3X1SA

Crystal structure of the nucleosome core particle
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
96
structure length
96
Chain Sequence
HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 28
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1sA00
2HIOA 1M1AA 3WKJA 1P3BB 5B1MC 1WWSA 5B1MA 1P3KC 5AVCA 5AY8A 2AROA 4AWLC 4LD9D 5AV5D 1BH8B 3O62D 3AZND 1H3OA 3AZFB 4X23C 3X1VD 3UTAA 3AZKD 3REKC 4ZBJB 3W96A 3AN2C 1KX5A 3UTAD 4H9OB 5DNND 3RELB 1KX4A 3LZ0B 3KWQB 5JA4B 5B0ZB 4H9OA 3MGRA 4YM6D 1TZYD 2PYOC 5F99C 1F66C 5JRGD 1P3LA 5B31C 1M19D 3REHA 3AZMC 4EO5C 5AV6D 1P3OA 1S32A 1KX3A 3WKJC 3WAAC 5GSUA 3AZJB 4Z2MG 1ID3C 2FJ7D 2LY8A 5B33D 3REIC 3AFAC 4J8UC 4J8UA 1KX4D 2NQBA 5DNNA 4WU8C 4XZQD 3TU4C 3B6FA 5B1LA 5AV5C 5B0YA 3O62A 4H9PA 3REJC 5B1LB 1ZLAA 5JRGB 1N1JA 4H9RA 3B0BA 1B6WA 1P3OC 3V9RA 2NQBB 4R8PB 1TZYC 4WU8D 2PYOD 4QLCD 5GT3B 3AN2B 3MGRC 4NE3A 3RELC 3AV2B 2NZDA 3W99A 3X1TB 1P3GC 4KGCC 5B40C 2CV5A 1EQZA 1F66B 3AZED 1M1AC 1P3OD 4HGAC 5B32B 3AZGA 3AZGC 1HQ3C 3AZLA 4XZQB 3WAAD 1ID3B 4J8WB 2F8ND 5BO0B 4YS3A 1H3OB 3AZFA 4QLCA 3REID 3LZ0A 3UTAB 4R8PD 4DRBA 1JFIA 1KX5B 3X1VB 3AV2D 1WWIA 3W99C 5B1MB 5AV6C 3AZLB 1U35C 5B24A 1HQ3D 3UT9B 5CPJA 5AY8B 2BYKB 4H9NB 4KHAB 1BH8A 2FJ7A 5AV8C 3LELA 3X1UD 5GT0D 1A7WA 4J8VB 5C3IC 3MNNA 4R8PC 3AYWB 3TU4D 1P3AB 5GXQC 2PYOB 3W97D 5CHLB 4UUZB 3NQUA 2F8NK 1P3BD 3AZKA 4H9PB 5JRGA 4WU9C 3W97B 3AZEC 2BYMA 3VH5T 4JJNC 4WNNA 3AZIB 1Q9CA 4J8UB 5B24D 5DNNB 3RELD 4WU8B 1P3MB 4J8VD 3AZNA 3O62C 1TAFA 3KXBC 5AV5A 5B0YC 3LZ1B 1ZLAC 3AV1A 1AOIA 3MVDC 1M1AD 1U35B 5BS7A 3AZGD 3AZFD 3UT9C 1R4VA 3W98B 2CV5D 2F8NG 1ID3A 1P3KA 2IO5C 4XZQA 4J8VC 1P3PD 5AV9C 3KXBD 3W96B 4QLCB 4J8WD 1P3LC 3X1SC 5B40B 3KUYB 1F1EA 1BH9A 3AZMA 1P3KD 3WA9C 3AZID 5KDMA 2HIOB 3MGSB 3WKJB 2JSSA 1P3BA 5AVCB 2PYOA 4HGAB 1P3BC 3B0CT 5AV6A 1HQ3B 5AV8D 4Z5TD 3C1BD 3AZEB 3AV1D 1KU5A 3B0CW 5B2JB 5CP6A 3MNNB 5BNVB 3MGPD 5B31G 4YM6B 4J8VA 4ZUXC 5B32G 4G92C 3B6FD 5GXQA 3B6GB 5KDMB 3MGSA 3X1VA 2L5AA 1P3MD 4LD9B 5F99B 1S32B 3B0DB 5CPKB 3MGQB 5E5AD 5CPID 2YFVA 1M19A 3UT9D 3WAAB 5B40D 5GSUD 5CPJC 3X1SD 1KX4B 5CPKD 1P3IA 3AFAB 1P3AC 5GT3D 2F8NA 4XUJB 1M18B 1P3LB 3AZHD 4NE6A 3WA9A 3AV1B 4M6BA 5GT0A 3LZ1A 3WA9B 3REJA 5AV5B 1P34C 4KUDC 5E5AA 5CPIA 4AWLB 2F8NH 3MGSD 3MGQD 3W99D 4CAYA 5FUGA 1ULYA 5AV9D 4KGCD 3WTPD 3LJAB 4R8PA 3VH5W 3MNNC 3REIA 1P3FB 5B0YB 4Z2MH 3MGPC 3AV2C 3A6ND 5B2IA 5B2JD 4Z5TA 5B31A 1P3GB 1N1JB 5G49B 1P3PB 3AZNC 1S32C 1BH9B 3AZMB 4X23D 3VH6T 4Z66A 4Z66C 4CSRA 1M1AB 3AZEA 3LELD 3AZHC 3UTBD 4X23A 3WTPE 5GXQD 3W96C 3A6NC 4WZSB 3B6FC 3C1CA 3KUYA 3TU4B 1P3AD 4XUJC 1M18C 3X1VC 4G91C 3MGSC 1ID3D 5AVCC 2F8NB 4WU9D 3REHB 3LELC 3R45A 5AV8A 4E45A 3MGQA 1M19B 3WAAA 5AV8B 5F99D 3MVDD 3AZIA 1TZYB 3RELA 5B1LD 4WNNB 5GT3C 3AZMD 3WTPA 3REJD 4G92B 3WTPC 3B6GC 1P3IC 4LD9A 5GXQB 3B6GA 3LZ0C 3AZKB 3X1UB 3UTBB 2YFWA 4H9SC 4J8XA 2CV5B 1S32D 5B31B 3REHD 4WU9B 5AVBB 4XZQC 1KX3D 4YS3C 3WA9D 4H9RB 4JJNB 5DNMA 3MNND 1ZLAD 1P3ID 4ZUXA 3A6NA 2RVQC 5BT1D 3B6FB 4XUJA 3X1UA 5B2IB 3LJAA 2NZDC 3AV1C 3O62B 5B40A 1EQZC 1P3GA 4XUJD 4H9QA 3MVDA 4Z5TB 1ZLAB 1P34B 4KUDB 3REHC 5AVCD 4CAYB 1B67A 1P3GD 3W98A 5FUGB 2BYKA 3W98C 1P3OB 4X23B 3LZ1D 5BT1C 3MGPA 3REKB 4ZUXD 5CP6D 5BNXB 3KUYD 3MGPB 3REKA 1M18D 3VH5A 5AV9B 3TU4A 3C1CB 3MGRB 4YM6A 3B6GD 3KWQA 3C1BA 3AZKC 4YS3D 3C1BC 3X1UC 1P3PA 5E5AC 5CPIC 5BS7C 5AVBC 5CPJD 5GSUC 5BO0A 4YS3B 1KX3C 1F66D 5AY8D 5B31D 1P34D 4KUDD 3NQJA 5B2JA 1P3MC 2HIOD 3V9RB 3WKJD 1P3FD 4JJNA 4DRAA 3REKD 3LZ0D 2RVQD 5B33B 3AN2D 5F99A 1P3AA 3AN2A 1KX5C 4LD9C 3REJB 3W99B 4J8XB 1AOID 4WU9A 3UTBA 3MGQC 5JRGC 5CPKC 1M19C 5AY8C 3AZJD 5B32D 2IO5B 2HUEC 5B0YD 5DNMC 5B33A 3WTPB 3LJAD 1P3IB 4NE5A 5C3IB 1TAFB 5CP6C 1M18A 3AYWC 2NQBD 2NZDD 5GT0B 3KUYC 4J8UD 3C1CC 4H9SA 5B2ID 3VH6W 3KWQD 3UTBC 3X1TC 5CPKA 5B24C 1U35A 4Z66D 2CV5C 4KGCA 5E5AB 5CPIB 5B32C 1P3KB 4J8WC 1P3LD 2AROB 1P3MA 5B2JC 3W96D 3AZFC 3AZIC 4ZUXB 5AV9A 5B0ZD 5B2IC 4ZBJC 5BNXA 3AV2A 1P3FC 5JA4A 5B0ZA 2AROD 3VH6A 5BNVA 4Z5TC 3AYWA 3KXBB 4CSRB 1P3PC 1HQ3A 5AV6B 3AZLC 5AVBD 4WV4B 5DNMD 4Z66B 4KHAA 1AOIC 2FJ7B 5B1MD 4H9NA 3UT9A 4J8XD 3AZHA 5CPJB 3AZJC 3NQJB 1U35D 1P3FA 3AZHB 1TZYA 3W97A 3KXBA 5CP6B 1JFIB 5GT0C 1KX5D 3AYWD 3C1BB 4UUZA 2CWEA 4G91B 5B24B 3R45B 3AZJA 5B1LC 1HTAA 5GSUB 3LELB 3W97C 1KX3B 2AROC 3LJAC 3AFAA 4NFTA 5DNNC 4WU8A 2NQBC 5B33C 3C1CD 3X1TD 5B0ZC 3KWQC 4YM6C 3W98D 4E44A 3LZ1C 3AZNB 1P34A 3NQUB 4J8XC 4KGCB 4KUDA 4H9QB 3MVDB 1F66A 2YFVB 3B0DC 4EO5B 3AZLD 2FJ7C 1AOIB 2HUEB 2BYMB 5B32A 3AZGB 4J8WA 5DNMB 1EQZD 3REIB 1BFMA 3A6NB 1KX4C 3X1TA 5GT3A 4QLCC 2YFWB 3X1SB 3MGRD 3UTAC 2NZDB 5G49A 1EQZB 3KSYA 3X1SA 3AFAD 5AVBA 2HIOC 4JJND
