3X1UA

Crystal structure of nucleosome core particle in the presence of histone variants involved in reprogramming
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
molecule tags Structural protein/dna
source organism Homo sapiens
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming.
pubmed doi rcsb
total genus 29
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1uA00
3LELA 1ID3A 3UTAA 1KX4C 3W98C 3REHC 5AY8B 3W96A 3B0CT 3TU4C 2NZDD 5B33D 4Z66C 1P3IB 4J8XA 4H9RA 1P34C 3AZIB 2HIOB 3REKB 4QLCA 3AZIC 4KGCA 5JRGC 4JJNB 2FJ7A 4WU8A 1M18B 2NZDA 1H3OA 3O62B 5B0ZB 5B2ID 1P3BA 3KUYB 1BH8A 5AV6C 4J8VC 3UTBA 4H9NB 2IO5C 3MGPC 1N1JA 1M1AB 4XZQB 3AZFB 1KX3D 3AZFA 5AVBC 5C3IC 3WAAA 5AV8C 1P3PD 1AOID 5E5AC 4ZUXA 1M19C 3V9RA 2YFVB 5AY8D 1ZLAB 2HIOA 3REKA 1S32C 1P3KD 3X1TC 3MGRD 3MGRA 5B32B 4NFTA 5GSUB 5AV9A 2F8NK 3WTPA 5CPJB 3REID 2HIOD 3REKD 2CV5D 5AY8A 2JSSA 1KX3C 4R8PB 1F66C 1B67A 4WNNA 4X23C 5B2JA 5B33B 3MGSD 1HTAA 1P3LC 1A7WA 3R45B 5CHLB 3AYWD 3W98A 5B1MC 4Z5TB 4DRBA 3MVDD 5AV6B 4J8VB 5AV5C 3AZLC 3AV1A 3AZED 4WU9A 3LZ1B 5GSUA 2YFWA 3AZEB 3AZJB 4G91B 5DNNC 5AVCC 5GT3A 3UT9B 4H9OB 5BO0A 3AV2B 5B1LB 1KX5A 4LD9D 4JJND 5B1LA 1KX5B 5B1LD 3X1UC 5F99A 4LD9B 4H9SC 5JRGB 4J8UA 5E5AD 3B0DC 3A6ND 3LZ0C 5G49A 4AWLC 3W99B 2AROB 2LY8A 1S32B 5CP6A 1WWIA 1ULYA 5DNND 3R45A 5AVCD 5B0YA 1P3BC 5GSUD 5B33A 1P3PB 2PYOC 3MVDA 3MNNC 5B2IC 3W98B 1M1AD 5DNMA 3WTPE 3AZFC 2PYOD 3LELC 5CPKD 3AYWA 3AZHB 3B6GD 1AOIB 5FUGB 3MGSC 3REHA 5CPIB 2CV5B 1U35B 2RVQD 2CV5A 3REIA 4J8XC 3REJD 3C1BD 2L5AA 5CPIC 5BNXB 5BS7C 3KXBD 3WTPD 3AN2A 3AV2A 1R4VA 3X1TA 2F8NB 4KUDA 1P3GC 3MGSB 3WTPC 3C1CA 3AZID 4XUJC 1Q9CA 4H9PA 3REJA 5DNMB 4E45A 5AV6D 4J8VD 4CAYA 3REHD 3AZEC 1AOIA 1P3PA 3A6NB 2NZDC 3AYWB 5B31A 4XZQD 5CPKA 5B31B 4ZBJB 3UTBB 1P3LD 1KX4D 3AZGA 1JFIA 2F8NG 1P3BD 3AZJD 5DNNA 5AVCA 4YM6C 3AN2B 4KUDB 3W99D 4H9QB 3UT9C 3B6FA 4AWLB 4WU8D 3V9RB 4YM6D 5B1LC 5F99C 4J8UC 1P3KC 4QLCD 3B0BA 1BFMA 3W97A 5AV9B 3X1VC 5GT3D 1TZYC 5B0YC 3KXBC 3REIB 4WU9D 3B6GB 2PYOA 5C3IB 4CSRB 3MNNA 3AZGD 2IO5B 3UTAB 4H9PB 3REJB 4M6BA 3AZMB 3KXBB 3MGSA 3X1VB 5CP6B 3W97B 5BT1C 4YS3A 3TU4A 3REIC 4JJNA 1P3GA 5B32C 5AV9C 3B6FD 3AN2D 4KUDD 3AV1B 2FJ7B 5JRGA 4J8UB 1M19D 3AZJA 3O62D 1F66A 3AFAB 4ZUXD 4CSRA 3AZKB 5E5AB 1ID3B 1U35A 3KUYC 3B6GA 1P3LA 3W98D 1N1JB 4H9RB 1HQ3C 4XZQA 5B31D 3AZGC 4HGAB 3AZMA 5GT0B 3LJAC 3MVDC 5AV6A 4J8VA 3KSYA 3UTBC 5B2IA 5DNMC 2NQBA 3WKJB 4QLCB 3WAAC 5AV9D 1M18C 1P3ID 5GT3B 3X1SA 2YFVA 1P3FC 1P3GD 5E5AA 4ZUXC 3MGRB 1P3GB 3X1UA 1P3KA 5B40D 5CPID 2CV5C 2HIOC 3REKC 3WA9C 1TAFB 3KWQB 3C1CB 4J8WA 4KHAA 3REHB 1P3MD 3WAAD 3LJAD 3WAAB 4H9QA 3B6FB 3MGQB 3AZHC 3AV1D 5DNMD 2F8NH 1M1AA 4YS3B 4Z5TA 3UTBD 4Z5TD 3MVDB 5B2IB 5AV8D 4E44A 1P3OC 1P3PC 5GXQC 3AFAC 3AZKC 1ID3D 3MGPD 5CP6D 4CAYB 1H3OB 4J8WD 4YS3C 3W97D 4J8WB 3A6NA 2FJ7D 4J8UD 1P3BB 2CWEA 5CPIA 1P3MC 1F1EA 3AV2C 3X1UD 1KX5D 4LD9A 4YM6A 3X1UB 5GT3C 3C1CC 1P3IA 4XUJA 5G49B 3LZ0B 3W99A 5B40C 3AZJC 4G91C 5AVCB 5DNNB 5B0ZD 3VH6T 4H9SA 2YFWB 4ZUXB 3AZEA 5AV5B 2HUEB 4HGAC 3W96D 3LZ1C 1P3AB 1KX4A 3LELB 3AZFD 3UTAD 1P3AC 4G92B 5CPKB 5B33C 3AZMC 4WU9B 1BH8B 5B24A 3AZGB 1JFIB 3O62A 1F66D 2NQBC 4R8PC 1P34A 1F66B 1EQZC 4H9OA 2HUEC 5B31G 3C1CD 5B0ZA 5B2JB 5BNVA 3X1VD 3X1TD 1BH9A 4Z2MH 5B40B 5BNXA 4WU8C 3X1TB 2F8NA 3WA9A 4YS3D 3W97C 4R8PD 5B32A 1P3MB 3RELD 5FUGA 1P3OB 3AZLB 3VH5T 4J8XD 3REJC 4ZBJC 3AZLD 3AZHA 3MGPB 1M1AC 1ZLAA 3MGPA 4Z5TC 3MGQC 5AVBA 3NQUB 5B32G 5AV8B 3KUYA 3B6GC 5AV8A 3W96B 3LELD 1HQ3A 4XZQC 1TZYB 4X23D 5CPKC 3WKJD 4WNNB 4NE3A 2AROA 1S32A 3A6NC 4Z66A 3NQJB 4Z2MG 5GT0D 1P3MA 4JJNC 3RELC 4NE5A 4KGCB 2BYMB 3VH5A 3C1BC 4QLCC 2RVQC 3WA9B 3UT9A 3C1BB 3WTPB 1P3FA 3X1SD 5GT0C 3LJAB 5F99B 5AV5D 1U35C 3NQUA 1P34B 3WKJC 4J8WC 3MNNB 2PYOB 3W96C 5KDMB 3MGQD 5B2JD 4KHAB 3O62C 1HQ3B 5B1MD 4UUZA 3KWQC 1P3OA 1U35D 3B0DB 3VH6W 3LZ1D 1M18A 2NZDB 3AZIA 1KX5C 3X1SC 4KGCC 1M19A 1P3FB 2FJ7C 3LZ0D 1P3FD 4XUJD 1B6WA 3AZNC 4WU8B 5CP6C 5CPJA 4LD9C 3B0CW 3AFAD 3RELB 3AZKD 1EQZD 3NQJA 4Z66B 1P3IC 1P3OD 1EQZB 4Z66D 4J8XB 1S32D 4UUZB 1KX3A 5BNVB 3MGQA 4X23A 1P3LB 1KX4B 4H9NA 5KDMA 5GXQA 1ID3C 3KUYD 3UTAC 1P3AD 5B0YD 3MNND 5B24B 2AROC 1ZLAD 5AV5A 3AZHD 3AZLA 3AV1C 5GSUC 3LJAA 5BS7A 3VH5W 3RELA 5B32D 5F99D 5JA4B 4R8PA 4KGCD 2BYKA 5CPJD 3W99C 2F8ND 1P3KB 5B40A 5GT0A 5B2JC 1M18D 2NQBB 4WV4B 3LZ1A 3WKJA 4WZSB 1HQ3D 5B31C 2NQBD 1M19B 5B1MB 5B1MA 1P3AA 4EO5B 5GXQD 3VH6A 3AZMD 5AVBD 5GXQB 4G92C 4EO5C 4WU9C 5AVBB 5BT1D 5B24C 4NE6A 1TAFA 3KWQA 3AYWC 3B6FC 1EQZA 3AFAA 3AZKA 2BYKB 5B0ZC 4X23B 1TZYD 5BO0B 5JA4A 5B0YB 5JRGD 3WA9D 4DRAA 1KX3B 3AZND 4XUJB 3LZ0A 3AZNA 1WWSA 3AZNB 3UT9D 1BH9B 4YM6B 2BYMA 3AN2C 3X1VA 5CPJC 4KUDC 1TZYA 3AV2D 3MGRC 3KXBA 3C1BA 3TU4B 1P34D 3TU4D 5AY8C 3KWQD 1KU5A 2AROD 1ZLAC 5B24D 3X1SB 1AOIC
