3X1UD

Crystal structure of nucleosome core particle in the presence of histone variants involved in reprogramming
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords DNA (146-MER)
total genus 30
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1uD00
3REHB 4QLCB 4AWLC 1P3AB 3KWQC 4WNNA 3AFAC 5B2JB 3AN2C 5CPIA 5B0YB 5F99D 3AYWC 5KDMB 5GT0C 3AV2D 2NZDB 3MGSC 3R45A 2LY8A 4KHAB 5AV8C 3X1VD 3REHD 3W96C 5B0YA 1P3OD 5B1LB 5CPIB 4H9SC 5GXQA 5B31G 5AV5C 4R8PA 3MVDC 3VH5W 4ZUXC 5CP6C 4LD9D 5GT0A 5GXQD 4QLCA 3MGPB 3REHA 2PYOB 1BH8B 3X1VA 1KX4A 3AZNA 5B1MB 5AV6C 1Q9CA 3B6GB 3LJAA 3UT9D 3AZFD 3LZ1D 4DRAA 3W96A 5B0YC 3C1CD 4NE6A 4Z5TD 3AV2A 1P3BB 3WKJB 5JRGD 1P3OB 3WTPC 3AZMB 3LELD 2NQBD 5B0ZB 4H9NA 1P3MA 1N1JA 1KX4C 1R4VA 1P3BC 3MGRD 3UT9A 3AZFA 2FJ7D 4J8XB 3KXBD 4HGAB 3W99B 4J8XA 4Z66B 3UT9B 3AZFB 5B1LD 4E44A 4QLCD 3AZLC 2PYOC 5FUGA 4YS3B 4J8WD 3MGPC 1P3MB 4H9NB 5B33C 3MNNC 3MGPD 3AZMA 1P3OA 4KUDC 4KGCC 1ULYA 1P3BA 1AOIC 3AZKB 5DNND 3LJAB 3AZEC 3B6FA 3TU4C 5B24C 3AZNB 4Z5TB 4Z66D 4XUJC 1BH8A 3X1VB 2PYOA 3X1UA 3MGPA 4WU8C 5GT0B 1P3PD 1P34D 5CPKC 1HTAA 4R8PB 1HQ3A 4CSRA 3AZGC 1P3PC 1P3IC 4EO5B 5GXQB 3W97B 5B1LA 4H9RB 4H9PA 2FJ7B 2CV5C 4WU8B 3AZID 4Z66C 3B6FC 3UTBD 2AROA 4J8WA 3KUYB 3R45B 4KHAA 1P3FC 2NZDA 3NQJA 1ID3C 5GT3B 4YM6D 5KDMA 3WKJD 3AZJC 1ZLAC 1TAFA 1F66A 1AOIB 4M6BA 1HQ3C 5B2JA 2CWEA 2HUEC 5CPKA 4WNNB 1P3AA 3LZ1A 1S32C 5BS7C 4WU9C 3C1BD 5DNMC 1P3KA 5GSUC 2YFWA 3LELA 5BO0B 3RELA 3AZND 3O62D 1M19B 5B2ID 3W99D 3VH5A 4J8VD 3KUYD 3A6ND 4G91C 5B31D 3LZ0B 4UUZB 3W98B 3A6NC 1EQZA 1KU5A 4KGCB 5BNXA 1P34B 4KUDB 3WAAB 3V9RA 4G92C 4H9QA 5AVBD 1M18A 5BNVB 3B0BA 4R8PD 1A7WA 1EQZD 5DNMA 3X1TB 4YM6B 3WKJC 3RELC 5F99B 4J8UD 3REKC 5B2IA 3RELD 4XZQA 1KX3D 4WU9B 4H9SA 5GXQC 3C1BA 4ZUXD 1JFIA 5AVCA 4LD9B 3AFAB 1P3AD 3W98C 5CPID 4CAYA 5AV8D 3X1VC 3REKD 1ZLAB 1P34C 5AV6A 1F66D 3A6NB 3TU4A 3X1TD 5B31B 3LZ0D 3AYWA 4XUJD 5JRGB 2HIOB 5C3IC 3B0DB 5AVBC 3UTBA 2NQBB 3O62B 1TZYC 3REJC 5GSUD 1H3OB 3AFAD 4KGCD 4KUDD 2IO5B 3KXBB 1KX3A 1P3FB 2JSSA 5E5AA 3LZ0C 1U35D 4J8UA 2PYOD 2F8NG 1P3LA 2F8NB 5DNMD 4WU9D 4H9OA 1P3GB 3AV1B 5DNNA 4JJNA 3KXBC 5GSUB 1P3BD 2FJ7C 2RVQC 2CV5D 5G49A 1WWSA 1S32A 3KWQA 2HIOC 2BYMB 3KSYA 3MGQC 1M1AB 2NQBC 3X1SA 1P3FD 3WTPD 1ID3B 3UTAA 5AY8D 4DRBA 4XUJB 5B24A 4HGAC 2F8ND 5AV8B 1P3LC 3UT9C 3AZFC 5CPJB 2F8NH 3B0CW 3MGRA 4X23A 1P3ID 5DNNC 3W97D 3AZGD 3MGQD 4X23D 2IO5C 1P3IA 3NQUB 2HIOD 2CV5B 2L5AA 3AZLA 3REIA 5CP6D 3AZIB 4WU8D 3WA9B 1U35B 3VH6W 5B33A 5B40A 3KUYC 4J8VC 3MGQA 3AZHA 1TZYB 3O62C 3C1CA 3REJB 3AZNC 3VH5T 5GT3C 3MGSB 3W96D 4NFTA 1KX5B 1AOID 3AZJA 4WV4B 1S32D 3AZEA 1U35C 1BH9A 5AY8A 3B0CT 3WTPA 5GT0D 3MNNB 1P3PB 5B0ZC 1P3PA 5CP6B 3WA9D 3X1UD 3REIC 1ID3D 1M19D 1BH9B 5JRGC 3AZEB 4Z5TC 1WWIA 3AZJB 3B6FD 5CPJD 1P3GD 1KX5A 5AY8C 4NE3A 1TZYA 3REJA 3MGQB 5B33B 4J8VB 1U35A 3AN2A 3AZMD 5CPIC 3W98D 1M1AC 3WA9A 2YFVA 1M18C 3WAAD 3LZ1C 3MVDD 5E5AC 5B2JC 3TU4D 4X23B 4J8XD 3AZED 5AVBB 3REKA 2BYKB 4WZSB 5AV8A 4G91B 5B24B 4XUJA 4NE5A 5B32B 5AV9A 3MGSD 4R8PC 3MVDA 3AZGB 3MNND 5B33D 1M1AA 4ZUXA 5JA4A 3KWQB 4G92B 1S32B 5AV5B 5AV5A 3REHC 5G49B 5JA4B 5B1LC 3AN2D 4ZUXB 3X1SC 3MVDB 3AZGA 1TZYD 3REJD 5AV9B 5B32A 5DNNB 3LJAD 3AV1A 1P3GA 2BYKA 1B6WA 3REKB 5AVBA 2F8NA 1KX4D 3W99C 5B2IC 5B1MC 4J8UB 1BFMA 5E5AB 1F66C 1P3FA 5AV9C 2YFVB 1P3AC 3AN2B 4J8VA 3O62A 1ZLAD 3AZJD 5B32C 5C3IB 4YM6C 3AV1C 3AV1D 3AYWB 5B32D 5B31A 4JJNC 3TU4B 4J8XC 3A6NA 1EQZC 3B6GC 3UTBC 5B2JD 5E5AD 3AZIC 5AV5D 3VH6T 4CAYB 5CP6A 3MNNA 1M1AD 3WTPB 3AFAA 3AZMC 5AVCB 5CPKD 1JFIB 5AY8B 3C1BB 5BT1C 5B1MD 4XZQB 5B31C 5CPJC 3B0DC 5B24D 3AV2C 5F99C 4YM6A 3AYWD 3MGSA 3LJAC 3X1TA 3C1CB 3AZHB 5B40B 3C1BC 3WA9C 5BNVA 4XZQC 3REIB 3AZIA 5B0ZD 3AZLB 2CV5A 3NQUA 1P3IB 3V9RB 2AROC 1B67A 5AVCD 3AZHC 3WAAA 1HQ3D 3MGRB 1P34A 5CPJA 1EQZB 4UUZA 3W98A 4E45A 5CHLB 1M19A 3UTAB 1ID3A 3LELB 3X1SB 1P3KB 4YS3D 1KX5D 3MGRC 2BYMA 3LZ1B 1M18D 5BT1D 5CPKB 5BS7A 2HUEB 5GSUA 4EO5C 3W97C 3LELC 4ZBJC 3AZKD 5B32G 1AOIA 4JJNB 3VH6A 1F66B 1TAFB 4H9OB 5GT3A 3NQJB 1KX5C 1P3LB 3KUYA 5B40D 4J8WB 1P3MD 2AROB 5AV6D 1M19C 1KX3B 4ZBJB 4WU8A 3X1UC 3WTPE 3KXBA 3REID 2FJ7A 4H9PB 4H9RA 4LD9C 3W97A 3AZHD 2RVQD 1HQ3B 4CSRB 1H3OA 4J8WC 2NQBA 4Z2MG 3X1UB 4XZQD 4QLCC 4AWLB 3UTBB 3AZLD 3UTAC 2HIOA 5JRGA 4Z5TA 3UTAD 1F1EA 5GT3D 3B6FB 5AVCC 2AROD 5AV6B 1ZLAA 3AZKA 4X23C 3X1SD 4LD9A 1P3MC 3KWQD 5FUGB 4WU9A 4YS3A 5B40C 5B0YD 3C1CC 1P3LD 5B2IB 5F99A 4Z66A 3W99A 3X1TC 4Z2MH 5DNMB 3AZKC 4JJND 1P3KD 2NZDC 1M18B 4H9QB 1N1JB 5B0ZA 4YS3C 3WAAC 3B6GD 1P3OC 4KUDA 5BNXB 3AV2B 3WKJA 1KX3C 4KGCA 3W96B 3LZ0A 5AV9D 2NZDD 4J8UC 1P3KC 2F8NK 5BO0A 3RELB 3B6GA 2YFWB 5B1MA 1P3GC 1KX4B
