3X1UD

Crystal structure of nucleosome core particle in the presence of histone variants involved in reprogramming
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
b'SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1uD00
2RVQC 5JRGD 5B31A 1P3MB 5AV8D 4H9SC 4YS3C 1P3GA 3W96C 5BNVA 1H3OA 1P3BD 3WKJB 3B0CW 3AZLB 4CSRA 4ZUXC 3X1SC 2BYMB 5DNMC 3AZGC 5B0ZD 4WNNA 3LELD 3REJC 5B2IC 5BNXA 3X1TA 3MGSC 3AFAB 2HIOD 4M6BA 1P3GD 3REHD 3KWQA 2AROA 4WU9C 2PYOB 1P3OC 5B2JD 1P3ID 3O62C 1ZLAA 3AZMC 1P34C 2FJ7A 1P3AB 5CPIC 1F66C 3REKA 1B6WA 3AV2D 5CP6A 3LZ0A 5DNNB 3X1TD 4J8WB 3REIB 4UUZB 2NQBB 4H9QA 3KWQD 2AROD 1P3MC 1EQZA 5GT0C 3WTPA 5B40B 2FJ7D 3AN2C 5CP6D 3RELA 3C1CA 5CPKA 1P3KB 5B0YA 3AZLC 3MNNA 3B6FC 3NQJA 5E5AA 5KDMA 5BS7A 4J8VA 5GXQA 5CPJA 1EQZD 3WTPD 1KX3B 4XUJB 3KUYA 4R8PB 5GSUB 4XZQC 3C1BB 3RELD 3MGPB 3C1CD 4E45A 5B1MA 5CPKD 2PYOC 5B0YD 1M18D 3MNND 5E5AD 3AZJB 3KXBA 1P3AC 4J8VD 1KX4B 3AZEB 3AZFB 5GXQD 5CPJD 5AV6A 5C3IB 3KUYD 4J8WC 3AV1B 5AVBB 1U35A 1S32B 3B6GB 3W98B 5FUGA 3VH6A 3KXBD 5B40C 5G49B 1N1JB 3AZHA 5AV6D 2CV5A 5B33B 1BH9B 3A6NC 5F99A 4NFTA 4LD9B 5B32C 4G92B 3W99B 5JA4A 1TAFB 1HQ3D 4R8PC 5AV5A 5GSUC 3AZHD 1ID3A 3C1BC 4H9PB 3UTAA 2IO5B 4E44A 3LZ1A 5B24A 3TU4A 4DRAA 3WA9C 5B1LA 1TZYB 3AZJC 2BYKA 3R45B 1A7WA 1KX4C 3AZEC 1M1AC 4WU8C 3UTBC 4KHAA 4X23A 4JJNB 4G91C 5AV5D 5AVBC 1ID3D 4H9SA 4YS3A 3LZ1D 5GT3B 5B24D 1S32C 3W96A 5B1LD 5AY8C 4Z5TB 3AZNB 3MVDD 4ZUXA 3X1SA 5DNMA 3MGRC 5B33C 3AZGA 2HUEC 3UT9D 4X23D 3REJA 2RVQD 5B2IA 4YS3D 5F99C 3MGSA 4LD9C 1ULYA 3W96D 3B0DC 1P3PB 3X1UD 1AOIC 3WAAD 4WU9A 1P3OA 1M19D 3X1SD 5DNMD 3AZGD 3AZMA 1P34A 4NE5A 5BO0A 5CPIA 1F66A 3REJD 1WWIA 4H9OA 1TZYC 3LJAB 4CAYB 4Z66A 3MGSD 1P3FB 4WU9D 1P3OD 3X1VB 1P3MA 5GT0A 3O62D 3AZMD 5GT3C 1P34D 5AV9B 4KUDB 3AN2A 5CPID 3MGQB 1F66D 3AZNC 3AZIB 3W97B 3AZLA 3AZKC 3B6FA 3AYWB 1KX5B 4QLCB 4H9RA 1P3MD 5GT0D 3NQUA 1R4VA 3AN2D 5B31D 4XZQA 5JRGB 1P3PC 4KGCC 5AV8B 2PYOA 4YM6B 3WTPE 3B6FD 1P3BB 2NZDC 3VH6T 1P3AA 2YFWB 3LJAC 4J8UC 4J8WA 3LELB 4UUZA 2NQBA 4XZQD 4Z66C 2HIOB 1P3GB 3REHB 5BNVB 1H3OB 4WV4B 5B40A 4KUDC 5B2JB 1P3IB 3A6NA 1ZLAD 3AZIC 3W97C 4J8WD 3REKD 3LZ0D 3AV2B 3WKJC 1KX5C 5BNXB 3X1TB 5B32A 1KX3A 4XUJA 3VH5T 4R8PA 5GSUA 3C1BA 3A6ND 3MGPA 3WA9A 3AFAC 2FJ7B 4YM6C 1B67A 5CP6B 2YFVA 3AZJA 1KX4A 3AZEA 3AZFA 1M1AA 3VH6W 5B32D 4WU8A 3UTBA 3LELC 5GSUD 5AVBA 3C1BD 1EQZB 3WTPB 5DNNC 1S32A 3WA9D 5AY8A 3REIC 2NQBC 3REHC 3RELB 1Q9CA 5B1MD 3C1CB 1KX4D 5CPKB 4H9NB 5B2JC 5B0YB 1P3IC 1M18B 1M1AD 3MNNB 5B33A 1BH9A 3NQJB 3MGRA 4WU8D 3UTBD 4J8XB 4J8VB 3AV2C 1P3KC 1JFIA 4LD9A 3KUYB 5AY8D 1U35D 1AOIA 1TAFA 1BH8B 4H9PA 3MGRD 1KX3C 4DRBA 4XUJC 3KXBB 1TZYA 2CV5D 4NE3A 5AV6B 3MGPC 5F99D 4LD9D 4AWLB 1P3LB 1AOID 4WZSB 2F8NK 4EO5B 3AZFC 5C3IC 3VH5A 5GT3A 3AV1C 5FUGB 5AVCB 2F8NA 1HQ3B 5B31G 3AZNA 3AZHB 3UTAD 3TU4D 4Z2MH 1WWSA 3AZKA 3B6GC 1M18C 3W98C 4J8XC 5JA4B 2F8ND 1P3PA 3AZND 1ID3B 4KGCA 5B24B 3AZKD 5B1LB 2NZDA 4G92C 3W99C 3MVDB 4ZUXD 3LJAA 4CAYA 4J8UA 2IO5C 3UT9B 4X23B 4AWLC 5B2ID 1P3LC 4KGCD 4YS3B 2NZDD 3X1UB 4KUDA 4JJNC 2JSSA 5AVCC 3WAAB 5CHLB 1HQ3C 4Z2MG 3LJAD 1M19B 3X1SB 4J8UD 3AZIA 5DNMB 3W97A 3AZGB 4Z5TC 3REJB 3WKJA 1KX5A 4Z66D 4ZBJB 4HGAB 2BYMA 5B32G 4KUDD 3O62B 1HTAA 3AZID 3AFAA 1P34B 4YM6A 5CPIB 1F66B 3WKJD 4H9OB 1KX5D 3AZLD 3B0BA 2YFWA 5BT1C 3UT9C 3LELA 3V9RB 5GT0B 5DNNA 5B0ZB 3AFAD 4YM6D 3REIA 2HIOA 1P3FC 3AN2B 3REHA 5B31B 2F8NH 3X1UC 2PYOD 3WAAC 3X1VC 5B2JA 1P3IA 1M19C 3B6FB 5AV9C 1P3AD 3MGQC 4CSRB 3AV2A 4H9RB 3NQUB 5DNND 4ZBJC 1P3KA 4HGAC 4WNNB 3REID 3AYWC 2NQBD 4XZQB 4QLCC 3KWQB 2AROB 5B40D 5JRGC 5AV8C 1ZLAB 1P3KD 3REKB 3LZ0B 1P3BC 4H9QB 1KX3D 4XUJD 3AV1A 5B0ZC 4R8PD 2F8NG 5B31C 3MGPD 3A6NB 3B6GA 4H9NA 2HIOC 1P3GC 1M18A 3W98A 3AZJD 2L5AA 5G49A 4J8XA 3AZED 1N1JA 3AZFD 5E5AB 5B32B 3AV1D 5KDMB 5AVBD 5GXQB 5CPJB 1S32D 3X1TC 3WA9B 3B6GD 1BH8A 3KWQC 3W98D 2AROC 2YFVB 3W99A 5B1MB 4J8XD 3VH5W 1M1AB 5B33D 1ZLAC 4WU8B 2FJ7C 3UTBB 3REKC 2LY8A 4G91B 5CP6C 3LZ0C 1P3LA 3R45A 5AY8B 1U35B 3W99D 4JJNA 5AVCA 1HQ3A 1EQZC 3WTPC 3MGRB 2HUEB 4Z5TA 1TZYD 3RELC 1P3LD 2CV5B 3C1CC 5F99B 5CPKC 1JFIB 5B0YC 1BFMA 3MNNC 3B0DB 5E5AC 1AOIB 5BS7C 4JJND 4J8VC 5AVCD 5GXQC 5CPJC 5GT3D 3KUYC 4Z5TD 5AV5B 3UTAB 3LZ1B 3MVDA 3TU4B 5B1MC 1F1EA 3KXBC 2BYKB 1KU5A 3UT9A 5AV6C 4KHAB 1P3FA 1P3PD 2F8NB 1U35C 3X1UA 3WAAA 3X1VA 4EO5C 3AZKB 3W96B 1M19A 3B0CT 4NE6A 5AV9A 5BT1D 3MGQA 3AZHC 4ZUXB 2CV5C 2CWEA 1P3FD 3AYWA 5B2IB 4KGCB 4QLCA 3MGSB 3X1VD 3O62A 2NZDB 5AV9D 4WU9B 3MGQD 1P3OB 5AV5C 5JRGA 1ID3C 5AV8A 3UTAC 4J8UB 3LZ1C 3TU4C 3AZMB 5B24C 3W97D 5BO0B 5B1LC 3AYWD 1P3BA 3MVDC 4Z66B 3KSYA 4QLCD 3V9RA 5B0ZA 4X23C