chains in the Genus database with same CATH superfamily
2HIOA 1M1AA 3WKJA 1P3BB 5B1MC 1WWSA 5B1MA 1P3KC 5AVCA 5AY8A 2AROA 4AWLC 4LD9D 5AV5D 1BH8B 3O62D 3AZND 1H3OA 3AZFB 4X23C 3X1VD 3UTAA 3AZKD 3REKC 4ZBJB 3W96A 3EPHA 3AN2C 1KX5A 3UTAD 4H9OB 5DNND 3RELB 1KX4A 3LZ0B 3F6TA 3KWQB 5JA4B 5B0ZB 4H9OA 3MGRA 4YM6D 1TZYD 2PYOC 5F99C 1F66C 5JRGD 1P3LA 5B31C 1M19D 3REHA 3AZMC 4EO5C 5AV6D 1P3OA 1S32A 1KX3A 3WKJC 3WAAC 5GSUA 3AZJB 4Z2MG 1ID3C 2FJ7D 2LY8A 5B33D 3REIC 3AFAC 4J8UC 4J8UA 1KX4D 2NQBA 5DNNA 4WU8C 4DQYB 2F2AC 4XZQD 3TU4C 3B6FA 5B1LA 2XD5A 5AV5C 5B0YA 3O62A 4H9PA 3REJC 5B1LB 1ZLAA 5JRGB 1N1JA 4H9RA 3B0BA 1B6WA 1P3OC 3H0LC 3V9RA 2NQBB 4R8PB 1TZYC 4WU8D 2PYOD 4QLCD 5GT3B 3AN2B 3MGRC 4NE3A 3RELC 3AV2B 2NZDA 3W99A 2Y2NA 3X1TB 1P3GC 4KGCC 5B40C 2CV5A 1EQZA 2Y2HA 1F66B 2JCHA 3AZED 3A1IA 1P3OD 1M1AC 4HGAC 5B32B 3AZGA 3AZGC 1HQ3C 3AZLA 4XZQB 3WAAD 3KFUG 1ID3B 4J8WB 2F8ND 5BO0B 4YS3A 1H3OB 3AZFA 4QLCA 3FDDA 3REID 3LZ0A 3UTAB 4R8PD 4DRBA 1JFIA 1KX5B 3X1VB 3AV2D 1WWIA 3W99C 5B1MB 5AV6C 3AZLB 1U35C 5B24A 1HQ3D 3UT9B 5CPJA 5AY8B 2BYKB 4H9NB 4KHAB 1BH8A 2FJ7A 5AV8C 3LELA 3X1UD 5GT0D 1A7WA 4J8VB 5C3IC 3MNNA 4R8PC 3AYWB 3TU4D 1P3AB 5GXQC 2PYOB 3W97D 5CHLB 4UUZB 3NQUA 2F8NK 2Y2PA 1P3BD 3AZKA 4H9PB 5JRGA 4WU9C 3W97B 3AZEC 2BYMA 3VH5T 4JJNC 4WNNA 3AZIB 1Q9CA 4J8UB 5B24D 4WJ3C 5DNNB 3RELD 4WU8B 1P3MB 4J8VD 2G5HC 3H0RC 3AZNA 3O62C 1TAFA 3KXBC 5AV5A 5B0YC 3LZ1B 1ZLAC 3AV1A 1AOIA 3MVDC 1M1AD 1U35B 5BS7A 3AZGD 3AZFD 3UT9C 1R4VA 3W98B 2CV5D 2F8NG 1ID3A 1P3KA 2IO5C 4XZQA 4J8VC 3AL0C 1P3PD 5AV9C 3KXBD 3W96B 4QLCB 4J8WD 1P3LC 3X1SC 5B40B 3KUYB 1F1EA 1BH9A 3AZMA 1P3KD 3WA9C 3AZID 5KDMA 2HIOB 3MGSB 3WKJB 2JSSA 1P3BA 5AVCB 2PYOA 4HGAB 1P3BC 3B0CT 5AV6A 1HQ3B 5AV8D 4Z5TD 2XD1A 3C1BD 3AZEB 3AV1D 2Y2GA 1KU5A 3B0CW 5B2JB 5CP6A 3MNNB 5BNVB 3MGPD 5B31G 4YM6B 4J8VA 4ZUXC 2JE5A 5B32G 4G92C 3B6FD 5GXQA 3B6GB 5KDMB 3MGSA 3X1VA 2L5AA 1P3MD 4LD9B 5F99B 1S32B 3B0DB 5CPKB 3MGQB 2RIQA 5E5AD 5CPID 2YFVA 1M19A 3UT9D 3WAAB 5B40D 5GSUD 5CPJC 3X1SD 1KX4B 5CPKD 1P3IA 3AFAB 1P3AC 5GT3D 2F8NA 4XUJB 1M18B 1P3LB 3AZHD 4NE6A 3WA9A 3AV1B 4M6BA 5GT0A 3LZ1A 2ZY4A 3WA9B 3REJA 5AV5B 1P34C 4KUDC 5E5AA 5CPIA 4AWLB 2F8NH 3MGSD 3MGQD 2Y2QA 3W99D 4CAYA 5FUGA 1ULYA 5AV9D 4KGCD 3A1KA 3WTPD 3LJAB 4R8PA 3VH5W 3MNNC 3REIA 1P3FB 5B0YB 4Z2MH 3MGPC 2Y2LA 3AV2C 1T3UA 3A6ND 5B2IA 5B2JD 4Z5TA 5B31A 1P3GB 1N1JB 5G49B 2FFFB 1P3PB 3AZNC 1S32C 1BH9B 3AZMB 4X23D 1Z2CB 3VH6T 4Z66A 4Z66C 4CSRA 1M1AB 3AZEA 1PZRA 2Y2IA 3LELD 2ZY3A 3AZHC 3UTBD 4X23A 3WTPE 5GXQD 3W96C 3A6NC 4WZSB 3B6FC 3C1CA 3KUYA 3TU4B 1P3AD 4XUJC 1M18C 3IP4C 3X1VC 4G91C 2VQRA 3MGSC 1ID3D 5AVCC 2F8NB 4WU9D 3REHB 3LELC 3R45A 5AV8A 4E45A 3MGQA 1M19B 3WAAA 5AV8B 5F99D 3MVDD 3AZIA 1TZYB 3RELA 5B1LD 4WNNB 5GT3C 3AZMD 3WTPA 3REJD 4G92B 3WTPC 3B6GC 4UPKA 1P3IC 2Y2MA 4LD9A 5GXQB 3B6GA 3LZ0C 3AZKB 3X1UB 3UTBB 2YFWA 4H9SC 4J8XA 2Y2KA 2CV5B 1S32D 5B31B 3REHD 4WU9B 5AVBB 4XZQC 1KX3D 2DQNC 4YS3C 3WA9D 4H9RB 4JJNB 5DNMA 3EPLA 3MNND 1ZLAD 3EPKA 1P3ID 4ZUXA 3A6NA 2RVQC 5BT1D 2DF4C 3B6FB 4XUJA 3X1UA 5B2IB 3LJAA 2NZDC 3AV1C 3O62B 5B40A 1EQZC 2UWXA 1P3GA 4XUJD 4H9QA 3MVDA 4Z5TB 1ZLAB 1P34B 4KUDB 3EG5B 3REHC 5AVCD 4CAYB 1B67A 1P3GD 3W98A 5FUGB 2BYKA 3W98C 3H0MC 1P3OB 4X23B 3LZ1D 5BT1C 3MGPA 3REKB 4ZUXD 5CP6D 5BNXB 3KUYD 3MGPB 3REKA 1M18D 3VH5A 5AV9B 3TU4A 1W2EA 3C1CB 3MGRB 4YM6A 3B6GD 3KWQA 3C1BA 3AZKC 4YS3D 3C1BC 3X1UC 1P3PA 3P5JB 5E5AC 5CPIC 2Y2JA 5BS7C 5AVBC 5CPJD 5GSUC 5BO0A 4YS3B 1KX3C 1F66D 5AY8D 5B31D 1P34D 4KUDD 3NQJA 5B2JA 1P3MC 2ZM5A 2HIOD 3V9RB 3WKJD 1P3FD 4JJNA 4DRAA 3REKD 3LZ0D 2RVQD 5B33B 3AN2D 2ZY5A 5F99A 1P3AA 3AN2A 1KX5C 4LD9C 3REJB 3W99B 4J8XB 1AOID 4WU9A 3UTBA 3MGQC 5JRGC 5CPKC 1M19C 5AY8C 3EPJA 3AZJD 5B32D 2IO5B 2HUEC 5B0YD 5DNMC 5B33A 3WTPB 3LJAD 1P3IB 4NE5A 2W8SA 1TAFB 5C3IB 5CP6C 3AYWC 1M18A 2NQBD 2NZDD 5GT0B 3KUYC 4J8UD 3C1CC 4H9SA 5B2ID 3VH6W 3KWQD 3UTBC 3X1TC 5CPKA 5B24C 1U35A 4Z66D 2CV5C 4KGCA 5E5AB 5CPIB 2Y2OA 5B32C 1P3KB 4J8WC 1P3LD 2AROB 1P3MA 5B2JC 3W96D 3AZFC 3AZIC 4ZUXB 5AV9A 5B0ZD 5B2IC 4ZBJC 5BNXA 3AV2A 1P3FC 5JA4A 5B0ZA 2AROD 3VH6A 5BNVA 4Z5TC 3AYWA 3KXBB 4CSRB 1P3PC 1HQ3A 5AV6B 3AZLC 5AVBD 4WV4B 5DNMD 4Z66B 4KHAA 1AOIC 2FJ7B 5B1MD 4H9NA 3UT9A 4J8XD 3AZHA 5CPJB 3AZJC 3NQJB 1U35D 1P3FA 3AZHB 1TZYA 3W97A 3KXBA 5CP6B 1JFIB 5GT0C 1KX5D 3AYWD 3C1BB 4UUZA 2CWEA 4G91B 5B24B 3R45B 3AZJA 5B1LC 1HTAA 5GSUB 3LELB 3W97C 1KX3B 2AROC 2J8PA 3LJAC 3AFAA 4NFTA 5DNNC 4WU8A 2NQBC 5B33C 3C1CD 3X1TD 5B0ZC 3KWQC 4YM6C 3W98D 4E44A 3LZ1C 2ZY2A 3AZNB 2BG1A 1P34A 3NQUB 4J8XC 4KGCB 4KUDA 4H9QB 3MVDB 1F66A 2G5IC 2YFVB 3B0DC 4EO5B 3AZLD 2FJ7C 1AOIB 2HUEB 2BYMB 5B32A 3AZGB 4J8WA 5DNMB 1EQZD 3REIB 1BFMA 3A6NB 1KX4C 3X1TA 5GT3A 4QLCC 2YFWB 3X1SB 3MGRD 3UTAC 2NZDB 5G49A 1EQZB 3KSYA 3X1SA 3AFAD 5AVBA 2HIOC 4JJND
chains in the Genus database with same CATH topology
2HIOA 1M1AA 3WKJA 1P3BB 5B1MC 1WWSA 5B1MA 1P3KC 5AVCA 5AY8A 2AROA 4AWLC 4LD9D 5AV5D 1BH8B 3O62D 3AZND 1H3OA 3AZFB 4X23C 3X1VD 3UTAA 3AZKD 3REKC 4ZBJB 3W96A 3EPHA 3AN2C 1KX5A 3UTAD 4H9OB 5DNND 3RELB 1KX4A 3LZ0B 3F6TA 3KWQB 5JA4B 5B0ZB 4H9OA 3MGRA 4YM6D 1TZYD 2PYOC 5F99C 1F66C 5JRGD 1P3LA 5B31C 1M19D 3REHA 3AZMC 4EO5C 5AV6D 1P3OA 1S32A 1KX3A 3WKJC 3WAAC 5GSUA 3AZJB 4Z2MG 1ID3C 2FJ7D 2LY8A 5B33D 3REIC 3AFAC 4J8UC 4J8UA 1KX4D 2NQBA 5DNNA 4WU8C 4DQYB 2F2AC 4XZQD 3TU4C 3B6FA 5B1LA 2XD5A 5AV5C 5B0YA 3O62A 4H9PA 3REJC 5B1LB 1ZLAA 5JRGB 1N1JA 4H9RA 3B0BA 1B6WA 1P3OC 3H0LC 3V9RA 2NQBB 4R8PB 1TZYC 4WU8D 2PYOD 4QLCD 5GT3B 3AN2B 3MGRC 4NE3A 3RELC 3AV2B 2NZDA 3W99A 2Y2NA 3X1TB 1P3GC 4KGCC 5B40C 2CV5A 1EQZA 2Y2HA 1F66B 2JCHA 3AZED 3A1IA 1P3OD 1M1AC 4HGAC 5B32B 3AZGA 3AZGC 1HQ3C 3AZLA 4XZQB 3WAAD 3KFUG 1ID3B 4J8WB 2F8ND 5BO0B 4YS3A 1H3OB 3AZFA 4QLCA 3FDDA 3REID 3LZ0A 3UTAB 4R8PD 4DRBA 1JFIA 1KX5B 3X1VB 3AV2D 1WWIA 3W99C 5B1MB 5AV6C 3AZLB 1U35C 5B24A 1HQ3D 3UT9B 5CPJA 5AY8B 2BYKB 4H9NB 4KHAB 1BH8A 2FJ7A 5AV8C 3LELA 3X1UD 5GT0D 1A7WA 4J8VB 5C3IC 3MNNA 4R8PC 3AYWB 3TU4D 1P3AB 5GXQC 2PYOB 3W97D 5CHLB 4UUZB 3NQUA 2F8NK 2Y2PA 1P3BD 3AZKA 4H9PB 5JRGA 4WU9C 3W97B 3AZEC 2BYMA 3VH5T 4JJNC 4WNNA 3AZIB 1Q9CA 4J8UB 5B24D 4WJ3C 5DNNB 3RELD 4WU8B 1P3MB 4J8VD 2G5HC 3H0RC 3AZNA 3O62C 1TAFA 3KXBC 5AV5A 5B0YC 3LZ1B 1ZLAC 3AV1A 1AOIA 3MVDC 1M1AD 1U35B 5BS7A 3AZGD 3AZFD 3UT9C 1R4VA 3W98B 2CV5D 2F8NG 1ID3A 1P3KA 2IO5C 4XZQA 4J8VC 3AL0C 1P3PD 5AV9C 3KXBD 3W96B 4QLCB 4J8WD 1P3LC 3X1SC 5B40B 3KUYB 1F1EA 1BH9A 3AZMA 1P3KD 3WA9C 3AZID 5KDMA 2HIOB 3MGSB 3WKJB 2JSSA 1P3BA 5AVCB 2PYOA 4HGAB 1P3BC 3B0CT 5AV6A 1HQ3B 5AV8D 4Z5TD 2XD1A 3C1BD 3AZEB 3AV1D 2Y2GA 1KU5A 3B0CW 5B2JB 5CP6A 3MNNB 5BNVB 3MGPD 5B31G 4YM6B 4J8VA 4ZUXC 2JE5A 5B32G 4G92C 3B6FD 5GXQA 3B6GB 5KDMB 3MGSA 3X1VA 2L5AA 1P3MD 4LD9B 5F99B 1S32B 3B0DB 5CPKB 3MGQB 2RIQA 5E5AD 5CPID 2YFVA 1M19A 3UT9D 3WAAB 5B40D 5GSUD 5CPJC 3X1SD 1KX4B 5CPKD 1P3IA 3AFAB 1P3AC 5GT3D 2F8NA 4XUJB 1M18B 1P3LB 3AZHD 4NE6A 3WA9A 3AV1B 4M6BA 5GT0A 3LZ1A 2ZY4A 3WA9B 3REJA 5AV5B 1P34C 4KUDC 5E5AA 5CPIA 4AWLB 2F8NH 3MGSD 3MGQD 2Y2QA 3W99D 4CAYA 5FUGA 1ULYA 5AV9D 4KGCD 3A1KA 3WTPD 3LJAB 4R8PA 3VH5W 3MNNC 3REIA 1P3FB 5B0YB 4Z2MH 3MGPC 2Y2LA 3AV2C 1T3UA 3A6ND 5B2IA 5B2JD 4Z5TA 5B31A 1P3GB 1N1JB 5G49B 2FFFB 1P3PB 3AZNC 1S32C 1BH9B 3AZMB 4X23D 1Z2CB 3VH6T 4Z66A 4Z66C 4CSRA 1M1AB 3AZEA 1PZRA 2Y2IA 3LELD 2ZY3A 3AZHC 3UTBD 4X23A 3WTPE 5GXQD 3W96C 3A6NC 4WZSB 3B6FC 3C1CA 3KUYA 3TU4B 1P3AD 4XUJC 1M18C 3IP4C 3X1VC 4G91C 2VQRA 3MGSC 1ID3D 5AVCC 2F8NB 4WU9D 3REHB 3LELC 3R45A 5AV8A 4E45A 3MGQA 1M19B 3WAAA 5AV8B 5F99D 3MVDD 3AZIA 1TZYB 3RELA 5B1LD 4WNNB 5GT3C 3AZMD 3WTPA 3REJD 4G92B 3WTPC 3B6GC 4UPKA 1P3IC 2Y2MA 4LD9A 5GXQB 3B6GA 3LZ0C 3AZKB 3X1UB 3UTBB 2YFWA 4H9SC 4J8XA 2Y2KA 2CV5B 1S32D 5B31B 3REHD 4WU9B 5AVBB 4XZQC 1KX3D 2DQNC 4YS3C 3WA9D 4H9RB 4JJNB 5DNMA 3EPLA 3MNND 1ZLAD 3EPKA 1P3ID 4ZUXA 3A6NA 2RVQC 5BT1D 2DF4C 3B6FB 4XUJA 3X1UA 5B2IB 3LJAA 2NZDC 3AV1C 3O62B 5B40A 1EQZC 2UWXA 1P3GA 4XUJD 4H9QA 3MVDA 4Z5TB 1ZLAB 1P34B 4KUDB 3EG5B 3REHC 5AVCD 4CAYB 1B67A 1P3GD 3W98A 5FUGB 2BYKA 3W98C 3H0MC 1P3OB 4X23B 3LZ1D 5BT1C 3MGPA 3REKB 4ZUXD 5CP6D 5BNXB 3KUYD 3MGPB 3REKA 1M18D 3VH5A 5AV9B 3TU4A 1W2EA 3C1CB 3MGRB 4YM6A 3B6GD 3KWQA 3C1BA 3AZKC 4YS3D 3C1BC 3X1UC 1P3PA 3P5JB 5E5AC 5CPIC 2Y2JA 5BS7C 5AVBC 5CPJD 5GSUC 5BO0A 4YS3B 1KX3C 1F66D 5AY8D 5B31D 1P34D 4KUDD 3NQJA 5B2JA 1P3MC 2ZM5A 2HIOD 3V9RB 3WKJD 1P3FD 4JJNA 4DRAA 3REKD 3LZ0D 2RVQD 5B33B 3AN2D 2ZY5A 5F99A 1P3AA 3AN2A 1KX5C 4LD9C 3REJB 3W99B 4J8XB 1AOID 4WU9A 3UTBA 3MGQC 5JRGC 5CPKC 1M19C 5AY8C 3EPJA 3AZJD 5B32D 2IO5B 2HUEC 5B0YD 5DNMC 5B33A 