chains in the Genus database with same CATH superfamily
3REHB 4QLCB 4AWLC 1P3AB 3KWQC 4WNNA 3AFAC 5B2JB 3AN2C 5CPIA 5B0YB 5F99D 3AYWC 5KDMB 5GT0C 3AV2D 2NZDB 3MGSC 3R45A 2DQNC 2LY8A 4KHAB 5AV8C 3X1VD 3REHD 3W96C 5B0YA 1P3OD 5B1LB 5CPIB 4H9SC 5GXQA 5B31G 5AV5C 4R8PA 3MVDC 3VH5W 4ZUXC 5CP6C 4LD9D 5GT0A 5GXQD 4QLCA 3MGPB 3REHA 2PYOB 1BH8B 3X1VA 1KX4A 3AZNA 5B1MB 5AV6C 1Q9CA 3B6GB 3LJAA 3UT9D 3AZFD 2XD5A 3LZ1D 4DRAA 3W96A 5B0YC 3C1CD 4NE6A 4Z5TD 3AV2A 1P3BB 3WKJB 5JRGD 1P3OB 3WTPC 3AZMB 3LELD 2NQBD 5B0ZB 4H9NA 1P3MA 2FFFB 1N1JA 2Y2PA 1KX4C 2ZY3A 1R4VA 3IP4C 3MGRD 3UT9A 3AZFA 1P3BC 2FJ7D 4J8XB 3KXBD 4HGAB 3W99B 4J8XA 4Z66B 3UT9B 3AZFB 5B1LD 4E44A 4QLCD 3AZLC 2JCHA 2PYOC 5FUGA 4YS3B 2BG1A 4J8WD 3MGPC 1P3MB 4H9NB 5B33C 3MNNC 3MGPD 3AZMA 1P3OA 4KUDC 4KGCC 1ULYA 1P3BA 1T3UA 1AOIC 3AZKB 5DNND 3LJAB 3AZEC 3B6FA 3TU4C 5B24C 3AZNB 4Z5TB 4Z66D 4XUJC 1BH8A 3X1VB 2PYOA 3X1UA 3MGPA 4WU8C 5GT0B 2UWXA 1P3PD 1P34D 5CPKC 1HTAA 4R8PB 1HQ3A 4CSRA 3AZGC 1P3PC 1P3IC 4EO5B 5GXQB 3W97B 5B1LA 4H9RB 4H9PA 2FJ7B 2CV5C 4WU8B 3AZID 4Z66C 3B6FC 3UTBD 2AROA 2Y2JA 4J8WA 3KUYB 3R45B 4KHAA 1P3FC 2NZDA 3NQJA 1ID3C 5GT3B 2Y2OA 4YM6D 5KDMA 3WKJD 3AZJC 1ZLAC 1TAFA 1F66A 1AOIB 4M6BA 1HQ3C 5B2JA 2CWEA 2HUEC 5CPKA 4WNNB 1P3AA 3LZ1A 1S32C 5BS7C 4WU9C 3C1BD 5DNMC 1P3KA 5GSUC 2YFWA 3LELA 5BO0B 3RELA 3AZND 3O62D 1M19B 5B2ID 3W99D 3VH5A 4J8VD 3KUYD 3A6ND 4G91C 5B31D 3LZ0B 4UUZB 3W98B 3A6NC 1EQZA 1KU5A 4KGCB 5BNXA 1P34B 4KUDB 3WAAB 3V9RA 4G92C 4H9QA 5AVBD 1M18A 5BNVB 3B0BA 4R8PD 1A7WA 1EQZD 5DNMA 3X1TB 4YM6B 3WKJC 3RELC 5F99B 4J8UD 3REKC 5B2IA 3RELD 4XZQA 1KX3D 2Y2QA 4WU9B 4H9SA 5GXQC 3C1BA 4ZUXD 1JFIA 5AVCA 4LD9B 3AFAB 1P3AD 3W98C 5CPID 1Z2CB 4CAYA 5AV8D 3X1VC 2ZY5A 3REKD 1P34C 5AV6A 1ZLAB 1F66D 3A6NB 3TU4A 3X1TD 5B31B 3LZ0D 3AYWA 4XUJD 2Y2GA 5JRGB 2HIOB 5C3IC 3B0DB 5AVBC 3UTBA 2NQBB 1TZYC 3O62B 2DF4C 3REJC 5GSUD 1H3OB 3KFUG 3AFAD 4KGCD 4KUDD 2IO5B 3KXBB 1KX3A 1P3FB 2JSSA 5E5AA 3LZ0C 1U35D 4J8UA 2PYOD 2F8NG 1P3LA 2F8NB 5DNMD 3EPLA 4WU9D 4H9OA 1P3GB 3AV1B 5DNNA 4JJNA 3KXBC 5GSUB 1P3BD 2FJ7C 2RVQC 2CV5D 5G49A 1WWSA 1S32A 3KWQA 2HIOC 2BYMB 3KSYA 3MGQC 1M1AB 2NQBC 3X1SA 3EPKA 3WTPD 1P3FD 2Y2IA 1ID3B 3UTAA 2G5IC 5AY8D 4DRBA 4XUJB 5B24A 4HGAC 2F8ND 5AV8B 1P3LC 3UT9C 3AZFC 5CPJB 2F8NH 3B0CW 3MGRA 4X23A 1P3ID 5DNNC 3W97D 3AZGD 3MGQD 4X23D 2IO5C 1P3IA 3NQUB 2HIOD 2CV5B 2L5AA 3AZLA 3REIA 5CP6D 3AZIB 4WU8D 3WA9B 1U35B 4DQYB 3VH6W 5B33A 5B40A 3KUYC 4J8VC 3MGQA 3AZHA 1TZYB 3O62C 3C1CA 3REJB 3AZNC 3VH5T 5GT3C 3MGSB 3W96D 4NFTA 1KX5B 2J8PA 3AZJA 1AOID 4WV4B 1S32D 3AZEA 1U35C 1BH9A 5AY8A 3B0CT 2Y2HA 3WTPA 5GT0D 3H0RC 3MNNB 1P3PB 5B0ZC 1P3PA 5CP6B 3WA9D 3X1UD 3REIC 1ID3D 1M19D 1BH9B 5JRGC 3AZEB 4Z5TC 1WWIA 3AZJB 3B6FD 5CPJD 1P3GD 1KX5A 5AY8C 4NE3A 1TZYA 3REJA 3MGQB 5B33B 4J8VB 1U35A 3AN2A 3AZMD 5CPIC 3W98D 1M1AC 3H0MC 3WA9A 2YFVA 1M18C 2XD1A 4UPKA 3WAAD 2W8SA 3LZ1C 3MVDD 5E5AC 5B2JC 3TU4D 4X23B 4J8XD 3AZED 5AVBB 3REKA 2BYKB 4WZSB 5AV8A 4G91B 5B24B 4XUJA 4NE5A 5B32B 5AV9A 3MGSD 4R8PC 3MVDA 3AZGB 3MNND 5B33D 1M1AA 3A1IA 4ZUXA 5JA4A 3KWQB 4G92B 1S32B 5AV5B 5AV5A 3REHC 5G49B 1PZRA 5JA4B 5B1LC 3AN2D 4ZUXB 3X1SC 3MVDB 3AZGA 1TZYD 3REJD 5AV9B 5B32A 5DNNB 3LJAD 3AV1A 1P3GA 4WJ3C 2BYKA 1B6WA 3REKB 5AVBA 2F8NA 1KX4D 3W99C 5B2IC 5B1MC 4J8UB 1BFMA 5E5AB 1F66C 1P3FA 5AV9C 2YFVB 1P3AC 3AN2B 4J8VA 3O62A 1ZLAD 3AZJD 5B32C 5C3IB 4YM6C 3AV1C 3AV1D 3AYWB 5B32D 5B31A 4JJNC 3TU4B 4J8XC 3A6NA 1EQZC 3B6GC 3UTBC 5B2JD 5E5AD 3AZIC 5AV5D 3VH6T 4CAYB 5CP6A 3EPJA 3MNNA 1M1AD 3WTPB 3AFAA 3AZMC 5AVCB 5CPKD 1JFIB 5AY8B 3EG5B 3C1BB 5BT1C 5B1MD 4XZQB 5B31C 5CPJC 3B0DC 5B24D 2Y2KA 3AV2C 5F99C 3F6TA 4YM6A 3MGSA 3AYWD 3LJAC 3X1TA 3C1CB 3AZHB 5B40B 3C1BC 3WA9C 5BNVA 4XZQC 3REIB 3AZIA 1W2EA 5B0ZD 3AZLB 2CV5A 3NQUA 1P3IB 3V9RB 2AROC 1B67A 5AVCD 2JE5A 3AZHC 1HQ3D 3WAAA 3MGRB 1P34A 5CPJA 1EQZB 4UUZA 3W98A 2F2AC 4E45A 5CHLB 1M19A 3UTAB 1ID3A 3LELB 3X1SB 1P3KB 4YS3D 1KX5D 3MGRC 2BYMA 3LZ1B 1M18D 5BT1D 5CPKB 5BS7A 2HUEB 3FDDA 5GSUA 4EO5C 3W97C 3LELC 3AL0C 4ZBJC 3AZKD 5B32G 1AOIA 4JJNB 3VH6A 1F66B 1TAFB 4H9OB 5GT3A 3NQJB 1KX5C 1P3LB 3KUYA 5B40D 3EPHA 4J8WB 1P3MD 2AROB 5AV6D 1M19C 3H0LC 1KX3B 4ZBJB 4WU8A 3X1UC 3WTPE 3KXBA 3REID 2FJ7A 4H9PB 4H9RA 4LD9C 3W97A 3AZHD 2RVQD 1HQ3B 4CSRB 1H3OA 2G5HC 4J8WC 3A1KA 2NQBA 4Z2MG 3X1UB 4XZQD 4QLCC 4AWLB 3UTBB 3AZLD 3UTAC 2HIOA 5JRGA 2ZY4A 4Z5TA 3UTAD 1F1EA 5GT3D 3B6FB 5AVCC 2AROD 5AV6B 1ZLAA 3AZKA 2Y2NA 4X23C 3X1SD 4LD9A 3P5JB 1P3MC 3KWQD 5FUGB 4WU9A 4YS3A 5B40C 2VQRA 5B0YD 3C1CC 1P3LD 5B2IB 5F99A 4Z66A 3W99A 3X1TC 4Z2MH 5DNMB 3AZKC 4JJND 1P3KD 2ZY2A 2NZDC 1M18B 4H9QB 1N1JB 2Y2LA 2ZM5A 5B0ZA 2Y2MA 4YS3C 3WAAC 3B6GD 2RIQA 1P3OC 4KUDA 5BNXB 3AV2B 3WKJA 1KX3C 4KGCA 3W96B 3LZ0A 5AV9D 2NZDD 4J8UC 1P3KC 2F8NK 5BO0A 3RELB 3B6GA 2YFWB 5B1MA 1P3GC 1KX4B
