3X1UD

Crystal structure of nucleosome core particle in the presence of histone variants involved in reprogramming
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1uD00
1ZLAD 2NQBA 2HIOB 4H9QA 1EQZD 1P3GB 5AVCD 4J8WD 5B31G 1P3LC 5CP6A 5AV5D 3KWQB 1M1AB 2FJ7B 5CPKA 5BO0B 3REIB 3REJD 3C1BD 5AV8A 4KGCA 2NZDB 4WU9A 5BNXA 4Z2MH 4KUDB 1P3IB 4ZUXD 3B0DC 3LZ0A 1P3OD 3X1VB 1BH9A 5AV9C 3REHC 4H9SC 3R45B 4YS3A 5B0ZD 2F8NB 5E5AA 3AZGB 4J8UC 1M19C 4R8PC 3UT9B 3WKJD 3X1SA 5G49A 5B32G 5B40D 5BS7A 1JFIA 2CV5D 5GT3C 1HQ3C 1R4VA 1BFMA 3O62C 3AZIA 2HIOA 3UTBC 4JJNB 1P3BB 3WTPB 3TU4B 3AZNB 3KWQA 1KU5A 4X23D 5C3IB 2FJ7A 5GXQC 5BO0A 4XUJD 3B6GC 5DNMB 3REIA 1U35B 2BYMB 3X1UB 3X1TA 4J8UB 3VH5A 4H9OB 4NE6A 5B1LB 3V9RB 3B0CT 4KUDA 1P3IA 3MVDD 1N1JB 3X1VA 3KUYC 3UTAA 4QLCC 4CSRB 3R45A 3C1CD 4Z66D 2AROC 1B6WA 2F8NA 3AZGA 1ZLAB 3UTBB 3MGSD 1EQZB 3UT9A 1ULYA 5F99C 3WAAD 5AVCB 4J8WB 5BNVB 5AV5B 4HGAC 3MNNC 1KX3D 5B0YC 3REJB 3LELC 5CHLB 3AZFD 3A6ND 3C1BB 4UUZB 3RELC 4JJNA 4EO5C 3AN2D 1P3BA 3AYWD 4ZUXB 3WTPA 3KUYB 1P3OB 3TU4A 2YFWA 3AZNA 5B2JC 1M1AD 1WWIA 5DNMA 1U35A 4XUJC 5B0ZB 3X1UA 2F8NK 4H9OA 2NZDD 5B1LA 3MGPC 1KX4A 3V9RA 3WKJB 4WU8C 5AY8D 1M18C 3AZEC 1N1JA 5CPID 4HGAB 1P3AC 5B40B 3AV1A 4YM6D 2CV5B 5AV6A 4J8VC 5BT1C 3KXBC 1EQZA 3MGSC 1P34C 1P3LD 5AVCA 4J8WA 5BNVA 3MGRD 5AV5A 5B31C 4X23B 4XUJB 3LJAC 4CAYB 2CWEA 3W97C 3C1BA 3REKD 3AZFC 3A6NC 2PYOC 1P3FC 5FUGB 4XZQC 5AVBC 3MVDB 4ZUXA 5AV9D 1P3OA 3REHD 3W99C 3C1CB 3MGQC 2IO5C 2JSSA 4Z66B 1M19D 5B0ZA 4R8PD 3MGSB 3AZKA 3WKJA 3WAAB 3AZMA 5GT3D 1HQ3D 4DRAA 5JRGC 1KX3B 3VH5T 5B32C 2CV5A 3O62D 4G92C 1P3KC 3UTBD 3AZFB 3A6NB 1AOIC 1S32A 3AN2B 1Q9CA 3AYWB 1P3MC 5B24C 3MGRC 5GXQD 3B6GD 4KHAB 4X23A 5B33C 3W98C 1B67A 4CAYA 3B6FC 3AZHC 3REKC 5FUGA 4J8XC 3AV2C 5AY8B 3KUYD 3MVDA 5CPIB 4H9RB 4QLCD 3WA9C 1KX5D 4Z5TC 2AROD 4H9PB 4YM6B 3C1CA 4G92B 4Z66A 5F99D 1P3LB 3AFAC 3WAAA 3MGRB 3MNND 1TZYC 5B0YD 5DNNC 1KX3A 3W98B 3LELD 3LZ1C 2HUEC 3RELD 3AZJC 3REKB 3B0DB 1P3GA 4E44A 3AN2A 3AYWA 5B2JD 5AV9B 3REHB 3W96D 1M1AA 4E45A 1ID3D 4KHAA 5GSUC 1M19B 3MGPD 4R8PB 4WU8D 5B1MC 1M18D 2NZDA 3AZED 5AY8A 5CPIA 1P3AD 2F8NG 5GT3B 1HQ3B 1KX5C 4J8VD 4YM6A 5BT1D 4LD9C 3O62B 3KXBD 1P34D 1F1EA 1P3LA 5B31D 5CPKD 5GT0C 5GXQB 3B6GB 3LJAD 4DRBA 3W97D 2PYOD 1P3FD 4XZQD 5AVBD 1P3PC 1F66C 3W99D 3AZLC 5B2IC 5AV9A 3REHA 4QLCB 4H9SA 1KX5B 3W96C 3MGQD 2AROB 1ID3C 2BYMA 4J8UA 1M19A 4R8PA 5F99B 3X1SD 2RVQC 4G91C 3MNNB 5JRGD 5B0YB 5CPJC 5B32D 5GT3A 1HQ3A 4CSRA 3AZID 1P3KD 4H9NB 3LELB 2NQBC 3O62A 3RELB 1ZLAA 3UTBA 4EO5B 1AOID 1P3MD 5B24D 5CP6C 5B2JB 3W96B 5CPKC 5B33D 5GXQA 3X1TD 1ID3B 3B6GA 3W98D 3B6FD 5AV8C 3REJA 3AZHD 4KGCC 4WU9C 3MGPB 4UUZA 3AV2D 4J8XD 4WU8B 1M18B 3LZ0C 3UTAD 3AZEB 3KUYA 3WA9D 1P3AB 4Z5TD 4QLCA 4YS3C 4J8VB 2AROA 5KDMB 5E5AC 3KXBB 1P34B 5F99A 3AFAD 1HTAA 3X1SC 1TZYD 5B31B 5BS7C 5CPKB 5DNND 3MNNA 5B40A 5B0YA 2BYKB 3LZ1D 3LJAB 4H9NA 3LELA 3AZIC 3W97B 5BNXB 3AZJD 2HIOC 4WZSB 2PYOB 4KGCB 3RELA 1P3FB 4XZQB 5AVBB 1BH9B 4NE5A 3W99B 3KWQC 5B2JA 1A7WA 2FJ7C 5GSUD 3MGQB 3REIC 2IO5B 3X1TC 4XUJA 1KX4D 5B1MD 1BH8B 3MGPA 4KUDC 1P3IC 4WU8A 3VH6A 1M18A 3X1SB 3AZEA 3X1VC 3UTAC 3AV1D 1P3AA 5JRGB 5B32B 4LD9D 3AZIB 4J8VA 5KDMA 3AZGC 1P3KB 3KXBA 2LY8A 3UT9C 3MGSA 1P34A 1AOIB 1P3MB 5B24B 5GT0D 5B31A 5B33B 3X1TB 2BYKA 3LJAA 3B0CW 3B6FB 3W97A 3AZHB 3AZFA 2PYOA 3NQJB 3A6NA 1H3OB 4JJNC 3AV2B 1P3FA 4J8XB 1P3PD 1P3BC 4XZQA 3WTPC 5AVBA 3UTAB 3AZLD 3TU4C 5B2ID 3AZNC 3W99A 3WA9B 4Z5TB 4Z2MG 5C3IC 5DNMC 3MGQA 1U35C 3X1UC 3AZKD 2F8NH 5B1LC 1KX4C 1BH8A 2RVQD 3AFAB 3AZMD 1TZYB 5CPJD 4H9RA 3AV1C 5DNNB 5JRGA 5B32A 3VH6W 5AV6C 3LZ1B 2NQBD 4H9PA 2HUEB 1P3KA 1ZLAC 3AZJB 1S32D 1EQZC 4AWLC 5CP6D 4M6BA 1AOIA 2YFWB 5AVCC 4J8WC 1P3MA 5B24A 5AV5C 3MGRA 5GSUB 5B33A 3W98A 5AV8D 3REJC 4WV4B 4KGCD 4WU9D 3C1BC 1KX4B 3B6FA 3AZHA 5B1MB 3LZ0D 3NQJA 1H3OA 3REKA 3AV2A 4J8XA 4ZUXC 1P3OC 3AV1B 3WA9A 4Z5TA 4YS3D 5AV6B 5E5AD 4LD9B 1TAFB 5B0ZC 4AWLB 3AZKC 3WKJC 3AFAA 4NE3A 4NFTA 5GT0B 3AZMC 1TZYA 5B40C 5DNNA 3KSYA 2CV5C 3LZ1A 1F66D 2HIOD 3VH6T 3AZJA 1P3GD 1P3PB 1S32C 2YFVB 1F66B 3KWQD 3AZLB 5B2IB 2FJ7D 4X23C 3REID 5GSUA 4KUDD 5JA4B 3AZKB 1P3ID 5B1MA 3B0BA 4WNNB 3X1VD 3MVDC 4G91B 3AZMB 3VH5W 5CPJB 1KX5A 3NQUB 3C1CC 2F8ND 3AZGD 4LD9A 4Z66C 2NQBB 1TAFA 4H9QB 3UT9D 1S32B 5CP6B 4ZBJC 3WAAC 5GT0A 1KX3C 5AV8B 4WU9B 4JJND 1P3BD 3WTPD 3LZ0B 1P3GC 3TU4D 1P3PA 2YFVA 3AZND 3AN2C 1F66A 3AYWC 3AZLA 5B2IA 1M1AC 3W96A 2L5AA 5DNMD 4YS3B 1WWSA 1U35D 3X1UD 1ID3A 5E5AB 4J8UD 5B1LD 2NZDC 5JA4A 4ZBJB 4WNNA 5AY8C 5G49B 5CPIC 3WTPE 1JFIB 5CPJA 5AV6D 3NQUA 4YM6C