chains in the Genus database with same CATH superfamily
2RVQC 5JRGD 5B31A 1P3MB 5AV8D 4H9SC 4YS3C 1P3GA 3W96C 5BNVA 1H3OA 1P3BD 3WKJB 3B0CW 3AZLB 4CSRA 4ZUXC 3X1SC 2BYMB 5DNMC 3AZGC 5B0ZD 4WNNA 3LELD 3REJC 5B2IC 5BNXA 3X1TA 3MGSC 3AFAB 2HIOD 4M6BA 1P3GD 3REHD 3KWQA 2AROA 3KFUG 4WU9C 2PYOB 1P3OC 5B2JD 1P3ID 3O62C 1ZLAA 3AZMC 1P34C 2FJ7A 3F6TA 1P3AB 5CPIC 4UPKA 3REKA 1B6WA 3AV2D 5CP6A 3LZ0A 1F66C 5DNNB 3X1TD 4J8WB 3REIB 4UUZB 2NQBB 4H9QA 3KWQD 2AROD 1P3MC 1EQZA 5GT0C 3WTPA 5B40B 2FJ7D 1W2EA 3AN2C 3EPHA 5CP6D 3RELA 3C1CA 2JE5A 5CPKA 1P3KB 5B0YA 3AZLC 3MNNA 3B6FC 3NQJA 5E5AA 5KDMA 5BS7A 4J8VA 5GXQA 5CPJA 1EQZD 3WTPD 1KX3B 4XUJB 3KUYA 4R8PB 5GSUB 4XZQC 3C1BB 3RELD 3MGPB 3C1CD 4E45A 5B1MA 5CPKD 2PYOC 5B0YD 1M18D 3MNND 5E5AD 3AZJB 3KXBA 2ZY5A 1P3AC 4J8VD 1KX4B 3AZEB 3AZFB 5AV6A 5GXQD 5CPJD 5C3IB 2Y2HA 2Y2GA 3KUYD 4J8WC 3AV1B 5AVBB 1U35A 1S32B 3A1IA 3B6GB 3W98B 5FUGA 3VH6A 3KXBD 5B40C 5G49B 1N1JB 3AZHA 5AV6D 2CV5A 5B33B 1BH9B 3A6NC 5F99A 1PZRA 4NFTA 4LD9B 5B32C 4G92B 3W99B 5JA4A 1TAFB 1HQ3D 4R8PC 5AV5A 5GSUC 3AZHD 1ID3A 3AL0C 3C1BC 4H9PB 3UTAA 2IO5B 4E44A 3LZ1A 5B24A 3TU4A 2G5HC 4DRAA 3WA9C 5B1LA 1TZYB 3AZJC 2BYKA 3R45B 1A7WA 1KX4C 3AZEC 1M1AC 4WU8C 3UTBC 4KHAA 4X23A 4JJNB 5AV5D 4G91C 5AVBC 1ID3D 4H9SA 4YS3A 3LZ1D 5GT3B 5B24D 1S32C 3W96A 5B1LD 5AY8C 4Z5TB 3AZNB 3MVDD 2Y2LA 4ZUXA 3X1SA 5DNMA 3MGRC 5B33C 3AZGA 2HUEC 3UT9D 4X23D 3REJA 2RVQD 5B2IA 4YS3D 5F99C 3MGSA 4LD9C 1ULYA 3W96D 3B0DC 1P3PB 3EG5B 3X1UD 1AOIC 3WAAD 2VQRA 4WU9A 1P3OA 1M19D 3X1SD 5DNMD 3AZGD 3AZMA 1P34A 4NE5A 5BO0A 5CPIA 1F66A 3REJD 1WWIA 4H9OA 1TZYC 3LJAB 4CAYB 2F2AC 4Z66A 3MGSD 1P3FB 4WU9D 1P3OD 3X1VB 1P3MA 5GT0A 3O62D 3AZMD 5GT3C 1P34D 5AV9B 3IP4C 2UWXA 4KUDB 3AN2A 5CPID 3MGQB 1Z2CB 1F66D 3AZNC 3AZIB 3W97B 3AZLA 3AZKC 3B6FA 3AYWB 1KX5B 4QLCB 4H9RA 1P3MD 5GT0D 3NQUA 1R4VA 3AN2D 5B31D 4XZQA 5JRGB 1P3PC 4KGCC 5AV8B 2PYOA 4YM6B 3WTPE 3B6FD 1P3BB 2NZDC 3VH6T 1P3AA 2YFWB 3LJAC 4J8UC 4J8WA 3LELB 4UUZA 2NQBA 4XZQD 3H0MC 4Z66C 2Y2NA 2HIOB 1P3GB 3REHB 5BNVB 1H3OB 4WV4B 5B40A 4KUDC 5B2JB 1P3IB 3A6NA 1ZLAD 3AZIC 3W97C 4J8WD 2J8PA 3REKD 3LZ0D 3AV2B 3WKJC 1KX5C 5BNXB 2Y2OA 3X1TB 5B32A 1KX3A 4XUJA 3VH5T 4R8PA 5GSUA 2Y2JA 3C1BA 2Y2MA 3A6ND 3MGPA 3WA9A 3AFAC 2FJ7B 4YM6C 1B67A 2Y2PA 5CP6B 2YFVA 3AZJA 1KX4A 3AZEA 3AZFA 1M1AA 2ZY4A 3VH6W 5B32D 4WU8A 3UTBA 3LELC 5GSUD 5AVBA 3C1BD 1EQZB 3WTPB 5DNNC 1S32A 3WA9D 5AY8A 3REIC 2NQBC 3REHC 3FDDA 3RELB 1Q9CA 5B1MD 3C1CB 1KX4D 5CPKB 4H9NB 5B2JC 5B0YB 1P3IC 1M18B 1M1AD 3MNNB 5B33A 1BH9A 3NQJB 3MGRA 2JCHA 4WU8D 3UTBD 4J8XB 4J8VB 3AV2C 1P3KC 1JFIA 4LD9A 3KUYB 5AY8D 1U35D 1AOIA 1TAFA 1BH8B 4H9PA 3MGRD 1KX3C 4DRBA 4XUJC 3KXBB 1TZYA 2CV5D 4NE3A 5AV6B 3MGPC 5F99D 4LD9D 4AWLB 1P3LB 1AOID 4WZSB 2F8NK 4EO5B 4DQYB 3AZFC 5C3IC 3VH5A 5GT3A 3AV1C 5FUGB 5AVCB 2F8NA 1HQ3B 2XD1A 5B31G 3AZHB 3AZNA 3UTAD 3TU4D 4Z2MH 1WWSA 3AZKA 3B6GC 2RIQA 1M18C 2ZM5A 3W98C 4J8XC 2XD5A 3P5JB 3EPLA 5JA4B 2F8ND 1P3PA 2Y2IA 3AZND 1ID3B 4KGCA 5B24B 3AZKD 5B1LB 2NZDA 4G92C 3W99C 3MVDB 4ZUXD 3LJAA 4CAYA 4J8UA 2IO5C 3UT9B 4X23B 4AWLC 5B2ID 1P3LC 4KGCD 4YS3B 2NZDD 3X1UB 4KUDA 4JJNC 2JSSA 5AVCC 3WAAB 5CHLB 1HQ3C 4Z2MG 3LJAD 1M19B 3X1SB 4J8UD 3AZIA 5DNMB 3W97A 3AZGB 4Z5TC 3REJB 3WKJA 1KX5A 4Z66D 4ZBJB 4HGAB 2BYMA 5B32G 4KUDD 3O62B 1HTAA 3AZID 3AFAA 1P34B 4YM6A 5CPIB 1F66B 3WKJD 4H9OB 1KX5D 3AZLD 3B0BA 2YFWA 5BT1C 3UT9C 3LELA 3V9RB 2G5IC 3EPKA 5GT0B 5DNNA 2DF4C 5B0ZB 3AFAD 4YM6D 3REIA 2HIOA 1P3FC 3AN2B 3REHA 5B31B 2F8NH 3X1UC 2PYOD 3WAAC 3X1VC 5B2JA 1P3IA 1M19C 3B6FB 5AV9C 1P3AD 3MGQC 4CSRB 3AV2A 4H9RB 3NQUB 5DNND 4ZBJC 1P3KA 4HGAC 4WNNB 3REID 3AYWC 2NQBD 2ZY3A 4XZQB 4QLCC 3KWQB 2AROB 5B40D 2FFFB 5JRGC 5AV8C 2Y2KA 1ZLAB 1P3KD 2W8SA 3REKB 2DQNC 3LZ0B 1P3BC 4H9QB 1KX3D 4XUJD 3AV1A 5B0ZC 4R8PD 2F8NG 2Y2QA 5B31C 3MGPD 3A6NB 3B6GA 4H9NA 2HIOC 1P3GC 1M18A 2ZY2A 3W98A 3AZJD 2L5AA 5G49A 4J8XA 3AZED 1N1JA 3AZFD 5E5AB 5B32B 3AV1D 5KDMB 5AVBD 5GXQB 5CPJB 1S32D 3X1TC 3WA9B 3B6GD 1BH8A 3KWQC 3W98D 2AROC 2YFVB 3W99A 5B1MB 4J8XD 3VH5W 1M1AB 5B33D 4WJ3C 1ZLAC 4WU8B 2FJ7C 3UTBB 3REKC 2LY8A 4G91B 5CP6C 3LZ0C 1P3LA 3A1KA 3R45A 5AY8B 1U35B 3W99D 4JJNA 5AVCA 1HQ3A 1EQZC 3WTPC 3MGRB 2HUEB 4Z5TA 1TZYD 1T3UA 3RELC 1P3LD 2CV5B 3C1CC 5F99B 5CPKC 1JFIB 5B0YC 1BFMA 3MNNC 3B0DB 5E5AC 1AOIB 5BS7C 4JJND 4J8VC 5AVCD 5GXQC 5CPJC 5GT3D 3KUYC 4Z5TD 5AV5B 3UTAB 3LZ1B 3MVDA 3TU4B 5B1MC 1F1EA 3KXBC 2BYKB 1KU5A 3UT9A 3H0LC 5AV6C 4KHAB 1P3FA 1P3PD 2F8NB 1U35C 3X1UA 2BG1A 3WAAA 3X1VA 4EO5C 3AZKB 3W96B 1M19A 3B0CT 4NE6A 5AV9A 5BT1D 3MGQA 3AZHC 4ZUXB 2CV5C 2CWEA 1P3FD 3AYWA 5B2IB 4KGCB 3H0RC 4QLCA 3MGSB 3X1VD 3O62A 2NZDB 5AV9D 4WU9B 3MGQD 1P3OB 5AV5C 5JRGA 3EPJA 1ID3C 5AV8A 3UTAC 4J8UB 3LZ1C 3TU4C 3AZMB 5B24C 3W97D 5BO0B 5B1LC 3AYWD 1P3BA 3MVDC 4Z66B 3KSYA 4QLCD 3V9RA 5B0ZA 4X23C