chains in the Genus database with same CATH topology
3REHB 4QLCB 4AWLC 1P3AB 3KWQC 4WNNA 3AFAC 5B2JB 3AN2C 5CPIA 5B0YB 5F99D 3AYWC 5KDMB 5GT0C 3AV2D 2NZDB 3MGSC 3R45A 2DQNC 2LY8A 4KHAB 5AV8C 3X1VD 3REHD 3W96C 5B0YA 1P3OD 5B1LB 5CPIB 4H9SC 5GXQA 5B31G 5AV5C 4R8PA 3MVDC 3VH5W 4ZUXC 5CP6C 4LD9D 5GT0A 5GXQD 4QLCA 3MGPB 3REHA 2PYOB 1BH8B 3X1VA 1KX4A 3AZNA 5B1MB 5AV6C 1Q9CA 3B6GB 3LJAA 3UT9D 3AZFD 2XD5A 3LZ1D 4DRAA 3W96A 5B0YC 3C1CD 4NE6A 4Z5TD 3AV2A 1P3BB 3WKJB 5JRGD 1P3OB 3WTPC 3AZMB 3LELD 2NQBD 5B0ZB 4H9NA 1P3MA 2FFFB 1N1JA 2Y2PA 1KX4C 2ZY3A 1R4VA 3IP4C 3MGRD 3UT9A 3AZFA 1P3BC 2FJ7D 4J8XB 3KXBD 4HGAB 3W99B 4J8XA 4Z66B 3UT9B 3AZFB 5B1LD 4E44A 4QLCD 3AZLC 2JCHA 2PYOC 5FUGA 4YS3B 2BG1A 4J8WD 3MGPC 1P3MB 4H9NB 5B33C 3MNNC 3MGPD 3AZMA 1P3OA 4KUDC 4KGCC 1ULYA 1P3BA 1T3UA 1AOIC 3AZKB 5DNND 3LJAB 3AZEC 3B6FA 3TU4C 5B24C 3AZNB 4Z5TB 4Z66D 4XUJC 1BH8A 3X1VB 2PYOA 3X1UA 3MGPA 4WU8C 5GT0B 2UWXA 1P3PD 1P34D 5CPKC 1HTAA 4R8PB 1HQ3A 4CSRA 3AZGC 1P3PC 1P3IC 4EO5B 5GXQB 3W97B 5B1LA 4H9RB 4H9PA 2FJ7B 2CV5C 4WU8B 3AZID 4Z66C 3B6FC 3UTBD 2AROA 2Y2JA 4J8WA 3KUYB 3R45B 4KHAA 1P3FC 2NZDA 3NQJA 1ID3C 5GT3B 2Y2OA 4YM6D 5KDMA 3WKJD 3AZJC 1ZLAC 1TAFA 1F66A 1AOIB 4M6BA 1HQ3C 5B2JA 2CWEA 2HUEC 5CPKA 4WNNB 1P3AA 3LZ1A 1S32C 5BS7C 4WU9C 3C1BD 5DNMC 1P3KA 5GSUC 2YFWA 3LELA 5BO0B 3RELA 3AZND 3O62D 1M19B 5B2ID 3W99D 3VH5A 4J8VD 3KUYD 3A6ND 4G91C 5B31D 3LZ0B 4UUZB 3W98B 3A6NC 1EQZA 1KU5A 4KGCB 5BNXA 1P34B 4KUDB 3WAAB 3V9RA 4G92C 4H9QA 5AVBD 1M18A 5BNVB 3B0BA 4R8PD 1A7WA 1EQZD 5DNMA 3X1TB 4YM6B 3WKJC 3RELC 5F99B 4J8UD 3REKC 5B2IA 3RELD 4XZQA 1KX3D 2Y2QA 4WU9B 4H9SA 5GXQC 3C1BA 4ZUXD 1JFIA 5AVCA 4LD9B 3AFAB 1P3AD 3W98C 5CPID 1Z2CB 4CAYA 5AV8D 3X1VC 2ZY5A 3REKD 1P34C 5AV6A 1ZLAB 1F66D 3A6NB 3TU4A 3X1TD 5B31B 3LZ0D 3AYWA 4XUJD 2Y2GA 5JRGB 2HIOB 5C3IC 3B0DB 5AVBC 3UTBA 2NQBB 1TZYC 3O62B 2DF4C 3REJC 5GSUD 1H3OB 3KFUG 3AFAD 4KGCD 4KUDD 2IO5B 3KXBB 1KX3A 1P3FB 2JSSA 5E5AA 3LZ0C 1U35D 4J8UA 2PYOD 2F8NG 1P3LA 2F8NB 5DNMD 3EPLA 4WU9D 4H9OA 1P3GB 3AV1B 5DNNA 4JJNA 3KXBC 5GSUB 1P3BD 2FJ7C 2RVQC 2CV5D 5G49A 1WWSA 1S32A 3KWQA 2HIOC 2BYMB 3KSYA 3MGQC 1M1AB 2NQBC 3X1SA 3EPKA 3WTPD 1P3FD 2Y2IA 1ID3B 3UTAA 2G5IC 5AY8D 4DRBA 4XUJB 5B24A 4HGAC 2F8ND 5AV8B 1P3LC 3UT9C 3AZFC 5CPJB 2F8NH 3B0CW 3MGRA 4X23A 1P3ID 5DNNC 3W97D 3AZGD 3MGQD 4X23D 2IO5C 1P3IA 3NQUB 2HIOD 2CV5B 2L5AA 3AZLA 3REIA 5CP6D 3AZIB 4WU8D 3WA9B 1U35B 4DQYB 3VH6W 5B33A 5B40A 3KUYC 4J8VC 3MGQA 3AZHA 1TZYB 3O62C 3C1CA 3REJB 3AZNC 3VH5T 5GT3C 3MGSB 3W96D 4NFTA 1KX5B 2J8PA 3AZJA 1AOID 4WV4B 1S32D 3AZEA 1U35C 1BH9A 5AY8A 3B0CT 2Y2HA 3WTPA 5GT0D 3H0RC 3MNNB 1P3PB 5B0ZC 1P3PA 5CP6B 3WA9D 3X1UD 3REIC 1ID3D 1M19D 1BH9B 5JRGC 3AZEB 4Z5TC 1WWIA 3AZJB 3B6FD 5CPJD 1P3GD 1KX5A 5AY8C 4NE3A 1TZYA 3REJA 3MGQB 5B33B 4J8VB 1U35A 3AN2A 3AZMD 5CPIC 3W98D 1M1AC 3H0MC 3WA9A 2YFVA 1M18C 2XD1A 4UPKA 3WAAD 2W8SA 3LZ1C 3MVDD 5E5AC 5B2JC 3TU4D 4X23B 4J8XD 3AZED 5AVBB 3REKA 2BYKB 4WZSB 5AV8A 4G91B 5B24B 4XUJA 4NE5A 5B32B 5AV9A 3MGSD 4R8PC 3MVDA 3AZGB 3MNND 5B33D 1M1AA 3A1IA 4ZUXA 5JA4A 3KWQB 4G92B 1S32B 5AV5B 5AV5A 3REHC 5G49B 1PZRA 5JA4B 5B1LC 3AN2D 4ZUXB 3X1SC 3MVDB 3AZGA 1TZYD 3REJD 5AV9B 5B32A 5DNNB 3LJAD 3AV1A 1P3GA 4WJ3C 2BYKA 1B6WA 3REKB 5AVBA 2F8NA 1KX4D 3W99C 5B2IC 5B1MC 4J8UB 1BFMA 5E5AB 1F66C 1P3FA 5AV9C 2YFVB 1P3AC 3AN2B 4J8VA 3O62A 1ZLAD 3AZJD 5B32C 5C3IB 4YM6C 3AV1C 3AV1D 3AYWB 5B32D 5B31A 4JJNC 3TU4B 4J8XC 3A6NA 1EQZC 3B6GC 3UTBC 5B2JD 5E5AD 3AZIC 5AV5D 3VH6T 4CAYB 5CP6A 3EPJA 3MNNA 1M1AD 3WTPB 3AFAA 3AZMC 5AVCB 5CPKD 1JFIB 5AY8B 3EG5B 3C1BB 5BT1C 5B1MD 4XZQB 5B31C 5CPJC 3B0DC 5B24D 2Y2KA 3AV2C 5F99C 3F6TA 4YM6A 3MGSA 3AYWD 3LJAC 3X1TA 3C1CB 3AZHB 5B40B 3C1BC 3WA9C 5BNVA 4XZQC 3REIB 3AZIA 1W2EA 5B0ZD 3AZLB 2CV5A 3NQUA 