chains in the Genus database with same CATH superfamily
3LELA 1ID3A 3UTAA 1KX4C 4DQYB 3W98C 3REHC 5AY8B 3W96A 3B0CT 2Y2QA 3TU4C 2NZDD 5B33D 4Z66C 1P3IB 4J8XA 4H9RA 1P34C 3AZIB 2HIOB 3REKB 4QLCA 3A1IA 3AZIC 4KGCA 5JRGC 4JJNB 2BG1A 2FJ7A 4WU8A 2ZY3A 1M18B 2NZDA 1H3OA 3O62B 5B0ZB 5B2ID 1P3BA 3KUYB 1BH8A 2XD1A 5AV6C 4J8VC 3UTBA 4H9NB 2IO5C 3MGPC 1N1JA 1M1AB 4XZQB 3AZFB 1KX3D 3AZFA 2W8SA 5AVBC 5C3IC 3WAAA 5AV8C 1P3PD 1AOID 5E5AC 4ZUXA 2G5IC 1M19C 3V9RA 2YFVB 5AY8D 1ZLAB 2HIOA 3REKA 1S32C 1P3KD 2JE5A 3X1TC 3MGRD 3MGRA 5B32B 4NFTA 5GSUB 5AV9A 2F8NK 3WTPA 5CPJB 3REID 2HIOD 3REKD 2CV5D 5AY8A 2JSSA 1KX3C 4R8PB 1F66C 1B67A 4WNNA 4X23C 2ZY2A 5B2JA 5B33B 3MGSD 1HTAA 1P3LC 1A7WA 3R45B 5CHLB 3AYWD 3W98A 5B1MC 4Z5TB 4DRBA 3MVDD 5AV6B 4J8VB 5AV5C 3AZLC 3AV1A 3AZED 4WU9A 3LZ1B 5GSUA 3IP4C 2YFWA 2G5HC 3AZEB 3AZJB 4G91B 5DNNC 5AVCC 5GT3A 3UT9B 4H9OB 5BO0A 3AV2B 5B1LB 1KX5A 4LD9D 4JJND 5B1LA 1KX5B 5B1LD 3X1UC 5F99A 4LD9B 4H9SC 5JRGB 4J8UA 5E5AD 3B0DC 3A6ND 3LZ0C 5G49A 4AWLC 3W99B 2AROB 2LY8A 1S32B 5CP6A 1WWIA 1ULYA 5DNND 3R45A 5AVCD 5B0YA 1P3BC 5GSUD 5B33A 1P3PB 2PYOC 3MVDA 2XD5A 3MNNC 5B2IC 3W98B 1M1AD 5DNMA 3WTPE 3AZFC 2PYOD 3LELC 5CPKD 3AYWA 3AZHB 3B6GD 1AOIB 5FUGB 3MGSC 3REHA 5CPIB 2CV5B 2RIQA 1U35B 2RVQD 2CV5A 3REIA 4J8XC 3REJD 3C1BD 2L5AA 5CPIC 5BNXB 5BS7C 3WTPD 3KXBD 3AN2A 3AV2A 1R4VA 3X1TA 2F8NB 4KUDA 1P3GC 3MGSB 1T3UA 3WTPC 3C1CA 3AZID 1Z2CB 4XUJC 1Q9CA 4H9PA 3REJA 5DNMB 4E45A 5AV6D 2JCHA 4CAYA 4J8VD 3REHD 3AZEC 1AOIA 1P3PA 3A6NB 2NZDC 3AYWB 3F6TA 5B31A 4XZQD 5CPKA 5B31B 4ZBJB 3UTBB 1P3LD 3FDDA 1KX4D 3AZGA 1JFIA 2F8NG 1P3BD 3AZJD 5DNNA 5AVCA 4YM6C 3AN2B 4KUDB 2Y2HA 3W99D 4H9QB 3UT9C 3B6FA 4AWLB 4WU8D 3V9RB 4YM6D 5B1LC 5F99C 4J8UC 1P3KC 2UWXA 4QLCD 3B0BA 1BFMA 3W97A 5AV9B 3EPHA 3X1VC 5GT3D 1TZYC 5B0YC 3KXBC 3REIB 4WU9D 3B6GB 2PYOA 5C3IB 4CSRB 3MNNA 3AZGD 2IO5B 3UTAB 4H9PB 3REJB 4M6BA 3AZMB 3P5JB 3KXBB 3MGSA 3X1VB 5CP6B 3W97B 5BT1C 4YS3A 3TU4A 3REIC 4JJNA 1P3GA 5B32C 5AV9C 3B6FD 3AN2D 4KUDD 3AV1B 2FJ7B 5JRGA 4J8UB 1M19D 3AZJA 3O62D 1F66A 3AFAB 4ZUXD 4CSRA 3AZKB 5E5AB 1ID3B 1U35A 2Y2LA 3KUYC 1P3LA 3B6GA 3W98D 1N1JB 4H9RB 1HQ3C 4XZQA 5B31D 3AZGC 4HGAB 3AZMA 5GT0B 3LJAC 3MVDC 5AV6A 4J8VA 3KSYA 3UTBC 5B2IA 5DNMC 2Y2GA 2NQBA 3WKJB 4QLCB 3WAAC 5AV9D 1M18C 1P3ID 5GT3B 3X1SA 2YFVA 1P3FC 1P3GD 5E5AA 4ZUXC 3MGRB 3EPJA 1P3GB 3X1UA 1P3KA 5B40D 5CPID 2CV5C 2HIOC 3REKC 3WA9C 1TAFB 3KWQB 3C1CB 4J8WA 4KHAA 3REHB 1P3MD 3H0MC 3LJAD 3WAAD 3WAAB 4H9QA 3B6FB 3MGQB 3AZHC 3AV1D 5DNMD 2F8NH 1M1AA 4YS3B 4Z5TA 3UTBD 4Z5TD 3MVDB 5B2IB 5AV8D 4E44A 1P3OC 1P3PC 5GXQC 3AFAC 3AZKC 1ID3D 3MGPD 5CP6D 2DF4C 4CAYB 1H3OB 4J8WD 4YS3C 3W97D 4J8WB 3A6NA 2FJ7D 4J8UD 1P3BB 2CWEA 5CPIA 1P3MC 1F1EA 3AV2C 3X1UD 1KX5D 4LD9A 4YM6A 3X1UB 5GT3C 3C1CC 1P3IA 4XUJA 5G49B 3LZ0B 3W99A 5B40C 3AZJC 4G91C 5AVCB 5DNNB 5B0ZD 3VH6T 4H9SA 2YFWB 4ZUXB 3AZEA 5AV5B 2HUEB 4HGAC 2ZM5A 3W96D 3LZ1C 1P3AB 1KX4A 3LELB 1W2EA 3AZFD 3UTAD 1P3AC 4G92B 5CPKB 4WJ3C 5B33C 3AZMC 4WU9B 1BH8B 5B24A 3AZGB 1JFIB 3O62A 1F66D 2NQBC 4R8PC 1P34A 1F66B 1EQZC 4H9OA 2HUEC 5B31G 3C1CD 5B0ZA 5B2JB 5BNVA 3X1VD 2J8PA 3X1TD 1BH9A 4Z2MH 5B40B 5BNXA 4WU8C 3X1TB 2F8NA 3WA9A 4YS3D 3W97C 2ZY5A 4R8PD 5B32A 1P3MB 2Y2PA 3RELD 5FUGA 1P3OB 3AZLB 3VH5T 4J8XD 3REJC 4ZBJC 3AZLD 3AZHA 2Y2OA 3MGPB 1M1AC 1ZLAA 3MGPA 4Z5TC 3MGQC 5AVBA 3NQUB 5B32G 5AV8B 3KUYA 3B6GC 5AV8A 3W96B 3H0LC 3LELD 1HQ3A 4XZQC 1TZYB 4X23D 5CPKC 3WKJD 3KFUG 4WNNB 4NE3A 2AROA 1S32A 3A6NC 3NQJB 4Z66A 4Z2MG 5GT0D 1P3MA 4JJNC 3RELC 4NE5A 4UPKA 4KGCB 2BYMB 3VH5A 3C1BC 3AL0C 4QLCC 2RVQC 3WA9B 3UT9A 3C1BB 3WTPB 1P3FA 3X1SD 5GT0C 3LJAB 5F99B 5AV5D 1U35C 3NQUA 1P34B 3WKJC 4J8WC 3MNNB 2PYOB 3W96C 5KDMB 3MGQD 5B2JD 4KHAB 3O62C 1HQ3B 5B1MD 4UUZA 3KWQC 1P3OA 1U35D 3B0DB 3VH6W 3LZ1D 1M18A 2NZDB 3AZIA 1KX5C 3X1SC 4KGCC 3A1KA 1M19A 1P3FB 2FJ7C 3LZ0D 1P3FD 2Y2JA 4XUJD 1B6WA 2Y2NA 3AZNC 4WU8B 5CP6C 5CPJA 2VQRA 4LD9C 3B0CW 3AFAD 3RELB 3AZKD 1EQZD 3NQJA 4Z66B 1P3IC 1P3OD 1EQZB 4Z66D 4J8XB 1S32D 4UUZB 1KX3A 5BNVB 3MGQA 4X23A 1P3LB 1KX4B 4H9NA 5KDMA 5GXQA 