chains in the Genus database with same CATH topology
2RVQC 5JRGD 5B31A 1P3MB 5AV8D 4H9SC 4YS3C 1P3GA 3W96C 5BNVA 1H3OA 1P3BD 3WKJB 3B0CW 3AZLB 4CSRA 4ZUXC 3X1SC 2BYMB 5DNMC 3AZGC 5B0ZD 4WNNA 3LELD 3REJC 5B2IC 5BNXA 3X1TA 3MGSC 3AFAB 2HIOD 4M6BA 1P3GD 3REHD 3KWQA 2AROA 3KFUG 4WU9C 2PYOB 1P3OC 5B2JD 1P3ID 3O62C 1ZLAA 3AZMC 1P34C 2FJ7A 3F6TA 1P3AB 5CPIC 4UPKA 3REKA 1B6WA 3AV2D 5CP6A 3LZ0A 1F66C 5DNNB 3X1TD 4J8WB 3REIB 4UUZB 2NQBB 4H9QA 3KWQD 2AROD 1P3MC 1EQZA 5GT0C 3WTPA 5B40B 2FJ7D 1W2EA 3AN2C 3EPHA 5CP6D 3RELA 3C1CA 2JE5A 5CPKA 1P3KB 5B0YA 3AZLC 3MNNA 3B6FC 3NQJA 5E5AA 5KDMA 5BS7A 4J8VA 5GXQA 5CPJA 1EQZD 3WTPD 1KX3B 4XUJB 3KUYA 4R8PB 5GSUB 4XZQC 3C1BB 3RELD 3MGPB 3C1CD 4E45A 5B1MA 5CPKD 2PYOC 5B0YD 1M18D 3MNND 5E5AD 3AZJB 3KXBA 2ZY5A 1P3AC 4J8VD 1KX4B 3AZEB 3AZFB 5AV6A 5GXQD 5CPJD 5C3IB 2Y2HA 2Y2GA 3KUYD 4J8WC 3AV1B 5AVBB 1U35A 1S32B 3A1IA 3B6GB 3W98B 5FUGA 3VH6A 3KXBD 5B40C 5G49B 1N1JB 3AZHA 5AV6D 2CV5A 5B33B 1BH9B 3A6NC 5F99A 1PZRA 4NFTA 4LD9B 5B32C 4G92B 3W99B 5JA4A 1TAFB 1HQ3D 4R8PC 5AV5A 5GSUC 3AZHD 1ID3A 3AL0C 3C1BC 4H9PB 3UTAA 2IO5B 4E44A 3LZ1A 5B24A 3TU4A 2G5HC 4DRAA 3WA9C 5B1LA 1TZYB 3AZJC 2BYKA 3R45B 1A7WA 1KX4C 3AZEC 1M1AC 4WU8C 3UTBC 4KHAA 4X23A 4JJNB 5AV5D 4G91C 5AVBC 1ID3D 4H9SA 4YS3A 3LZ1D 5GT3B 5B24D 1S32C 3W96A 5B1LD 5AY8C 4Z5TB 3AZNB 3MVDD 2Y2LA 4ZUXA 3X1SA 5DNMA 3MGRC 5B33C 3AZGA 2HUEC 3UT9D 4X23D 3REJA 2RVQD 5B2IA 4YS3D 5F99C 3MGSA 4LD9C 1ULYA 3W96D 3B0DC 1P3PB 3EG5B 3X1UD 1AOIC 3WAAD 2VQRA 4WU9A 1P3OA 1M19D 3X1SD 5DNMD 3AZGD 3AZMA 1P34A 4NE5A 5BO0A 5CPIA 1F66A 3REJD 1WWIA 4H9OA 1TZYC 3LJAB 4CAYB 2F2AC 4Z66A 3MGSD 1P3FB 4WU9D 1P3OD 3X1VB 1P3MA 5GT0A 3O62D 3AZMD 5GT3C 1P34D 5AV9B 3IP4C 2UWXA 4KUDB 3AN2A 5CPID 3MGQB 1Z2CB 1F66D 3AZNC 3AZIB 3W97B 3AZLA 3AZKC 3B6FA 3AYWB 1KX5B 4QLCB 4H9RA 1P3MD 5GT0D 3NQUA 1R4VA 3AN2D 5B31D 4XZQA 5JRGB 1P3PC 4KGCC 5AV8B 2PYOA 4YM6B 3WTPE 3B6FD 1P3BB 2NZDC 3VH6T 1P3AA 2YFWB 3LJAC 4J8UC 4J8WA 3LELB 4UUZA 2NQBA 4XZQD 3H0MC 4Z66C 2Y2NA 2HIOB 1P3GB 3REHB 5BNVB 1H3OB 4WV4B 5B40A 4KUDC 5B2JB 1P3IB 3A6NA 1ZLAD 3AZIC 3W97C 4J8WD 2J8PA 3REKD 3LZ0D 3AV2B 3WKJC 1KX5C 5BNXB 2Y2OA 3X1TB 5B32A 1KX3A 4XUJA 3VH5T 4R8PA 5GSUA 2Y2JA 3C1BA 2Y2MA 3A6ND 3MGPA 3WA9A 3AFAC 2FJ7B 4YM6C 1B67A 2Y2PA 5CP6B 2YFVA 3AZJA 1KX4A 3AZEA 3AZFA 1M1AA 2ZY4A 3VH6W 5B32D 4WU8A 3UTBA 3LELC 5GSUD 5AVBA 3C1BD 1EQZB 3WTPB 5DNNC 1S32A 3WA9D 5AY8A 3REIC 2NQBC 3REHC 3FDDA 3RELB 1Q9CA 5B1MD 3C1CB 1KX4D 5CPKB 4H9NB 5B2JC 5B0YB 1P3IC 1M18B 1M1AD 3MNNB 5B33A 1BH9A 3NQJB 3MGRA 2JCHA 4WU8D 3UTBD 4J8XB 4J8VB 3AV2C 1P3KC 1JFIA 4LD9A 3KUYB 5AY8D 1U35D 1AOIA 1TAFA 1BH8B 4H9PA 3MGRD 1KX3C 4DRBA 4XUJC 3KXBB 1TZYA 2CV5D 4NE3A 5AV6B 3MGPC 5F99D 4LD9D 4AWLB 1P3LB 1AOID 4WZSB 2F8NK 4EO5B 4DQYB 3AZFC 5C3IC 3VH5A 5GT3A 3AV1C 5FUGB 5AVCB 2F8NA 1HQ3B 2XD1A 5B31G 3AZHB 3AZNA 3UTAD 3TU4D 4Z2MH 1WWSA 3AZKA 3B6GC 2RIQA 1M18C 2ZM5A 3W98C 4J8XC 2XD5A 3P5JB 3EPLA 5JA4B 2F8ND 1P3PA 2Y2IA 3AZND 1ID3B 4KGCA 5B24B 3AZKD 5B1LB 2NZDA 4G92C 3W99C 3MVDB 4ZUXD 3LJAA 4CAYA 4J8UA 2IO5C 3UT9B 4X23B 4AWLC 5B2ID 1P3LC 4KGCD 4YS3B 2NZDD 3X1UB 4KUDA 4JJNC 2JSSA 5AVCC 3WAAB 5CHLB 1HQ3C 4Z2MG 3LJAD 1M19B 3X1SB 4J8UD 3AZIA 5DNMB 3W97A 3AZGB 4Z5TC 3REJB 3WKJA 1KX5A 4Z66D 4ZBJB 4HGAB 2BYMA 5B32G 4KUDD 3O62B 1HTAA 3AZID 3AFAA 1P34B 4YM6A 5CPIB 1F66B 3WKJD 4H9OB 1KX5D 3AZLD 3B0BA 2YFWA 5BT1C 3UT9C 3LELA 3V9RB 2G5IC 3EPKA 5GT0B 5DNNA 2DF4C 5B0ZB 3AFAD 4YM6D 3REIA 2HIOA 1P3FC 3AN2B 3REHA 5B31B 2F8NH 3X1UC 2PYOD 3WAAC 3X1VC 5B2JA 1P3IA 1M19C 3B6FB 5AV9C 1P3AD 3MGQC 4CSRB 3AV2A 4H9RB 3NQUB 5DNND 4ZBJC 1P3KA 4HGAC 4WNNB 3REID 3AYWC 2NQBD 2ZY3A 4XZQB 4QLCC 3KWQB 2AROB 5B40D 2FFFB 5JRGC 5AV8C 2Y2KA 1ZLAB 1P3KD 2W8SA 3REKB 2DQNC 3LZ0B 1P3BC 4H9QB 1KX3D 4XUJD 3AV1A 5B0ZC 4R8PD 2F8NG 2Y2QA 