1P3IB 3V9RB 2AROC 1B67A 5AVCD 2JE5A 3AZHC 1HQ3D 3WAAA 3MGRB 1P34A 5CPJA 1EQZB 4UUZA 3W98A 2F2AC 4E45A 5CHLB 1M19A 3UTAB 1ID3A 3LELB 3X1SB 1P3KB 4YS3D 1KX5D 3MGRC 2BYMA 3LZ1B 1M18D 5BT1D 5CPKB 5BS7A 2HUEB 3FDDA 5GSUA 4EO5C 3W97C 3LELC 3AL0C 4ZBJC 3AZKD 5B32G 1AOIA 4JJNB 3VH6A 1F66B 1TAFB 4H9OB 5GT3A 3NQJB 1KX5C 1P3LB 3KUYA 5B40D 3EPHA 4J8WB 1P3MD 2AROB 5AV6D 1M19C 3H0LC 1KX3B 4ZBJB 4WU8A 3X1UC 3WTPE 3KXBA 3REID 2FJ7A 4H9PB 4H9RA 4LD9C 3W97A 3AZHD 2RVQD 1HQ3B 4CSRB 1H3OA 2G5HC 4J8WC 3A1KA 2NQBA 4Z2MG 3X1UB 4XZQD 4QLCC 4AWLB 3UTBB 3AZLD 3UTAC 2HIOA 5JRGA 2ZY4A 4Z5TA 3UTAD 1F1EA 5GT3D 3B6FB 5AVCC 2AROD 5AV6B 1ZLAA 3AZKA 2Y2NA 4X23C 3X1SD 4LD9A 3P5JB 1P3MC 3KWQD 5FUGB 4WU9A 4YS3A 5B40C 2VQRA 5B0YD 3C1CC 1P3LD 5B2IB 5F99A 4Z66A 3W99A 3X1TC 4Z2MH 5DNMB 3AZKC 4JJND 1P3KD 2ZY2A 2NZDC 1M18B 4H9QB 1N1JB 2Y2LA 2ZM5A 5B0ZA 2Y2MA 4YS3C 3WAAC 3B6GD 2RIQA 1P3OC 4KUDA 5BNXB 3AV2B 3WKJA 1KX3C 4KGCA 3W96B 3LZ0A 5AV9D 2NZDD 4J8UC 1P3KC 2F8NK 5BO0A 3RELB 3B6GA 2YFWB 5B1MA 1P3GC 1KX4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REH B;  4QLC B;  4AWL C;  1P3A B;  3KWQ C;  4WNN A;  3AFA C;  5B2J B;  3AN2 C;  5CPI A;  5B0Y B;  5F99 D;  3AYW C;  5KDM B;  5GT0 C;  3AV2 D;  2NZD B;  3MGS C;  3R45 A;  2LY8 A;  4KHA B;  5AV8 C;  3X1V D;  3REH D;  3W96 C;  5B0Y A;  1P3O D;  5B1L B;  5CPI B;  4H9S C;  5GXQ A;  5B31 G;  5AV5 C;  4R8P A;  3MVD C;  3VH5 W;  4ZUX C;  5CP6 C;  4LD9 D;  5GT0 A;  5GXQ D;  4QLC A;  3MGP B;  3REH A;  2PYO B;  1BH8 B;  3X1V A;  1KX4 A;  3AZN A;  5B1M B;  5AV6 C;  1Q9C A;  3B6G B;  3LJA A;  3UT9 D;  3AZF D;  3LZ1 D;  4DRA A;  3W96 A;  5B0Y C;  3C1C D;  4NE6 A;  4Z5T D;  3AV2 A;  1P3B B;  3WKJ B;  5JRG D;  1P3O B;  3WTP C;  3AZM B;  3LEL D;  2NQB D;  5B0Z B;  4H9N A;  1P3M A;  1N1J A;  1KX4 C;  1R4V A;  1P3B C;  3MGR D;  3UT9 A;  3AZF A;  2FJ7 D;  4J8X B;  3KXB D;  4HGA B;  3W99 B;  4J8X A;  4Z66 B;  3UT9 B;  3AZF B;  5B1L D;  4E44 A;  4QLC D;  3AZL C;  2PYO C;  5FUG A;  4YS3 B;  4J8W D;  3MGP C;  1P3M B;  4H9N B;  5B33 C;  3MNN C;  3MGP D;  3AZM A;  1P3O A;  4KUD C;  4KGC C;  1ULY A;  1P3B A;  1AOI C;  3AZK B;  5DNN D;  3LJA B;  3AZE C;  3B6F A;  3TU4 C;  5B24 C;  3AZN B;  4Z5T B;  4Z66 D;  4XUJ C;  1BH8 A;  3X1V B;  2PYO A;  3X1U A;  3MGP A;  4WU8 C;  5GT0 B;  1P3P D;  1P34 D;  5CPK C;  1HTA A;  4R8P B;  1HQ3 A;  4CSR A;  3AZG C;  1P3P C;  1P3I C;  4EO5 B;  5GXQ B;  3W97 B;  5B1L A;  4H9R B;  4H9P A;  2FJ7 B;  2CV5 C;  4WU8 B;  3AZI D;  4Z66 C;  3B6F C;  3UTB D;  2ARO A;  4J8W A;  3KUY B;  3R45 B;  4KHA A;  1P3F C;  2NZD A;  3NQJ A;  1ID3 C;  5GT3 B;  4YM6 D;  5KDM A;  3WKJ D;  3AZJ C;  1ZLA C;  1TAF A;  1F66 A;  1AOI B;  4M6B A;  1HQ3 C;  5B2J A;  2CWE A;  2HUE C;  5CPK A;  4WNN B;  1P3A A;  3LZ1 A;  1S32 C;  5BS7 C;  4WU9 C;  3C1B D;  5DNM C;  1P3K A;  5GSU C;  2YFW A;  3LEL A;  5BO0 B;  3REL A;  3AZN D;  3O62 D;  1M19 B;  5B2I D;  3W99 D;  3VH5 A;  4J8V D;  3KUY D;  3A6N D;  4G91 C;  5B31 D;  3LZ0 B;  4UUZ B;  3W98 B;  3A6N C;  1EQZ A;  1KU5 A;  4KGC B;  5BNX A;  1P34 B;  4KUD B;  3WAA B;  3V9R A;  4G92 C;  4H9Q A;  5AVB D;  1M18 A;  5BNV B;  3B0B A;  4R8P D;  1A7W A;  1EQZ D;  5DNM A;  3X1T B;  4YM6 B;  3WKJ C;  3REL C;  5F99 B;  4J8U D;  3REK C;  5B2I A;  3REL D;  4XZQ A;  1KX3 D;  4WU9 B;  4H9S A;  5GXQ C;  3C1B A;  4ZUX D;  1JFI A;  5AVC A;  4LD9 B;  3AFA B;  1P3A D;  3W98 C;  5CPI D;  4CAY A;  5AV8 D;  3X1V C;  3REK D;  1ZLA B;  1P34 C;  5AV6 A;  1F66 D;  3A6N B;  3TU4 A;  3X1T D;  5B31 B;  3LZ0 D;  3AYW A;  4XUJ D;  5JRG B;  2HIO B;  5C3I C;  3B0D B;  5AVB C;  3UTB A;  2NQB B;  3O62 B;  1TZY C;  3REJ C;  5GSU D;  1H3O B;  3AFA D;  4KGC D;  4KUD D;  2IO5 B;  3KXB B;  1KX3 A;  1P3F B;  2JSS A;  5E5A A;  3LZ0 C;  1U35 D;  4J8U A;  2PYO D;  2F8N G;  1P3L A;  2F8N B;  5DNM D;  4WU9 D;  4H9O A;  1P3G B;  3AV1 B;  5DNN A;  4JJN A;  3KXB C;  5GSU B;  1P3B D;  2FJ7 C;  2RVQ C;  2CV5 D;  5G49 A;  1WWS A;  1S32 A;  3KWQ A;  2HIO C;  2BYM B;  3KSY A;  3MGQ C;  1M1A B;  2NQB C;  3X1S A;  1P3F D;  3WTP D;  1ID3 B;  3UTA A;  5AY8 D;  4DRB A;  4XUJ B;  5B24 A;  4HGA C;  2F8N D;  5AV8 B;  1P3L C;  3UT9 C;  3AZF C;  5CPJ B;  2F8N H;  3B0C W;  3MGR A;  4X23 A;  1P3I D;  5DNN C;  3W97 D;  3AZG D;  3MGQ D;  4X23 D;  2IO5 C;  1P3I A;  3NQU B;  2HIO D;  2CV5 B;  2L5A A;  3AZL A;  3REI A;  5CP6 D;  3AZI B;  4WU8 D;  3WA9 B;  1U35 