chains in the Genus database with same CATH superfamily
1ZLAD 2NQBA 2HIOB 4H9QA 1EQZD 1P3GB 5AVCD 4J8WD 5B31G 1P3LC 5CP6A 5AV5D 3KWQB 1M1AB 2FJ7B 5CPKA 5BO0B 3REIB 3REJD 3C1BD 5AV8A 4KGCA 2NZDB 4WU9A 5BNXA 4Z2MH 4KUDB 1P3IB 3EPLA 4ZUXD 3B0DC 3LZ0A 1P3OD 2Y2NA 3X1VB 1BH9A 5AV9C 3REHC 4H9SC 3R45B 4YS3A 5B0ZD 2F8NB 5E5AA 3AZGB 4J8UC 1M19C 4R8PC 3UT9B 3WKJD 3A1KA 3X1SA 5G49A 5B32G 5B40D 5BS7A 1JFIA 2CV5D 5GT3C 1HQ3C 1R4VA 2Y2JA 1BFMA 3O62C 3AZIA 2HIOA 3UTBC 4JJNB 1P3BB 3WTPB 3TU4B 3AZNB 3KWQA 1KU5A 4X23D 5C3IB 2FJ7A 5GXQC 5BO0A 4XUJD 3B6GC 5DNMB 3REIA 1U35B 2BYMB 3X1UB 3X1TA 4J8UB 3VH5A 4H9OB 2J8PA 4NE6A 5B1LB 3V9RB 3B0CT 4KUDA 1P3IA 3MVDD 1N1JB 3X1VA 3KUYC 3UTAA 2DQNC 4QLCC 4CSRB 3R45A 3C1CD 4Z66D 2AROC 2G5HC 1B6WA 2F8NA 3AZGA 1ZLAB 3UTBB 3MGSD 1EQZB 3UT9A 1ULYA 5F99C 3WAAD 5AVCB 4J8WB 5BNVB 5AV5B 4HGAC 3MNNC 1KX3D 5B0YC 3REJB 3LELC 5CHLB 3AZFD 3A6ND 3F6TA 3EPKA 4UUZB 3C1BB 3RELC 4JJNA 2DF4C 4EO5C 3AN2D 1P3BA 3AYWD 4ZUXB 3WTPA 3KUYB 2Y2MA 3TU4A 1P3OB 2YFWA 3AZNA 5B2JC 1M1AD 1WWIA 5DNMA 1U35A 4XUJC 5B0ZB 3X1UA 2F8NK 4H9OA 2NZDD 5B1LA 3MGPC 1KX4A 3V9RA 3WKJB 4WU8C 5AY8D 1M18C 3AZEC 1N1JA 2Y2KA 5CPID 4HGAB 1P3AC 5B40B 3KFUG 3AV1A 4YM6D 2CV5B 5AV6A 4J8VC 5BT1C 3KXBC 2BG1A 1EQZA 3MGSC 1P34C 1P3LD 3EG5B 5AVCA 4J8WA 5BNVA 3MGRD 5AV5A 5B31C 4X23B 3H0MC 4XUJB 3LJAC 4CAYB 2CWEA 3W97C 3C1BA 3REKD 3AZFC 3A6NC 2PYOC 1P3FC 5FUGB 4XZQC 5AVBC 3MVDB 4ZUXA 5AV9D 1P3OA 3REHD 3W99C 3C1CB 3MGQC 2IO5C 2JSSA 4Z66B 1M19D 5B0ZA 4R8PD 3MGSB 3AZKA 2W8SA 3WKJA 3WAAB 3AZMA 5GT3D 1HQ3D 4DRAA 5JRGC 1KX3B 2JE5A 3VH5T 5B32C 2CV5A 3O62D 4G92C 1P3KC 3UTBD 3AZFB 3A6NB 2ZY5A 1AOIC 1S32A 3AN2B 1Q9CA 3AYWB 1P3MC 5B24C 3H0LC 3MGRC 5GXQD 2G5IC 3B6GD 4KHAB 4X23A 5B33C 4DQYB 3W98C 1B67A 4CAYA 3B6FC 3AZHC 3REKC 5FUGA 4J8XC 3AV2C 5AY8B 3KUYD 3MVDA 5CPIB 4H9RB 4QLCD 3WA9C 1KX5D 4Z5TC 2AROD 4H9PB 4YM6B 3C1CA 4G92B 4Z66A 5F99D 1P3LB 3AFAC 3WAAA 3MGRB 3MNND 1TZYC 3P5JB 5B0YD 5DNNC 1KX3A 3W98B 3LELD 3LZ1C 2HUEC 3RELD 2Y2LA 3AZJC 3REKB 3B0DB 1P3GA 4E44A 3AN2A 3AYWA 2ZM5A 5B2JD 5AV9B 3REHB 3W96D 1M1AA 4E45A 1ID3D 4KHAA 5GSUC 1M19B 3MGPD 4R8PB 4WU8D 5B1MC 1M18D 2NZDA 3AZED 5AY8A 5CPIA 1P3AD 2F8NG 5GT3B 1HQ3B 1KX5C 4J8VD 4YM6A 5BT1D 4LD9C 3O62B 3KXBD 1P34D 1F1EA 1P3LA 5B31D 5CPKD 2FFFB 5GT0C 5GXQB 3B6GB 3LJAD 4DRBA 3W97D 2PYOD 1P3FD 4XZQD 5AVBD 1P3PC 1F66C 3W99D 3AZLC 5B2IC 5AV9A 3REHA 4QLCB 4H9SA 1KX5B 3W96C 3MGQD 2AROB 1ID3C 2BYMA 4WJ3C 4J8UA 1M19A 2Y2IA 4R8PA 5F99B 2Y2GA 3X1SD 2RVQC 4G91C 3MNNB 5JRGD 5B0YB 5CPJC 5B32D 5GT3A 1HQ3A 4CSRA 3AZID 3H0RC 3AL0C 1P3KD 4H9NB 3LELB 2NQBC 3O62A 3RELB 1ZLAA 3UTBA 4EO5B 1AOID 1P3MD 5B24D 5CP6C 5B2JB 3W96B 3EPHA 5CPKC 2Y2OA 5B33D 5GXQA 3X1TD 1ID3B 3B6GA 3W98D 3B6FD 5AV8C 3REJA 3AZHD 4KGCC 4WU9C 3MGPB 4UUZA 3AV2D 4J8XD 4WU8B 1M18B 3A1IA 3LZ0C 3UTAD 3AZEB 3KUYA 3WA9D 1P3AB 4Z5TD 4QLCA 1W2EA 2Y2PA 4YS3C 4J8VB 2AROA 5KDMB 5E5AC 3KXBB 1P34B 5F99A 3AFAD 1HTAA 3X1SC 1TZYD 5B31B 5BS7C 5CPKB 5DNND 3MNNA 5B40A 5B0YA 2BYKB 3LZ1D 3LJAB 4H9NA 3LELA 3AZIC 3W97B 5BNXB 3AZJD 2HIOC 4WZSB 2PYOB 3IP4C 3RELA 1P3FB 4KGCB 4XZQB 5AVBB 1BH9B 4NE5A 3W99B 3KWQC 5B2JA 1A7WA 2FJ7C 5GSUD 2ZY4A 3MGQB 3REIC 2IO5B 3X1TC 4XUJA 1KX4D 5B1MD 1BH8B 3MGPA 4KUDC 1P3IC 4WU8A 3VH6A 1M18A 3X1SB 3AZEA 2ZY3A 3X1VC 3UTAC 3AV1D 1P3AA 5JRGB 5B32B 4LD9D 2JCHA 3AZIB 4J8VA 5KDMA 3AZGC 1P3KB 3KXBA 2LY8A 2Y2HA 3UT9C 3MGSA 1P34A 1AOIB 1P3MB 5B24B 2UWXA 5GT0D 2XD5A 5B31A 1PZRA 5B33B 3X1TB 2BYKA 3LJAA 3B0CW 3B6FB 3W97A 3AZHB 3AZFA 2PYOA 3NQJB 3A6NA 1H3OB 4JJNC 3AV2B 1P3FA 4J8XB 1P3PD 1P3BC 4XZQA 3WTPC 5AVBA 3UTAB 3AZLD 3TU4C 5B2ID 3AZNC 3W99A 3WA9B 2VQRA 4Z5TB 4Z2MG 5C3IC 5DNMC 3MGQA 1U35C 3X1UC 3AZKD 2F8NH 5B1LC 1KX4C 1BH8A 2RVQD 3AFAB 3AZMD 1TZYB 5CPJD 4H9RA 3AV1C 5DNNB 5JRGA 5B32A 3VH6W 5AV6C 3LZ1B 2NQBD 4H9PA 2HUEB 1P3KA 1ZLAC 3AZJB 1S32D 1EQZC 4AWLC 5CP6D 4M6BA 1AOIA 2YFWB 5AVCC 4J8WC 1P3MA 5B24A 5AV5C 3MGRA 5GSUB 5B33A 3W98A 5AV8D 3REJC 4WV4B 4KGCD 4WU9D 3C1BC 1KX4B 3B6FA 3AZHA 5B1MB 3LZ0D 3NQJA 1H3OA 3REKA 3AV2A 4J8XA 3FDDA 4ZUXC 1P3OC 3AV1B 3WA9A 4Z5TA 4YS3D 5AV6B 5E5AD 4LD9B 1TAFB 5B0ZC 4AWLB 3AZKC 3WKJC 3AFAA 4NE3A 4NFTA 5GT0B 3AZMC 1TZYA 5B40C 3EPJA 5DNNA 3KSYA 2CV5C 2F2AC 3LZ1A 1F66D 2HIOD 3VH6T 3AZJA 1P3GD 1P3PB 1S32C 2YFVB 1F66B 3KWQD 3AZLB 4UPKA 5B2IB 2FJ7D 4X23C 3REID 5GSUA 4KUDD 5JA4B 3AZKB 1P3ID 5B1MA 3B0BA 4WNNB 3X1VD 3MVDC 4G91B 3AZMB 3VH5W 5CPJB 1KX5A 3NQUB 3C1CC 2F8ND 3AZGD 4LD9A 4Z66C 2NQBB 1TAFA 4H9QB 3UT9D 1S32B 2RIQA 4ZBJC 5CP6B 3WAAC 5GT0A 2XD1A 2ZY2A 1KX3C 5AV8B 4WU9B 4JJND 1P3BD 3WTPD 3LZ0B 1P3GC 3TU4D 1P3PA 2YFVA 3AZND 3AN2C 1F66A 3AYWC 3AZLA 1T3UA 5B2IA 1M1AC 3W96A 2L5AA 5DNMD 4YS3B 1WWSA 1U35D 3X1UD 1ID3A 5E5AB 4J8UD 5B1LD 2NZDC 5JA4A 4ZBJB 4WNNA 5AY8C 1Z2CB 5G49B 5CPIC 3WTPE 1JFIB 2Y2QA 5CPJA 5AV6D 3NQUA 4YM6C