3WTPB 3LJAD 1P3IB 4NE5A 2W8SA 1TAFB 5C3IB 5CP6C 3AYWC 1M18A 2NQBD 2NZDD 5GT0B 3KUYC 4J8UD 3C1CC 4H9SA 5B2ID 3VH6W 3KWQD 3UTBC 3X1TC 5CPKA 5B24C 1U35A 4Z66D 2CV5C 4KGCA 5E5AB 5CPIB 2Y2OA 5B32C 1P3KB 4J8WC 1P3LD 2AROB 1P3MA 5B2JC 3W96D 3AZFC 3AZIC 4ZUXB 5AV9A 5B0ZD 5B2IC 4ZBJC 5BNXA 3AV2A 1P3FC 5JA4A 5B0ZA 2AROD 3VH6A 5BNVA 4Z5TC 3AYWA 3KXBB 4CSRB 1P3PC 1HQ3A 5AV6B 3AZLC 5AVBD 4WV4B 5DNMD 4Z66B 4KHAA 1AOIC 2FJ7B 5B1MD 4H9NA 3UT9A 4J8XD 3AZHA 5CPJB 3AZJC 3NQJB 1U35D 1P3FA 3AZHB 1TZYA 3W97A 3KXBA 5CP6B 1JFIB 5GT0C 1KX5D 3AYWD 3C1BB 4UUZA 2CWEA 4G91B 5B24B 3R45B 3AZJA 5B1LC 1HTAA 5GSUB 3LELB 3W97C 1KX3B 2AROC 2J8PA 3LJAC 3AFAA 4NFTA 5DNNC 4WU8A 2NQBC 5B33C 3C1CD 3X1TD 5B0ZC 3KWQC 4YM6C 3W98D 4E44A 3LZ1C 2ZY2A 3AZNB 2BG1A 1P34A 3NQUB 4J8XC 4KGCB 4KUDA 4H9QB 3MVDB 1F66A 2G5IC 2YFVB 3B0DC 4EO5B 3AZLD 2FJ7C 1AOIB 2HUEB 2BYMB 5B32A 3AZGB 4J8WA 5DNMB 1EQZD 3REIB 1BFMA 3A6NB 1KX4C 3X1TA 5GT3A 4QLCC 2YFWB 3X1SB 3MGRD 3UTAC 2NZDB 5G49A 1EQZB 3KSYA 3X1SA 3AFAD 5AVBA 2HIOC 4JJND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIO A;  1M1A A;  3WKJ A;  1P3B B;  5B1M C;  1WWS A;  5B1M A;  1P3K C;  5AVC A;  5AY8 A;  2ARO A;  4AWL C;  4LD9 D;  5AV5 D;  1BH8 B;  3O62 D;  3AZN D;  1H3O A;  3AZF B;  4X23 C;  3X1V D;  3UTA A;  3AZK D;  3REK C;  4ZBJ B;  3W96 A;  3AN2 C;  1KX5 A;  3UTA D;  4H9O B;  5DNN D;  3REL B;  1KX4 A;  3LZ0 B;  3KWQ B;  5JA4 B;  5B0Z B;  4H9O A;  3MGR A;  4YM6 D;  1TZY D;  2PYO C;  5F99 C;  1F66 C;  5JRG D;  1P3L A;  5B31 C;  1M19 D;  3REH A;  3AZM C;  4EO5 C;  5AV6 D;  1P3O A;  1S32 A;  1KX3 A;  3WKJ C;  3WAA C;  5GSU A;  3AZJ B;  4Z2M G;  1ID3 C;  2FJ7 D;  2LY8 A;  5B33 D;  3REI C;  3AFA C;  4J8U C;  4J8U A;  1KX4 D;  2NQB A;  5DNN A;  4WU8 C;  4XZQ D;  3TU4 C;  3B6F A;  5B1L A;  5AV5 C;  5B0Y A;  3O62 A;  4H9P A;  3REJ C;  5B1L B;  1ZLA A;  5JRG B;  1N1J A;  4H9R A;  3B0B A;  1B6W A;  1P3O C;  3V9R A;  2NQB B;  4R8P B;  1TZY C;  4WU8 D;  2PYO D;  4QLC D;  5GT3 B;  3AN2 B;  3MGR C;  4NE3 A;  3REL C;  3AV2 B;  2NZD A;  3W99 A;  3X1T B;  1P3G C;  4KGC C;  5B40 C;  2CV5 A;  1EQZ A;  1F66 B;  3AZE D;  1M1A C;  1P3O D;  4HGA C;  5B32 B;  3AZG A;  3AZG C;  1HQ3 C;  3AZL A;  4XZQ B;  3WAA D;  1ID3 B;  4J8W B;  2F8N D;  5BO0 B;  4YS3 A;  1H3O B;  3AZF A;  4QLC A;  3REI D;  3LZ0 A;  3UTA B;  4R8P D;  4DRB A;  1JFI A;  1KX5 B;  3X1V B;  3AV2 D;  1WWI A;  3W99 C;  5B1M B;  5AV6 C;  3AZL B;  1U35 C;  5B24 A;  1HQ3 D;  3UT9 B;  5CPJ A;  5AY8 B;  2BYK B;  4H9N B;  4KHA B;  1BH8 A;  2FJ7 A;  5AV8 C;  3LEL A;  3X1U D;  5GT0 D;  1A7W A;  4J8V B;  5C3I C;  3MNN A;  4R8P C;  3AYW B;  3TU4 D;  1P3A B;  5GXQ C;  2PYO B;  3W97 D;  5CHL B;  4UUZ B;  3NQU A;  2F8N K;  1P3B D;  3AZK A;  4H9P B;  5JRG A;  4WU9 C;  3W97 B;  3AZE C;  2BYM A;  3VH5 T;  4JJN C;  4WNN A;  3AZI B;  1Q9C A;  4J8U B;  5B24 D;  5DNN B;  3REL D;  4WU8 B;  1P3M B;  4J8V D;  3AZN A;  3O62 C;  1TAF A;  3KXB C;  5AV5 A;  5B0Y C;  3LZ1 B;  1ZLA C;  3AV1 A;  1AOI A;  3MVD C;  1M1A D;  1U35 B;  5BS7 A;  3AZG D;  3AZF D;  3UT9 C;  1R4V A;  3W98 B;  2CV5 D;  2F8N G;  1ID3 A;  1P3K A;  2IO5 C;  4XZQ A;  4J8V C;  1P3P D;  5AV9 C;  3KXB D;  3W96 B;  4QLC B;  4J8W D;  1P3L C;  3X1S C;  5B40 B;  3KUY B;  1F1E A;  1BH9 A;  3AZM A;  1P3K D;  3WA9 C;  3AZI D;  5KDM A;  2HIO B;  3MGS B;  3WKJ B;  2JSS A;  1P3B A;  5AVC B;  2PYO A;  4HGA B;  1P3B C;  3B0C T;  5AV6 A;  1HQ3 B;  5AV8 D;  4Z5T D;  3C1B D;  3AZE B;  3AV1 D;  1KU5 A;  3B0C W;  5B2J B;  5CP6 A;  3MNN B;  5BNV B;  3MGP D;  5B31 G;  4YM6 B;  4J8V A;  4ZUX C;  5B32 G;  4G92 C;  3B6F D;  5GXQ A;  3B6G B;  5KDM B;  3MGS A;  3X1V A;  2L5A A;  1P3M D;  4LD9 B;  5F99 B;  1S32 B;  3B0D B;  5CPK B;  3MGQ B;  5E5A D;  5CPI D;  2YFV A;  1M19 A;  3UT9 D;  3WAA B;  5B40 D;  5GSU D;  5CPJ C;  3X1S D;  1KX4 B;  5CPK D;  1P3I A;  3AFA B;  1P3A C;  5GT3 D;  2F8N A;  4XUJ B;  1M18 B;  1P3L B;  3AZH D;  4NE6 A;  3WA9 A;  3AV1 B;  4M6B A;  5GT0 A;  3LZ1 A;  3WA9 B;  3REJ A;  5AV5 B;  1P34 C;  4KUD C;  5E5A A;  5CPI A;  4AWL B;  2F8N H;  3MGS D;  3MGQ D;  3W99 D;  4CAY A;  5FUG A;  1ULY A;  5AV9 D;  4KGC D;  3WTP D;  3LJA B;  4R8P A;  3VH5 W;  3MNN C;  3REI A;  1P3F B;  5B0Y B;  4Z2M H;  3MGP C;  3AV2 C;  3A6N D;  5B2I A;  5B2J D;  4Z5T A;  5B31 A;  1P3G B;  1N1J B;  5G49 B;  1P3P B;  3AZN C;  1S32 C;  1BH9 B;  3AZM B;  4X23 D;  3VH6 T;  