B;  3VH6 W;  5B33 A;  5B40 A;  3KUY C;  4J8V C;  3MGQ A;  3AZH A;  1TZY B;  3O62 C;  3C1C A;  3REJ B;  3AZN C;  3VH5 T;  5GT3 C;  3MGS B;  3W96 D;  4NFT A;  1KX5 B;  1AOI D;  3AZJ A;  4WV4 B;  1S32 D;  3AZE A;  1U35 C;  1BH9 A;  5AY8 A;  3B0C T;  3WTP A;  5GT0 D;  3MNN B;  1P3P B;  5B0Z C;  1P3P A;  5CP6 B;  3WA9 D;  3X1U D;  3REI C;  1ID3 D;  1M19 D;  1BH9 B;  5JRG C;  3AZE B;  4Z5T C;  1WWI A;  3AZJ B;  3B6F D;  5CPJ D;  1P3G D;  1KX5 A;  5AY8 C;  4NE3 A;  1TZY A;  3REJ A;  3MGQ B;  5B33 B;  4J8V B;  1U35 A;  3AN2 A;  3AZM D;  5CPI C;  3W98 D;  1M1A C;  3WA9 A;  2YFV A;  1M18 C;  3WAA D;  3LZ1 C;  3MVD D;  5E5A C;  5B2J C;  3TU4 D;  4X23 B;  4J8X D;  3AZE D;  5AVB B;  3REK A;  2BYK B;  4WZS B;  5AV8 A;  4G91 B;  5B24 B;  4XUJ A;  4NE5 A;  5B32 B;  5AV9 A;  3MGS D;  4R8P C;  3MVD A;  3AZG B;  3MNN D;  5B33 D;  1M1A A;  4ZUX A;  5JA4 A;  3KWQ B;  4G92 B;  1S32 B;  5AV5 B;  5AV5 A;  3REH C;  5G49 B;  5JA4 B;  5B1L C;  3AN2 D;  4ZUX B;  3X1S C;  3MVD B;  3AZG A;  1TZY D;  3REJ D;  5AV9 B;  5B32 A;  5DNN B;  3LJA D;  3AV1 A;  1P3G A;  2BYK A;  1B6W A;  3REK B;  5AVB A;  2F8N A;  1KX4 D;  3W99 C;  5B2I C;  5B1M C;  4J8U B;  1BFM A;  5E5A B;  1F66 C;  1P3F A;  5AV9 C;  2YFV B;  1P3A C;  3AN2 B;  4J8V A;  3O62 A;  1ZLA D;  3AZJ D;  5B32 C;  5C3I B;  4YM6 C;  3AV1 C;  3AV1 D;  3AYW B;  5B32 D;  5B31 A;  4JJN C;  3TU4 B;  4J8X C;  3A6N A;  1EQZ C;  3B6G C;  3UTB C;  5B2J D;  5E5A D;  3AZI C;  5AV5 D;  3VH6 T;  4CAY B;  5CP6 A;  3MNN A;  1M1A D;  3WTP B;  3AFA A;  3AZM C;  5AVC B;  5CPK D;  1JFI B;  5AY8 B;  3C1B B;  5BT1 C;  5B1M D;  4XZQ B;  5B31 C;  5CPJ C;  3B0D C;  5B24 D;  3AV2 C;  5F99 C;  4YM6 A;  3AYW D;  3MGS A;  3LJA C;  3X1T A;  3C1C B;  3AZH B;  5B40 B;  3C1B C;  3WA9 C;  5BNV A;  4XZQ C;  3REI B;  3AZI A;  5B0Z D;  3AZL B;  2CV5 A;  3NQU A;  1P3I B;  3V9R B;  2ARO C;  1B67 A;  5AVC D;  3AZH C;  3WAA A;  1HQ3 D;  3MGR B;  1P34 A;  5CPJ A;  1EQZ B;  4UUZ A;  3W98 A;  4E45 A;  5CHL B;  1M19 A;  3UTA B;  1ID3 A;  3LEL B;  3X1S B;  1P3K B;  4YS3 D;  1KX5 D;  3MGR C;  2BYM A;  3LZ1 B;  1M18 D;  5BT1 D;  5CPK B;  5BS7 A;  2HUE B;  5GSU A;  4EO5 C;  3W97 C;  3LEL C;  4ZBJ C;  3AZK D;  5B32 G;  1AOI A;  4JJN B;  3VH6 A;  1F66 B;  1TAF B;  4H9O B;  5GT3 A;  3NQJ B;  1KX5 C;  1P3L B;  3KUY A;  5B40 D;  4J8W B;  1P3M D;  2ARO B;  5AV6 D;  1M19 C;  1KX3 B;  4ZBJ B;  4WU8 A;  3X1U C;  3WTP E;  3KXB A;  3REI D;  2FJ7 A;  4H9P B;  4H9R A;  4LD9 C;  3W97 A;  3AZH D;  2RVQ D;  1HQ3 B;  4CSR B;  1H3O A;  4J8W C;  2NQB A;  4Z2M G;  3X1U B;  4XZQ D;  4QLC C;  4AWL B;  3UTB B;  3AZL D;  3UTA C;  2HIO A;  5JRG A;  4Z5T A;  3UTA D;  1F1E A;  5GT3 D;  3B6F B;  5AVC C;  2ARO D;  5AV6 B;  1ZLA A;  3AZK A;  4X23 C;  3X1S D;  4LD9 A;  1P3M C;  3KWQ D;  5FUG B;  4WU9 A;  4YS3 A;  5B40 C;  5B0Y D;  3C1C C;  1P3L D;  5B2I B;  5F99 A;  4Z66 A;  3W99 A;  3X1T C;  4Z2M H;  5DNM B;  3AZK C;  4JJN D;  1P3K D;  2NZD C;  1M18 B;  4H9Q B;  1N1J B;  5B0Z A;  4YS3 C;  3WAA C;  3B6G D;  1P3O C;  4KUD A;  5BNX B;  3AV2 B;  3WKJ A;  1KX3 C;  4KGC A;  3W96 B;  3LZ0 A;  5AV9 D;  2NZD D;  4J8U C;  1P3K C;  2F8N K;  5BO0 A;  3REL B;  3B6G A;  2YFW B;  5B1M A;  1P3G C;  1KX4 B; 
#chains in the Genus database with same CATH topology
 3REH B;  4QLC B;  4AWL C;  1P3A B;  3KWQ C;  4WNN A;  3AFA C;  5B2J B;  3AN2 C;  5CPI A;  5B0Y B;  5F99 D;  3AYW C;  5KDM B;  5GT0 C;  3AV2 D;  2NZD B;  3MGS C;  3R45 A;  2DQN C;  2LY8 A;  4KHA B;  5AV8 C;  3X1V D;  3REH D;  3W96 C;  5B0Y A;  1P3O D;  5B1L B;  5CPI B;  4H9S C;  5GXQ A;  5B31 G;  5AV5 C;  4R8P A;  3MVD C;  3VH5 W;  4ZUX C;  5CP6 C;  4LD9 D;  5GT0 A;  5GXQ D;  4QLC A;  3MGP B;  3REH A;  2PYO B;  1BH8 B;  3X1V A;  1KX4 A;  3AZN A;  5B1M B;  5AV6 C;  1Q9C A;  3B6G B;  3LJA A;  3UT9 D;  3AZF D;  2XD5 A;  3LZ1 D;  4DRA A;  3W96 A;  5B0Y C;  3C1C D;  4NE6 A;  4Z5T D;  3AV2 A;  1P3B B;  3WKJ B;  5JRG D;  1P3O B;  3WTP C;  3AZM B;  3LEL D;  2NQB D;  5B0Z B;  4H9N A;  1P3M A;  2FFF B;  1N1J A;  2Y2P A;  1KX4 C;  2ZY3 A;  1R4V A;  3IP4 C;  3MGR D;  3UT9 A;  3AZF A;  1P3B C;  2FJ7 D;  4J8X B;  3KXB D;  4HGA B;  3W99 B;  4J8X A;  4Z66 B;  3UT9 B;  3AZF B;  5B1L D;  4E44 A;  4QLC D;  3AZL C;  2JCH A;  2PYO C;  5FUG A;  4YS3 B;  2BG1 A;  4J8W D;  3MGP C;  1P3M B;  4H9N B;  5B33 C;  3MNN C;  3MGP D;  3AZM A;  1P3O A;  4KUD