chains in the Genus database with same CATH topology
1ZLAD 2NQBA 2HIOB 4H9QA 1EQZD 1P3GB 5AVCD 4J8WD 5B31G 1P3LC 5CP6A 5AV5D 3KWQB 1M1AB 2FJ7B 5CPKA 5BO0B 3REIB 3REJD 3C1BD 5AV8A 4KGCA 2NZDB 4WU9A 5BNXA 4Z2MH 4KUDB 1P3IB 3EPLA 4ZUXD 3B0DC 3LZ0A 1P3OD 2Y2NA 3X1VB 1BH9A 5AV9C 3REHC 4H9SC 3R45B 4YS3A 5B0ZD 2F8NB 5E5AA 3AZGB 4J8UC 1M19C 4R8PC 3UT9B 3WKJD 3A1KA 3X1SA 5G49A 5B32G 5B40D 5BS7A 1JFIA 2CV5D 5GT3C 1HQ3C 1R4VA 2Y2JA 1BFMA 3O62C 3AZIA 2HIOA 3UTBC 4JJNB 1P3BB 3WTPB 3TU4B 3AZNB 3KWQA 1KU5A 4X23D 5C3IB 2FJ7A 5GXQC 5BO0A 4XUJD 3B6GC 5DNMB 3REIA 1U35B 2BYMB 3X1UB 3X1TA 4J8UB 3VH5A 4H9OB 2J8PA 4NE6A 5B1LB 3V9RB 3B0CT 4KUDA 1P3IA 3MVDD 1N1JB 3X1VA 3KUYC 3UTAA 2DQNC 4QLCC 4CSRB 3R45A 3C1CD 4Z66D 2AROC 2G5HC 1B6WA 2F8NA 3AZGA 1ZLAB 3UTBB 3MGSD 1EQZB 3UT9A 1ULYA 5F99C 3WAAD 5AVCB 4J8WB 5BNVB 5AV5B 4HGAC 3MNNC 1KX3D 5B0YC 3REJB 3LELC 5CHLB 3AZFD 3A6ND 3F6TA 3EPKA 4UUZB 3C1BB 3RELC 4JJNA 2DF4C 4EO5C 3AN2D 1P3BA 3AYWD 4ZUXB 3WTPA 3KUYB 2Y2MA 3TU4A 1P3OB 2YFWA 3AZNA 5B2JC 1M1AD 1WWIA 5DNMA 1U35A 4XUJC 5B0ZB 3X1UA 2F8NK 4H9OA 2NZDD 5B1LA 3MGPC 1KX4A 3V9RA 3WKJB 4WU8C 5AY8D 1M18C 3AZEC 1N1JA 2Y2KA 5CPID 4HGAB 1P3AC 5B40B 3KFUG 3AV1A 4YM6D 2CV5B 5AV6A 4J8VC 5BT1C 3KXBC 2BG1A 1EQZA 3MGSC 1P34C 1P3LD 3EG5B 5AVCA 4J8WA 5BNVA 3MGRD 5AV5A 5B31C 4X23B 3H0MC 4XUJB 3LJAC 4CAYB 2CWEA 3W97C 3C1BA 3REKD 3AZFC 3A6NC 2PYOC 1P3FC 5FUGB 4XZQC 5AVBC 3MVDB 4ZUXA 5AV9D 1P3OA 3REHD 3W99C 3C1CB 3MGQC 2IO5C 2JSSA 4Z66B 1M19D 5B0ZA 4R8PD 3MGSB 3AZKA 2W8SA 3WKJA 3WAAB 3AZMA 5GT3D 1HQ3D 4DRAA 5JRGC 1KX3B 2JE5A 3VH5T 5B32C 2CV5A 3O62D 4G92C 1P3KC 3UTBD 3AZFB 3A6NB 2ZY5A 1AOIC 1S32A 3AN2B 1Q9CA 3AYWB 1P3MC 5B24C 3H0LC 3MGRC 5GXQD 2G5IC 3B6GD 4KHAB 4X23A 5B33C 4DQYB 3W98C 1B67A 4CAYA 3B6FC 3AZHC 3REKC 5FUGA 4J8XC 3AV2C 5AY8B 3KUYD 3MVDA 5CPIB 4H9RB 4QLCD 3WA9C 1KX5D 4Z5TC 2AROD 4H9PB 4YM6B 3C1CA 4G92B 4Z66A 5F99D 1P3LB 3AFAC 3WAAA 3MGRB 3MNND 1TZYC 3P5JB 5B0YD 5DNNC 1KX3A 3W98B 3LELD 3LZ1C 2HUEC 3RELD 2Y2LA 3AZJC 3REKB 3B0DB 1P3GA 4E44A 3AN2A 3AYWA 2ZM5A 5B2JD 5AV9B 3REHB 3W96D 1M1AA 4E45A 1ID3D 4KHAA 5GSUC 1M19B 3MGPD 4R8PB 4WU8D 5B1MC 1M18D 2NZDA 3AZED 5AY8A 5CPIA 1P3AD 2F8NG 5GT3B 1HQ3B 1KX5C 4J8VD 4YM6A 5BT1D 4LD9C 3O62B 3KXBD 1P34D 1F1EA 1P3LA 5B31D 5CPKD 2FFFB 5GT0C 5GXQB 3B6GB 3LJAD 4DRBA 3W97D 2PYOD 1P3FD 4XZQD 5AVBD 1P3PC 1F66C 3W99D 3AZLC 5B2IC 5AV9A 3REHA 4QLCB 4H9SA 1KX5B 3W96C 3MGQD 2AROB 1ID3C 2BYMA 4WJ3C 4J8UA 1M19A 2Y2IA 4R8PA 5F99B 2Y2GA 3X1SD 2RVQC 4G91C 3MNNB 5JRGD 5B0YB 5CPJC 5B32D 5GT3A 1HQ3A 4CSRA 3AZID 3H0RC 3AL0C 1P3KD 4H9NB 3LELB 2NQBC 3O62A 3RELB 1ZLAA 3UTBA 4EO5B 1AOID 1P3MD 5B24D 5CP6C 5B2JB 3W96B 3EPHA 5CPKC 2Y2OA 5B33D 5GXQA 3X1TD 1ID3B 3B6GA 3W98D 3B6FD 5AV8C 3REJA 3AZHD 4KGCC 4WU9C 3MGPB 4UUZA 3AV2D 4J8XD 4WU8B 1M18B 3A1IA 3LZ0C 3UTAD 3AZEB 3KUYA 3WA9D 1P3AB 4Z5TD 4QLCA 1W2EA 2Y2PA 4YS3C 4J8VB 2AROA 5KDMB 5E5AC 3KXBB 1P34B 5F99A 3AFAD 1HTAA 3X1SC 1TZYD 5B31B 5BS7C 5CPKB 5DNND 3MNNA 5B40A 5B0YA 2BYKB 3LZ1D 3LJAB 4H9NA 3LELA 3AZIC 3W97B 5BNXB 3AZJD 2HIOC 4WZSB 2PYOB 3IP4C 3RELA 1P3FB 4KGCB 4XZQB 5AVBB 1BH9B 4NE5A 3W99B 3KWQC 5B2JA 1A7WA 2FJ7C 5GSUD 2ZY4A 3MGQB 3REIC 2IO5B 3X1TC 4XUJA 1KX4D 5B1MD 1BH8B 3MGPA 4KUDC 1P3IC 4WU8A 3VH6A 1M18A 3X1SB 3AZEA 2ZY3A 3X1VC 3UTAC 3AV1D 1P3AA 5JRGB 5B32B 4LD9D 2JCHA 3AZIB 4J8VA 5KDMA 3AZGC 1P3KB 3KXBA 2LY8A 2Y2HA 3UT9C 3MGSA 1P34A 1AOIB 1P3MB 5B24B 2UWXA 5GT0D 2XD5A 5B31A 1PZRA 5B33B 3X1TB 2BYKA 3LJAA 3B0CW 3B6FB 3W97A 3AZHB 3AZFA 2PYOA 3NQJB 3A6NA 1H3OB 4JJNC 3AV2B 1P3FA 4J8XB 1P3PD 1P3BC 4XZQA 3WTPC 5AVBA 3UTAB 3AZLD 3TU4C 5B2ID 3AZNC 3W99A 3WA9B 2VQRA 4Z5TB 4Z2MG 5C3IC 5DNMC 3MGQA 1U35C 3X1UC 3AZKD 2F8NH 5B1LC 1KX4C 1BH8A 2RVQD 3AFAB 3AZMD 1TZYB 5CPJD 4H9RA 3AV1C 5DNNB 5JRGA 5B32A 3VH6W 5AV6C 3LZ1B 2NQBD 4H9PA 2HUEB 1P3KA 1ZLAC 3AZJB 