4Z66 A;  4Z66 C;  4CSR A;  1M1A B;  3AZE A;  3LEL D;  3AZH C;  3UTB D;  4X23 A;  3WTP E;  5GXQ D;  3W96 C;  3A6N C;  4WZS B;  3B6F C;  3C1C A;  3KUY A;  3TU4 B;  1P3A D;  4XUJ C;  1M18 C;  3X1V C;  4G91 C;  3MGS C;  1ID3 D;  5AVC C;  2F8N B;  4WU9 D;  3REH B;  3LEL C;  3R45 A;  5AV8 A;  4E45 A;  3MGQ A;  1M19 B;  3WAA A;  5AV8 B;  5F99 D;  3MVD D;  3AZI A;  1TZY B;  3REL A;  5B1L D;  4WNN B;  5GT3 C;  3AZM D;  3WTP A;  3REJ D;  4G92 B;  3WTP C;  3B6G C;  1P3I C;  4LD9 A;  5GXQ B;  3B6G A;  3LZ0 C;  3AZK B;  3X1U B;  3UTB B;  2YFW A;  4H9S C;  4J8X A;  2CV5 B;  1S32 D;  5B31 B;  3REH D;  4WU9 B;  5AVB B;  4XZQ C;  1KX3 D;  4YS3 C;  3WA9 D;  4H9R B;  4JJN B;  5DNM A;  3MNN D;  1ZLA D;  1P3I D;  4ZUX A;  3A6N A;  2RVQ C;  5BT1 D;  3B6F B;  4XUJ A;  3X1U A;  5B2I B;  3LJA A;  2NZD C;  3AV1 C;  3O62 B;  5B40 A;  1EQZ C;  1P3G A;  4XUJ D;  4H9Q A;  3MVD A;  4Z5T B;  1ZLA B;  1P34 B;  4KUD B;  3REH C;  5AVC D;  4CAY B;  1B67 A;  1P3G D;  3W98 A;  5FUG B;  2BYK A;  3W98 C;  1P3O B;  4X23 B;  3LZ1 D;  5BT1 C;  3MGP A;  3REK B;  4ZUX D;  5CP6 D;  5BNX B;  3KUY D;  3MGP B;  3REK A;  1M18 D;  3VH5 A;  5AV9 B;  3TU4 A;  3C1C B;  3MGR B;  4YM6 A;  3B6G D;  3KWQ A;  3C1B A;  3AZK C;  4YS3 D;  3C1B C;  3X1U C;  1P3P A;  5E5A C;  5CPI C;  5BS7 C;  5AVB C;  5CPJ D;  5GSU C;  5BO0 A;  4YS3 B;  1KX3 C;  1F66 D;  5AY8 D;  5B31 D;  1P34 D;  4KUD D;  3NQJ A;  5B2J A;  1P3M C;  2HIO D;  3V9R B;  3WKJ D;  1P3F D;  4JJN A;  4DRA A;  3REK D;  3LZ0 D;  2RVQ D;  5B33 B;  3AN2 D;  5F99 A;  1P3A A;  3AN2 A;  1KX5 C;  4LD9 C;  3REJ B;  3W99 B;  4J8X B;  1AOI D;  4WU9 A;  3UTB A;  3MGQ C;  5JRG C;  5CPK C;  1M19 C;  5AY8 C;  3AZJ D;  5B32 D;  2IO5 B;  2HUE C;  5B0Y D;  5DNM C;  5B33 A;  3WTP B;  3LJA D;  1P3I B;  4NE5 A;  5C3I B;  1TAF B;  5CP6 C;  1M18 A;  3AYW C;  2NQB D;  2NZD D;  5GT0 B;  3KUY C;  4J8U D;  3C1C C;  4H9S A;  5B2I D;  3VH6 W;  3KWQ D;  3UTB C;  3X1T C;  5CPK A;  5B24 C;  1U35 A;  4Z66 D;  2CV5 C;  4KGC A;  5E5A B;  5CPI B;  5B32 C;  1P3K B;  4J8W C;  1P3L D;  2ARO B;  1P3M A;  5B2J C;  3W96 D;  3AZF C;  3AZI C;  4ZUX B;  5AV9 A;  5B0Z D;  5B2I C;  4ZBJ C;  5BNX A;  3AV2 A;  1P3F C;  5JA4 A;  5B0Z A;  2ARO D;  3VH6 A;  5BNV A;  4Z5T C;  3AYW A;  3KXB B;  4CSR B;  1P3P C;  1HQ3 A;  5AV6 B;  3AZL C;  5AVB D;  4WV4 B;  5DNM D;  4Z66 B;  4KHA A;  1AOI C;  2FJ7 B;  5B1M D;  4H9N A;  3UT9 A;  4J8X D;  3AZH A;  5CPJ B;  3AZJ C;  3NQJ B;  1U35 D;  1P3F A;  3AZH B;  1TZY A;  3W97 A;  3KXB A;  5CP6 B;  1JFI B;  5GT0 C;  1KX5 D;  3AYW D;  3C1B B;  4UUZ A;  2CWE A;  4G91 B;  5B24 B;  3R45 B;  3AZJ A;  5B1L C;  1HTA A;  5GSU B;  3LEL B;  3W97 C;  1KX3 B;  2ARO C;  3LJA C;  3AFA A;  4NFT A;  5DNN C;  4WU8 A;  2NQB C;  5B33 C;  3C1C D;  3X1T D;  5B0Z C;  3KWQ C;  4YM6 C;  3W98 D;  4E44 A;  3LZ1 C;  3AZN B;  1P34 A;  3NQU B;  4J8X C;  4KGC B;  4KUD A;  4H9Q B;  3MVD B;  1F66 A;  2YFV B;  3B0D C;  4EO5 B;  3AZL D;  2FJ7 C;  1AOI B;  2HUE B;  2BYM B;  5B32 A;  3AZG B;  4J8W A;  5DNM B;  1EQZ D;  3REI B;  1BFM A;  3A6N B;  1KX4 C;  3X1T A;  5GT3 A;  4QLC C;  2YFW B;  3X1S B;  3MGR D;  3UTA C;  2NZD B;  5G49 A;  1EQZ B;  3KSY A;  3X1S A;  3AFA D;  5AVB A;  2HIO C;  4JJN D; 
#chains in the Genus database with same CATH topology
 2HIO A;  1M1A A;  3WKJ A;  1P3B B;  5B1M C;  1WWS A;  5B1M A;  1P3K C;  5AVC A;  5AY8 A;  2ARO A;  4AWL C;  4LD9 D;  5AV5 D;  1BH8 B;  3O62 D;  3AZN D;  1H3O A;  3AZF B;  4X23 C;  3X1V D;  3UTA A;  3AZK D;  3REK C;  4ZBJ B;  3W96 A;  3EPH A;  3AN2 C;  1KX5 A;  3UTA D;  4H9O B;  5DNN D;  3REL B;  1KX4 A;  3LZ0 B;  3F6T A;  3KWQ B;  5JA4 B;  5B0Z B;  4H9O A;  3MGR A;  4YM6 D;  1TZY D;  2PYO C;  5F99 C;  1F66 C;  5JRG D;  1P3L A;  5B31 C;  1M19 D;  3REH A;  3AZM C;  4EO5 C;  5AV6 D;  1P3O A;  1S32 A;  1KX3 A;  3WKJ C;  3WAA C;  5GSU A;  3AZJ B;  4Z2M G;  1ID3 C;  2FJ7 D;  2LY8 A;  5B33 D;  3REI C;  3AFA C;  4J8U C;  4J8U A;  1KX4 D;  2NQB A;  5DNN A;  4WU8 C;  4DQY B;  2F2A C;  4XZQ D;  3TU4 C;  3B6F A;  5B1L A;  2XD5 A;  5AV5 C;  5B0Y A;  3O62 A;  4H9P A;  3REJ C;  5B1L B;  1ZLA A;  5JRG B;  1N1J A;  4H9R A;  3B0B A;  1B6W A;  1P3O C;  3H0L C;  3V9R A;  2NQB B;  4R8P B;  1TZY C;  4WU8 D;  2PYO D;  4QLC D;  5GT3 B;  3AN2 B;  3MGR C;  4NE3 A;  3REL C;  3AV2 B;  2NZD A;  3W99 A;  2Y2N A;  3X1T B;  1P3G C;  4KGC C;  5B40 C;  2CV5 