C;  4KGC C;  1ULY A;  1P3B A;  1T3U A;  1AOI C;  3AZK B;  5DNN D;  3LJA B;  3AZE C;  3B6F A;  3TU4 C;  5B24 C;  3AZN B;  4Z5T B;  4Z66 D;  4XUJ C;  1BH8 A;  3X1V B;  2PYO A;  3X1U A;  3MGP A;  4WU8 C;  5GT0 B;  2UWX A;  1P3P D;  1P34 D;  5CPK C;  1HTA A;  4R8P B;  1HQ3 A;  4CSR A;  3AZG C;  1P3P C;  1P3I C;  4EO5 B;  5GXQ B;  3W97 B;  5B1L A;  4H9R B;  4H9P A;  2FJ7 B;  2CV5 C;  4WU8 B;  3AZI D;  4Z66 C;  3B6F C;  3UTB D;  2ARO A;  2Y2J A;  4J8W A;  3KUY B;  3R45 B;  4KHA A;  1P3F C;  2NZD A;  3NQJ A;  1ID3 C;  5GT3 B;  2Y2O A;  4YM6 D;  5KDM A;  3WKJ D;  3AZJ C;  1ZLA C;  1TAF A;  1F66 A;  1AOI B;  4M6B A;  1HQ3 C;  5B2J A;  2CWE A;  2HUE C;  5CPK A;  4WNN B;  1P3A A;  3LZ1 A;  1S32 C;  5BS7 C;  4WU9 C;  3C1B D;  5DNM C;  1P3K A;  5GSU C;  2YFW A;  3LEL A;  5BO0 B;  3REL A;  3AZN D;  3O62 D;  1M19 B;  5B2I D;  3W99 D;  3VH5 A;  4J8V D;  3KUY D;  3A6N D;  4G91 C;  5B31 D;  3LZ0 B;  4UUZ B;  3W98 B;  3A6N C;  1EQZ A;  1KU5 A;  4KGC B;  5BNX A;  1P34 B;  4KUD B;  3WAA B;  3V9R A;  4G92 C;  4H9Q A;  5AVB D;  1M18 A;  5BNV B;  3B0B A;  4R8P D;  1A7W A;  1EQZ D;  5DNM A;  3X1T B;  4YM6 B;  3WKJ C;  3REL C;  5F99 B;  4J8U D;  3REK C;  5B2I A;  3REL D;  4XZQ A;  1KX3 D;  2Y2Q A;  4WU9 B;  4H9S A;  5GXQ C;  3C1B A;  4ZUX D;  1JFI A;  5AVC A;  4LD9 B;  3AFA B;  1P3A D;  3W98 C;  5CPI D;  1Z2C B;  4CAY A;  5AV8 D;  3X1V C;  2ZY5 A;  3REK D;  1P34 C;  5AV6 A;  1ZLA B;  1F66 D;  3A6N B;  3TU4 A;  3X1T D;  5B31 B;  3LZ0 D;  3AYW A;  4XUJ D;  2Y2G A;  5JRG B;  2HIO B;  5C3I C;  3B0D B;  5AVB C;  3UTB A;  2NQB B;  1TZY C;  3O62 B;  2DF4 C;  3REJ C;  5GSU D;  1H3O B;  3KFU G;  3AFA D;  4KGC D;  4KUD D;  2IO5 B;  3KXB B;  1KX3 A;  1P3F B;  2JSS A;  5E5A A;  3LZ0 C;  1U35 D;  4J8U A;  2PYO D;  2F8N G;  1P3L A;  2F8N B;  5DNM D;  3EPL A;  4WU9 D;  4H9O A;  1P3G B;  3AV1 B;  5DNN A;  4JJN A;  3KXB C;  5GSU B;  1P3B D;  2FJ7 C;  2RVQ C;  2CV5 D;  5G49 A;  1WWS A;  1S32 A;  3KWQ A;  2HIO C;  2BYM B;  3KSY A;  3MGQ C;  1M1A B;  2NQB C;  3X1S A;  3EPK A;  3WTP D;  1P3F D;  2Y2I A;  1ID3 B;  3UTA A;  2G5I C;  5AY8 D;  4DRB A;  4XUJ B;  5B24 A;  4HGA C;  2F8N D;  5AV8 B;  1P3L C;  3UT9 C;  3AZF C;  5CPJ B;  2F8N H;  3B0C W;  3MGR A;  4X23 A;  1P3I D;  5DNN C;  3W97 D;  3AZG D;  3MGQ D;  4X23 D;  2IO5 C;  1P3I A;  3NQU B;  2HIO D;  2CV5 B;  2L5A A;  3AZL A;  3REI A;  5CP6 D;  3AZI B;  4WU8 D;  3WA9 B;  1U35 B;  4DQY B;  3VH6 W;  5B33 A;  5B40 A;  3KUY C;  4J8V C;  3MGQ A;  3AZH A;  1TZY B;  3O62 C;  3C1C A;  3REJ B;  3AZN C;  3VH5 T;  5GT3 C;  3MGS B;  3W96 D;  4NFT A;  1KX5 B;  2J8P A;  3AZJ A;  1AOI D;  4WV4 B;  1S32 D;  3AZE A;  1U35 C;  1BH9 A;  5AY8 A;  3B0C T;  2Y2H A;  3WTP A;  5GT0 D;  3H0R C;  3MNN B;  1P3P B;  5B0Z C;  1P3P A;  5CP6 B;  3WA9 D;  3X1U D;  3REI C;  1ID3 D;  1M19 D;  1BH9 B;  5JRG C;  3AZE B;  4Z5T C;  1WWI A;  3AZJ B;  3B6F D;  5CPJ D;  1P3G D;  1KX5 A;  5AY8 C;  4NE3 A;  1TZY A;  3REJ A;  3MGQ B;  5B33 B;  4J8V B;  1U35 A;  3AN2 A;  3AZM D;  5CPI C;  3W98 D;  1M1A C;  3H0M C;  3WA9 A;  2YFV A;  1M18 C;  2XD1 A;  4UPK A;  3WAA D;  2W8S A;  3LZ1 C;  3MVD D;  5E5A C;  5B2J C;  3TU4 D;  4X23 B;  4J8X D;  3AZE D;  5AVB B;  3REK A;  2BYK B;  4WZS B;  5AV8 A;  4G91 B;  5B24 B;  4XUJ A;  4NE5 A;  5B32 B;  5AV9 A;  3MGS D;  4R8P C;  3MVD A;  3AZG B;  3MNN D;  5B33 D;  1M1A A;  3A1I A;  4ZUX A;  5JA4 A;  3KWQ B;  4G92 B;  1S32 B;  5AV5 B;  5AV5 A;  3REH C;  5G49 B;  1PZR A;  5JA4 B;  5B1L C;  3AN2 D;  4ZUX B;  3X1S C;  3MVD B;  3AZG A;  1TZY D;  3REJ D;  5AV9 B;  5B32 A;  5DNN B;  3LJA D;  3AV1 A;  1P3G A;  4WJ3 C;  2BYK A;  1B6W A;  3REK B;  5AVB A;  2F8N A;  1KX4 D;  3W99 C;  5B2I C;  5B1M C;  4J8U B;  1BFM A;  5E5A B;  1F66 C;  1P3F A;  5AV9 C;  2YFV B;  1P3A C;  3AN2 B;  4J8V A;  3O62 A;  1ZLA D;  3AZJ D;  5B32 C;  5C3I B;  4YM6 C;  3AV1 C;  3AV1 D;  3AYW B;  5B32 D;  5B31 A;  4JJN C;  3TU4 B;  4J8X C;  3A6N A;  1EQZ C;  3B6G C;  3UTB C;  5B2J D;  5E5A D;  3AZI C;  5AV5 D;  3VH6 T;  4CAY B;  5CP6 A;  3EPJ A;  3MNN A;  1M1A D;  3WTP B;  3AFA A;  3AZM C;  5AVC B;  5CPK D;  1JFI B;  5AY8 B;  3EG5 B;  3C1B B;  5BT1 C;  5B1M D;  4XZQ B;  5B31 C;  5CPJ C;  3B0D C;  5B24 D;  2Y2K A;  3AV2 C;  5F99 C;  3F6T A;  4YM6 A;  3MGS A;  3AYW D;  3LJA C;  3X1T A;  3C1C B;  3AZH B;  5B40 B;  3C1B C;  3WA9 C;  5BNV A;  4XZQ C;  3REI B;  