1ID3C 3KUYD 2Y2KA 3UTAC 1P3AD 3EG5B 5B0YD 3MNND 5B24B 2AROC 1ZLAD 5AV5A 3AZHD 3AZLA 3AV1C 5GSUC 3LJAA 5BS7A 3VH5W 3RELA 5B32D 5F99D 5JA4B 4R8PA 2Y2IA 4KGCD 2BYKA 5CPJD 3W99C 2F2AC 2F8ND 1P3KB 5B40A 5GT0A 5B2JC 3EPKA 1PZRA 1M18D 3H0RC 4WV4B 3LZ1A 3WKJA 2NQBB 4WZSB 1HQ3D 5B31C 2NQBD 1M19B 2ZY4A 5B1MB 5B1MA 1P3AA 4EO5B 5GXQD 3VH6A 3AZMD 2FFFB 5AVBD 5GXQB 4G92C 4EO5C 4WU9C 5AVBB 5BT1D 5B24C 4NE6A 1TAFA 3KWQA 3AYWC 3B6FC 1EQZA 3AFAA 3AZKA 2BYKB 2DQNC 5B0ZC 1TZYD 5JA4A 5BO0B 4X23B 5B0YB 2Y2MA 5JRGD 3WA9D 4DRAA 1KX3B 3AZND 4XUJB 3LZ0A 3AZNA 1WWSA 3AZNB 3UT9D 1BH9B 4YM6B 2BYMA 3AN2C 3X1VA 5CPJC 4KUDC 1TZYA 3AV2D 3MGRC 3KXBA 3C1BA 3TU4B 1P34D 3TU4D 5AY8C 3KWQD 1KU5A 2AROD 1ZLAC 5B24D 3X1SB 3EPLA 1AOIC
chains in the Genus database with same CATH topology
3LELA 1ID3A 3UTAA 1KX4C 4DQYB 3W98C 3REHC 5AY8B 3W96A 3B0CT 2Y2QA 3TU4C 2NZDD 5B33D 4Z66C 1P3IB 4J8XA 4H9RA 1P34C 3AZIB 2HIOB 3REKB 4QLCA 3A1IA 3AZIC 4KGCA 5JRGC 4JJNB 2BG1A 2FJ7A 4WU8A 2ZY3A 1M18B 2NZDA 1H3OA 3O62B 5B0ZB 5B2ID 1P3BA 3KUYB 1BH8A 2XD1A 5AV6C 4J8VC 3UTBA 4H9NB 2IO5C 3MGPC 1N1JA 1M1AB 4XZQB 3AZFB 1KX3D 3AZFA 2W8SA 5AVBC 5C3IC 3WAAA 5AV8C 1P3PD 1AOID 5E5AC 4ZUXA 2G5IC 1M19C 3V9RA 2YFVB 5AY8D 1ZLAB 2HIOA 3REKA 1S32C 1P3KD 2JE5A 3X1TC 3MGRD 3MGRA 5B32B 4NFTA 5GSUB 5AV9A 2F8NK 3WTPA 5CPJB 3REID 2HIOD 3REKD 2CV5D 5AY8A 2JSSA 1KX3C 4R8PB 1F66C 1B67A 4WNNA 4X23C 2ZY2A 5B2JA 5B33B 3MGSD 1HTAA 1P3LC 1A7WA 3R45B 5CHLB 3AYWD 3W98A 5B1MC 4Z5TB 4DRBA 3MVDD 5AV6B 4J8VB 5AV5C 3AZLC 3AV1A 3AZED 4WU9A 3LZ1B 5GSUA 3IP4C 2YFWA 2G5HC 3AZEB 3AZJB 4G91B 5DNNC 5AVCC 5GT3A 3UT9B 4H9OB 5BO0A 3AV2B 5B1LB 1KX5A 4LD9D 4JJND 5B1LA 1KX5B 5B1LD 3X1UC 5F99A 4LD9B 4H9SC 5JRGB 4J8UA 5E5AD 3B0DC 3A6ND 3LZ0C 5G49A 4AWLC 3W99B 2AROB 2LY8A 1S32B 5CP6A 1WWIA 1ULYA 5DNND 3R45A 5AVCD 5B0YA 1P3BC 5GSUD 5B33A 1P3PB 2PYOC 3MVDA 2XD5A 3MNNC 5B2IC 3W98B 1M1AD 5DNMA 3WTPE 3AZFC 2PYOD 3LELC 5CPKD 3AYWA 3AZHB 3B6GD 1AOIB 5FUGB 3MGSC 3REHA 5CPIB 2CV5B 2RIQA 1U35B 2RVQD 2CV5A 3REIA 4J8XC 3REJD 3C1BD 2L5AA 5CPIC 5BNXB 5BS7C 3WTPD 3KXBD 3AN2A 3AV2A 1R4VA 3X1TA 2F8NB 4KUDA 1P3GC 3MGSB 1T3UA 3WTPC 3C1CA 3AZID 1Z2CB 4XUJC 1Q9CA 4H9PA 3REJA 5DNMB 4E45A 5AV6D 2JCHA 4CAYA 4J8VD 3REHD 3AZEC 1AOIA 1P3PA 3A6NB 2NZDC 3AYWB 3F6TA 5B31A 4XZQD 5CPKA 5B31B 4ZBJB 3UTBB 1P3LD 3FDDA 1KX4D 3AZGA 1JFIA 2F8NG 1P3BD 3AZJD 5DNNA 5AVCA 4YM6C 3AN2B 4KUDB 2Y2HA 3W99D 4H9QB 3UT9C 3B6FA 4AWLB 4WU8D 3V9RB 4YM6D 5B1LC 5F99C 4J8UC 1P3KC 2UWXA 4QLCD 3B0BA 1BFMA 3W97A 5AV9B 3EPHA 3X1VC 5GT3D 1TZYC 5B0YC 3KXBC 3REIB 4WU9D 3B6GB 2PYOA 5C3IB 4CSRB 3MNNA 3AZGD 2IO5B 3UTAB 4H9PB 3REJB 4M6BA 3AZMB 3P5JB 3KXBB 3MGSA 3X1VB 5CP6B 3W97B 5BT1C 4YS3A 3TU4A 3REIC 4JJNA 1P3GA 5B32C 5AV9C 3B6FD 3AN2D 4KUDD 3AV1B 2FJ7B 5JRGA 4J8UB 1M19D 3AZJA 3O62D 1F66A 3AFAB 4ZUXD 4CSRA 3AZKB 5E5AB 1ID3B 1U35A 2Y2LA 3KUYC 1P3LA 3B6GA 3W98D 1N1JB 4H9RB 1HQ3C 4XZQA 5B31D 3AZGC 4HGAB 3AZMA 5GT0B 3LJAC 3MVDC 5AV6A 4J8VA 3KSYA 3UTBC 5B2IA 5DNMC 2Y2GA 2NQBA 3WKJB 4QLCB 3WAAC 5AV9D 1M18C 1P3ID 5GT3B 3X1SA 2YFVA 1P3FC 1P3GD 5E5AA 4ZUXC 3MGRB 3EPJA 1P3GB 3X1UA 1P3KA 5B40D 5CPID 2CV5C 2HIOC 3REKC 3WA9C 1TAFB 3KWQB 3C1CB 4J8WA 4KHAA 3REHB 1P3MD 3H0MC 3LJAD 3WAAD 3WAAB 4H9QA 3B6FB 3MGQB 3AZHC 3AV1D 5DNMD 2F8NH 1M1AA 4YS3B 4Z5TA 3UTBD 4Z5TD 3MVDB 5B2IB 5AV8D 4E44A 1P3OC 1P3PC 5GXQC 3AFAC 3AZKC 1ID3D 3MGPD 5CP6D 2DF4C 4CAYB 1H3OB 4J8WD 4YS3C 3W97D 4J8WB 3A6NA 2FJ7D 4J8UD 1P3BB 2CWEA 5CPIA 1P3MC 1F1EA 3AV2C 3X1UD 1KX5D 4LD9A 4YM6A 3X1UB 5GT3C 3C1CC 1P3IA 4XUJA 5G49B 3LZ0B 3W99A 5B40C 3AZJC 4G91C 5AVCB 5DNNB 5B0ZD 3VH6T 4H9SA 2YFWB 4ZUXB 3AZEA 5AV5B 2HUEB 4HGAC 2ZM5A 3W96D 3LZ1C 1P3AB 1KX4A 3LELB 1W2EA 3AZFD 3UTAD 1P3AC 4G92B 5CPKB 4WJ3C 5B33C 3AZMC 4WU9B 1BH8B 5B24A 3AZGB 1JFIB 3O62A 1F66D 2NQBC 4R8PC 1P34A 1F66B 1EQZC 4H9OA 2HUEC 5B31G 3C1CD 5B0ZA 5B2JB 5BNVA 3X1VD 2J8PA 3X1TD 1BH9A 4Z2MH 5B40B 5BNXA 4WU8C 3X1TB 2F8NA 3WA9A 4YS3D 3W97C 2ZY5A 4R8PD 5B32A 1P3MB 2Y2PA 3RELD 5FUGA 1P3OB 3AZLB 3VH5T 4J8XD 3REJC 4ZBJC 3AZLD 3AZHA 2Y2OA 3MGPB 1M1AC 1ZLAA 3MGPA 4Z5TC 3MGQC 5AVBA 3NQUB 5B32G 5AV8B 3KUYA 3B6GC 5AV8A 3W96B 3H0LC 3LELD 1HQ3A 4XZQC 1TZYB 4X23D 5CPKC 3WKJD 3KFUG 4WNNB 4NE3A 2AROA 1S32A 3A6NC 3NQJB 4Z66A 4Z2MG 5GT0D 1P3MA 4JJNC 3RELC 4NE5A 4UPKA 4KGCB 2BYMB 3VH5A 3C1BC 3AL0C 4QLCC 2RVQC 3WA9B 3UT9A 3C1BB 3WTPB 1P3FA 3X1SD 5GT0C 3LJAB 5F99B 5AV5D 1U35C 3NQUA 1P34B 3WKJC 4J8WC 3MNNB 2PYOB 3W96C 5KDMB 