A;  1EQZ A;  2Y2H A;  1F66 B;  2JCH A;  3AZE D;  3A1I A;  1P3O D;  1M1A C;  4HGA C;  5B32 B;  3AZG A;  3AZG C;  1HQ3 C;  3AZL A;  4XZQ B;  3WAA D;  3KFU G;  1ID3 B;  4J8W B;  2F8N D;  5BO0 B;  4YS3 A;  1H3O B;  3AZF A;  4QLC A;  3FDD A;  3REI D;  3LZ0 A;  3UTA B;  4R8P D;  4DRB A;  1JFI A;  1KX5 B;  3X1V B;  3AV2 D;  1WWI A;  3W99 C;  5B1M B;  5AV6 C;  3AZL B;  1U35 C;  5B24 A;  1HQ3 D;  3UT9 B;  5CPJ A;  5AY8 B;  2BYK B;  4H9N B;  4KHA B;  1BH8 A;  2FJ7 A;  5AV8 C;  3LEL A;  3X1U D;  5GT0 D;  1A7W A;  4J8V B;  5C3I C;  3MNN A;  4R8P C;  3AYW B;  3TU4 D;  1P3A B;  5GXQ C;  2PYO B;  3W97 D;  5CHL B;  4UUZ B;  3NQU A;  2F8N K;  2Y2P A;  1P3B D;  3AZK A;  4H9P B;  5JRG A;  4WU9 C;  3W97 B;  3AZE C;  2BYM A;  3VH5 T;  4JJN C;  4WNN A;  3AZI B;  1Q9C A;  4J8U B;  5B24 D;  4WJ3 C;  5DNN B;  3REL D;  4WU8 B;  1P3M B;  4J8V D;  2G5H C;  3H0R C;  3AZN A;  3O62 C;  1TAF A;  3KXB C;  5AV5 A;  5B0Y C;  3LZ1 B;  1ZLA C;  3AV1 A;  1AOI A;  3MVD C;  1M1A D;  1U35 B;  5BS7 A;  3AZG D;  3AZF D;  3UT9 C;  1R4V A;  3W98 B;  2CV5 D;  2F8N G;  1ID3 A;  1P3K A;  2IO5 C;  4XZQ A;  4J8V C;  3AL0 C;  1P3P D;  5AV9 C;  3KXB D;  3W96 B;  4QLC B;  4J8W D;  1P3L C;  3X1S C;  5B40 B;  3KUY B;  1F1E A;  1BH9 A;  3AZM A;  1P3K D;  3WA9 C;  3AZI D;  5KDM A;  2HIO B;  3MGS B;  3WKJ B;  2JSS A;  1P3B A;  5AVC B;  2PYO A;  4HGA B;  1P3B C;  3B0C T;  5AV6 A;  1HQ3 B;  5AV8 D;  4Z5T D;  2XD1 A;  3C1B D;  3AZE B;  3AV1 D;  2Y2G A;  1KU5 A;  3B0C W;  5B2J B;  5CP6 A;  3MNN B;  5BNV B;  3MGP D;  5B31 G;  4YM6 B;  4J8V A;  4ZUX C;  2JE5 A;  5B32 G;  4G92 C;  3B6F D;  5GXQ A;  3B6G B;  5KDM B;  3MGS A;  3X1V A;  2L5A A;  1P3M D;  4LD9 B;  5F99 B;  1S32 B;  3B0D B;  5CPK B;  3MGQ B;  2RIQ A;  5E5A D;  5CPI D;  2YFV A;  1M19 A;  3UT9 D;  3WAA B;  5B40 D;  5GSU D;  5CPJ C;  3X1S D;  1KX4 B;  5CPK D;  1P3I A;  3AFA B;  1P3A C;  5GT3 D;  2F8N A;  4XUJ B;  1M18 B;  1P3L B;  3AZH D;  4NE6 A;  3WA9 A;  3AV1 B;  4M6B A;  5GT0 A;  3LZ1 A;  2ZY4 A;  3WA9 B;  3REJ A;  5AV5 B;  1P34 C;  4KUD C;  5E5A A;  5CPI A;  4AWL B;  2F8N H;  3MGS D;  3MGQ D;  2Y2Q A;  3W99 D;  4CAY A;  5FUG A;  1ULY A;  5AV9 D;  4KGC D;  3A1K A;  3WTP D;  3LJA B;  4R8P A;  3VH5 W;  3MNN C;  3REI A;  1P3F B;  5B0Y B;  4Z2M H;  3MGP C;  2Y2L A;  3AV2 C;  1T3U A;  3A6N D;  5B2I A;  5B2J D;  4Z5T A;  5B31 A;  1P3G B;  1N1J B;  5G49 B;  2FFF B;  1P3P B;  3AZN C;  1S32 C;  1BH9 B;  3AZM B;  4X23 D;  1Z2C B;  3VH6 T;  4Z66 A;  4Z66 C;  4CSR A;  1M1A B;  3AZE A;  1PZR A;  2Y2I A;  3LEL D;  2ZY3 A;  3AZH C;  3UTB D;  4X23 A;  3WTP E;  5GXQ D;  3W96 C;  3A6N C;  4WZS B;  3B6F C;  3C1C A;  3KUY A;  3TU4 B;  1P3A D;  4XUJ C;  1M18 C;  3IP4 C;  3X1V C;  4G91 C;  2VQR A;  3MGS C;  1ID3 D;  5AVC C;  2F8N B;  4WU9 D;  3REH B;  3LEL C;  3R45 A;  5AV8 A;  4E45 A;  3MGQ A;  1M19 B;  3WAA A;  5AV8 B;  5F99 D;  3MVD D;  3AZI A;  1TZY B;  3REL A;  5B1L D;  4WNN B;  5GT3 C;  3AZM D;  3WTP A;  3REJ D;  4G92 B;  3WTP C;  3B6G C;  4UPK A;  1P3I C;  2Y2M A;  4LD9 A;  5GXQ B;  3B6G A;  3LZ0 C;  3AZK B;  3X1U B;  3UTB B;  2YFW A;  4H9S C;  4J8X A;  2Y2K A;  2CV5 B;  1S32 D;  5B31 B;  3REH D;  4WU9 B;  5AVB B;  4XZQ C;  1KX3 D;  2DQN C;  4YS3 C;  3WA9 D;  4H9R B;  4JJN B;  5DNM A;  3EPL A;  3MNN D;  1ZLA D;  3EPK A;  1P3I D;  4ZUX A;  3A6N A;  2RVQ C;  5BT1 D;  2DF4 C;  3B6F B;  4XUJ A;  3X1U A;  5B2I B;  3LJA A;  2NZD C;  3AV1 C;  3O62 B;  5B40 A;  1EQZ C;  2UWX A;  1P3G A;  4XUJ D;  4H9Q A;  3MVD A;  4Z5T B;  1ZLA B;  1P34 B;  4KUD B;  3EG5 B;  3REH C;  5AVC D;  4CAY B;  1B67 A;  1P3G D;  3W98 A;  5FUG B;  2BYK A;  3W98 C;  3H0M C;  1P3O B;  4X23 B;  3LZ1 D;  5BT1 C;  3MGP A;  3REK B;  4ZUX D;  5CP6 D;  5BNX B;  3KUY D;  3MGP B;  3REK A;  1M18 D;  3VH5 A;  5AV9 B;  3TU4 A;  1W2E A;  3C1C B;  3MGR B;  4YM6 A;  3B6G D;  3KWQ A;  3C1B A;  3AZK C;  4YS3 D;  3C1B C;  3X1U C;  1P3P A;  3P5J B;  5E5A C;  5CPI C;  2Y2J A;  5BS7 C;  5AVB C;  5CPJ D;  5GSU C;  5BO0 A;  4YS3 B;  1KX3 C;  1F66 D;  5AY8 D;  5B31 D;  1P34 D;  4KUD D;  3NQJ A;  5B2J A;  1P3M C;  2ZM5 A;  2HIO D;  3V9R B;  3WKJ D;  1P3F D;  4JJN A;  4DRA A;  3REK D;  3LZ0 D;  2RVQ D;  5B33 B;  3AN2 D;  2ZY5 A;  5F99 A;  1P3A A;  3AN2 A;  1KX5 C;  4LD9 C;  3REJ B;  3W99 B;  4J8X B;  1AOI D;  4WU9 A;  3UTB A;  3MGQ C;  5JRG C;  5CPK C;  1M19 C;  5AY8 C;  3EPJ A;  3AZJ D;  