3AZI A;  1W2E A;  5B0Z D;  3AZL B;  2CV5 A;  3NQU A;  1P3I B;  3V9R B;  2ARO C;  1B67 A;  5AVC D;  2JE5 A;  3AZH C;  1HQ3 D;  3WAA A;  3MGR B;  1P34 A;  5CPJ A;  1EQZ B;  4UUZ A;  3W98 A;  2F2A C;  4E45 A;  5CHL B;  1M19 A;  3UTA B;  1ID3 A;  3LEL B;  3X1S B;  1P3K B;  4YS3 D;  1KX5 D;  3MGR C;  2BYM A;  3LZ1 B;  1M18 D;  5BT1 D;  5CPK B;  5BS7 A;  2HUE B;  3FDD A;  5GSU A;  4EO5 C;  3W97 C;  3LEL C;  3AL0 C;  4ZBJ C;  3AZK D;  5B32 G;  1AOI A;  4JJN B;  3VH6 A;  1F66 B;  1TAF B;  4H9O B;  5GT3 A;  3NQJ B;  1KX5 C;  1P3L B;  3KUY A;  5B40 D;  3EPH A;  4J8W B;  1P3M D;  2ARO B;  5AV6 D;  1M19 C;  3H0L C;  1KX3 B;  4ZBJ B;  4WU8 A;  3X1U C;  3WTP E;  3KXB A;  3REI D;  2FJ7 A;  4H9P B;  4H9R A;  4LD9 C;  3W97 A;  3AZH D;  2RVQ D;  1HQ3 B;  4CSR B;  1H3O A;  2G5H C;  4J8W C;  3A1K A;  2NQB A;  4Z2M G;  3X1U B;  4XZQ D;  4QLC C;  4AWL B;  3UTB B;  3AZL D;  3UTA C;  2HIO A;  5JRG A;  2ZY4 A;  4Z5T A;  3UTA D;  1F1E A;  5GT3 D;  3B6F B;  5AVC C;  2ARO D;  5AV6 B;  1ZLA A;  3AZK A;  2Y2N A;  4X23 C;  3X1S D;  4LD9 A;  3P5J B;  1P3M C;  3KWQ D;  5FUG B;  4WU9 A;  4YS3 A;  5B40 C;  2VQR A;  5B0Y D;  3C1C C;  1P3L D;  5B2I B;  5F99 A;  4Z66 A;  3W99 A;  3X1T C;  4Z2M H;  5DNM B;  3AZK C;  4JJN D;  1P3K D;  2ZY2 A;  2NZD C;  1M18 B;  4H9Q B;  1N1J B;  2Y2L A;  2ZM5 A;  5B0Z A;  2Y2M A;  4YS3 C;  3WAA C;  3B6G D;  2RIQ A;  1P3O C;  4KUD A;  5BNX B;  3AV2 B;  3WKJ A;  1KX3 C;  4KGC A;  3W96 B;  3LZ0 A;  5AV9 D;  2NZD D;  4J8U C;  1P3K C;  2F8N K;  5BO0 A;  3REL B;  3B6G A;  2YFW B;  5B1M A;  1P3G C;  1KX4 B; 
#chains in the Genus database with same CATH homology
 3REH B;  4QLC B;  4AWL C;  1P3A B;  3KWQ C;  4WNN A;  3AFA C;  5B2J B;  3AN2 C;  5CPI A;  5B0Y B;  5F99 D;  3AYW C;  5KDM B;  5GT0 C;  3AV2 D;  2NZD B;  3MGS C;  3R45 A;  2DQN C;  2LY8 A;  4KHA B;  5AV8 C;  3X1V D;  3REH D;  3W96 C;  5B0Y A;  1P3O D;  5B1L B;  5CPI B;  4H9S C;  5GXQ A;  5B31 G;  5AV5 C;  4R8P A;  3MVD C;  3VH5 W;  4ZUX C;  5CP6 C;  4LD9 D;  5GT0 A;  5GXQ D;  4QLC A;  3MGP B;  3REH A;  2PYO B;  1BH8 B;  3X1V A;  1KX4 A;  3AZN A;  5B1M B;  5AV6 C;  1Q9C A;  3B6G B;  3LJA A;  3UT9 D;  3AZF D;  2XD5 A;  3LZ1 D;  4DRA A;  3W96 A;  5B0Y C;  3C1C D;  4NE6 A;  4Z5T D;  3AV2 A;  1P3B B;  3WKJ B;  5JRG D;  1P3O B;  3WTP C;  3AZM B;  3LEL D;  2NQB D;  5B0Z B;  4H9N A;  1P3M A;  2FFF B;  1N1J A;  2Y2P A;  1KX4 C;  2ZY3 A;  1R4V A;  3IP4 C;  3MGR D;  3UT9 A;  3AZF A;  1P3B C;  2FJ7 D;  4J8X B;  3KXB D;  4HGA B;  3W99 B;  4J8X A;  4Z66 B;  3UT9 B;  3AZF B;  5B1L D;  4E44 A;  4QLC D;  3AZL C;  2JCH A;  2PYO C;  5FUG A;  4YS3 B;  2BG1 A;  4J8W D;  3MGP C;  1P3M B;  4H9N B;  5B33 C;  3MNN C;  3MGP D;  3AZM A;  1P3O A;  4KUD C;  4KGC C;  1ULY A;  1P3B A;  1T3U A;  1AOI C;  3AZK B;  5DNN D;  3LJA B;  3AZE C;  3B6F A;  3TU4 C;  5B24 C;  3AZN B;  4Z5T B;  4Z66 D;  4XUJ C;  1BH8 A;  3X1V B;  2PYO A;  3X1U A;  3MGP A;  4WU8 C;  5GT0 B;  2UWX A;  1P3P D;  1P34 D;  5CPK C;  1HTA A;  4R8P B;  1HQ3 A;  4CSR A;  3AZG C;  1P3P C;  1P3I C;  4EO5 B;  5GXQ B;  3W97 B;  5B1L A;  4H9R B;  4H9P A;  2FJ7 B;  2CV5 C;  4WU8 B;  3AZI D;  4Z66 C;  3B6F C;  3UTB D;  2ARO A;  2Y2J A;  4J8W A;  3KUY B;  3R45 B;  4KHA A;  1P3F C;  2NZD A;  3NQJ A;  1ID3 C;  5GT3 B;  2Y2O A;  4YM6 D;  5KDM A;  3WKJ D;  3AZJ C;  1ZLA C;  1TAF A;  1F66 A;  1AOI B;  4M6B A;  1HQ3 C;  5B2J A;  2CWE A;  2HUE C;  5CPK A;  4WNN B;  1P3A A;  3LZ1 A;  1S32 C;  5BS7 C;  4WU9 C;  3C1B D;  5DNM C;  1P3K A;  5GSU C;  2YFW A;  3LEL A;  5BO0 B;  3REL A;  3AZN D;  3O62 D;  1M19 B;  5B2I D;  3W99 D;  3VH5 A;  4J8V D;  3KUY D;  3A6N D;  4G91 C;  5B31 D;  3LZ0 B;  4UUZ B;  3W98 B;  3A6N C;  1EQZ A;  1KU5 A;  4KGC B;  5BNX A;  1P34 B;  4KUD B;  3WAA B;  3V9R A;  4G92 C;  4H9Q A;  5AVB D;  1M18 A;  5BNV B;  3B0B A;  4R8P D;  1A7W A;  1EQZ D;  5DNM A;  3X1T B;  4YM6 B;  3WKJ C;  3REL C;  5F99 B;  4J8U D;  3REK C;  5B2I A;  3REL D;  4XZQ A;  1KX3 D;  2Y2Q A;  4WU9 B;  4H9S A;  5GXQ C;  3C1B A;  4ZUX D;  1JFI A;  5AVC A;  4LD9 B;  3AFA B;  1P3A D;  3W98 C;  5CPI D;  1Z2C B;  4CAY A;  5AV8 D;  3X1V C;  2ZY5 A;  3REK D;  1P34 C;  5AV6 A;  1ZLA B;  1F66 D;  3A6N B;  3TU4 A;  3X1T D;  5B31 B;  3LZ0 D;  3AYW A;  4XUJ D;  2Y2G A;  5JRG B;  2HIO B;  5C3I C;  3B0D B;  5AVB C;  3UTB A;  2NQB B;  1TZY C;  3O62 B;  2DF4 C;  3REJ C;  5GSU D;  1H3O