5B31C 3MGPD 3A6NB 3B6GA 4H9NA 2HIOC 1P3GC 1M18A 2ZY2A 3W98A 3AZJD 2L5AA 5G49A 4J8XA 3AZED 1N1JA 3AZFD 5E5AB 5B32B 3AV1D 5KDMB 5AVBD 5GXQB 5CPJB 1S32D 3X1TC 3WA9B 3B6GD 1BH8A 3KWQC 3W98D 2AROC 2YFVB 3W99A 5B1MB 4J8XD 3VH5W 1M1AB 5B33D 4WJ3C 1ZLAC 4WU8B 2FJ7C 3UTBB 3REKC 2LY8A 4G91B 5CP6C 3LZ0C 1P3LA 3A1KA 3R45A 5AY8B 1U35B 3W99D 4JJNA 5AVCA 1HQ3A 1EQZC 3WTPC 3MGRB 2HUEB 4Z5TA 1TZYD 1T3UA 3RELC 1P3LD 2CV5B 3C1CC 5F99B 5CPKC 1JFIB 5B0YC 1BFMA 3MNNC 3B0DB 5E5AC 1AOIB 5BS7C 4JJND 4J8VC 5AVCD 5GXQC 5CPJC 5GT3D 3KUYC 4Z5TD 5AV5B 3UTAB 3LZ1B 3MVDA 3TU4B 5B1MC 1F1EA 3KXBC 2BYKB 1KU5A 3UT9A 3H0LC 5AV6C 4KHAB 1P3FA 1P3PD 2F8NB 1U35C 3X1UA 2BG1A 3WAAA 3X1VA 4EO5C 3AZKB 3W96B 1M19A 3B0CT 4NE6A 5AV9A 5BT1D 3MGQA 3AZHC 4ZUXB 2CV5C 2CWEA 1P3FD 3AYWA 5B2IB 4KGCB 3H0RC 4QLCA 3MGSB 3X1VD 3O62A 2NZDB 5AV9D 4WU9B 3MGQD 1P3OB 5AV5C 5JRGA 3EPJA 1ID3C 5AV8A 3UTAC 4J8UB 3LZ1C 3TU4C 3AZMB 5B24C 3W97D 5BO0B 5B1LC 3AYWD 1P3BA 3MVDC 4Z66B 3KSYA 4QLCD 3V9RA 5B0ZA 4X23C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVQ C;  5JRG D;  5B31 A;  1P3M B;  5AV8 D;  4H9S C;  4YS3 C;  1P3G A;  3W96 C;  5BNV A;  1H3O A;  1P3B D;  3WKJ B;  3B0C W;  3AZL B;  4CSR A;  4ZUX C;  3X1S C;  2BYM B;  5DNM C;  3AZG C;  5B0Z D;  4WNN A;  3LEL D;  3REJ C;  5B2I C;  5BNX A;  3X1T A;  3MGS C;  3AFA B;  2HIO D;  4M6B A;  1P3G D;  3REH D;  3KWQ A;  2ARO A;  4WU9 C;  2PYO B;  1P3O C;  5B2J D;  1P3I D;  3O62 C;  1ZLA A;  3AZM C;  1P34 C;  2FJ7 A;  1P3A B;  5CPI C;  1F66 C;  3REK A;  1B6W A;  3AV2 D;  5CP6 A;  3LZ0 A;  5DNN B;  3X1T D;  4J8W B;  3REI B;  4UUZ B;  2NQB B;  4H9Q A;  3KWQ D;  2ARO D;  1P3M C;  1EQZ A;  5GT0 C;  3WTP A;  5B40 B;  2FJ7 D;  3AN2 C;  5CP6 D;  3REL A;  3C1C A;  5CPK A;  1P3K B;  5B0Y A;  3AZL C;  3MNN A;  3B6F C;  3NQJ A;  5E5A A;  5KDM A;  5BS7 A;  4J8V A;  5GXQ A;  5CPJ A;  1EQZ D;  3WTP D;  1KX3 B;  4XUJ B;  3KUY A;  4R8P B;  5GSU B;  4XZQ C;  3C1B B;  3REL D;  3MGP B;  3C1C D;  4E45 A;  5B1M A;  5CPK D;  2PYO C;  5B0Y D;  1M18 D;  3MNN D;  5E5A D;  3AZJ B;  3KXB A;  1P3A C;  4J8V D;  1KX4 B;  3AZE B;  3AZF B;  5GXQ D;  5CPJ D;  5AV6 A;  5C3I B;  3KUY D;  4J8W C;  3AV1 B;  5AVB B;  1U35 A;  1S32 B;  3B6G B;  3W98 B;  5FUG A;  3VH6 A;  3KXB D;  5B40 C;  5G49 B;  1N1J B;  3AZH A;  5AV6 D;  2CV5 A;  5B33 B;  1BH9 B;  3A6N C;  5F99 A;  4NFT A;  4LD9 B;  5B32 C;  4G92 B;  3W99 B;  5JA4 A;  1TAF B;  1HQ3 D;  4R8P C;  5AV5 A;  5GSU C;  3AZH D;  1ID3 A;  3C1B C;  4H9P B;  3UTA A;  2IO5 B;  4E44 A;  3LZ1 A;  5B24 A;  3TU4 A;  4DRA A;  3WA9 C;  5B1L A;  1TZY B;  3AZJ C;  2BYK A;  3R45 B;  1A7W A;  1KX4 C;  3AZE C;  1M1A C;  4WU8 C;  3UTB C;  4KHA A;  4X23 A;  4JJN B;  4G91 C;  5AV5 D;  5AVB C;  1ID3 D;  4H9S A;  4YS3 A;  3LZ1 D;  5GT3 B;  5B24 D;  1S32 C;  3W96 A;  5B1L D;  5AY8 C;  4Z5T B;  3AZN B;  3MVD D;  4ZUX A;  3X1S A;  5DNM A;  3MGR C;  5B33 C;  3AZG A;  2HUE C;  3UT9 D;  4X23 D;  3REJ A;  2RVQ D;  5B2I A;  4YS3 D;  5F99 C;  3MGS A;  4LD9 C;  1ULY A;  3W96 D;  3B0D C;  1P3P B;  3X1U D;  1AOI C;  3WAA D;  4WU9 A;  1P3O A;  1M19 D;  3X1S D;  5DNM D;  3AZG D;  3AZM A;  1P34 A;  4NE5 A;  5BO0 A;  5CPI A;  1F66 A;  3REJ D;  1WWI A;  4H9O A;  1TZY C;  3LJA B;  4CAY B;  4Z66 A;  3MGS D;  1P3F B;  4WU9 D;  1P3O D;  3X1V B;  1P3M A;  5GT0 A;  3O62 D;  3AZM D;  5GT3 C;  1P34 D;  5AV9 B;  4KUD B;  3AN2 A;  5CPI D;  3MGQ B;  1F66 D;  3AZN C;  3AZI B;  3W97 B;  3AZL A;  3AZK C;  3B6F A;  3AYW B;  1KX5 B;  4QLC B;  4H9R A;  1P3M D;  5GT0 D;  3NQU A;  1R4V A;  3AN2 D;  5B31 D;  4XZQ A;  5JRG B;  1P3P C;  4KGC C;  5AV8 B;  2PYO A;  4YM6 B;  3WTP E;  3B6F D;  1P3B B;  2NZD C;  3VH6 T;  1P3A A;  2YFW B;  3LJA C;  4J8U C;  4J8W A;  3LEL B;  4UUZ A;  2NQB A;  4XZQ D;  4Z66 C;  2HIO B;  1P3G B;  3REH B;  5BNV B;  1H3O B;  4WV4 B;  5B40 A;  4KUD C;  5B2J B;  1P3I B;  3A6N A;  1ZLA D;  3AZI C;  3W97 C;  4J8W D;  3REK D;  3LZ0 D;  3AV2 B;  3WKJ C;  1KX5 C;  5BNX B;  3X1T B;  5B32 A;  1KX3 A;  4XUJ A;  3VH5 T;  4R8P A;  5GSU A;  3C1B A;  3A6N D;  3MGP A;  3WA9 A;  3AFA C;  2FJ7 B;  4YM6 C;  1B67 A;  5CP6 B;  2YFV A;  3AZJ A;  1KX4 A;  3AZE A;  3AZF A;  1M1A A;  3VH6 W;  5B32 D;  4WU8 A;  3UTB A;  3LEL C;  5GSU D;  5AVB A;  3C1B D;  1EQZ B;  3WTP B;  5DNN C;  1S32 A;  3WA9 D;  5AY8 A;  3REI C;  2NQB C;  3REH C;  3REL B;  1Q9C A;  5B1M D;  3C1C B;  1KX4 D;  