1S32D 1EQZC 4AWLC 5CP6D 4M6BA 1AOIA 2YFWB 5AVCC 4J8WC 1P3MA 5B24A 5AV5C 3MGRA 5GSUB 5B33A 3W98A 5AV8D 3REJC 4WV4B 4KGCD 4WU9D 3C1BC 1KX4B 3B6FA 3AZHA 5B1MB 3LZ0D 3NQJA 1H3OA 3REKA 3AV2A 4J8XA 3FDDA 4ZUXC 1P3OC 3AV1B 3WA9A 4Z5TA 4YS3D 5AV6B 5E5AD 4LD9B 1TAFB 5B0ZC 4AWLB 3AZKC 3WKJC 3AFAA 4NE3A 4NFTA 5GT0B 3AZMC 1TZYA 5B40C 3EPJA 5DNNA 3KSYA 2CV5C 2F2AC 3LZ1A 1F66D 2HIOD 3VH6T 3AZJA 1P3GD 1P3PB 1S32C 2YFVB 1F66B 3KWQD 3AZLB 4UPKA 5B2IB 2FJ7D 4X23C 3REID 5GSUA 4KUDD 5JA4B 3AZKB 1P3ID 5B1MA 3B0BA 4WNNB 3X1VD 3MVDC 4G91B 3AZMB 3VH5W 5CPJB 1KX5A 3NQUB 3C1CC 2F8ND 3AZGD 4LD9A 4Z66C 2NQBB 1TAFA 4H9QB 3UT9D 1S32B 2RIQA 4ZBJC 5CP6B 3WAAC 5GT0A 2XD1A 2ZY2A 1KX3C 5AV8B 4WU9B 4JJND 1P3BD 3WTPD 3LZ0B 1P3GC 3TU4D 1P3PA 2YFVA 3AZND 3AN2C 1F66A 3AYWC 3AZLA 1T3UA 5B2IA 1M1AC 3W96A 2L5AA 5DNMD 4YS3B 1WWSA 1U35D 3X1UD 1ID3A 5E5AB 4J8UD 5B1LD 2NZDC 5JA4A 4ZBJB 4WNNA 5AY8C 1Z2CB 5G49B 5CPIC 3WTPE 1JFIB 2Y2QA 5CPJA 5AV6D 3NQUA 4YM6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLA D;  2NQB A;  2HIO B;  4H9Q A;  1EQZ D;  1P3G B;  5AVC D;  4J8W D;  5B31 G;  1P3L C;  5CP6 A;  5AV5 D;  3KWQ B;  1M1A B;  2FJ7 B;  5CPK A;  5BO0 B;  3REI B;  3REJ D;  3C1B D;  5AV8 A;  4KGC A;  2NZD B;  4WU9 A;  5BNX A;  4Z2M H;  4KUD B;  1P3I B;  4ZUX D;  3B0D C;  3LZ0 A;  1P3O D;  3X1V B;  1BH9 A;  5AV9 C;  3REH C;  4H9S C;  3R45 B;  4YS3 A;  5B0Z D;  2F8N B;  5E5A A;  3AZG B;  4J8U C;  1M19 C;  4R8P C;  3UT9 B;  3WKJ D;  3X1S A;  5G49 A;  5B32 G;  5B40 D;  5BS7 A;  1JFI A;  2CV5 D;  5GT3 C;  1HQ3 C;  1R4V A;  1BFM A;  3O62 C;  3AZI A;  2HIO A;  3UTB C;  4JJN B;  1P3B B;  3WTP B;  3TU4 B;  3AZN B;  3KWQ A;  1KU5 A;  4X23 D;  5C3I B;  2FJ7 A;  5GXQ C;  5BO0 A;  4XUJ D;  3B6G C;  5DNM B;  3REI A;  1U35 B;  2BYM B;  3X1U B;  3X1T A;  4J8U B;  3VH5 A;  4H9O B;  4NE6 A;  5B1L B;  3V9R B;  3B0C T;  4KUD A;  1P3I A;  3MVD D;  1N1J B;  3X1V A;  3KUY C;  3UTA A;  4QLC C;  4CSR B;  3R45 A;  3C1C D;  4Z66 D;  2ARO C;  1B6W A;  2F8N A;  3AZG A;  1ZLA B;  3UTB B;  3MGS D;  1EQZ B;  3UT9 A;  1ULY A;  5F99 C;  3WAA D;  5AVC B;  4J8W B;  5BNV B;  5AV5 B;  4HGA C;  3MNN C;  1KX3 D;  5B0Y C;  3REJ B;  3LEL C;  5CHL B;  3AZF D;  3A6N D;  3C1B B;  4UUZ B;  3REL C;  4JJN A;  4EO5 C;  3AN2 D;  1P3B A;  3AYW D;  4ZUX B;  3WTP A;  3KUY B;  1P3O B;  3TU4 A;  2YFW A;  3AZN A;  5B2J C;  1M1A D;  1WWI A;  5DNM A;  1U35 A;  4XUJ C;  5B0Z B;  3X1U A;  2F8N K;  4H9O A;  2NZD D;  5B1L A;  3MGP C;  1KX4 A;  3V9R A;  3WKJ B;  4WU8 C;  5AY8 D;  1M18 C;  3AZE C;  1N1J A;  5CPI D;  4HGA B;  1P3A C;  5B40 B;  3AV1 A;  4YM6 D;  2CV5 B;  5AV6 A;  4J8V C;  5BT1 C;  3KXB C;  1EQZ A;  3MGS C;  1P34 C;  1P3L D;  5AVC A;  4J8W A;  5BNV A;  3MGR D;  5AV5 A;  5B31 C;  4X23 B;  4XUJ B;  3LJA C;  4CAY B;  2CWE A;  3W97 C;  3C1B A;  3REK D;  3AZF C;  3A6N C;  2PYO C;  1P3F C;  5FUG B;  4XZQ C;  5AVB C;  3MVD B;  4ZUX A;  5AV9 D;  1P3O A;  3REH D;  3W99 C;  3C1C B;  3MGQ C;  2IO5 C;  2JSS A;  4Z66 B;  1M19 D;  5B0Z A;  4R8P D;  3MGS B;  3AZK A;  3WKJ A;  3WAA B;  3AZM A;  5GT3 D;  1HQ3 D;  4DRA A;  5JRG C;  1KX3 B;  3VH5 T;  5B32 C;  2CV5 A;  3O62 D;  4G92 C;  1P3K C;  3UTB D;  3AZF B;  3A6N B;  1AOI C;  1S32 A;  3AN2 B;  1Q9C A;  3AYW B;  1P3M C;  5B24 C;  3MGR C;  5GXQ D;  3B6G D;  4KHA B;  4X23 A;  5B33 C;  3W98 C;  1B67 A;  4CAY A;  3B6F C;  3AZH C;  3REK C;  5FUG A;  4J8X C;  3AV2 C;  5AY8 B;  3KUY D;  3MVD A;  5CPI B;  4H9R B;  4QLC D;  3WA9 C;  1KX5 D;  4Z5T C;  2ARO D;  4H9P B;  4YM6 B;  3C1C A;  4G92 B;  4Z66 A;  5F99 D;  1P3L B;  3AFA C;  3WAA A;  3MGR B;  3MNN D;  1TZY C;  5B0Y D;  5DNN C;  1KX3 A;  3W98 B;  3LEL D;  3LZ1 C;  2HUE C;  3REL D;  3AZJ C;  3REK B;  3B0D B;  1P3G A;  4E44 A;  3AN2 A;  3AYW A;  5B2J D;  5AV9 B;  3REH B;  3W96 D;  1M1A A;  4E45 A;  1ID3 D;  4KHA A;  5GSU C;  1M19 B;  3MGP D;  4R8P B;  4WU8 D;  5B1M C;  1M18 D;  2NZD A;  3AZE D;  5AY8 A;  5CPI A;  1P3A D;  2F8N G;  5GT3 B;  1HQ3 B;  1KX5 C;  4J8V D;  4YM6 A;  5BT1 D;  4LD9 C;  3O62 B;  3KXB D;  1P34 D;  1F1E A;  1P3L A;  5B31 D;  5CPK D;  5GT0 C;  5GXQ B;  3B6G B;  3LJA D;  4DRB A;  3W97 D;  2PYO D;  1P3F D;  4XZQ D;  5AVB D;  1P3P C;  1F66 C;  3W99 D;  3AZL C;  5B2I C;  5AV9 A;  3REH A;  4QLC B;  4H9S A;  1KX5 B;  3W96 C;  3MGQ D;  2ARO B;  1ID3 C;  2BYM A;  4J8U A;  1M19 A;  4R8P A;  5F99 B;  3X1S D;  2RVQ C;  4G91 C;  3MNN B;  5JRG D;  5B0Y B;  5CPJ C;  5B32 D;  5GT3 A;  1HQ3 A;  4CSR A;  3AZI D;  1P3K D;  4H9N B;  3LEL B;  2NQB C;  3O62 A;  3REL B;  1ZLA A;  3UTB A;  4EO5 B;  1AOI D;  1P3M D;  5B24 D;  5CP6 C;  5B2J B;  3W96 B;  5CPK C;  5B33 D;  5GXQ A;  3X1T D;  1ID3 B;  3B6G A;  3W98 D;  3B6F D;  5AV8 C;  3REJ A;  3AZH D;  4KGC C;  4WU9 C;  3MGP B;  4UUZ A;  3AV2 D;  4J8X D;  4WU8 B;  1M18 B;  3LZ0 C;  3UTA D;  3AZE B;  3KUY A;  3WA9 D;  1P3A B;  4Z5T D;  4QLC A;  4YS3 C;  4J8V B;  2ARO A;  5KDM B;  5E5A C;  3KXB B;  1P34 B;  5F99 A;  3AFA D;  1HTA A;  3X1S C;  1TZY D;  5B31 B;  5BS7 C;  5CPK B;  5DNN D;  3MNN A;  5B40 A;  5B0Y A;  2BYK B;  3LZ1 D;  3LJA B;  4H9N A;  3LEL A;  3AZI C;  3W97 B;  5BNX B;  3AZJ D;  2HIO C;  4WZS B;  2PYO B;  4KGC B;  3REL A;  1P3F B;  4XZQ B;  5AVB B;  1BH9 B;  4NE5 A;  3W99 B;  3KWQ C;  5B2J A;  1A7W A;  2FJ7 C;  5GSU D;  3MGQ B;  3REI C;  2IO5 B;  3X1T C;  4XUJ A;  1KX4 D;  5B1M D;  1BH8 B;  3MGP A;  4KUD C;  1P3I C;  4WU8 A;  3VH6 A;  1M18 A;  3X1S B;  3AZE A;  3X1V C;  3UTA C;  3AV1 D;  1P3A A;  5JRG B;  5B32 B;  4LD9 D;  3AZI B;  4J8V A;  5KDM A;  3AZG C;  1P3K B;  3KXB A;  2LY8 A;  3UT9 C;  3MGS A;  1P34 A;  1AOI B;  1P3M B;  5B24 B;  5GT0 D;  5B31 A;  5B33 B;  3X1T B;  2BYK A;  3LJA A;  3B0C W;  3B6F B;  3W97 A;  3AZH B;  3AZF A;  2PYO A;  3NQJ B;  3A6N A;  1H3O B;  4JJN C;  3AV2 B;  1P3F A;  4J8X B;  1P3P D;  1P3B C;  4XZQ A;  3WTP C;  5AVB A;  3UTA B;  3AZL D;  3TU4 C;  5B2I D;  3AZN C;  3W99 A;  3WA9 B;  4Z5T B;  4Z2M G;  5C3I C;  5DNM C;  3MGQ A;  1U35 C;  3X1U C;  3AZK D;  2F8N H;  5B1L C;  1KX4 C;  1BH8 A;  2RVQ D;  3AFA B;  3AZM D;  1TZY B;  5CPJ D;  4H9R A;  3AV1 C;  5DNN B;  5JRG A;  5B32 A;  3VH6 W;  5AV6 C;  3LZ1 B;  2NQB D;  4H9P A;  2HUE B;  1P3K A;  1ZLA C;  3AZJ B;  1S32 D;  1EQZ C;  4AWL C;  5CP6 D;  4M6B A;  1AOI A;  2YFW B;  5AVC C;  4J8W C;  1P3M A;  5B24 A;  5AV5 C;  3MGR A;  5GSU B;  5B33 A;  3W98 A;  5AV8 D;  3REJ C;  4WV4 B;  4KGC D;  4WU9 D;  3C1B C;  1KX4 B;  3B6F A;  3AZH A;  5B1M B;  3LZ0 D;  3NQJ A;  1H3O A;  3REK A;  3AV2 A;  4J8X A;  4ZUX C;  1P3O C;  3AV1 B;  3WA9 A;  4Z5T A;  4YS3 D;  5AV6 B;  5E5A D;  4LD9 B;  1TAF B;  5B0Z C;  4AWL B;  3AZK C;  3WKJ C;  3AFA A;  4NE3 A;  4NFT A;  5GT0 B;  3AZM C;  1TZY A;  5B40 C;  5DNN A;  3KSY A;  2CV5 C;  3LZ1 A;  1F66 D;  2HIO D;  3VH6 T;  3AZJ A;  1P3G D;  1P3P B;  1S32 C;  2YFV B;  1F66 B;  3KWQ D;  3AZL B;  5B2I B;  2FJ7 D;  4X23 C;  3REI D;  5GSU A;  4KUD D;  5JA4 B;  3AZK B;  1P3I D;  5B1M A;  3B0B A;  4WNN B;  3X1V D;  3MVD C;  4G91 B;  3AZM B;  3VH5 W;  5CPJ B;  1KX5 A;  3NQU B;  3C1C C;  2F8N D;  3AZG D;  4LD9 A;  4Z66 C;  2NQB B;  1TAF A;  4H9Q B;  3UT9 D;  1S32 B;  5CP6 B;  4ZBJ C;  3WAA C;  5GT0 A;  1KX3 C;  5AV8 B;  4WU9 B;  4JJN D;  1P3B D;  3WTP D;  3LZ0 B;  1P3G C;  3TU4 D;  1P3P A;  2YFV A;  3AZN D;  3AN2 C;  1F66 A;  3AYW C;  3AZL A;  5B2I A;  1M1A C;  3W96 A;  2L5A A;  5DNM D;  4YS3 B;  1WWS A;  1U35 D;  3X1U D;  1ID3 A;  5E5A B;  4J8U D;  5B1L D;  2NZD C;  5JA4 A;  4ZBJ B;  4WNN A;  5AY8 C;  5G49 B;  5CPI C;  3WTP E;  1JFI B;  5CPJ A;  5AV6 D;  3NQU A;  4YM6 C; 
#chains in the Genus database with same CATH topology
 1ZLA D;  2NQB A;  2HIO B;  4H9Q A;  1EQZ D;  1P3G B;  5AVC D;  4J8W D;  5B31 G;  1P3L C;  5CP6 A;  5AV5 D;  3KWQ B;  1M1A B;  2FJ7 B;  5CPK A;  5BO0 B;  3REI B;  3REJ D;  3C1B D;  5AV8 A;  4KGC A;  2NZD B;  4WU9 A;  5BNX A;  4Z2M H;  4KUD B;  1P3I B;  3EPL A;  4ZUX D;  3B0D C;  3LZ0 A;  1P3O D;  2Y2N A;  3X1V B;  1BH9 A;  5AV9 C;  3REH C;  4H9S C;  3R45 B;  4YS3 A;  5B0Z D;  2F8N B;  5E5A A;  3AZG B;  4J8U C;  1M19 C;  4R8P C;  3UT9 B;  3WKJ D;  3A1K A;  3X1S A;  5G49 A;  5B32 G;  5B40 D;  5BS7 A;  1JFI A;  2CV5 D;  5GT3 C;  1HQ3 C;  1R4V A;  2Y2J A;  1BFM A;  3O62 C;  3AZI A;  2HIO A;  3UTB C;  4JJN B;  1P3B B;  3WTP B;  3TU4 B;  3AZN B;  3KWQ A;  1KU5 A;  4X23 D;  5C3I B;  2FJ7 A;  5GXQ C;  5BO0 A;  4XUJ D;  3B6G C;  5DNM B;  3REI A;  1U35 B;  2BYM B;  3X1U B;  3X1T A;  4J8U B;  3VH5 A;  4H9O B;  2J8P A;  4NE6 A;  5B1L B;  3V9R B;  3B0C T;  4KUD A;  1P3I A;  3MVD D;  1N1J B;  3X1V A;  3KUY C;  3UTA A;  2DQN C;  4QLC C;  4CSR B;  3R45 A;  3C1C D;  4Z66 D;  2ARO C;  2G5H C;  1B6W A;  2F8N A;  3AZG A;  1ZLA B;  3UTB B;  3MGS D;  1EQZ B;  3UT9 A;  1ULY A;  5F99 