5B32 D;  2IO5 B;  2HUE C;  5B0Y D;  5DNM C;  5B33 A;  3WTP B;  3LJA D;  1P3I B;  4NE5 A;  2W8S A;  1TAF B;  5C3I B;  5CP6 C;  3AYW C;  1M18 A;  2NQB D;  2NZD D;  5GT0 B;  3KUY C;  4J8U D;  3C1C C;  4H9S A;  5B2I D;  3VH6 W;  3KWQ D;  3UTB C;  3X1T C;  5CPK A;  5B24 C;  1U35 A;  4Z66 D;  2CV5 C;  4KGC A;  5E5A B;  5CPI B;  2Y2O A;  5B32 C;  1P3K B;  4J8W C;  1P3L D;  2ARO B;  1P3M A;  5B2J C;  3W96 D;  3AZF C;  3AZI C;  4ZUX B;  5AV9 A;  5B0Z D;  5B2I C;  4ZBJ C;  5BNX A;  3AV2 A;  1P3F C;  5JA4 A;  5B0Z A;  2ARO D;  3VH6 A;  5BNV A;  4Z5T C;  3AYW A;  3KXB B;  4CSR B;  1P3P C;  1HQ3 A;  5AV6 B;  3AZL C;  5AVB D;  4WV4 B;  5DNM D;  4Z66 B;  4KHA A;  1AOI C;  2FJ7 B;  5B1M D;  4H9N A;  3UT9 A;  4J8X D;  3AZH A;  5CPJ B;  3AZJ C;  3NQJ B;  1U35 D;  1P3F A;  3AZH B;  1TZY A;  3W97 A;  3KXB A;  5CP6 B;  1JFI B;  5GT0 C;  1KX5 D;  3AYW D;  3C1B B;  4UUZ A;  2CWE A;  4G91 B;  5B24 B;  3R45 B;  3AZJ A;  5B1L C;  1HTA A;  5GSU B;  3LEL B;  3W97 C;  1KX3 B;  2ARO C;  2J8P A;  3LJA C;  3AFA A;  4NFT A;  5DNN C;  4WU8 A;  2NQB C;  5B33 C;  3C1C D;  3X1T D;  5B0Z C;  3KWQ C;  4YM6 C;  3W98 D;  4E44 A;  3LZ1 C;  2ZY2 A;  3AZN B;  2BG1 A;  1P34 A;  3NQU B;  4J8X C;  4KGC B;  4KUD A;  4H9Q B;  3MVD B;  1F66 A;  2G5I C;  2YFV B;  3B0D C;  4EO5 B;  3AZL D;  2FJ7 C;  1AOI B;  2HUE B;  2BYM B;  5B32 A;  3AZG B;  4J8W A;  5DNM B;  1EQZ D;  3REI B;  1BFM A;  3A6N B;  1KX4 C;  3X1T A;  5GT3 A;  4QLC C;  2YFW B;  3X1S B;  3MGR D;  3UTA C;  2NZD B;  5G49 A;  1EQZ B;  3KSY A;  3X1S A;  3AFA D;  5AVB A;  2HIO C;  4JJN D; 
#chains in the Genus database with same CATH homology
 2HIO A;  1M1A A;  3WKJ A;  1P3B B;  5B1M C;  1WWS A;  5B1M A;  1P3K C;  5AVC A;  5AY8 A;  2ARO A;  4AWL C;  4LD9 D;  5AV5 D;  1BH8 B;  3O62 D;  3AZN D;  1H3O A;  3AZF B;  4X23 C;  3X1V D;  3UTA A;  3AZK D;  3REK C;  4ZBJ B;  3W96 A;  3EPH A;  3AN2 C;  1KX5 A;  3UTA D;  4H9O B;  5DNN D;  3REL B;  1KX4 A;  3LZ0 B;  3F6T A;  3KWQ B;  5JA4 B;  5B0Z B;  4H9O A;  3MGR A;  4YM6 D;  1TZY D;  2PYO C;  5F99 C;  1F66 C;  5JRG D;  1P3L A;  5B31 C;  1M19 D;  3REH A;  3AZM C;  4EO5 C;  5AV6 D;  1P3O A;  1S32 A;  1KX3 A;  3WKJ C;  3WAA C;  5GSU A;  3AZJ B;  4Z2M G;  1ID3 C;  2FJ7 D;  2LY8 A;  5B33 D;  3REI C;  3AFA C;  4J8U C;  4J8U A;  1KX4 D;  2NQB A;  5DNN A;  4WU8 C;  4DQY B;  2F2A C;  4XZQ D;  3TU4 C;  3B6F A;  5B1L A;  2XD5 A;  5AV5 C;  5B0Y A;  3O62 A;  4H9P A;  3REJ C;  5B1L B;  1ZLA A;  5JRG B;  1N1J A;  4H9R A;  3B0B A;  1B6W A;  1P3O C;  3H0L C;  3V9R A;  2NQB B;  4R8P B;  1TZY C;  4WU8 D;  2PYO D;  4QLC D;  5GT3 B;  3AN2 B;  3MGR C;  4NE3 A;  3REL C;  3AV2 B;  2NZD A;  3W99 A;  2Y2N A;  3X1T B;  1P3G C;  4KGC C;  5B40 C;  2CV5 A;  1EQZ A;  2Y2H A;  1F66 B;  2JCH A;  3AZE D;  3A1I A;  1P3O D;  1M1A C;  4HGA C;  5B32 B;  3AZG A;  3AZG C;  1HQ3 C;  3AZL A;  4XZQ B;  3WAA D;  3KFU G;  1ID3 B;  4J8W B;  2F8N D;  5BO0 B;  4YS3 A;  1H3O B;  3AZF A;  4QLC A;  3FDD A;  3REI D;  3LZ0 A;  3UTA B;  4R8P D;  4DRB A;  1JFI A;  1KX5 B;  3X1V B;  3AV2 D;  1WWI A;  3W99 C;  5B1M B;  5AV6 C;  3AZL B;  1U35 C;  5B24 A;  1HQ3 D;  3UT9 B;  5CPJ A;  5AY8 B;  2BYK B;  4H9N B;  4KHA B;  1BH8 A;  2FJ7 A;  5AV8 C;  3LEL A;  3X1U D;  5GT0 D;  1A7W A;  4J8V B;  5C3I C;  3MNN A;  4R8P C;  3AYW B;  3TU4 D;  1P3A B;  5GXQ C;  2PYO B;  3W97 D;  5CHL B;  4UUZ B;  3NQU A;  2F8N K;  2Y2P A;  1P3B D;  3AZK A;  4H9P B;  5JRG A;  4WU9 C;  3W97 B;  3AZE C;  2BYM A;  3VH5 T;  4JJN C;  4WNN A;  3AZI B;  1Q9C A;  4J8U B;  5B24 D;  4WJ3 C;  5DNN B;  3REL D;  4WU8 B;  1P3M B;  4J8V D;  2G5H C;  3H0R C;  3AZN A;  3O62 C;  1TAF A;  3KXB C;  5AV5 A;  5B0Y C;  3LZ1 B;  1ZLA C;  3AV1 A;  1AOI A;  3MVD C;  1M1A D;  1U35 B;  5BS7 A;  3AZG D;  3AZF D;  3UT9 C;  1R4V A;  3W98 B;  2CV5 D;  2F8N G;  1ID3 A;  1P3K A;  2IO5 C;  4XZQ A;  4J8V C;  3AL0 C;  1P3P D;  5AV9 C;  3KXB D;  3W96 B;  4QLC B;  4J8W D;  1P3L C;  3X1S C;  5B40 B;  3KUY B;  1F1E A;  1BH9 A;  3AZM A;  1P3K D;  3WA9 C;  3AZI D;  5KDM A;  2HIO B;  3MGS B;  3WKJ B;  2JSS A;  1P3B A;  5AVC B;  2PYO A;  4HGA B;  1P3B C;  3B0C T;  5AV6 A;  1HQ3 B;  5AV8 D;  4Z5T D;  2XD1 A;  3C1B D;  3AZE B;  3AV1 D;  2Y2G A;  1KU5 A;  3B0C W;  5B2J B;  5CP6 A;  3MNN B;  5BNV B;  3MGP D;  5B31 G;  4YM6 B;  4J8V A;  4ZUX C;  2JE5 A;  5B32 G;  4G92 C;  3B6F D;  5GXQ A;  3B6G B;  