3X1VB

Crystal structure of nucleosome core particle in the presence of histone variant involved in reprogramming
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
b'DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
molecule tags Structural protein/dna
source organism Homo sapiens
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1vB00
3W98A 3MVDA 3AZGC 4JJNC 4H9QB 5AVCD 3AZGA 4WU9C 5KDMA 4WU8A 3NQUA 2AROC 5B32C 3MNNB 4J8XC 5B1MC 3AN2C 5AVCA 3MGRC 3UTAB 3WTPC 4LD9B 5B40A 3MVDD 5GT3A 3AV1B 4ZBJB 3W98B 4QLCB 3AZHD 4H9SC 3REJD 4X23B 3KWQC 3W97D 3R45A 3B6GA 5AY8A 5B0ZA 4J8WD 2NQBC 3RELA 5DNMA 3REHB 3AZJC 1EQZB 5CPKA 5BS7A 3LZ0B 3REJA 5AVBD 3W99D 3LZ1B 2NQBB 4X23A 5AV5B 4CSRA 3C1CB 3W96C 1JFIA 3AYWB 4Z5TD 1R4VA 1P3LB 3X1VC 3REKC 5BO0A 3UT9A 1P3AA 2BYMB 1KX5B 3AZNC 3AN2B 3AZKA 3UT9D 4DRBA 3AV1C 3C1BD 3AV2B 1KX3B 2PYOD 4G91B 3C1CA 1P3PD 3AZFB 1N1JA 4YM6B 4XUJD 5GT3B 3AZMD 1U35D 3LZ1A 5B2IC 4H9PA 5JA4B 1P3OC 3MNNA 3AFAD 3UTBB 3AZFC 3A6NC 5B24D 4WNNA 3AZIC 3LELA 1P3BA 1N1JB 3KUYA 4G92C 5GSUB 4XUJA 3LZ0D 3AZMA 1AOIC 4DRAA 2F8NG 4Z2MH 3AZEC 3B6FB 5GSUC 3REHD 4NE3A 3B6FD 1M1AB 3C1CD 1P3PA 5DNMB 5B40C 5B32D 4J8XD 5B1MD 1Q9CA 2NZDD 3AZGB 5AV9D 4H9QA 5GT0B 3MGRD 3AN2A 2RVQD 5B1MA 3W98D 3WKJD 3O62B 3AZHC 3B6FA 4UUZB 4J8VD 3A6NA 3LJAB 3X1SC 4NFTA 5CPJC 2NQBD 3AV2A 1KX3A 3AZIA 1U35B 1HQ3A 5B2JA 4X23C 1BH9B 3KWQB 3MGQC 3AZJD 1M19A 3AZKB 1HQ3C 3AZLC 3RELD 2F8NB 4J8UA 4UUZA 3WTPE 4Z66A 3NQJB 5B33D 1F66D 2NQBA 5BT1C 4NE6A 1P3OB 3REKD 5AV5A 3X1VD 2HUEB 1M19B 1BH9A 5B32G 1M1AA 3UT9C 3AZIB 2F8NA 2HIOD 3B0DB 5DNND 4KGCA 4YM6D 3X1UC 1ID3C 4WU8D 4QLCD 3AZHB 3RELB 2F8ND 1S32D 5GXQD 4Z5TB 5C3IC 1P34C 1BFMA 3AZLA 4G91C 3O62D 1TZYB 5E5AC 5GT0A 5AV5D 5JRGA 4Z66B 3REJB 4KUDB 5GT0D 3MGRB 5CP6A 4ZUXD 3LJAD 3REIB 4Z66D 2FJ7A 3KUYD 5G49B 4R8PA 5BNXA 5B0YC 5BNVB 5AV8A 3MGSA 3MNND 2HIOA 5CPJB 1AOID 1P3MC 1KX4C 3AZED 4H9SA 3A6NB 3LJAA 3AZNA 3WTPA 4XUJB 3AZMB 3C1CC 1EQZC 4R8PB 4H9OA 4JJND 5AVCC 4WU9D 3X1TD 5F99B 3UTAD 3TU4C 3B0BA 4J8WB 3WA9C 2YFVB 3KXBD 2PYOA 2AROD 2RVQC 3AN2D 3B6GB 