5CPK B;  4H9N B;  5B2J C;  5B0Y B;  1P3I C;  1M18 B;  1M1A D;  3MNN B;  5B33 A;  1BH9 A;  3NQJ B;  3MGR A;  4WU8 D;  3UTB D;  4J8X B;  4J8V B;  3AV2 C;  1P3K C;  1JFI A;  4LD9 A;  3KUY B;  5AY8 D;  1U35 D;  1AOI A;  1TAF A;  1BH8 B;  4H9P A;  3MGR D;  1KX3 C;  4DRB A;  4XUJ C;  3KXB B;  1TZY A;  2CV5 D;  4NE3 A;  5AV6 B;  3MGP C;  5F99 D;  4LD9 D;  4AWL B;  1P3L B;  1AOI D;  4WZS B;  2F8N K;  4EO5 B;  3AZF C;  5C3I C;  3VH5 A;  5GT3 A;  3AV1 C;  5FUG B;  5AVC B;  2F8N A;  1HQ3 B;  5B31 G;  3AZN A;  3AZH B;  3UTA D;  3TU4 D;  4Z2M H;  1WWS A;  3AZK A;  3B6G C;  1M18 C;  3W98 C;  4J8X C;  5JA4 B;  2F8N D;  1P3P A;  3AZN D;  1ID3 B;  4KGC A;  5B24 B;  3AZK D;  5B1L B;  2NZD A;  4G92 C;  3W99 C;  3MVD B;  4ZUX D;  3LJA A;  4CAY A;  4J8U A;  2IO5 C;  3UT9 B;  4X23 B;  4AWL C;  5B2I D;  1P3L C;  4KGC D;  4YS3 B;  2NZD D;  3X1U B;  4KUD A;  4JJN C;  2JSS A;  5AVC C;  3WAA B;  5CHL B;  1HQ3 C;  4Z2M G;  3LJA D;  1M19 B;  3X1S B;  4J8U D;  3AZI A;  5DNM B;  3W97 A;  3AZG B;  4Z5T C;  3REJ B;  3WKJ A;  1KX5 A;  4Z66 D;  4ZBJ B;  4HGA B;  2BYM A;  5B32 G;  4KUD D;  3O62 B;  1HTA A;  3AZI D;  3AFA A;  1P34 B;  4YM6 A;  5CPI B;  1F66 B;  3WKJ D;  4H9O B;  1KX5 D;  3AZL D;  3B0B A;  2YFW A;  5BT1 C;  3UT9 C;  3LEL A;  3V9R B;  5GT0 B;  5DNN A;  5B0Z B;  3AFA D;  4YM6 D;  3REI A;  2HIO A;  1P3F C;  3AN2 B;  3REH A;  5B31 B;  2F8N H;  3X1U C;  2PYO D;  3WAA C;  3X1V C;  5B2J A;  1P3I A;  1M19 C;  3B6F B;  5AV9 C;  1P3A D;  3MGQ C;  4CSR B;  3AV2 A;  4H9R B;  3NQU B;  5DNN D;  4ZBJ C;  1P3K A;  4HGA C;  4WNN B;  3REI D;  3AYW C;  2NQB D;  4XZQ B;  4QLC C;  3KWQ B;  2ARO B;  5B40 D;  5JRG C;  5AV8 C;  1ZLA B;  1P3K D;  3REK B;  3LZ0 B;  1P3B C;  4H9Q B;  1KX3 D;  4XUJ D;  3AV1 A;  5B0Z C;  4R8P D;  2F8N G;  5B31 C;  3MGP D;  3A6N B;  3B6G A;  4H9N A;  2HIO C;  1P3G C;  1M18 A;  3W98 A;  3AZJ D;  2L5A A;  5G49 A;  4J8X A;  3AZE D;  1N1J A;  3AZF D;  5E5A B;  5B32 B;  3AV1 D;  5KDM B;  5AVB D;  5GXQ B;  5CPJ B;  1S32 D;  3X1T C;  3WA9 B;  3B6G D;  1BH8 A;  3KWQ C;  3W98 D;  2ARO C;  2YFV B;  3W99 A;  5B1M B;  4J8X D;  3VH5 W;  1M1A B;  5B33 D;  1ZLA C;  4WU8 B;  2FJ7 C;  3UTB B;  3REK C;  2LY8 A;  4G91 B;  5CP6 C;  3LZ0 C;  1P3L A;  3R45 A;  5AY8 B;  1U35 B;  3W99 D;  4JJN A;  5AVC A;  1HQ3 A;  1EQZ C;  3WTP C;  3MGR B;  2HUE B;  4Z5T A;  1TZY D;  3REL C;  1P3L D;  2CV5 B;  3C1C C;  5F99 B;  5CPK C;  1JFI B;  5B0Y C;  1BFM A;  3MNN C;  3B0D B;  5E5A C;  1AOI B;  5BS7 C;  4JJN D;  4J8V C;  5AVC D;  5GXQ C;  5CPJ C;  5GT3 D;  3KUY C;  4Z5T D;  5AV5 B;  3UTA B;  3LZ1 B;  3MVD A;  3TU4 B;  5B1M C;  1F1E A;  3KXB C;  2BYK B;  1KU5 A;  3UT9 A;  5AV6 C;  4KHA B;  1P3F A;  1P3P D;  2F8N B;  1U35 C;  3X1U A;  3WAA A;  3X1V A;  4EO5 C;  3AZK B;  3W96 B;  1M19 A;  3B0C T;  4NE6 A;  5AV9 A;  5BT1 D;  3MGQ A;  3AZH C;  4ZUX B;  2CV5 C;  2CWE A;  1P3F D;  3AYW A;  5B2I B;  4KGC B;  4QLC A;  3MGS B;  3X1V D;  3O62 A;  2NZD B;  5AV9 D;  4WU9 B;  3MGQ D;  1P3O B;  5AV5 C;  5JRG A;  1ID3 C;  5AV8 A;  3UTA C;  4J8U B;  3LZ1 C;  3TU4 C;  3AZM B;  5B24 C;  3W97 D;  5BO0 B;  5B1L C;  3AYW D;  1P3B A;  3MVD C;  4Z66 B;  3KSY A;  4QLC D;  3V9R A;  5B0Z A;  4X23 C; 
#chains in the Genus database with same CATH topology
 2RVQ C;  5JRG D;  5B31 A;  1P3M B;  5AV8 D;  4H9S C;  4YS3 C;  1P3G A;  3W96 C;  5BNV A;  1H3O A;  1P3B D;  3WKJ B;  3B0C W;  3AZL B;  4CSR A;  4ZUX C;  3X1S C;  2BYM B;  5DNM C;  3AZG C;  5B0Z D;  4WNN A;  3LEL D;  3REJ C;  5B2I C;  5BNX A;  3X1T A;  3MGS C;  3AFA B;  2HIO D;  4M6B A;  1P3G D;  3REH D;  3KWQ A;  2ARO A;  3KFU G;  4WU9 C;  2PYO B;  1P3O C;  5B2J D;  1P3I D;  3O62 C;  1ZLA A;  3AZM C;  1P34 C;  2FJ7 A;  3F6T A;  1P3A B;  5CPI C;  4UPK A;  3REK A;  1B6W A;  3AV2 D;  5CP6 A;  3LZ0 A;  1F66 C;  5DNN B;  3X1T D;  4J8W B;  3REI B;  4UUZ B;  2NQB B;  4H9Q A;  3KWQ D;  2ARO D;  1P3M C;  1EQZ A;  5GT0 C;  3WTP A;  5B40 B;  2FJ7 D;  1W2E A;  3AN2 C;  3EPH A;  5CP6 D;  3REL A;  3C1C A;  2JE5 A;  5CPK A;  1P3K B;  5B0Y A;  3AZL C;  3MNN A;  3B6F C;  3NQJ A;  5E5A A;  5KDM A;  5BS7 A;  4J8V A;  5GXQ A;  5CPJ A;  1EQZ D;  3WTP D;  1KX3 B;  4XUJ B;  3KUY A;  4R8P B;  5GSU B;  4XZQ C;  3C1B B;  3REL D;  3MGP B;  3C1C D;  4E45 A;  5B1M A;  5CPK D;  2PYO C;  5B0Y D;  1M18 D;  3MNN D;  5E5A D;  3AZJ B;  3KXB A;  2ZY5 A;  1P3A C;  4J8V D;  