B;  3KFU G;  3AFA D;  4KGC D;  4KUD D;  2IO5 B;  3KXB B;  1KX3 A;  1P3F B;  2JSS A;  5E5A A;  3LZ0 C;  1U35 D;  4J8U A;  2PYO D;  2F8N G;  1P3L A;  2F8N B;  5DNM D;  3EPL A;  4WU9 D;  4H9O A;  1P3G B;  3AV1 B;  5DNN A;  4JJN A;  3KXB C;  5GSU B;  1P3B D;  2FJ7 C;  2RVQ C;  2CV5 D;  5G49 A;  1WWS A;  1S32 A;  3KWQ A;  2HIO C;  2BYM B;  3KSY A;  3MGQ C;  1M1A B;  2NQB C;  3X1S A;  3EPK A;  3WTP D;  1P3F D;  2Y2I A;  1ID3 B;  3UTA A;  2G5I C;  5AY8 D;  4DRB A;  4XUJ B;  5B24 A;  4HGA C;  2F8N D;  5AV8 B;  1P3L C;  3UT9 C;  3AZF C;  5CPJ B;  2F8N H;  3B0C W;  3MGR A;  4X23 A;  1P3I D;  5DNN C;  3W97 D;  3AZG D;  3MGQ D;  4X23 D;  2IO5 C;  1P3I A;  3NQU B;  2HIO D;  2CV5 B;  2L5A A;  3AZL A;  3REI A;  5CP6 D;  3AZI B;  4WU8 D;  3WA9 B;  1U35 B;  4DQY B;  3VH6 W;  5B33 A;  5B40 A;  3KUY C;  4J8V C;  3MGQ A;  3AZH A;  1TZY B;  3O62 C;  3C1C A;  3REJ B;  3AZN C;  3VH5 T;  5GT3 C;  3MGS B;  3W96 D;  4NFT A;  1KX5 B;  2J8P A;  3AZJ A;  1AOI D;  4WV4 B;  1S32 D;  3AZE A;  1U35 C;  1BH9 A;  5AY8 A;  3B0C T;  2Y2H A;  3WTP A;  5GT0 D;  3H0R C;  3MNN B;  1P3P B;  5B0Z C;  1P3P A;  5CP6 B;  3WA9 D;  3X1U D;  3REI C;  1ID3 D;  1M19 D;  1BH9 B;  5JRG C;  3AZE B;  4Z5T C;  1WWI A;  3AZJ B;  3B6F D;  5CPJ D;  1P3G D;  1KX5 A;  5AY8 C;  4NE3 A;  1TZY A;  3REJ A;  3MGQ B;  5B33 B;  4J8V B;  1U35 A;  3AN2 A;  3AZM D;  5CPI C;  3W98 D;  1M1A C;  3H0M C;  3WA9 A;  2YFV A;  1M18 C;  2XD1 A;  4UPK A;  3WAA D;  2W8S A;  3LZ1 C;  3MVD D;  5E5A C;  5B2J C;  3TU4 D;  4X23 B;  4J8X D;  3AZE D;  5AVB B;  3REK A;  2BYK B;  4WZS B;  5AV8 A;  4G91 B;  5B24 B;  4XUJ A;  4NE5 A;  5B32 B;  5AV9 A;  3MGS D;  4R8P C;  3MVD A;  3AZG B;  3MNN D;  5B33 D;  1M1A A;  3A1I A;  4ZUX A;  5JA4 A;  3KWQ B;  4G92 B;  1S32 B;  5AV5 B;  5AV5 A;  3REH C;  5G49 B;  1PZR A;  5JA4 B;  5B1L C;  3AN2 D;  4ZUX B;  3X1S C;  3MVD B;  3AZG A;  1TZY D;  3REJ D;  5AV9 B;  5B32 A;  5DNN B;  3LJA D;  3AV1 A;  1P3G A;  4WJ3 C;  2BYK A;  1B6W A;  3REK B;  5AVB A;  2F8N A;  1KX4 D;  3W99 C;  5B2I C;  5B1M C;  4J8U B;  1BFM A;  5E5A B;  1F66 C;  1P3F A;  5AV9 C;  2YFV B;  1P3A C;  3AN2 B;  4J8V A;  3O62 A;  1ZLA D;  3AZJ D;  5B32 C;  5C3I B;  4YM6 C;  3AV1 C;  3AV1 D;  3AYW B;  5B32 D;  5B31 A;  4JJN C;  3TU4 B;  4J8X C;  3A6N A;  1EQZ C;  3B6G C;  3UTB C;  5B2J D;  5E5A D;  3AZI C;  5AV5 D;  3VH6 T;  4CAY B;  5CP6 A;  3EPJ A;  3MNN A;  1M1A D;  3WTP B;  3AFA A;  3AZM C;  5AVC B;  5CPK D;  1JFI B;  5AY8 B;  3EG5 B;  3C1B B;  5BT1 C;  5B1M D;  4XZQ B;  5B31 C;  5CPJ C;  3B0D C;  5B24 D;  2Y2K A;  3AV2 C;  5F99 C;  3F6T A;  4YM6 A;  3MGS A;  3AYW D;  3LJA C;  3X1T A;  3C1C B;  3AZH B;  5B40 B;  3C1B C;  3WA9 C;  5BNV A;  4XZQ C;  3REI B;  3AZI A;  1W2E A;  5B0Z D;  3AZL B;  2CV5 A;  3NQU A;  1P3I B;  3V9R B;  2ARO C;  1B67 A;  5AVC D;  2JE5 A;  3AZH C;  1HQ3 D;  3WAA A;  3MGR B;  1P34 A;  5CPJ A;  1EQZ B;  4UUZ A;  3W98 A;  2F2A C;  4E45 A;  5CHL B;  1M19 A;  3UTA B;  1ID3 A;  3LEL B;  3X1S B;  1P3K B;  4YS3 D;  1KX5 D;  3MGR C;  2BYM A;  3LZ1 B;  1M18 D;  5BT1 D;  5CPK B;  5BS7 A;  2HUE B;  3FDD A;  5GSU A;  4EO5 C;  3W97 C;  3LEL C;  3AL0 C;  4ZBJ C;  3AZK D;  5B32 G;  1AOI A;  4JJN B;  3VH6 A;  1F66 B;  1TAF B;  4H9O B;  5GT3 A;  3NQJ B;  1KX5 C;  1P3L B;  3KUY A;  5B40 D;  3EPH A;  4J8W B;  1P3M D;  2ARO B;  5AV6 D;  1M19 C;  3H0L C;  1KX3 B;  4ZBJ B;  4WU8 A;  3X1U C;  3WTP E;  3KXB A;  3REI D;  2FJ7 A;  4H9P B;  4H9R A;  4LD9 C;  3W97 A;  3AZH D;  2RVQ D;  1HQ3 B;  4CSR B;  1H3O A;  2G5H C;  4J8W C;  3A1K A;  2NQB A;  4Z2M G;  3X1U B;  4XZQ D;  4QLC C;  4AWL B;  3UTB B;  3AZL D;  3UTA C;  2HIO A;  5JRG A;  2ZY4 A;  4Z5T A;  3UTA D;  1F1E A;  5GT3 D;  3B6F B;  5AVC C;  2ARO D;  5AV6 B;  1ZLA A;  3AZK A;  2Y2N A;  4X23 C;  3X1S D;  4LD9 A;  3P5J B;  1P3M C;  3KWQ D;  5FUG B;  4WU9 A;  4YS3 A;  5B40 C;  2VQR A;  5B0Y D;  3C1C C;  1P3L D;  5B2I B;  5F99 A;  4Z66 A;  3W99 A;  3X1T C;  4Z2M H;  5DNM B;  3AZK C;  4JJN D;  1P3K D;  2ZY2 A;  2NZD C;  1M18 B;  4H9Q B;  1N1J B;  2Y2L A;  2ZM5 A;  5B0Z A;  2Y2M A;  4YS3 C;  3WAA C;  3B6G D;  2RIQ A;  1P3O C;  4KUD A;  5BNX B;  3AV2 B;  3WKJ A;  1KX3 C;  4KGC A;  3W96 B;  3LZ0 A;  5AV9 D;  2NZD D;  4J8U C;  1P3K C;  2F8N K;  5BO0 A;  3REL B;  3B6G A;  2YFW B;  5B1M A;  1P3G C;  1KX4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...