4WZSB 4J8UD 3R45B 2JSSA 5FUGA 5B31G 5CPKC 4J8VC 3V9RA 3VH6T 3AZJA 3MGPA 3X1SD 1M19D 4LD9C 2YFWB 1P3GD 3REJC 5DNMC 3KWQD 5CPKB 5GXQB 5AV6A 2L5AA 4H9NA 1WWSA 5B1MB 5F99A 2F8NH 4X23D 3B6GC 3NQUB 3MGQD 1P3MA 3B0CT 4WV4B 3X1UB 1ID3B 3AZLD 3RELC 5B1LB 1ZLAB 1HQ3B 4Z2MG 3WAAB 1M18C 5B1LD 5AVBC 4YS3C 5AV9A 3W99C 1BH8A 2AROA 1TAFA 2CV5C 3W99B 5B31D 3LELB 1P3BB 3REHA 1H3OA 1P3GB 1M18B 3AZND 5BNXB 1P3FC 2IO5C 1P3MB 3WA9A 4AWLB 5B24A 3AZEB 4KHAB 3X1UD 4WU8C 1ID3D 2NZDB 4EO5C 2PYOC 2AROB 4XZQA 1P34D 1P3AD 3AFAA 3AYWA 3WTPB 4R8PD 5AV5C 5E5AD 4JJNB 5AV8C 3TU4B 4Z5TA 1M18A 3LJAC 5CPIB 4Z66C 5KDMB 3B0CW 1H3OB 1P3GA 3AFAC 3REIA 5CP6B 3AZFD 2FJ7B 5AV6B 3VH5A 5G49A 5GT3C 5GXQA 3X1SB 3C1BA 3MGPC 3AFAB 1P3ID 4KUDA 4YM6A 5AV6C 1ZLAD 2NZDA 3LZ0C 3VH5W 4J8UB 1P3KB 1KX4B 5CPJA 5GSUD 3REHC 3W97A 3KXBB 1EQZD 1TZYD 3UTAC 3AZHA 4NE5A 3B6FC 4KGCC 3TU4D 1P3FB 1EQZA 1F66A 5B40D 1M1AC 5B31A 2NZDC 3W99A 5AV9C 3UTBC 3WKJC 5AV9B 5CPKD 1P3KA 4CSRB 4LD9D 1P3GC 5DNMD 4E44A 4WU9B 5B0YA 3MGSC 1F66B 5B31B 2BYMA 1KX5A 5CP6C 4H9NB 2FJ7C 3AV2C 1KX3C 5JRGD 1A7WA 5CPID 5F99D 5B2JC 1KX5D 2YFWA 4H9RA 1M18D 5B1LC 4ZBJC 1S32A 4YS3D 1P3OA 1KU5A 4XZQD 1P34A 2CV5D 5B33C 3MGQB 5BT1D 5B32B 1B6WA 4J8XB 3WAAA 1HTAA 5CHLB 1P3LA 3WAAD 3UTBA 4G92B 3AZLB 2HIOC 4H9OB 5AVBA 5DNNC 5B33B 1TZYA 5JRGB 2CWEA 1P3AC 2IO5B 3LELC 1P3BC 3W97C 4R8PC 5AV8D 4J8WC 4XZQB 3KSYA 3O62C 3AZFA 3WA9B 4M6BA 3W96A 4KHAA 5DNNB 5GT0C 4ZUXC 3KUYC 5AY8B 5B0ZB 4EO5B 5CPIA 5B0YD 4H9PB 5JA4A 3AYWD 5E5AB 3MNNC 1ZLAC 3X1SA 3C1BB 4Z5TC 5C3IB 1P34B 4E45A 3KUYB 4HGAB 3AZKC 1TZYC 4KGCD 5B2JB 3X1TA 1P3KC 3WA9D 3X1TC 3KXBA 3REKA 5BNVA 3X1VA 1M1AD 1P3PB 3MVDB 3KXBC 3AV1D 5B2IB 5BO0B 1KX4A 1P3FA 1P3AB 1P3PC 4J8UC 3W97B 4XUJC 3AZMC 3VH6A 1AOIA 5GSUA 4KUDD 5B24B 3AZEA 3NQJA 1M19C 5AVCB 3VH5T 2BYKB 1ZLAA 5B1LA 5B40B 3MGSD 5AV8B 4J8WA 4YS3A 1P3OD 5CP6D 5BS7C 4ZUXA 3AV2D 1KX3D 5JRGC 2FJ7D 2PYOB 3B6GD 5CPIC 5B2JD 3LZ1D 1KX5C 1TAFB 3KWQA 3AZID 3REIC 3AZNB 5AY8C 5B0ZC 2LY8A 3O62A 1P3LC 1S32B 4WNNB 4LD9A 5B31C 3AZGD 5DNNA 3UTAA 3WAAC 5B32A 4J8XA 4YS3B 3W98C 1P3FD 