1KX4 B;  3AZE B;  3AZF B;  5AV6 A;  5GXQ D;  5CPJ D;  5C3I B;  2Y2H A;  2Y2G A;  3KUY D;  4J8W C;  3AV1 B;  5AVB B;  1U35 A;  1S32 B;  3A1I A;  3B6G B;  3W98 B;  5FUG A;  3VH6 A;  3KXB D;  5B40 C;  5G49 B;  1N1J B;  3AZH A;  5AV6 D;  2CV5 A;  5B33 B;  1BH9 B;  3A6N C;  5F99 A;  1PZR A;  4NFT A;  4LD9 B;  5B32 C;  4G92 B;  3W99 B;  5JA4 A;  1TAF B;  1HQ3 D;  4R8P C;  5AV5 A;  5GSU C;  3AZH D;  1ID3 A;  3AL0 C;  3C1B C;  4H9P B;  3UTA A;  2IO5 B;  4E44 A;  3LZ1 A;  5B24 A;  3TU4 A;  2G5H C;  4DRA A;  3WA9 C;  5B1L A;  1TZY B;  3AZJ C;  2BYK A;  3R45 B;  1A7W A;  1KX4 C;  3AZE C;  1M1A C;  4WU8 C;  3UTB C;  4KHA A;  4X23 A;  4JJN B;  5AV5 D;  4G91 C;  5AVB C;  1ID3 D;  4H9S A;  4YS3 A;  3LZ1 D;  5GT3 B;  5B24 D;  1S32 C;  3W96 A;  5B1L D;  5AY8 C;  4Z5T B;  3AZN B;  3MVD D;  2Y2L A;  4ZUX A;  3X1S A;  5DNM A;  3MGR C;  5B33 C;  3AZG A;  2HUE C;  3UT9 D;  4X23 D;  3REJ A;  2RVQ D;  5B2I A;  4YS3 D;  5F99 C;  3MGS A;  4LD9 C;  1ULY A;  3W96 D;  3B0D C;  1P3P B;  3EG5 B;  3X1U D;  1AOI C;  3WAA D;  2VQR A;  4WU9 A;  1P3O A;  1M19 D;  3X1S D;  5DNM D;  3AZG D;  3AZM A;  1P34 A;  4NE5 A;  5BO0 A;  5CPI A;  1F66 A;  3REJ D;  1WWI A;  4H9O A;  1TZY C;  3LJA B;  4CAY B;  2F2A C;  4Z66 A;  3MGS D;  1P3F B;  4WU9 D;  1P3O D;  3X1V B;  1P3M A;  5GT0 A;  3O62 D;  3AZM D;  5GT3 C;  1P34 D;  5AV9 B;  3IP4 C;  2UWX A;  4KUD B;  3AN2 A;  5CPI D;  3MGQ B;  1Z2C B;  1F66 D;  3AZN C;  3AZI B;  3W97 B;  3AZL A;  3AZK C;  3B6F A;  3AYW B;  1KX5 B;  4QLC B;  4H9R A;  1P3M D;  5GT0 D;  3NQU A;  1R4V A;  3AN2 D;  5B31 D;  4XZQ A;  5JRG B;  1P3P C;  4KGC C;  5AV8 B;  2PYO A;  4YM6 B;  3WTP E;  3B6F D;  1P3B B;  2NZD C;  3VH6 T;  1P3A A;  2YFW B;  3LJA C;  4J8U C;  4J8W A;  3LEL B;  4UUZ A;  2NQB A;  4XZQ D;  3H0M C;  4Z66 C;  2Y2N A;  2HIO B;  1P3G B;  3REH B;  5BNV B;  1H3O B;  4WV4 B;  5B40 A;  4KUD C;  5B2J B;  1P3I B;  3A6N A;  1ZLA D;  3AZI C;  3W97 C;  4J8W D;  2J8P A;  3REK D;  3LZ0 D;  3AV2 B;  3WKJ C;  1KX5 C;  5BNX B;  2Y2O A;  3X1T B;  5B32 A;  1KX3 A;  4XUJ A;  3VH5 T;  4R8P A;  5GSU A;  2Y2J A;  3C1B A;  2Y2M A;  3A6N D;  3MGP A;  3WA9 A;  3AFA C;  2FJ7 B;  4YM6 C;  1B67 A;  2Y2P A;  5CP6 B;  2YFV A;  3AZJ A;  1KX4 A;  3AZE A;  3AZF A;  1M1A A;  2ZY4 A;  3VH6 W;  5B32 D;  4WU8 A;  3UTB A;  3LEL C;  5GSU D;  5AVB A;  3C1B D;  1EQZ B;  3WTP B;  5DNN C;  1S32 A;  3WA9 D;  5AY8 A;  3REI C;  2NQB C;  3REH C;  3FDD A;  3REL B;  1Q9C A;  5B1M D;  3C1C B;  1KX4 D;  5CPK B;  4H9N B;  5B2J C;  5B0Y B;  1P3I C;  1M18 B;  1M1A D;  3MNN B;  5B33 A;  1BH9 A;  3NQJ B;  3MGR A;  2JCH A;  4WU8 D;  3UTB D;  4J8X B;  4J8V B;  3AV2 C;  1P3K C;  1JFI A;  4LD9 A;  3KUY B;  5AY8 D;  1U35 D;  1AOI A;  1TAF A;  1BH8 B;  4H9P A;  3MGR D;  1KX3 C;  4DRB A;  4XUJ C;  3KXB B;  1TZY A;  2CV5 D;  4NE3 A;  5AV6 B;  3MGP C;  5F99 D;  4LD9 D;  4AWL B;  1P3L B;  1AOI D;  4WZS B;  2F8N K;  4EO5 B;  4DQY B;  3AZF C;  5C3I C;  3VH5 A;  5GT3 A;  3AV1 C;  5FUG B;  5AVC B;  2F8N A;  1HQ3 B;  2XD1 A;  5B31 G;  3AZH B;  3AZN A;  3UTA D;  3TU4 D;  4Z2M H;  1WWS A;  3AZK A;  3B6G C;  2RIQ A;  1M18 C;  2ZM5 A;  3W98 C;  4J8X C;  2XD5 A;  3P5J B;  3EPL A;  5JA4 B;  2F8N D;  1P3P A;  2Y2I A;  3AZN D;  1ID3 B;  4KGC A;  5B24 B;  3AZK D;  5B1L B;  2NZD A;  4G92 C;  3W99 C;  3MVD B;  4ZUX D;  3LJA A;  4CAY A;  4J8U A;  2IO5 C;  3UT9 B;  4X23 B;  4AWL C;  5B2I D;  1P3L C;  4KGC D;  4YS3 B;  2NZD D;  3X1U B;  4KUD A;  4JJN C;  2JSS A;  5AVC C;  3WAA B;  5CHL B;  1HQ3 C;  4Z2M G;  3LJA D;  1M19 B;  3X1S B;  4J8U D;  3AZI A;  5DNM B;  3W97 A;  3AZG B;  4Z5T C;  3REJ B;  3WKJ A;  1KX5 A;  4Z66 D;  4ZBJ B;  4HGA B;  2BYM A;  5B32 G;  4KUD D;  3O62 B;  1HTA A;  3AZI D;  3AFA A;  1P34 B;  4YM6 A;  5CPI B;  1F66 B;  3WKJ D;  4H9O B;  1KX5 D;  3AZL D;  3B0B A;  2YFW A;  5BT1 C;  3UT9 C;  3LEL A;  3V9R B;  2G5I C;  3EPK A;  5GT0 B;  5DNN A;  2DF4 C;  5B0Z B;  3AFA D;  4YM6 D;  3REI A;  2HIO A;  1P3F C;  3AN2 B;  3REH A;  5B31 B;  2F8N H;  3X1U C;  2PYO D;  3WAA C;  3X1V C;  5B2J A;  1P3I A;  1M19 C;  3B6F B;  5AV9 C;  1P3A D;  3MGQ C;  4CSR B;  3AV2 A;  4H9R B;  3NQU B;  5DNN D;  4ZBJ C;  1P3K A;  4HGA C;  4WNN B;  3REI D;  3AYW C;  2NQB D;  2ZY3 A;  4XZQ B;  4QLC C;  3KWQ B;  2ARO B;  5B40 D;  2FFF B;  5JRG C;  5AV8 C;  2Y2K A;  1ZLA B;  1P3K D;  2W8S A;  3REK B;  2DQN C;  3LZ0 B;  