C;  3WAA D;  5AVC B;  4J8W B;  5BNV B;  5AV5 B;  4HGA C;  3MNN C;  1KX3 D;  5B0Y C;  3REJ B;  3LEL C;  5CHL B;  3AZF D;  3A6N D;  3F6T A;  3EPK A;  4UUZ B;  3C1B B;  3REL C;  4JJN A;  2DF4 C;  4EO5 C;  3AN2 D;  1P3B A;  3AYW D;  4ZUX B;  3WTP A;  3KUY B;  2Y2M A;  3TU4 A;  1P3O B;  2YFW A;  3AZN A;  5B2J C;  1M1A D;  1WWI A;  5DNM A;  1U35 A;  4XUJ C;  5B0Z B;  3X1U A;  2F8N K;  4H9O A;  2NZD D;  5B1L A;  3MGP C;  1KX4 A;  3V9R A;  3WKJ B;  4WU8 C;  5AY8 D;  1M18 C;  3AZE C;  1N1J A;  2Y2K A;  5CPI D;  4HGA B;  1P3A C;  5B40 B;  3KFU G;  3AV1 A;  4YM6 D;  2CV5 B;  5AV6 A;  4J8V C;  5BT1 C;  3KXB C;  2BG1 A;  1EQZ A;  3MGS C;  1P34 C;  1P3L D;  3EG5 B;  5AVC A;  4J8W A;  5BNV A;  3MGR D;  5AV5 A;  5B31 C;  4X23 B;  3H0M C;  4XUJ B;  3LJA C;  4CAY B;  2CWE A;  3W97 C;  3C1B A;  3REK D;  3AZF C;  3A6N C;  2PYO C;  1P3F C;  5FUG B;  4XZQ C;  5AVB C;  3MVD B;  4ZUX A;  5AV9 D;  1P3O A;  3REH D;  3W99 C;  3C1C B;  3MGQ C;  2IO5 C;  2JSS A;  4Z66 B;  1M19 D;  5B0Z A;  4R8P D;  3MGS B;  3AZK A;  2W8S A;  3WKJ A;  3WAA B;  3AZM A;  5GT3 D;  1HQ3 D;  4DRA A;  5JRG C;  1KX3 B;  2JE5 A;  3VH5 T;  5B32 C;  2CV5 A;  3O62 D;  4G92 C;  1P3K C;  3UTB D;  3AZF B;  3A6N B;  2ZY5 A;  1AOI C;  1S32 A;  3AN2 B;  1Q9C A;  3AYW B;  1P3M C;  5B24 C;  3H0L C;  3MGR C;  5GXQ D;  2G5I C;  3B6G D;  4KHA B;  4X23 A;  5B33 C;  4DQY B;  3W98 C;  1B67 A;  4CAY A;  3B6F C;  3AZH C;  3REK C;  5FUG A;  4J8X C;  3AV2 C;  5AY8 B;  3KUY D;  3MVD A;  5CPI B;  4H9R B;  4QLC D;  3WA9 C;  1KX5 D;  4Z5T C;  2ARO D;  4H9P B;  4YM6 B;  3C1C A;  4G92 B;  4Z66 A;  5F99 D;  1P3L B;  3AFA C;  3WAA A;  3MGR B;  3MNN D;  1TZY C;  3P5J B;  5B0Y D;  5DNN C;  1KX3 A;  3W98 B;  3LEL D;  3LZ1 C;  2HUE C;  3REL D;  2Y2L A;  3AZJ C;  3REK B;  3B0D B;  1P3G A;  4E44 A;  3AN2 A;  3AYW A;  2ZM5 A;  5B2J D;  5AV9 B;  3REH B;  3W96 D;  1M1A A;  4E45 A;  1ID3 D;  4KHA A;  5GSU C;  1M19 B;  3MGP D;  4R8P B;  4WU8 D;  5B1M C;  1M18 D;  2NZD A;  3AZE D;  5AY8 A;  5CPI A;  1P3A D;  2F8N G;  5GT3 B;  1HQ3 B;  1KX5 C;  4J8V D;  4YM6 A;  5BT1 D;  4LD9 C;  3O62 B;  3KXB D;  1P34 D;  1F1E A;  1P3L A;  5B31 D;  5CPK D;  2FFF B;  5GT0 C;  5GXQ B;  3B6G B;  3LJA D;  4DRB A;  3W97 D;  2PYO D;  1P3F D;  4XZQ D;  5AVB D;  1P3P C;  1F66 C;  3W99 D;  3AZL C;  5B2I C;  5AV9 A;  3REH A;  4QLC B;  4H9S A;  1KX5 B;  3W96 C;  3MGQ D;  2ARO B;  1ID3 C;  2BYM A;  4WJ3 C;  4J8U A;  1M19 A;  2Y2I A;  4R8P A;  5F99 B;  2Y2G A;  3X1S D;  2RVQ C;  4G91 C;  3MNN B;  5JRG D;  5B0Y B;  5CPJ C;  5B32 D;  5GT3 A;  1HQ3 A;  4CSR A;  3AZI D;  3H0R C;  3AL0 C;  1P3K D;  4H9N B;  3LEL B;  2NQB C;  3O62 A;  3REL B;  1ZLA A;  3UTB A;  4EO5 B;  1AOI D;  1P3M D;  5B24 D;  5CP6 C;  5B2J B;  3W96 B;  3EPH A;  5CPK C;  2Y2O A;  5B33 D;  5GXQ A;  3X1T D;  1ID3 B;  3B6G A;  3W98 D;  3B6F D;  5AV8 C;  3REJ A;  3AZH D;  4KGC C;  4WU9 C;  3MGP B;  4UUZ A;  3AV2 D;  4J8X D;  4WU8 B;  1M18 B;  3A1I A;  3LZ0 C;  3UTA D;  3AZE B;  3KUY A;  3WA9 D;  1P3A B;  4Z5T D;  4QLC A;  1W2E A;  2Y2P A;  4YS3 C;  4J8V B;  2ARO A;  5KDM B;  5E5A C;  3KXB B;  1P34 B;  5F99 A;  3AFA D;  1HTA A;  3X1S C;  1TZY D;  5B31 B;  5BS7 C;  5CPK B;  5DNN D;  3MNN A;  5B40 A;  5B0Y A;  2BYK B;  3LZ1 D;  3LJA B;  4H9N A;  3LEL A;  3AZI C;  3W97 B;  5BNX B;  3AZJ D;  2HIO C;  4WZS B;  2PYO B;  3IP4 C;  3REL A;  1P3F B;  4KGC B;  4XZQ B;  5AVB B;  1BH9 B;  4NE5 A;  3W99 B;  3KWQ C;  5B2J A;  1A7W A;  2FJ7 C;  5GSU D;  2ZY4 A;  3MGQ B;  3REI C;  2IO5 B;  3X1T C;  4XUJ A;  1KX4 D;  5B1M D;  1BH8 B;  3MGP A;  4KUD C;  1P3I C;  4WU8 A;  3VH6 A;  1M18 A;  3X1S B;  3AZE A;  2ZY3 A;  3X1V C;  3UTA C;  3AV1 D;  1P3A A;  5JRG B;  5B32 B;  4LD9 D;  2JCH A;  3AZI B;  4J8V A;  5KDM A;  3AZG C;  1P3K B;  3KXB A;  2LY8 A;  2Y2H A;  3UT9 C;  3MGS A;  1P34 A;  1AOI B;  1P3M B;  5B24 B;  2UWX A;  5GT0 D;  2XD5 A;  5B31 A;  1PZR A;  5B33 B;  3X1T B;  2BYK A;  3LJA A;  3B0C W;  3B6F B;  3W97 A;  3AZH B;  3AZF A;  2PYO A;  3NQJ B;  3A6N A;  1H3O B;  4JJN C;  3AV2 B;  1P3F A;  4J8X B;  1P3P D;  1P3B C;  4XZQ A;  3WTP C;  5AVB A;  3UTA B;  3AZL D;  3TU4 C;  5B2I D;  3AZN C;  3W99 A;  3WA9 B;  2VQR A;  4Z5T B;  4Z2M G;  5C3I C;  5DNM C;  3MGQ A;  1U35 C;  3X1U C;  3AZK D;  2F8N H;  5B1L C;  1KX4 C;  1BH8 A;  2RVQ D;  3AFA B;  3AZM D;  1TZY B;  5CPJ D;  4H9R A;  3AV1 