3MGQD 5B2JD 4KHAB 3O62C 1HQ3B 5B1MD 4UUZA 3KWQC 1P3OA 1U35D 3B0DB 3VH6W 3LZ1D 1M18A 2NZDB 3AZIA 1KX5C 3X1SC 4KGCC 3A1KA 1M19A 1P3FB 2FJ7C 3LZ0D 1P3FD 2Y2JA 4XUJD 1B6WA 2Y2NA 3AZNC 4WU8B 5CP6C 5CPJA 2VQRA 4LD9C 3B0CW 3AFAD 3RELB 3AZKD 1EQZD 3NQJA 4Z66B 1P3IC 1P3OD 1EQZB 4Z66D 4J8XB 1S32D 4UUZB 1KX3A 5BNVB 3MGQA 4X23A 1P3LB 1KX4B 4H9NA 5KDMA 5GXQA 1ID3C 3KUYD 2Y2KA 3UTAC 1P3AD 3EG5B 5B0YD 3MNND 5B24B 2AROC 1ZLAD 5AV5A 3AZHD 3AZLA 3AV1C 5GSUC 3LJAA 5BS7A 3VH5W 3RELA 5B32D 5F99D 5JA4B 4R8PA 2Y2IA 4KGCD 2BYKA 5CPJD 3W99C 2F2AC 2F8ND 1P3KB 5B40A 5GT0A 5B2JC 3EPKA 1PZRA 1M18D 3H0RC 4WV4B 3LZ1A 3WKJA 2NQBB 4WZSB 1HQ3D 5B31C 2NQBD 1M19B 2ZY4A 5B1MB 5B1MA 1P3AA 4EO5B 5GXQD 3VH6A 3AZMD 2FFFB 5AVBD 5GXQB 4G92C 4EO5C 4WU9C 5AVBB 5BT1D 5B24C 4NE6A 1TAFA 3KWQA 3AYWC 3B6FC 1EQZA 3AFAA 3AZKA 2BYKB 2DQNC 5B0ZC 1TZYD 5JA4A 5BO0B 4X23B 5B0YB 2Y2MA 5JRGD 3WA9D 4DRAA 1KX3B 3AZND 4XUJB 3LZ0A 3AZNA 1WWSA 3AZNB 3UT9D 1BH9B 4YM6B 2BYMA 3AN2C 3X1VA 5CPJC 4KUDC 1TZYA 3AV2D 3MGRC 3KXBA 3C1BA 3TU4B 1P34D 3TU4D 5AY8C 3KWQD 1KU5A 2AROD 1ZLAC 5B24D 3X1SB 3EPLA 1AOIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEL A;  1ID3 A;  3UTA A;  1KX4 C;  3W98 C;  3REH C;  5AY8 B;  3W96 A;  3B0C T;  3TU4 C;  2NZD D;  5B33 D;  4Z66 C;  1P3I B;  4J8X A;  4H9R A;  1P34 C;  3AZI B;  2HIO B;  3REK B;  4QLC A;  3AZI C;  4KGC A;  5JRG C;  4JJN B;  2FJ7 A;  4WU8 A;  1M18 B;  2NZD A;  1H3O A;  3O62 B;  5B0Z B;  5B2I D;  1P3B A;  3KUY B;  1BH8 A;  5AV6 C;  4J8V C;  3UTB A;  4H9N B;  2IO5 C;  3MGP C;  1N1J A;  1M1A B;  4XZQ B;  3AZF B;  1KX3 D;  3AZF A;  5AVB C;  5C3I C;  3WAA A;  5AV8 C;  1P3P D;  1AOI D;  5E5A C;  4ZUX A;  1M19 C;  3V9R A;  2YFV B;  5AY8 D;  1ZLA B;  2HIO A;  3REK A;  1S32 C;  1P3K D;  3X1T C;  3MGR D;  3MGR A;  5B32 B;  4NFT A;  5GSU B;  5AV9 A;  2F8N K;  3WTP A;  5CPJ B;  3REI D;  2HIO D;  3REK D;  2CV5 D;  5AY8 A;  2JSS A;  1KX3 C;  4R8P B;  1F66 C;  1B67 A;  4WNN A;  4X23 C;  5B2J A;  5B33 B;  3MGS D;  1HTA A;  1P3L C;  1A7W A;  3R45 B;  5CHL B;  3AYW D;  3W98 A;  5B1M C;  4Z5T B;  4DRB A;  3MVD D;  5AV6 B;  4J8V B;  5AV5 C;  3AZL C;  3AV1 A;  3AZE D;  4WU9 A;  3LZ1 B;  5GSU A;  2YFW A;  3AZE B;  3AZJ B;  4G91 B;  5DNN C;  5AVC C;  5GT3 A;  3UT9 B;  4H9O B;  5BO0 A;  3AV2 B;  5B1L B;  1KX5 A;  4LD9 D;  4JJN D;  5B1L A;  1KX5 B;  5B1L D;  3X1U C;  5F99 A;  4LD9 B;  4H9S C;  5JRG B;  4J8U A;  5E5A D;  3B0D C;  3A6N D;  3LZ0 C;  5G49 A;  4AWL C;  3W99 B;  2ARO B;  2LY8 A;  1S32 B;  5CP6 A;  1WWI A;  1ULY A;  5DNN D;  3R45 A;  5AVC D;  5B0Y A;  1P3B C;  5GSU D;  5B33 A;  1P3P B;  2PYO C;  3MVD A;  3MNN C;  5B2I C;  3W98 B;  1M1A D;  5DNM A;  3WTP E;  3AZF C;  2PYO D;  3LEL C;  5CPK D;  3AYW A;  3AZH B;  3B6G D;  1AOI B;  5FUG B;  3MGS C;  3REH A;  5CPI B;  2CV5 B;  1U35 B;  2RVQ D;  2CV5 A;  3REI A;  4J8X C;  3REJ D;  3C1B D;  2L5A A;  5CPI C;  5BNX B;  5BS7 C;  3KXB D;  3WTP D;  3AN2 A;  3AV2 A;  1R4V A;  3X1T A;  2F8N B;  4KUD A;  1P3G C;  3MGS B;  3WTP C;  3C1C A;  3AZI D;  4XUJ C;  1Q9C A;  4H9P A;  3REJ A;  5DNM B;  4E45 A;  5AV6 D;  4J8V D;  4CAY A;  3REH D;  3AZE C;  1AOI A;  1P3P A;  3A6N B;  2NZD C;  3AYW B;  5B31 A;  4XZQ D;  5CPK A;  5B31 B;  4ZBJ B;  3UTB B;  1P3L D;  1KX4 D;  3AZG A;  1JFI A;  2F8N G;  1P3B D;  3AZJ D;  5DNN A;  5AVC A;  4YM6 C;  3AN2 B;  4KUD B;  3W99 D;  4H9Q B;  3UT9 C;  3B6F A;  4AWL B;  4WU8 D;  3V9R B;  4YM6 D;  5B1L C;  5F99 C;  4J8U C;  1P3K C;  4QLC D;  3B0B A;  1BFM A;  3W97 A;  5AV9 B;  3X1V C;  5GT3 D;  1TZY C;  5B0Y C;  3KXB C;  3REI B;  4WU9 D;  3B6G B;  2PYO A;  5C3I B;  4CSR B;  3MNN A;  3AZG D;  2IO5 B;  3UTA B;  4H9P B;  3REJ B;  4M6B A;  3AZM B;  3KXB B;  3MGS A;  3X1V B;  5CP6 B;  3W97 B;  5BT1 C;  4YS3 A;  3TU4 A;  3REI C;  4JJN A;  1P3G A;  5B32 C;  5AV9 C;  3B6F D;  3AN2 D;  4KUD D;  3AV1 B;  2FJ7 B;  5JRG A;  4J8U B;  1M19 D;  3AZJ A;  3O62 D;  1F66 A;  3AFA B;  4ZUX D;  4CSR A;  3AZK B;  5E5A B;  1ID3 B;  1U35 A;  3KUY C;  3B6G A;  1P3L A;  3W98 D;  1N1J B;  4H9R B;  1HQ3 C;  4XZQ A;  5B31 D;  3AZG C;  4HGA B;  3AZM A;  5GT0 B;  3LJA C;  3MVD C;  5AV6 A;  4J8V A;  3KSY A;  3UTB C;  5B2I A;  5DNM C;  2NQB A;  3WKJ B;  4QLC B;  3WAA C;  5AV9 D;  1M18 C;  1P3I D;  5GT3 B;  3X1S A;  2YFV A;  1P3F C;  1P3G D;  5E5A A;  4ZUX C;  3MGR B;  1P3G B;  3X1U A;  1P3K A;  5B40 D;  5CPI D;  2CV5 C;  2HIO C;  3REK