1P3B C;  4H9Q B;  1KX3 D;  4XUJ D;  3AV1 A;  5B0Z C;  4R8P D;  2F8N G;  2Y2Q A;  5B31 C;  3MGP D;  3A6N B;  3B6G A;  4H9N A;  2HIO C;  1P3G C;  1M18 A;  2ZY2 A;  3W98 A;  3AZJ D;  2L5A A;  5G49 A;  4J8X A;  3AZE D;  1N1J A;  3AZF D;  5E5A B;  5B32 B;  3AV1 D;  5KDM B;  5AVB D;  5GXQ B;  5CPJ B;  1S32 D;  3X1T C;  3WA9 B;  3B6G D;  1BH8 A;  3KWQ C;  3W98 D;  2ARO C;  2YFV B;  3W99 A;  5B1M B;  4J8X D;  3VH5 W;  1M1A B;  5B33 D;  4WJ3 C;  1ZLA C;  4WU8 B;  2FJ7 C;  3UTB B;  3REK C;  2LY8 A;  4G91 B;  5CP6 C;  3LZ0 C;  1P3L A;  3A1K A;  3R45 A;  5AY8 B;  1U35 B;  3W99 D;  4JJN A;  5AVC A;  1HQ3 A;  1EQZ C;  3WTP C;  3MGR B;  2HUE B;  4Z5T A;  1TZY D;  1T3U A;  3REL C;  1P3L D;  2CV5 B;  3C1C C;  5F99 B;  5CPK C;  1JFI B;  5B0Y C;  1BFM A;  3MNN C;  3B0D B;  5E5A C;  1AOI B;  5BS7 C;  4JJN D;  4J8V C;  5AVC D;  5GXQ C;  5CPJ C;  5GT3 D;  3KUY C;  4Z5T D;  5AV5 B;  3UTA B;  3LZ1 B;  3MVD A;  3TU4 B;  5B1M C;  1F1E A;  3KXB C;  2BYK B;  1KU5 A;  3UT9 A;  3H0L C;  5AV6 C;  4KHA B;  1P3F A;  1P3P D;  2F8N B;  1U35 C;  3X1U A;  2BG1 A;  3WAA A;  3X1V A;  4EO5 C;  3AZK B;  3W96 B;  1M19 A;  3B0C T;  4NE6 A;  5AV9 A;  5BT1 D;  3MGQ A;  3AZH C;  4ZUX B;  2CV5 C;  2CWE A;  1P3F D;  3AYW A;  5B2I B;  4KGC B;  3H0R C;  4QLC A;  3MGS B;  3X1V D;  3O62 A;  2NZD B;  5AV9 D;  4WU9 B;  3MGQ D;  1P3O B;  5AV5 C;  5JRG A;  3EPJ A;  1ID3 C;  5AV8 A;  3UTA C;  4J8U B;  3LZ1 C;  3TU4 C;  3AZM B;  5B24 C;  3W97 D;  5BO0 B;  5B1L C;  3AYW D;  1P3B A;  3MVD C;  4Z66 B;  3KSY A;  4QLC D;  3V9R A;  5B0Z A;  4X23 C; 
#chains in the Genus database with same CATH homology
 2RVQ C;  5JRG D;  5B31 A;  1P3M B;  5AV8 D;  4H9S C;  4YS3 C;  1P3G A;  3W96 C;  5BNV A;  1H3O A;  1P3B D;  3WKJ B;  3B0C W;  3AZL B;  4CSR A;  4ZUX C;  3X1S C;  2BYM B;  5DNM C;  3AZG C;  5B0Z D;  4WNN A;  3LEL D;  3REJ C;  5B2I C;  5BNX A;  3X1T A;  3MGS C;  3AFA B;  2HIO D;  4M6B A;  1P3G D;  3REH D;  3KWQ A;  2ARO A;  3KFU G;  4WU9 C;  2PYO B;  1P3O C;  5B2J D;  1P3I D;  3O62 C;  1ZLA A;  3AZM C;  1P34 C;  2FJ7 A;  3F6T A;  1P3A B;  5CPI C;  4UPK A;  3REK A;  1B6W A;  3AV2 D;  5CP6 A;  3LZ0 A;  1F66 C;  5DNN B;  3X1T D;  4J8W B;  3REI B;  4UUZ B;  2NQB B;  4H9Q A;  3KWQ D;  2ARO D;  1P3M C;  1EQZ A;  5GT0 C;  3WTP A;  5B40 B;  2FJ7 D;  1W2E A;  3AN2 C;  3EPH A;  5CP6 D;  3REL A;  3C1C A;  2JE5 A;  5CPK A;  1P3K B;  5B0Y A;  3AZL C;  3MNN A;  3B6F C;  3NQJ A;  5E5A A;  5KDM A;  5BS7 A;  4J8V A;  5GXQ A;  5CPJ A;  1EQZ D;  3WTP D;  1KX3 B;  4XUJ B;  3KUY A;  4R8P B;  5GSU B;  4XZQ C;  3C1B B;  3REL D;  3MGP B;  3C1C D;  4E45 A;  5B1M A;  5CPK D;  2PYO C;  5B0Y D;  1M18 D;  3MNN D;  5E5A D;  3AZJ B;  3KXB A;  2ZY5 A;  1P3A C;  4J8V D;  1KX4 B;  3AZE B;  3AZF B;  5AV6 A;  5GXQ D;  5CPJ D;  5C3I B;  2Y2H A;  2Y2G A;  3KUY D;  4J8W C;  3AV1 B;  5AVB B;  1U35 A;  1S32 B;  3A1I A;  3B6G B;  3W98 B;  5FUG A;  3VH6 A;  3KXB D;  5B40 C;  5G49 B;  1N1J B;  3AZH A;  5AV6 D;  2CV5 A;  5B33 B;  1BH9 B;  3A6N C;  5F99 A;  1PZR A;  4NFT A;  4LD9 B;  5B32 C;  4G92 B;  3W99 B;  5JA4 A;  1TAF B;  1HQ3 D;  4R8P C;  5AV5 A;  5GSU C;  3AZH D;  1ID3 A;  3AL0 C;  3C1B C;  4H9P B;  3UTA A;  2IO5 B;  4E44 A;  3LZ1 A;  5B24 A;  3TU4 A;  2G5H C;  4DRA A;  3WA9 C;  5B1L A;  1TZY B;  3AZJ C;  2BYK A;  3R45 B;  1A7W A;  1KX4 C;  3AZE C;  1M1A C;  4WU8 C;  3UTB C;  4KHA A;  4X23 A;  4JJN B;  5AV5 D;  4G91 C;  5AVB C;  1ID3 D;  4H9S A;  4YS3 A;  3LZ1 D;  5GT3 B;  5B24 D;  1S32 C;  3W96 A;  5B1L D;  5AY8 C;  4Z5T B;  3AZN B;  3MVD D;  2Y2L A;  4ZUX A;  3X1S A;  5DNM A;  3MGR C;  5B33 C;  3AZG A;  2HUE C;  3UT9 D;  4X23 D;  3REJ A;  2RVQ D;  5B2I A;  4YS3 D;  5F99 C;  3MGS A;  4LD9 C;  1ULY A;  3W96 D;  3B0D C;  1P3P B;  3EG5 B;  3X1U D;  1AOI C;  3WAA D;  2VQR A;  4WU9 A;  1P3O A;  1M19 D;  3X1S D;  5DNM D;  3AZG D;  3AZM A;  1P34 A;  4NE5 A;  5BO0 A;  5CPI A;  1F66 A;  3REJ D;  1WWI A;  4H9O A;  1TZY C;  3LJA B;  4CAY B;  2F2A C;  4Z66 A;  3MGS D;  1P3F B;  4WU9 D;  1P3O D;  3X1V B;  1P3M A;  5GT0 A;  3O62 D;  3AZM D;  5GT3 C;  1P34 D;  5AV9 B;  3IP4 C;  2UWX A;  4KUD B;  3AN2 A;  5CPI D;  3MGQ B;  1Z2C B;  1F66 D;  3AZN C;  3AZI B;  3W97 B;  3AZL A;  3AZK C;  3B6F A;  3AYW B;  1KX5 B;  4QLC B;  4H9R A;  1P3M D;  5GT0 D;  3NQU A;  1R4V A;  3AN2 D;  5B31 D;  4XZQ A;  5JRG B;  1P3P C;  4KGC C;  5AV8 B;  