C;  5DNN B;  5JRG A;  5B32 A;  3VH6 W;  5AV6 C;  3LZ1 B;  2NQB D;  4H9P A;  2HUE B;  1P3K A;  1ZLA C;  3AZJ B;  1S32 D;  1EQZ C;  4AWL C;  5CP6 D;  4M6B A;  1AOI A;  2YFW B;  5AVC C;  4J8W C;  1P3M A;  5B24 A;  5AV5 C;  3MGR A;  5GSU B;  5B33 A;  3W98 A;  5AV8 D;  3REJ C;  4WV4 B;  4KGC D;  4WU9 D;  3C1B C;  1KX4 B;  3B6F A;  3AZH A;  5B1M B;  3LZ0 D;  3NQJ A;  1H3O A;  3REK A;  3AV2 A;  4J8X A;  3FDD A;  4ZUX C;  1P3O C;  3AV1 B;  3WA9 A;  4Z5T A;  4YS3 D;  5AV6 B;  5E5A D;  4LD9 B;  1TAF B;  5B0Z C;  4AWL B;  3AZK C;  3WKJ C;  3AFA A;  4NE3 A;  4NFT A;  5GT0 B;  3AZM C;  1TZY A;  5B40 C;  3EPJ A;  5DNN A;  3KSY A;  2CV5 C;  2F2A C;  3LZ1 A;  1F66 D;  2HIO D;  3VH6 T;  3AZJ A;  1P3G D;  1P3P B;  1S32 C;  2YFV B;  1F66 B;  3KWQ D;  3AZL B;  4UPK A;  5B2I B;  2FJ7 D;  4X23 C;  3REI D;  5GSU A;  4KUD D;  5JA4 B;  3AZK B;  1P3I D;  5B1M A;  3B0B A;  4WNN B;  3X1V D;  3MVD C;  4G91 B;  3AZM B;  3VH5 W;  5CPJ B;  1KX5 A;  3NQU B;  3C1C C;  2F8N D;  3AZG D;  4LD9 A;  4Z66 C;  2NQB B;  1TAF A;  4H9Q B;  3UT9 D;  1S32 B;  2RIQ A;  4ZBJ C;  5CP6 B;  3WAA C;  5GT0 A;  2XD1 A;  2ZY2 A;  1KX3 C;  5AV8 B;  4WU9 B;  4JJN D;  1P3B D;  3WTP D;  3LZ0 B;  1P3G C;  3TU4 D;  1P3P A;  2YFV A;  3AZN D;  3AN2 C;  1F66 A;  3AYW C;  3AZL A;  1T3U A;  5B2I A;  1M1A C;  3W96 A;  2L5A A;  5DNM D;  4YS3 B;  1WWS A;  1U35 D;  3X1U D;  1ID3 A;  5E5A B;  4J8U D;  5B1L D;  2NZD C;  5JA4 A;  4ZBJ B;  4WNN A;  5AY8 C;  1Z2C B;  5G49 B;  5CPI C;  3WTP E;  1JFI B;  2Y2Q A;  5CPJ A;  5AV6 D;  3NQU A;  4YM6 C; 
#chains in the Genus database with same CATH homology
 1ZLA D;  2NQB A;  2HIO B;  4H9Q A;  1EQZ D;  1P3G B;  5AVC D;  4J8W D;  5B31 G;  1P3L C;  5CP6 A;  5AV5 D;  3KWQ B;  1M1A B;  2FJ7 B;  5CPK A;  5BO0 B;  3REI B;  3REJ D;  3C1B D;  5AV8 A;  4KGC A;  2NZD B;  4WU9 A;  5BNX A;  4Z2M H;  4KUD B;  1P3I B;  3EPL A;  4ZUX D;  3B0D C;  3LZ0 A;  1P3O D;  2Y2N A;  3X1V B;  1BH9 A;  5AV9 C;  3REH C;  4H9S C;  3R45 B;  4YS3 A;  5B0Z D;  2F8N B;  5E5A A;  3AZG B;  4J8U C;  1M19 C;  4R8P C;  3UT9 B;  3WKJ D;  3A1K A;  3X1S A;  5G49 A;  5B32 G;  5B40 D;  5BS7 A;  1JFI A;  2CV5 D;  5GT3 C;  1HQ3 C;  1R4V A;  2Y2J A;  1BFM A;  3O62 C;  3AZI A;  2HIO A;  3UTB C;  4JJN B;  1P3B B;  3WTP B;  3TU4 B;  3AZN B;  3KWQ A;  1KU5 A;  4X23 D;  5C3I B;  2FJ7 A;  5GXQ C;  5BO0 A;  4XUJ D;  3B6G C;  5DNM B;  3REI A;  1U35 B;  2BYM B;  3X1U B;  3X1T A;  4J8U B;  3VH5 A;  4H9O B;  2J8P A;  4NE6 A;  5B1L B;  3V9R B;  3B0C T;  4KUD A;  1P3I A;  3MVD D;  1N1J B;  3X1V A;  3KUY C;  3UTA A;  2DQN C;  4QLC C;  4CSR B;  3R45 A;  3C1C D;  4Z66 D;  2ARO C;  2G5H C;  1B6W A;  2F8N A;  3AZG A;  1ZLA B;  3UTB B;  3MGS D;  1EQZ B;  3UT9 A;  1ULY A;  5F99 C;  3WAA D;  5AVC B;  4J8W B;  5BNV B;  5AV5 B;  4HGA C;  3MNN C;  1KX3 D;  5B0Y C;  3REJ B;  3LEL C;  5CHL B;  3AZF D;  3A6N D;  3F6T A;  3EPK A;  4UUZ B;  3C1B B;  3REL C;  4JJN A;  2DF4 C;  4EO5 C;  3AN2 D;  1P3B A;  3AYW D;  4ZUX B;  3WTP A;  3KUY B;  2Y2M A;  3TU4 A;  1P3O B;  2YFW A;  3AZN A;  5B2J C;  1M1A D;  1WWI A;  5DNM A;  1U35 A;  4XUJ C;  5B0Z B;  3X1U A;  2F8N K;  4H9O A;  2NZD D;  5B1L A;  3MGP C;  1KX4 A;  3V9R A;  3WKJ B;  4WU8 C;  5AY8 D;  1M18 C;  3AZE C;  1N1J A;  2Y2K A;  5CPI D;  4HGA B;  1P3A C;  5B40 B;  3KFU G;  3AV1 A;  4YM6 D;  2CV5 B;  5AV6 A;  4J8V C;  5BT1 C;  3KXB C;  2BG1 A;  1EQZ A;  3MGS C;  1P34 C;  1P3L D;  3EG5 B;  5AVC A;  4J8W A;  5BNV A;  3MGR D;  5AV5 A;  5B31 C;  4X23 B;  3H0M C;  4XUJ B;  3LJA C;  4CAY B;  2CWE A;  3W97 C;  3C1B A;  3REK D;  3AZF C;  3A6N C;  2PYO C;  1P3F C;  5FUG B;  4XZQ C;  5AVB C;  3MVD B;  4ZUX A;  5AV9 D;  1P3O A;  3REH D;  3W99 C;  3C1C B;  3MGQ C;  2IO5 C;  2JSS A;  4Z66 B;  1M19 D;  5B0Z A;  4R8P D;  3MGS B;  3AZK A;  2W8S A;  3WKJ A;  3WAA B;  3AZM A;  5GT3 D;  1HQ3 D;  4DRA A;  5JRG C;  1KX3 B;  2JE5 A;  3VH5 T;  5B32 C;  2CV5 A;  3O62 D;  4G92 C;  1P3K C;  3UTB D;  3AZF B;  3A6N B;  2ZY5 A;  1AOI C;  1S32 A;  3AN2 B;  1Q9C A;  3AYW B;  1P3M C;  5B24 C;  3H0L C;  3MGR C;  5GXQ D;  2G5I C;  3B6G D;  4KHA B;  4X23 A;  5B33 C;  4DQY B;  3W98 C;  1B67 A;  4CAY A;  3B6F C;  3AZH C;  3REK C;  5FUG A;  4J8X C;  3AV2 C;  5AY8 B;  3KUY D;  3MVD A;  5CPI B;  4H9R B;  4QLC D;  3WA9 C;  1KX5 D;  4Z5T C;  2ARO D;  4H9P B;  4YM6 B;  3C1C A;  4G92 B;  4Z66 A;  5F99 