C;  3WA9 C;  1TAF B;  3KWQ B;  3C1C B;  4J8W A;  4KHA A;  3REH B;  1P3M D;  3WAA D;  3LJA D;  3WAA B;  4H9Q A;  3B6F B;  3MGQ B;  3AZH C;  3AV1 D;  5DNM D;  2F8N H;  1M1A A;  4YS3 B;  4Z5T A;  3UTB D;  4Z5T D;  3MVD B;  5B2I B;  5AV8 D;  4E44 A;  1P3O C;  1P3P C;  5GXQ C;  3AFA C;  3AZK C;  1ID3 D;  3MGP D;  5CP6 D;  4CAY B;  1H3O B;  4J8W D;  4YS3 C;  3W97 D;  4J8W B;  3A6N A;  2FJ7 D;  4J8U D;  1P3B B;  2CWE A;  5CPI A;  1P3M C;  1F1E A;  3AV2 C;  3X1U D;  1KX5 D;  4LD9 A;  4YM6 A;  3X1U B;  5GT3 C;  3C1C C;  1P3I A;  4XUJ A;  5G49 B;  3LZ0 B;  3W99 A;  5B40 C;  3AZJ C;  4G91 C;  5AVC B;  5DNN B;  5B0Z D;  3VH6 T;  4H9S A;  2YFW B;  4ZUX B;  3AZE A;  5AV5 B;  2HUE B;  4HGA C;  3W96 D;  3LZ1 C;  1P3A B;  1KX4 A;  3LEL B;  3AZF D;  3UTA D;  1P3A C;  4G92 B;  5CPK B;  5B33 C;  3AZM C;  4WU9 B;  1BH8 B;  5B24 A;  3AZG B;  1JFI B;  3O62 A;  1F66 D;  2NQB C;  4R8P C;  1P34 A;  1F66 B;  1EQZ C;  4H9O A;  2HUE C;  5B31 G;  3C1C D;  5B0Z A;  5B2J B;  5BNV A;  3X1V D;  3X1T D;  1BH9 A;  4Z2M H;  5B40 B;  5BNX A;  4WU8 C;  3X1T B;  2F8N A;  3WA9 A;  4YS3 D;  3W97 C;  4R8P D;  5B32 A;  1P3M B;  3REL D;  5FUG A;  1P3O B;  3AZL B;  3VH5 T;  4J8X D;  3REJ C;  4ZBJ C;  3AZL D;  3AZH A;  3MGP B;  1M1A C;  1ZLA A;  3MGP A;  4Z5T C;  3MGQ C;  5AVB A;  3NQU B;  5B32 G;  5AV8 B;  3KUY A;  3B6G C;  5AV8 A;  3W96 B;  3LEL D;  1HQ3 A;  4XZQ C;  1TZY B;  4X23 D;  5CPK C;  3WKJ D;  4WNN B;  4NE3 A;  2ARO A;  1S32 A;  3A6N C;  4Z66 A;  3NQJ B;  4Z2M G;  5GT0 D;  1P3M A;  4JJN C;  3REL C;  4NE5 A;  4KGC B;  2BYM B;  3VH5 A;  3C1B C;  4QLC C;  2RVQ C;  3WA9 B;  3UT9 A;  3C1B B;  3WTP B;  1P3F A;  3X1S D;  5GT0 C;  3LJA B;  5F99 B;  5AV5 D;  1U35 C;  3NQU A;  1P34 B;  3WKJ C;  4J8W C;  3MNN B;  2PYO B;  3W96 C;  5KDM B;  3MGQ D;  5B2J D;  4KHA B;  3O62 C;  1HQ3 B;  5B1M D;  4UUZ A;  3KWQ C;  1P3O A;  1U35 D;  3B0D B;  3VH6 W;  3LZ1 D;  1M18 A;  2NZD B;  3AZI A;  1KX5 C;  3X1S C;  4KGC C;  1M19 A;  1P3F B;  2FJ7 C;  3LZ0 D;  1P3F D;  4XUJ D;  1B6W A;  3AZN C;  4WU8 B;  5CP6 C;  5CPJ A;  4LD9 C;  3B0C W;  3AFA D;  3REL B;  3AZK D;  1EQZ D;  3NQJ A;  4Z66 B;  1P3I C;  1P3O D;  1EQZ B;  4Z66 D;  4J8X B;  1S32 D;  4UUZ B;  1KX3 A;  5BNV B;  3MGQ A;  4X23 A;  1P3L B;  1KX4 B;  4H9N A;  5KDM A;  5GXQ A;  1ID3 C;  3KUY D;  3UTA C;  1P3A D;  5B0Y D;  3MNN D;  5B24 B;  2ARO C;  1ZLA D;  5AV5 A;  3AZH D;  3AZL A;  3AV1 C;  5GSU C;  3LJA A;  5BS7 A;  3VH5 W;  3REL A;  5B32 D;  5F99 D;  5JA4 B;  4R8P A;  4KGC D;  2BYK A;  5CPJ D;  3W99 C;  2F8N D;  1P3K B;  5B40 A;  5GT0 A;  5B2J C;  1M18 D;  2NQB B;  4WV4 B;  3LZ1 A;  3WKJ A;  4WZS B;  1HQ3 D;  5B31 C;  2NQB D;  1M19 B;  5B1M B;  5B1M A;  1P3A A;  4EO5 B;  5GXQ D;  3VH6 A;  3AZM D;  5AVB D;  5GXQ B;  4G92 C;  4EO5 C;  4WU9 C;  5AVB B;  5BT1 D;  5B24 C;  4NE6 A;  1TAF A;  3KWQ A;  3AYW C;  3B6F C;  1EQZ A;  3AFA A;  3AZK A;  2BYK B;  5B0Z C;  4X23 B;  1TZY D;  5BO0 B;  5JA4 A;  5B0Y B;  5JRG D;  3WA9 D;  4DRA A;  1KX3 B;  3AZN D;  4XUJ B;  3LZ0 A;  3AZN A;  1WWS A;  3AZN B;  3UT9 D;  1BH9 B;  4YM6 B;  2BYM A;  3AN2 C;  3X1V A;  5CPJ C;  4KUD C;  1TZY A;  3AV2 D;  3MGR C;  3KXB A;  3C1B A;  3TU4 B;  1P34 D;  3TU4 D;  5AY8 C;  3KWQ D;  1KU5 A;  2ARO D;  1ZLA C;  5B24 D;  3X1S B;  1AOI C; 
#chains in the Genus database with same CATH topology
 3LEL A;  1ID3 A;  3UTA A;  1KX4 C;  4DQY B;  3W98 C;  3REH C;  5AY8 B;  3W96 A;  3B0C T;  2Y2Q A;  3TU4 C;  2NZD D;  5B33 D;  4Z66 C;  1P3I B;  4J8X A;  4H9R A;  1P34 C;  3AZI B;  2HIO B;  3REK B;  4QLC A;  3A1I A;  3AZI C;  4KGC A;  5JRG C;  4JJN B;  2BG1 A;  2FJ7 A;  4WU8 A;  2ZY3 A;  1M18 B;  2NZD A;  1H3O A;  3O62 B;  5B0Z B;  5B2I D;  1P3B A;  3KUY B;  1BH8 A;  2XD1 A;  5AV6 C;  4J8V C;  3UTB A;  4H9N B;  2IO5 C;  3MGP C;  1N1J A;  1M1A B;  4XZQ B;  3AZF B;  1KX3 D;  3AZF A;  2W8S A;  5AVB C;  5C3I C;  3WAA A;  5AV8 C;  1P3P D;  1AOI D;  5E5A C;  4ZUX A;  2G5I C;  1M19 C;  3V9R A;  2YFV B;  5AY8 D;  1ZLA B;  2HIO A;  3REK A;  1S32 C;  1P3K D;  2JE5 A;  3X1T C;  3MGR D;  3MGR A;  5B32 B;  4NFT A;  5GSU B;  5AV9 A;  2F8N K;  3WTP A;  5CPJ B;  3REI D;  2HIO D;  3REK D;  2CV5 D;  5AY8 A;  2JSS A;  1KX3 C;  4R8P B;  1F66 C;  1B67 A;  4WNN A;  4X23 C;  2ZY2 A;  5B2J A;  5B33 B;  3MGS D;  1HTA A;  1P3L C;  1A7W A;  3R45 B;  5CHL B;  3AYW D;  3W98 A;  5B1M C;  4Z5T B;  4DRB A;  3MVD