2PYO A;  4YM6 B;  3WTP E;  3B6F D;  1P3B B;  2NZD C;  3VH6 T;  1P3A A;  2YFW B;  3LJA C;  4J8U C;  4J8W A;  3LEL B;  4UUZ A;  2NQB A;  4XZQ D;  3H0M C;  4Z66 C;  2Y2N A;  2HIO B;  1P3G B;  3REH B;  5BNV B;  1H3O B;  4WV4 B;  5B40 A;  4KUD C;  5B2J B;  1P3I B;  3A6N A;  1ZLA D;  3AZI C;  3W97 C;  4J8W D;  2J8P A;  3REK D;  3LZ0 D;  3AV2 B;  3WKJ C;  1KX5 C;  5BNX B;  2Y2O A;  3X1T B;  5B32 A;  1KX3 A;  4XUJ A;  3VH5 T;  4R8P A;  5GSU A;  2Y2J A;  3C1B A;  2Y2M A;  3A6N D;  3MGP A;  3WA9 A;  3AFA C;  2FJ7 B;  4YM6 C;  1B67 A;  2Y2P A;  5CP6 B;  2YFV A;  3AZJ A;  1KX4 A;  3AZE A;  3AZF A;  1M1A A;  2ZY4 A;  3VH6 W;  5B32 D;  4WU8 A;  3UTB A;  3LEL C;  5GSU D;  5AVB A;  3C1B D;  1EQZ B;  3WTP B;  5DNN C;  1S32 A;  3WA9 D;  5AY8 A;  3REI C;  2NQB C;  3REH C;  3FDD A;  3REL B;  1Q9C A;  5B1M D;  3C1C B;  1KX4 D;  5CPK B;  4H9N B;  5B2J C;  5B0Y B;  1P3I C;  1M18 B;  1M1A D;  3MNN B;  5B33 A;  1BH9 A;  3NQJ B;  3MGR A;  2JCH A;  4WU8 D;  3UTB D;  4J8X B;  4J8V B;  3AV2 C;  1P3K C;  1JFI A;  4LD9 A;  3KUY B;  5AY8 D;  1U35 D;  1AOI A;  1TAF A;  1BH8 B;  4H9P A;  3MGR D;  1KX3 C;  4DRB A;  4XUJ C;  3KXB B;  1TZY A;  2CV5 D;  4NE3 A;  5AV6 B;  3MGP C;  5F99 D;  4LD9 D;  4AWL B;  1P3L B;  1AOI D;  4WZS B;  2F8N K;  4EO5 B;  4DQY B;  3AZF C;  5C3I C;  3VH5 A;  5GT3 A;  3AV1 C;  5FUG B;  5AVC B;  2F8N A;  1HQ3 B;  2XD1 A;  5B31 G;  3AZH B;  3AZN A;  3UTA D;  3TU4 D;  4Z2M H;  1WWS A;  3AZK A;  3B6G C;  2RIQ A;  1M18 C;  2ZM5 A;  3W98 C;  4J8X C;  2XD5 A;  3P5J B;  3EPL A;  5JA4 B;  2F8N D;  1P3P A;  2Y2I A;  3AZN D;  1ID3 B;  4KGC A;  5B24 B;  3AZK D;  5B1L B;  2NZD A;  4G92 C;  3W99 C;  3MVD B;  4ZUX D;  3LJA A;  4CAY A;  4J8U A;  2IO5 C;  3UT9 B;  4X23 B;  4AWL C;  5B2I D;  1P3L C;  4KGC D;  4YS3 B;  2NZD D;  3X1U B;  4KUD A;  4JJN C;  2JSS A;  5AVC C;  3WAA B;  5CHL B;  1HQ3 C;  4Z2M G;  3LJA D;  1M19 B;  3X1S B;  4J8U D;  3AZI A;  5DNM B;  3W97 A;  3AZG B;  4Z5T C;  3REJ B;  3WKJ A;  1KX5 A;  4Z66 D;  4ZBJ B;  4HGA B;  2BYM A;  5B32 G;  4KUD D;  3O62 B;  1HTA A;  3AZI D;  3AFA A;  1P34 B;  4YM6 A;  5CPI B;  1F66 B;  3WKJ D;  4H9O B;  1KX5 D;  3AZL D;  3B0B A;  2YFW A;  5BT1 C;  3UT9 C;  3LEL A;  3V9R B;  2G5I C;  3EPK A;  5GT0 B;  5DNN A;  2DF4 C;  5B0Z B;  3AFA D;  4YM6 D;  3REI A;  2HIO A;  1P3F C;  3AN2 B;  3REH A;  5B31 B;  2F8N H;  3X1U C;  2PYO D;  3WAA C;  3X1V C;  5B2J A;  1P3I A;  1M19 C;  3B6F B;  5AV9 C;  1P3A D;  3MGQ C;  4CSR B;  3AV2 A;  4H9R B;  3NQU B;  5DNN D;  4ZBJ C;  1P3K A;  4HGA C;  4WNN B;  3REI D;  3AYW C;  2NQB D;  2ZY3 A;  4XZQ B;  4QLC C;  3KWQ B;  2ARO B;  5B40 D;  2FFF B;  5JRG C;  5AV8 C;  2Y2K A;  1ZLA B;  1P3K D;  2W8S A;  3REK B;  2DQN C;  3LZ0 B;  1P3B C;  4H9Q B;  1KX3 D;  4XUJ D;  3AV1 A;  5B0Z C;  4R8P D;  2F8N G;  2Y2Q A;  5B31 C;  3MGP D;  3A6N B;  3B6G A;  4H9N A;  2HIO C;  1P3G C;  1M18 A;  2ZY2 A;  3W98 A;  3AZJ D;  2L5A A;  5G49 A;  4J8X A;  3AZE D;  1N1J A;  3AZF D;  5E5A B;  5B32 B;  3AV1 D;  5KDM B;  5AVB D;  5GXQ B;  5CPJ B;  1S32 D;  3X1T C;  3WA9 B;  3B6G D;  1BH8 A;  3KWQ C;  3W98 D;  2ARO C;  2YFV B;  3W99 A;  5B1M B;  4J8X D;  3VH5 W;  1M1A B;  5B33 D;  4WJ3 C;  1ZLA C;  4WU8 B;  2FJ7 C;  3UTB B;  3REK C;  2LY8 A;  4G91 B;  5CP6 C;  3LZ0 C;  1P3L A;  3A1K A;  3R45 A;  5AY8 B;  1U35 B;  3W99 D;  4JJN A;  5AVC A;  1HQ3 A;  1EQZ C;  3WTP C;  3MGR B;  2HUE B;  4Z5T A;  1TZY D;  1T3U A;  3REL C;  1P3L D;  2CV5 B;  3C1C C;  5F99 B;  5CPK C;  1JFI B;  5B0Y C;  1BFM A;  3MNN C;  3B0D B;  5E5A C;  1AOI B;  5BS7 C;  4JJN D;  4J8V C;  5AVC D;  5GXQ C;  5CPJ C;  5GT3 D;  3KUY C;  4Z5T D;  5AV5 B;  3UTA B;  3LZ1 B;  3MVD A;  3TU4 B;  5B1M C;  1F1E A;  3KXB C;  2BYK B;  1KU5 A;  3UT9 A;  3H0L C;  5AV6 C;  4KHA B;  1P3F A;  1P3P D;  2F8N B;  1U35 C;  3X1U A;  2BG1 A;  3WAA A;  3X1V A;  4EO5 C;  3AZK B;  3W96 B;  1M19 A;  3B0C T;  4NE6 A;  5AV9 A;  5BT1 D;  3MGQ A;  3AZH C;  4ZUX B;  2CV5 C;  2CWE A;  1P3F D;  3AYW A;  5B2I B;  4KGC B;  3H0R C;  4QLC A;  3MGS B;  3X1V D;  3O62 A;  2NZD B;  5AV9 D;  4WU9 B;  3MGQ D;  1P3O B;  5AV5 C;  5JRG A;  3EPJ A;  1ID3 C;  5AV8 A;  3UTA C;  4J8U B;  3LZ1 C;  3TU4 C;  3AZM B;  5B24 C;  3W97 D;  5BO0 B;  5B1L C;  3AYW D;  1P3B A;  3MVD C;  4Z66 B;  3KSY A;  4QLC D;  3V9R A;  5B0Z A;  4X23 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...