D;  1P3L B;  3AFA C;  3WAA A;  3MGR B;  3MNN D;  1TZY C;  3P5J B;  5B0Y D;  5DNN C;  1KX3 A;  3W98 B;  3LEL D;  3LZ1 C;  2HUE C;  3REL D;  2Y2L A;  3AZJ C;  3REK B;  3B0D B;  1P3G A;  4E44 A;  3AN2 A;  3AYW A;  2ZM5 A;  5B2J D;  5AV9 B;  3REH B;  3W96 D;  1M1A A;  4E45 A;  1ID3 D;  4KHA A;  5GSU C;  1M19 B;  3MGP D;  4R8P B;  4WU8 D;  5B1M C;  1M18 D;  2NZD A;  3AZE D;  5AY8 A;  5CPI A;  1P3A D;  2F8N G;  5GT3 B;  1HQ3 B;  1KX5 C;  4J8V D;  4YM6 A;  5BT1 D;  4LD9 C;  3O62 B;  3KXB D;  1P34 D;  1F1E A;  1P3L A;  5B31 D;  5CPK D;  2FFF B;  5GT0 C;  5GXQ B;  3B6G B;  3LJA D;  4DRB A;  3W97 D;  2PYO D;  1P3F D;  4XZQ D;  5AVB D;  1P3P C;  1F66 C;  3W99 D;  3AZL C;  5B2I C;  5AV9 A;  3REH A;  4QLC B;  4H9S A;  1KX5 B;  3W96 C;  3MGQ D;  2ARO B;  1ID3 C;  2BYM A;  4WJ3 C;  4J8U A;  1M19 A;  2Y2I A;  4R8P A;  5F99 B;  2Y2G A;  3X1S D;  2RVQ C;  4G91 C;  3MNN B;  5JRG D;  5B0Y B;  5CPJ C;  5B32 D;  5GT3 A;  1HQ3 A;  4CSR A;  3AZI D;  3H0R C;  3AL0 C;  1P3K D;  4H9N B;  3LEL B;  2NQB C;  3O62 A;  3REL B;  1ZLA A;  3UTB A;  4EO5 B;  1AOI D;  1P3M D;  5B24 D;  5CP6 C;  5B2J B;  3W96 B;  3EPH A;  5CPK C;  2Y2O A;  5B33 D;  5GXQ A;  3X1T D;  1ID3 B;  3B6G A;  3W98 D;  3B6F D;  5AV8 C;  3REJ A;  3AZH D;  4KGC C;  4WU9 C;  3MGP B;  4UUZ A;  3AV2 D;  4J8X D;  4WU8 B;  1M18 B;  3A1I A;  3LZ0 C;  3UTA D;  3AZE B;  3KUY A;  3WA9 D;  1P3A B;  4Z5T D;  4QLC A;  1W2E A;  2Y2P A;  4YS3 C;  4J8V B;  2ARO A;  5KDM B;  5E5A C;  3KXB B;  1P34 B;  5F99 A;  3AFA D;  1HTA A;  3X1S C;  1TZY D;  5B31 B;  5BS7 C;  5CPK B;  5DNN D;  3MNN A;  5B40 A;  5B0Y A;  2BYK B;  3LZ1 D;  3LJA B;  4H9N A;  3LEL A;  3AZI C;  3W97 B;  5BNX B;  3AZJ D;  2HIO C;  4WZS B;  2PYO B;  3IP4 C;  3REL A;  1P3F B;  4KGC B;  4XZQ B;  5AVB B;  1BH9 B;  4NE5 A;  3W99 B;  3KWQ C;  5B2J A;  1A7W A;  2FJ7 C;  5GSU D;  2ZY4 A;  3MGQ B;  3REI C;  2IO5 B;  3X1T C;  4XUJ A;  1KX4 D;  5B1M D;  1BH8 B;  3MGP A;  4KUD C;  1P3I C;  4WU8 A;  3VH6 A;  1M18 A;  3X1S B;  3AZE A;  2ZY3 A;  3X1V C;  3UTA C;  3AV1 D;  1P3A A;  5JRG B;  5B32 B;  4LD9 D;  2JCH A;  3AZI B;  4J8V A;  5KDM A;  3AZG C;  1P3K B;  3KXB A;  2LY8 A;  2Y2H A;  3UT9 C;  3MGS A;  1P34 A;  1AOI B;  1P3M B;  5B24 B;  2UWX A;  5GT0 D;  2XD5 A;  5B31 A;  1PZR A;  5B33 B;  3X1T B;  2BYK A;  3LJA A;  3B0C W;  3B6F B;  3W97 A;  3AZH B;  3AZF A;  2PYO A;  3NQJ B;  3A6N A;  1H3O B;  4JJN C;  3AV2 B;  1P3F A;  4J8X B;  1P3P D;  1P3B C;  4XZQ A;  3WTP C;  5AVB A;  3UTA B;  3AZL D;  3TU4 C;  5B2I D;  3AZN C;  3W99 A;  3WA9 B;  2VQR A;  4Z5T B;  4Z2M G;  5C3I C;  5DNM C;  3MGQ A;  1U35 C;  3X1U C;  3AZK D;  2F8N H;  5B1L C;  1KX4 C;  1BH8 A;  2RVQ D;  3AFA B;  3AZM D;  1TZY B;  5CPJ D;  4H9R A;  3AV1 C;  5DNN B;  5JRG A;  5B32 A;  3VH6 W;  5AV6 C;  3LZ1 B;  2NQB D;  4H9P A;  2HUE B;  1P3K A;  1ZLA C;  3AZJ B;  1S32 D;  1EQZ C;  4AWL C;  5CP6 D;  4M6B A;  1AOI A;  2YFW B;  5AVC C;  4J8W C;  1P3M A;  5B24 A;  5AV5 C;  3MGR A;  5GSU B;  5B33 A;  3W98 A;  5AV8 D;  3REJ C;  4WV4 B;  4KGC D;  4WU9 D;  3C1B C;  1KX4 B;  3B6F A;  3AZH A;  5B1M B;  3LZ0 D;  3NQJ A;  1H3O A;  3REK A;  3AV2 A;  4J8X A;  3FDD A;  4ZUX C;  1P3O C;  3AV1 B;  3WA9 A;  4Z5T A;  4YS3 D;  5AV6 B;  5E5A D;  4LD9 B;  1TAF B;  5B0Z C;  4AWL B;  3AZK C;  3WKJ C;  3AFA A;  4NE3 A;  4NFT A;  5GT0 B;  3AZM C;  1TZY A;  5B40 C;  3EPJ A;  5DNN A;  3KSY A;  2CV5 C;  2F2A C;  3LZ1 A;  1F66 D;  2HIO D;  3VH6 T;  3AZJ A;  1P3G D;  1P3P B;  1S32 C;  2YFV B;  1F66 B;  3KWQ D;  3AZL B;  4UPK A;  5B2I B;  2FJ7 D;  4X23 C;  3REI D;  5GSU A;  4KUD D;  5JA4 B;  3AZK B;  1P3I D;  5B1M A;  3B0B A;  4WNN B;  3X1V D;  3MVD C;  4G91 B;  3AZM B;  3VH5 W;  5CPJ B;  1KX5 A;  3NQU B;  3C1C C;  2F8N D;  3AZG D;  4LD9 A;  4Z66 C;  2NQB B;  1TAF A;  4H9Q B;  3UT9 D;  1S32 B;  2RIQ A;  4ZBJ C;  5CP6 B;  3WAA C;  5GT0 A;  2XD1 A;  2ZY2 A;  1KX3 C;  5AV8 B;  4WU9 B;  4JJN D;  1P3B D;  3WTP D;  3LZ0 B;  1P3G C;  3TU4 D;  1P3P A;  2YFV A;  3AZN D;  3AN2 C;  1F66 A;  3AYW C;  3AZL A;  1T3U A;  5B2I A;  1M1A C;  3W96 A;  2L5A A;  5DNM D;  4YS3 B;  1WWS A;  1U35 D;  3X1U D;  1ID3 A;  5E5A B;  4J8U D;  5B1L D;  2NZD C;  5JA4 A;  4ZBJ B;  4WNN A;  5AY8 C;  1Z2C B;  5G49 B;  5CPI C;  3WTP E;  1JFI B;  2Y2Q A;  5CPJ A;  5AV6 D;  3NQU A;  4YM6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...