5KDM B;  3MGS A;  3X1V A;  2L5A A;  1P3M D;  4LD9 B;  5F99 B;  1S32 B;  3B0D B;  5CPK B;  3MGQ B;  2RIQ A;  5E5A D;  5CPI D;  2YFV A;  1M19 A;  3UT9 D;  3WAA B;  5B40 D;  5GSU D;  5CPJ C;  3X1S D;  1KX4 B;  5CPK D;  1P3I A;  3AFA B;  1P3A C;  5GT3 D;  2F8N A;  4XUJ B;  1M18 B;  1P3L B;  3AZH D;  4NE6 A;  3WA9 A;  3AV1 B;  4M6B A;  5GT0 A;  3LZ1 A;  2ZY4 A;  3WA9 B;  3REJ A;  5AV5 B;  1P34 C;  4KUD C;  5E5A A;  5CPI A;  4AWL B;  2F8N H;  3MGS D;  3MGQ D;  2Y2Q A;  3W99 D;  4CAY A;  5FUG A;  1ULY A;  5AV9 D;  4KGC D;  3A1K A;  3WTP D;  3LJA B;  4R8P A;  3VH5 W;  3MNN C;  3REI A;  1P3F B;  5B0Y B;  4Z2M H;  3MGP C;  2Y2L A;  3AV2 C;  1T3U A;  3A6N D;  5B2I A;  5B2J D;  4Z5T A;  5B31 A;  1P3G B;  1N1J B;  5G49 B;  2FFF B;  1P3P B;  3AZN C;  1S32 C;  1BH9 B;  3AZM B;  4X23 D;  1Z2C B;  3VH6 T;  4Z66 A;  4Z66 C;  4CSR A;  1M1A B;  3AZE A;  1PZR A;  2Y2I A;  3LEL D;  2ZY3 A;  3AZH C;  3UTB D;  4X23 A;  3WTP E;  5GXQ D;  3W96 C;  3A6N C;  4WZS B;  3B6F C;  3C1C A;  3KUY A;  3TU4 B;  1P3A D;  4XUJ C;  1M18 C;  3IP4 C;  3X1V C;  4G91 C;  2VQR A;  3MGS C;  1ID3 D;  5AVC C;  2F8N B;  4WU9 D;  3REH B;  3LEL C;  3R45 A;  5AV8 A;  4E45 A;  3MGQ A;  1M19 B;  3WAA A;  5AV8 B;  5F99 D;  3MVD D;  3AZI A;  1TZY B;  3REL A;  5B1L D;  4WNN B;  5GT3 C;  3AZM D;  3WTP A;  3REJ D;  4G92 B;  3WTP C;  3B6G C;  4UPK A;  1P3I C;  2Y2M A;  4LD9 A;  5GXQ B;  3B6G A;  3LZ0 C;  3AZK B;  3X1U B;  3UTB B;  2YFW A;  4H9S C;  4J8X A;  2Y2K A;  2CV5 B;  1S32 D;  5B31 B;  3REH D;  4WU9 B;  5AVB B;  4XZQ C;  1KX3 D;  2DQN C;  4YS3 C;  3WA9 D;  4H9R B;  4JJN B;  5DNM A;  3EPL A;  3MNN D;  1ZLA D;  3EPK A;  1P3I D;  4ZUX A;  3A6N A;  2RVQ C;  5BT1 D;  2DF4 C;  3B6F B;  4XUJ A;  3X1U A;  5B2I B;  3LJA A;  2NZD C;  3AV1 C;  3O62 B;  5B40 A;  1EQZ C;  2UWX A;  1P3G A;  4XUJ D;  4H9Q A;  3MVD A;  4Z5T B;  1ZLA B;  1P34 B;  4KUD B;  3EG5 B;  3REH C;  5AVC D;  4CAY B;  1B67 A;  1P3G D;  3W98 A;  5FUG B;  2BYK A;  3W98 C;  3H0M C;  1P3O B;  4X23 B;  3LZ1 D;  5BT1 C;  3MGP A;  3REK B;  4ZUX D;  5CP6 D;  5BNX B;  3KUY D;  3MGP B;  3REK A;  1M18 D;  3VH5 A;  5AV9 B;  3TU4 A;  1W2E A;  3C1C B;  3MGR B;  4YM6 A;  3B6G D;  3KWQ A;  3C1B A;  3AZK C;  4YS3 D;  3C1B C;  3X1U C;  1P3P A;  3P5J B;  5E5A C;  5CPI C;  2Y2J A;  5BS7 C;  5AVB C;  5CPJ D;  5GSU C;  5BO0 A;  4YS3 B;  1KX3 C;  1F66 D;  5AY8 D;  5B31 D;  1P34 D;  4KUD D;  3NQJ A;  5B2J A;  1P3M C;  2ZM5 A;  2HIO D;  3V9R B;  3WKJ D;  1P3F D;  4JJN A;  4DRA A;  3REK D;  3LZ0 D;  2RVQ D;  5B33 B;  3AN2 D;  2ZY5 A;  5F99 A;  1P3A A;  3AN2 A;  1KX5 C;  4LD9 C;  3REJ B;  3W99 B;  4J8X B;  1AOI D;  4WU9 A;  3UTB A;  3MGQ C;  5JRG C;  5CPK C;  1M19 C;  5AY8 C;  3EPJ A;  3AZJ D;  5B32 D;  2IO5 B;  2HUE C;  5B0Y D;  5DNM C;  5B33 A;  3WTP B;  3LJA D;  1P3I B;  4NE5 A;  2W8S A;  1TAF B;  5C3I B;  5CP6 C;  3AYW C;  1M18 A;  2NQB D;  2NZD D;  5GT0 B;  3KUY C;  4J8U D;  3C1C C;  4H9S A;  5B2I D;  3VH6 W;  3KWQ D;  3UTB C;  3X1T C;  5CPK A;  5B24 C;  1U35 A;  4Z66 D;  2CV5 C;  4KGC A;  5E5A B;  5CPI B;  2Y2O A;  5B32 C;  1P3K B;  4J8W C;  1P3L D;  2ARO B;  1P3M A;  5B2J C;  3W96 D;  3AZF C;  3AZI C;  4ZUX B;  5AV9 A;  5B0Z D;  5B2I C;  4ZBJ C;  5BNX A;  3AV2 A;  1P3F C;  5JA4 A;  5B0Z A;  2ARO D;  3VH6 A;  5BNV A;  4Z5T C;  3AYW A;  3KXB B;  4CSR B;  1P3P C;  1HQ3 A;  5AV6 B;  3AZL C;  5AVB D;  4WV4 B;  5DNM D;  4Z66 B;  4KHA A;  1AOI C;  2FJ7 B;  5B1M D;  4H9N A;  3UT9 A;  4J8X D;  3AZH A;  5CPJ B;  3AZJ C;  3NQJ B;  1U35 D;  1P3F A;  3AZH B;  1TZY A;  3W97 A;  3KXB A;  5CP6 B;  1JFI B;  5GT0 C;  1KX5 D;  3AYW D;  3C1B B;  4UUZ A;  2CWE A;  4G91 B;  5B24 B;  3R45 B;  3AZJ A;  5B1L C;  1HTA A;  5GSU B;  3LEL B;  3W97 C;  1KX3 B;  2ARO C;  2J8P A;  3LJA C;  3AFA A;  4NFT A;  5DNN C;  4WU8 A;  2NQB C;  5B33 C;  3C1C D;  3X1T D;  5B0Z C;  3KWQ C;  4YM6 C;  3W98 D;  4E44 A;  3LZ1 C;  2ZY2 A;  3AZN B;  2BG1 A;  1P34 A;  3NQU B;  4J8X C;  4KGC B;  4KUD A;  4H9Q B;  3MVD B;  1F66 A;  2G5I C;  2YFV B;  3B0D C;  4EO5 B;  3AZL D;  2FJ7 C;  1AOI B;  2HUE B;  2BYM B;  5B32 A;  3AZG B;  4J8W A;  5DNM B;  1EQZ D;  3REI B;  1BFM A;  3A6N B;  1KX4 C;  3X1T A;  5GT3 A;  4QLC C;  2YFW B;  3X1S B;  3MGR D;  3UTA C;  2NZD B;  5G49 A;  1EQZ B;  3KSY A;  3X1S A;  3AFA D;  5AVB A;  2HIO C;  4JJN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...