D;  5AV6 B;  4J8V B;  5AV5 C;  3AZL C;  3AV1 A;  3AZE D;  4WU9 A;  3LZ1 B;  5GSU A;  3IP4 C;  2YFW A;  2G5H C;  3AZE B;  3AZJ B;  4G91 B;  5DNN C;  5AVC C;  5GT3 A;  3UT9 B;  4H9O B;  5BO0 A;  3AV2 B;  5B1L B;  1KX5 A;  4LD9 D;  4JJN D;  5B1L A;  1KX5 B;  5B1L D;  3X1U C;  5F99 A;  4LD9 B;  4H9S C;  5JRG B;  4J8U A;  5E5A D;  3B0D C;  3A6N D;  3LZ0 C;  5G49 A;  4AWL C;  3W99 B;  2ARO B;  2LY8 A;  1S32 B;  5CP6 A;  1WWI A;  1ULY A;  5DNN D;  3R45 A;  5AVC D;  5B0Y A;  1P3B C;  5GSU D;  5B33 A;  1P3P B;  2PYO C;  3MVD A;  2XD5 A;  3MNN C;  5B2I C;  3W98 B;  1M1A D;  5DNM A;  3WTP E;  3AZF C;  2PYO D;  3LEL C;  5CPK D;  3AYW A;  3AZH B;  3B6G D;  1AOI B;  5FUG B;  3MGS C;  3REH A;  5CPI B;  2CV5 B;  2RIQ A;  1U35 B;  2RVQ D;  2CV5 A;  3REI A;  4J8X C;  3REJ D;  3C1B D;  2L5A A;  5CPI C;  5BNX B;  5BS7 C;  3WTP D;  3KXB D;  3AN2 A;  3AV2 A;  1R4V A;  3X1T A;  2F8N B;  4KUD A;  1P3G C;  3MGS B;  1T3U A;  3WTP C;  3C1C A;  3AZI D;  1Z2C B;  4XUJ C;  1Q9C A;  4H9P A;  3REJ A;  5DNM B;  4E45 A;  5AV6 D;  2JCH A;  4CAY A;  4J8V D;  3REH D;  3AZE C;  1AOI A;  1P3P A;  3A6N B;  2NZD C;  3AYW B;  3F6T A;  5B31 A;  4XZQ D;  5CPK A;  5B31 B;  4ZBJ B;  3UTB B;  1P3L D;  3FDD A;  1KX4 D;  3AZG A;  1JFI A;  2F8N G;  1P3B D;  3AZJ D;  5DNN A;  5AVC A;  4YM6 C;  3AN2 B;  4KUD B;  2Y2H A;  3W99 D;  4H9Q B;  3UT9 C;  3B6F A;  4AWL B;  4WU8 D;  3V9R B;  4YM6 D;  5B1L C;  5F99 C;  4J8U C;  1P3K C;  2UWX A;  4QLC D;  3B0B A;  1BFM A;  3W97 A;  5AV9 B;  3EPH A;  3X1V C;  5GT3 D;  1TZY C;  5B0Y C;  3KXB C;  3REI B;  4WU9 D;  3B6G B;  2PYO A;  5C3I B;  4CSR B;  3MNN A;  3AZG D;  2IO5 B;  3UTA B;  4H9P B;  3REJ B;  4M6B A;  3AZM B;  3P5J B;  3KXB B;  3MGS A;  3X1V B;  5CP6 B;  3W97 B;  5BT1 C;  4YS3 A;  3TU4 A;  3REI C;  4JJN A;  1P3G A;  5B32 C;  5AV9 C;  3B6F D;  3AN2 D;  4KUD D;  3AV1 B;  2FJ7 B;  5JRG A;  4J8U B;  1M19 D;  3AZJ A;  3O62 D;  1F66 A;  3AFA B;  4ZUX D;  4CSR A;  3AZK B;  5E5A B;  1ID3 B;  1U35 A;  2Y2L A;  3KUY C;  1P3L A;  3B6G A;  3W98 D;  1N1J B;  4H9R B;  1HQ3 C;  4XZQ A;  5B31 D;  3AZG C;  4HGA B;  3AZM A;  5GT0 B;  3LJA C;  3MVD C;  5AV6 A;  4J8V A;  3KSY A;  3UTB C;  5B2I A;  5DNM C;  2Y2G A;  2NQB A;  3WKJ B;  4QLC B;  3WAA C;  5AV9 D;  1M18 C;  1P3I D;  5GT3 B;  3X1S A;  2YFV A;  1P3F C;  1P3G D;  5E5A A;  4ZUX C;  3MGR B;  3EPJ A;  1P3G B;  3X1U A;  1P3K A;  5B40 D;  5CPI D;  2CV5 C;  2HIO C;  3REK C;  3WA9 C;  1TAF B;  3KWQ B;  3C1C B;  4J8W A;  4KHA A;  3REH B;  1P3M D;  3H0M C;  3LJA D;  3WAA D;  3WAA B;  4H9Q A;  3B6F B;  3MGQ B;  3AZH C;  3AV1 D;  5DNM D;  2F8N H;  1M1A A;  4YS3 B;  4Z5T A;  3UTB D;  4Z5T D;  3MVD B;  5B2I B;  5AV8 D;  4E44 A;  1P3O C;  1P3P C;  5GXQ C;  3AFA C;  3AZK C;  1ID3 D;  3MGP D;  5CP6 D;  2DF4 C;  4CAY B;  1H3O B;  4J8W D;  4YS3 C;  3W97 D;  4J8W B;  3A6N A;  2FJ7 D;  4J8U D;  1P3B B;  2CWE A;  5CPI A;  1P3M C;  1F1E A;  3AV2 C;  3X1U D;  1KX5 D;  4LD9 A;  4YM6 A;  3X1U B;  5GT3 C;  3C1C C;  1P3I A;  4XUJ A;  5G49 B;  3LZ0 B;  3W99 A;  5B40 C;  3AZJ C;  4G91 C;  5AVC B;  5DNN B;  5B0Z D;  3VH6 T;  4H9S A;  2YFW B;  4ZUX B;  3AZE A;  5AV5 B;  2HUE B;  4HGA C;  2ZM5 A;  3W96 D;  3LZ1 C;  1P3A B;  1KX4 A;  3LEL B;  1W2E A;  3AZF D;  3UTA D;  1P3A C;  4G92 B;  5CPK B;  4WJ3 C;  5B33 C;  3AZM C;  4WU9 B;  1BH8 B;  5B24 A;  3AZG B;  1JFI B;  3O62 A;  1F66 D;  2NQB C;  4R8P C;  1P34 A;  1F66 B;  1EQZ C;  4H9O A;  2HUE C;  5B31 G;  3C1C D;  5B0Z A;  5B2J B;  5BNV A;  3X1V D;  2J8P A;  3X1T D;  1BH9 A;  4Z2M H;  5B40 B;  5BNX A;  4WU8 C;  3X1T B;  2F8N A;  3WA9 A;  4YS3 D;  3W97 C;  2ZY5 A;  4R8P D;  5B32 A;  1P3M B;  2Y2P A;  3REL D;  5FUG A;  1P3O B;  3AZL B;  3VH5 T;  4J8X D;  3REJ C;  4ZBJ C;  3AZL D;  3AZH A;  2Y2O A;  3MGP B;  1M1A C;  1ZLA A;  3MGP A;  4Z5T C;  3MGQ C;  5AVB A;  3NQU B;  5B32 G;  5AV8 B;  3KUY A;  3B6G C;  5AV8 A;  3W96 B;  3H0L C;  3LEL D;  1HQ3 A;  4XZQ C;  1TZY B;  4X23 D;  5CPK C;  3WKJ D;  3KFU G;  4WNN B;  4NE3 A;  2ARO A;  1S32 A;  3A6N C;  3NQJ B;  4Z66 A;  4Z2M G;  5GT0 D;  1P3M A;  4JJN C;  3REL C;  4NE5 A;  4UPK A;  4KGC B;  2BYM B;  3VH5 A;  3C1B C;  3AL0 C;  4QLC C;  2RVQ C;  3WA9 B;  3UT9 A;  3C1B B;  3WTP B;  1P3F A;  3X1S D;  5GT0 C;  3LJA B;  5F99 B;  5AV5 D;  1U35 C;  3NQU A;  1P34 B;  3WKJ C;  4J8W C;  3MNN B;  2PYO B;  3W96 C;  5KDM B;  3MGQ D;  5B2J D;  4KHA