3UTB C;  1HQ3 D;  4J8W D;  3VH5 W;  3X1U B;  5B2J C;  2CV5 C;  3FDD A;  3B6G C;  1S32 A;  3A6N D;  4H9O A;  1TAF B;  5B32 A;  5GT3 C;  1P3B D;  3V9R B;  5DNM A;  5JRG C;  3MGP C;  1PZR A;  4XUJ D;  3R45 B;  4J8X A;  3REH A;  2FJ7 D;  1F66 B;  5DNN C;  1P3O A;  4KHA A;  5AY8 A;  4CAY A;  3X1T C;  5E5A D;  3MNN A;  3AZI C;  3MVD A;  4AWL B;  1ZLA A;  4WU9 C;  2Y2J A;  3TU4 C;  3REK D;  2JCH A;  5AV9 C;  3AYW A;  3B6F C;  2IO5 B;  1EQZ D;  5CPK B;  1TZY B;  1P34 C;  3AZM D;  5B2I C;  1P3F A;  5B1L A;  1P3L B;  3REI D;  1KX3 C;  5CPI C;  2ZM5 A;  3WA9 C;  4Z5T C;  3WKJ C;  2CWE A;  5B40 D;  3LJA D;  3W98 C;  4XZQ A;  1P3M D;  4UUZ B;  1AOI D;  1R4V A;  3B0C W;  1ULY A;  3C1C D;  4YM6 D;  4DQY B;  3X1U C;  5FUG B;  5CPJ B;  3W97 A;  5AVC A;  3AZH A;  5JA4 B;  3REL D;  2Y2G A;  5B31 B;  1U35 D;  1P3I D;  5C3I B;  3MGQ D;  3AN2 A;  1F66 C;  5BNV A;  4NE6 A;  2HIO D;  5GSU D;  3AZK C;  4UPK A;  4J8V B;  3AFA A;  4KGC D;  3AV1 D;  5B0Y B;  1P3K D;  5B0Z B;  4AWL C;  4LD9 D;  2IO5 C;  3UT9 B;  5CPK C;  1TZY C;  5CP6 B;  5AVB B;  2DF4 C;  5GT0 B;  1P3L C;  2HUE B;  2NZD B;  5AV8 D;  1B6W A;  1S32 D;  1JFI B;  5B32 D;  1H3O B;  5CPJ C;  4J8X D;  5B2J A;  2CV5 A;  4R8P D;  1BH9 B;  5B33 B;  3B6G A;  1ID3 D;  5B31 C;  4WV4 B;  3MNN D;  5GT3 A;  3AZJ D;  5C3I C;  5JRG A;  3MGP A;  1ZLA D;  1BH8 A;  2BYM B;  3AZN D;  4X23 B;  4ZUX A;  1N1J A;  3EPL A;  4J8V C;  3IP4 C;  3X1T A;  3C1B B;  5AV6 B;  3LZ1 D;  5B0Z C;  1P3F D;  1F1E A;  4H9P B;  5B1L D;  3AZI A;  4EO5 B;  4WU9 A;  4E44 A;  4XZQ D;  1M1A D;  5AV9 A;  3B6F A;  3UT9 C;  5GT0 C;  3H0L C;  5B2I A;  3AZH D;  2HUE C;  3KSY A;  5F99 A;  1KX3 A;  4Z5T A;  3WA9 A;  3W98 A;  1KX5 B;  3X1U A;  2FFF B;  3EG5 B;  4HGA B;  3AN2 D;  4H9N B;  4WU8 D;  5B33 C;  5KDM A;  3AFA D;  3AV2 D;  3EPK A;  3W96 D;  5BO0 B;  3AZG B;  1TAF A;  2L5A A;  3V9R A;  4Z66 B;  3W99 A;  3R45 A;  1HQ3 B;  3WAA C;  5B1M B;  4JJN D;  1A7W A;  4J8W B;  1F66 A;  3AL0 C;  3AZK A;  3WTP E;  4X23 C;  2Y2Q A;  4ZBJ B;  4YS3 A;  1KU5 A;  5AV6 C;  3A6N B;  2Y2M A;  4EO5 C;  1P3B B;  5BNX B;  1P3P D;  4Z2M H;  2FJ7 B;  2F8N A;  5CPK A;  5B2J D;  2CV5 D;  1P3L A;  5E5A B;  3B6G D;  4J8U D;  1M18 B;  5B24 B;  3MGS D;  3VH5 T;  1M19 D;  5GT3 D;  3REK B;  3AZF D;  2NQB C;  1KX5 C;  3NQU A;  5AV5 D;  5FUG A;  2F2A C;  4HGA C;  4CSR B;  4QLC B;  5CPJ A;  1EQZ B;  4KUD C;  3AZM B;  5JA4 A;  4ZUX D;  5B31 A;  2PYO A;  2Y2H A;  3AZG C;  3REI B;  3X1T D;  5B40 B;  3LJA B;  4G92 C;  4Z66 C;  3LEL A;  2F8N H;  1AOI B;  4WU9 D;  5G49 A;  1HQ3 C;  5B1M C;  4YM6 B;  5AV9 D;  2ARO D;  3REL B;  5B0Z A;  4WJ3 C;  1KX3 D;  5F99 D;  3WA9 D;  1P3B C;  1U35 B;  3W98 D;  3MGQ B;  2RVQ D;  2ZY4 A;  2FJ7 C;  4KUD B;  3X1V D;  3UT9 A;  2HIO B;  3H0M C;  5GSU B;  4Z2M G;  3B0D B;  5E5A C;  3LZ0 D;  3NQJ B;  1P3K B;  1M18 C;  4H9S C;  5B24 C;  2W8S A;  3A1K A;  1JFI A;  5BT1 D;  3WTP D;  3KUY A;  3REJ D;  3REK C;  1H3O A;  3W99 D;  2BG1 A;  4NFT A;  4QLC C;  1EQZ C;  1F66 D;  5B33 A;  3AZK D;  3AZM C;  4YS3 D;  5AV8 B;  3LJA C;  1S32 B;  4H9O B;  3MGR A;  1AOI C;  3WAA A;  2BYM A;  2YFW A;  4YM6 C;  1P3G B;  1P3A A;  3UTA B;  2F8N G;  4X23 A;  4J8X B;  2F8N D;  4R8P B;  5CPK D;  1KX4 B;  3REL C;  1ID3 B;  5AV6 A;  5BS7 C;  4CAY B;  4H9P A;  1P3L D;  2YFV B;  3MNN B;  2Y2I A;  1U35 C;  3AZJ B;  5B32 G;  3MGQ C;  3UTB A;  1ZLA B;  3H0R C;  5DNM D;  3AZN B;  2HIO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...