B;  3O62 C;  1HQ3 B;  5B1M D;  4UUZ A;  3KWQ C;  1P3O A;  1U35 D;  3B0D B;  3VH6 W;  3LZ1 D;  1M18 A;  2NZD B;  3AZI A;  1KX5 C;  3X1S C;  4KGC C;  3A1K A;  1M19 A;  1P3F B;  2FJ7 C;  3LZ0 D;  1P3F D;  2Y2J A;  4XUJ D;  1B6W A;  2Y2N A;  3AZN C;  4WU8 B;  5CP6 C;  5CPJ A;  2VQR A;  4LD9 C;  3B0C W;  3AFA D;  3REL B;  3AZK D;  1EQZ D;  3NQJ A;  4Z66 B;  1P3I C;  1P3O D;  1EQZ B;  4Z66 D;  4J8X B;  1S32 D;  4UUZ B;  1KX3 A;  5BNV B;  3MGQ A;  4X23 A;  1P3L B;  1KX4 B;  4H9N A;  5KDM A;  5GXQ A;  1ID3 C;  3KUY D;  2Y2K A;  3UTA C;  1P3A D;  3EG5 B;  5B0Y D;  3MNN D;  5B24 B;  2ARO C;  1ZLA D;  5AV5 A;  3AZH D;  3AZL A;  3AV1 C;  5GSU C;  3LJA A;  5BS7 A;  3VH5 W;  3REL A;  5B32 D;  5F99 D;  5JA4 B;  4R8P A;  2Y2I A;  4KGC D;  2BYK A;  5CPJ D;  3W99 C;  2F2A C;  2F8N D;  1P3K B;  5B40 A;  5GT0 A;  5B2J C;  3EPK A;  1PZR A;  1M18 D;  3H0R C;  4WV4 B;  3LZ1 A;  3WKJ A;  2NQB B;  4WZS B;  1HQ3 D;  5B31 C;  2NQB D;  1M19 B;  2ZY4 A;  5B1M B;  5B1M A;  1P3A A;  4EO5 B;  5GXQ D;  3VH6 A;  3AZM D;  2FFF B;  5AVB D;  5GXQ B;  4G92 C;  4EO5 C;  4WU9 C;  5AVB B;  5BT1 D;  5B24 C;  4NE6 A;  1TAF A;  3KWQ A;  3AYW C;  3B6F C;  1EQZ A;  3AFA A;  3AZK A;  2BYK B;  2DQN C;  5B0Z C;  1TZY D;  5JA4 A;  5BO0 B;  4X23 B;  5B0Y B;  2Y2M A;  5JRG D;  3WA9 D;  4DRA A;  1KX3 B;  3AZN D;  4XUJ B;  3LZ0 A;  3AZN A;  1WWS A;  3AZN B;  3UT9 D;  1BH9 B;  4YM6 B;  2BYM A;  3AN2 C;  3X1V A;  5CPJ C;  4KUD C;  1TZY A;  3AV2 D;  3MGR C;  3KXB A;  3C1B A;  3TU4 B;  1P34 D;  3TU4 D;  5AY8 C;  3KWQ D;  1KU5 A;  2ARO D;  1ZLA C;  5B24 D;  3X1S B;  3EPL A;  1AOI C; 
#chains in the Genus database with same CATH homology
 3LEL A;  1ID3 A;  3UTA A;  1KX4 C;  4DQY B;  3W98 C;  3REH C;  5AY8 B;  3W96 A;  3B0C T;  2Y2Q A;  3TU4 C;  2NZD D;  5B33 D;  4Z66 C;  1P3I B;  4J8X A;  4H9R A;  1P34 C;  3AZI B;  2HIO B;  3REK B;  4QLC A;  3A1I A;  3AZI C;  4KGC A;  5JRG C;  4JJN B;  2BG1 A;  2FJ7 A;  4WU8 A;  2ZY3 A;  1M18 B;  2NZD A;  1H3O A;  3O62 B;  5B0Z B;  5B2I D;  1P3B A;  3KUY B;  1BH8 A;  2XD1 A;  5AV6 C;  4J8V C;  3UTB A;  4H9N B;  2IO5 C;  3MGP C;  1N1J A;  1M1A B;  4XZQ B;  3AZF B;  1KX3 D;  3AZF A;  2W8S A;  5AVB C;  5C3I C;  3WAA A;  5AV8 C;  1P3P D;  1AOI D;  5E5A C;  4ZUX A;  2G5I C;  1M19 C;  3V9R A;  2YFV B;  5AY8 D;  1ZLA B;  2HIO A;  3REK A;  1S32 C;  1P3K D;  2JE5 A;  3X1T C;  3MGR D;  3MGR A;  5B32 B;  4NFT A;  5GSU B;  5AV9 A;  2F8N K;  3WTP A;  5CPJ B;  3REI D;  2HIO D;  3REK D;  2CV5 D;  5AY8 A;  2JSS A;  1KX3 C;  4R8P B;  1F66 C;  1B67 A;  4WNN A;  4X23 C;  2ZY2 A;  5B2J A;  5B33 B;  3MGS D;  1HTA A;  1P3L C;  1A7W A;  3R45 B;  5CHL B;  3AYW D;  3W98 A;  5B1M C;  4Z5T B;  4DRB A;  3MVD D;  5AV6 B;  4J8V B;  5AV5 C;  3AZL C;  3AV1 A;  3AZE D;  4WU9 A;  3LZ1 B;  5GSU A;  3IP4 C;  2YFW A;  2G5H C;  3AZE B;  3AZJ B;  4G91 B;  5DNN C;  5AVC C;  5GT3 A;  3UT9 B;  4H9O B;  5BO0 A;  3AV2 B;  5B1L B;  1KX5 A;  4LD9 D;  4JJN D;  5B1L A;  1KX5 B;  5B1L D;  3X1U C;  5F99 A;  4LD9 B;  4H9S C;  5JRG B;  4J8U A;  5E5A D;  3B0D C;  3A6N D;  3LZ0 C;  5G49 A;  4AWL C;  3W99 B;  2ARO B;  2LY8 A;  1S32 B;  5CP6 A;  1WWI A;  1ULY A;  5DNN D;  3R45 A;  5AVC D;  5B0Y A;  1P3B C;  5GSU D;  5B33 A;  1P3P B;  2PYO C;  3MVD A;  2XD5 A;  3MNN C;  5B2I C;  3W98 B;  1M1A D;  5DNM A;  3WTP E;  3AZF C;  2PYO D;  3LEL C;  5CPK D;  3AYW A;  3AZH B;  3B6G D;  1AOI B;  5FUG B;  3MGS C;  3REH A;  5CPI B;  2CV5 B;  2RIQ A;  1U35 B;  2RVQ D;  2CV5 A;  3REI A;  4J8X C;  3REJ D;  3C1B D;  2L5A A;  5CPI C;  5BNX B;  5BS7 C;  3WTP D;  3KXB D;  3AN2 A;  3AV2 A;  1R4V A;  3X1T A;  2F8N B;  4KUD A;  1P3G C;  3MGS B;  1T3U A;  3WTP C;  3C1C A;  3AZI D;  1Z2C B;  4XUJ C;  1Q9C A;  4H9P A;  3REJ A;  5DNM B;  4E45 A;  5AV6 D;  2JCH A;  4CAY A;  4J8V D;  3REH D;  3AZE C;  1AOI A;  1P3P A;  3A6N B;  2NZD C;  3AYW B;  3F6T A;  5B31 A;  4XZQ D;  5CPK A;  5B31 B;  4ZBJ B;  3UTB B;  1P3L D;  3FDD A;  1KX4 D;  3AZG A;  1JFI A;  2F8N G;  1P3B D;  3AZJ D;  5DNN A;  5AVC A;  4YM6 C;  3AN2 B;  4KUD B;  2Y2H A;  3W99 D;  4H9Q B;  3UT9 C;  3B6F A;  4AWL B;  4WU8 D;  3V9R B;  4YM6 D;  5B1L C;  5F99 C;  4J8U C;  1P3K C;  2UWX A;  4QLC D;  3B0B A;  1BFM A;  3W97 A;  5AV9 B;  3EPH A;  3X1V C;  5GT3 D;  1TZY C;  5B0Y C;  3KXB C;  3REI B;  4WU9 D;  3B6G B;  2PYO A;  5C3I B;  4CSR B;  3MNN A;  3AZG D;  2IO5 B;  3UTA B;  4H9P B;  3REJ B;  4M6B A;  3AZM B;  3P5J B;  3KXB B;  3MGS A;  3X1V B;  5CP6 B;  3W97 B;  5BT1 C;  4YS3 A;  3TU4 A;  3REI C;  4JJN A;  1P3G A;  5B32 C;  5AV9 C;  3B6F D;  3AN2 D;  4KUD D;  3AV1 B;  2FJ7 B;  5JRG A;  4J8U B;  1M19 D;  3AZJ A;  3O62 D;  1F66 A;  3AFA B;  4ZUX D;  4CSR A;  3AZK B;  5E5A B;  1ID3 B;  1U35 A;  2Y2L A;  3KUY C;  1P3L A;  3B6G A;  3W98 D;  1N1J B;  4H9R B;  1HQ3 C;  4XZQ A;  5B31 D;  3AZG C;  4HGA B;  3AZM A;  5GT0 B;  3LJA C;  3MVD C;  5AV6 A;  4J8V A;  3KSY A;  3UTB C;  5B2I A;  5DNM C;  2Y2G A;  2NQB A;  3WKJ B;  4QLC B;  3WAA C;  5AV9 D;  1M18 C;  1P3I D;  5GT3 B;  3X1S A;  2YFV A;  1P3F C;  1P3G D;  5E5A A;  4ZUX C;  3MGR B;  3EPJ A;  1P3G B;  3X1U A;  1P3K A;  5B40 D;  5CPI D;  2CV5 C;  2HIO C;  3REK C;  3WA9 C;  1TAF B;  3KWQ B;  3C1C B;  4J8W A;  4KHA A;  3REH B;  1P3M D;  3H0M C;  3LJA D;  3WAA D;  3WAA B;  4H9Q A;  3B6F B;  3MGQ B;  3AZH C;  3AV1 D;  5DNM D;  2F8N H;  1M1A A;  4YS3 B;  4Z5T A;  3UTB D;  4Z5T D;  3MVD B;  5B2I B;  5AV8 D;  4E44 A;  1P3O C;  1P3P C;  5GXQ C;  3AFA C;  3AZK C;  1ID3 D;  3MGP D;  5CP6 D;  2DF4 C;  4CAY B;  1H3O B;  4J8W D;  4YS3 C;  3W97 D;  4J8W B;  3A6N A;  2FJ7 D;  4J8U D;  1P3B B;  2CWE A;  5CPI A;  1P3M C;  1F1E A;  3AV2 C;  3X1U D;  1KX5 D;  4LD9 A;  4YM6 A;  3X1U B;  5GT3 C;  3C1C C;  1P3I A;  4XUJ A;  5G49 B;  3LZ0 B;  3W99 A;  5B40 C;  3AZJ C;  4G91 C;  5AVC B;  5DNN B;  5B0Z D;  3VH6 T;  4H9S A;  2YFW B;  4ZUX B;  3AZE A;  5AV5 B;  2HUE B;  4HGA C;  2ZM5 A;  3W96 D;  3LZ1 C;  1P3A B;  1KX4 A;  3LEL B;  1W2E A;  3AZF D;  3UTA D;  1P3A C;  4G92 B;  5CPK B;  4WJ3 C;  5B33 C;  3AZM C;  4WU9 B;  1BH8 B;  5B24 A;  3AZG B;  1JFI B;  3O62 A;  1F66 D;  2NQB C;  4R8P C;  1P34 A;  1F66 B;  1EQZ C;  4H9O A;  2HUE C;  5B31 G;  3C1C D;  5B0Z A;  5B2J B;  5BNV A;  3X1V D;  2J8P A;  3X1T D;  1BH9 A;  4Z2M H;  5B40 B;  5BNX A;  4WU8 C;  3X1T B;  2F8N A;  3WA9 A;  4YS3 D;  3W97 C;  2ZY5 A;  4R8P D;  5B32 A;  1P3M B;  2Y2P A;  3REL D;  5FUG A;  1P3O B;  3AZL B;  3VH5 T;  4J8X D;  3REJ C;  4ZBJ C;  3AZL D;  3AZH A;  2Y2O A;  3MGP B;  1M1A C;  1ZLA A;  3MGP A;  4Z5T C;  3MGQ C;  5AVB A;  3NQU B;  5B32 G;  5AV8 B;  3KUY A;  3B6G C;  5AV8 A;  3W96 B;  3H0L C;  3LEL D;  1HQ3 A;  4XZQ C;  1TZY B;  4X23 D;  5CPK C;  3WKJ D;  3KFU G;  4WNN B;  4NE3 A;  2ARO A;  1S32 A;  3A6N C;  3NQJ B;  4Z66 A;  4Z2M G;  5GT0 D;  1P3M A;  4JJN C;  3REL C;  4NE5 A;  4UPK A;  4KGC B;  2BYM B;  3VH5 A;  3C1B C;  3AL0 C;  4QLC C;  2RVQ C;  3WA9 B;  3UT9 A;  3C1B B;  3WTP B;  1P3F A;  3X1S D;  5GT0 C;  3LJA B;  5F99 B;  5AV5 D;  1U35 C;  3NQU A;  1P34 B;  3WKJ C;  4J8W C;  3MNN B;  2PYO B;  3W96 C;  5KDM B;  3MGQ D;  5B2J D;  4KHA B;  3O62 C;  1HQ3 B;  5B1M D;  4UUZ A;  3KWQ C;  1P3O A;  1U35 D;  3B0D B;  3VH6 W;  3LZ1 D;  1M18 A;  2NZD B;  3AZI A;  1KX5 C;  3X1S C;  4KGC C;  3A1K A;  1M19 A;  1P3F B;  2FJ7 C;  3LZ0 D;  1P3F D;  2Y2J A;  4XUJ D;  1B6W A;  2Y2N A;  3AZN C;  4WU8 B;  5CP6 C;  5CPJ A;  2VQR A;  4LD9 C;  3B0C W;  3AFA D;  3REL B;  3AZK D;  1EQZ D;  3NQJ A;  4Z66 B;  1P3I C;  1P3O D;  1EQZ B;  4Z66 D;  4J8X B;  1S32 D;  4UUZ B;  1KX3 A;  5BNV B;  3MGQ A;  4X23 A;  1P3L B;  1KX4 B;  4H9N A;  5KDM A;  5GXQ A;  1ID3 C;  3KUY D;  2Y2K A;  3UTA C;  1P3A D;  3EG5 B;  5B0Y D;  3MNN D;  5B24 B;  2ARO C;  1ZLA D;  5AV5 A;  3AZH D;  3AZL A;  3AV1 C;  5GSU C;  3LJA A;  5BS7 A;  3VH5 W;  3REL A;  5B32 D;  5F99 D;  5JA4 B;  4R8P A;  2Y2I A;  4KGC D;  2BYK A;  5CPJ D;  3W99 C;  2F2A C;  2F8N D;  1P3K B;  5B40 A;  5GT0 A;  5B2J C;  3EPK A;  1PZR A;  1M18 D;  3H0R C;  4WV4 B;  3LZ1 A;  3WKJ A;  2NQB B;  4WZS B;  1HQ3 D;  5B31 C;  2NQB D;  1M19 B;  2ZY4 A;  5B1M B;  5B1M A;  1P3A A;  4EO5 B;  5GXQ D;  3VH6 A;  3AZM D;  2FFF B;  5AVB D;  5GXQ B;  4G92 C;  4EO5 C;  4WU9 C;  5AVB B;  5BT1 D;  5B24 C;  4NE6 A;  1TAF A;  3KWQ A;  3AYW C;  3B6F C;  1EQZ A;  3AFA A;  3AZK A;  2BYK B;  2DQN C;  5B0Z C;  1TZY D;  5JA4 A;  5BO0 B;  4X23 B;  5B0Y B;  2Y2M A;  5JRG D;  3WA9 D;  4DRA A;  1KX3 B;  3AZN D;  4XUJ B;  3LZ0 A;  3AZN A;  1WWS A;  3AZN B;  3UT9 D;  1BH9 B;  4YM6 B;  2BYM A;  3AN2 C;  3X1V A;  5CPJ C;  4KUD C;  1TZY A;  3AV2 D;  3MGR C;  3KXB A;  3C1B A;  3TU4 B;  1P34 D;  3TU4 D;  5AY8 C;  3KWQ D;  1KU5 A;  2ARO D;  1ZLA C;  5B24 D;  3X1S B;  3EPL A;  1AOI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...