3VH6W 4WU9A 3V9RB 3AZJB 3WTPD 3TU4A 1BH8B 3MVDC 3LELD 1P3BD 4CAYB 5B33A 5AVBB 5CPJD 1AOIB 2CV5A 4J8VB 1HQ3D 3WKJB 1F1EA 3REKB 3X1VB 4ZUXB 2BYKA 1U35A 1ULYA 3AYWC 5GT3D 1JFIB 3MGPD 3W96B 1P3IC 5AV6D 3MGSB 1F66C 4H9RB 3MGPB 3W96D 5E5AA 3AZKD 3WKJA 1P3KD 3MGRA 3X1UA 1ID3A 1P3IB 4YM6C 3X1TB 1B67A 4QLCC 3C1BC 3UTBD 1WWIA 4JJNA 1S32C 5GXQC 5B0YB 2HIOB 4HGAC 4KUDC 4AWLC 4KGCB 1U35C 3LZ0A 5FUGB 4CAYA 5B2IA 2F8NK 5B2ID 1P3IA 4WU8B 3LZ1C 2YFVA 3REID 5F99C 2CV5B 3A6ND 5AY8D 5B0ZD 3UT9B 5B24C 3B0DC 3MGQA 4J8VA 1P3MD 1KX4D 3AV1A 1P3LD 4XZQC 2HUEC 4QLCA
chains in the Genus database with same CATH superfamily
3W98A 3MVDA 3AZGC 4JJNC 4H9QB 5AVCD 3AZGA 4WU9C 5KDMA 4WU8A 3NQUA 2AROC 5B32C 3MNNB 4J8XC 5B1MC 3AN2C 5AVCA 3MGRC 3UTAB 3WTPC 4LD9B 5B40A 3MVDD 5GT3A 3AV1B 3H0MC 4ZBJB 3W98B 4QLCB 3AZHD 4H9SC 3REJD 4X23B 3KWQC 3W97D 3R45A 3B6GA 5AY8A 5B0ZA 2Y2GA 4J8WD 2NQBC 3RELA 5DNMA 3REHB 3AZJC 1EQZB 5CPKA 5BS7A 3LZ0B 3REJA 5AVBD 3W99D 3LZ1B 2NQBB 2JE5A 5AV5B 4X23A 4CSRA 3C1CB 3W96C 1JFIA 3AYWB 4Z5TD 1R4VA 1P3LB 3X1VC 3REKC 5BO0A 3UT9A 1P3AA 2BYMB 1KX5B 3AZNC 3AN2B 3AZKA 3UT9D 4DRBA 3AV1C 3C1BD 3AV2B 1KX3B 2PYOD 4G91B 3C1CA 1P3PD 3AZFB 1N1JA 2Y2JA 4YM6B 4XUJD 5GT3B 3AZMD 1U35D 3LZ1A 2DF4C 5B2IC 2XD5A 4H9PA 5JA4B 1P3OC 3MNNA 3AFAD 3UTBB 3AZFC 2ZY3A 3A6NC 1PZRA 5B24D 4WNNA 3AZIC 3LELA 1P3BA 1N1JB 3KUYA 4G92C 5GSUB 4XUJA 3LZ0D 3A1IA 3AZMA 1AOIC 4DRAA 2F8NG 4Z2MH 3AZEC 3B6FB 5GSUC 3REHD 4NE3A 3B6FD 1M1AB 3C1CD 1P3PA 5DNMB 5B40C 5B32D 4J8XD 5B1MD 1Q9CA 2NZDD 3AZGB 5AV9D 4H9QA 5GT0B 3MGRD 3AN2A 3F6TA 2RVQD 5B1MA 3W98D 3WKJD 3O62B 3AZHC 3B6FA 4UUZB 4J8VD 3A6NA 3LJAB 3X1SC 4NFTA 5CPJC 2NQBD 3AV2A 1KX3A 3AZIA 1U35B 1HQ3A 5B2JA 4X23C 1BH9B 3KWQB 3MGQC 3AZJD 1M19A 3AZKB 1HQ3C 1T3UA 3AZLC 3RELD 2F8NB 4J8UA 4UUZA 3WTPE 4Z66A 2G5IC 3NQJB 5B33D 1F66D 2NQBA 2Y2KA 5BT1C 4NE6A 1P3OB 3REKD 5AV5A 3X1VD 2HUEB 1M19B 2Y2MA 1BH9A 5B32G 1M1AA 3UT9C 3AZIB 2F8NA 2HIOD 3B0DB 5DNND 4KGCA 4YM6D 3X1UC 1ID3C 4WU8D 4QLCD 3AZHB 3RELB 2F8ND 1S32D 5GXQD 4Z5TB 5C3IC 1P34C 1BFMA 3AZLA 3P5JB 4G91C 3O62D 1TZYB 5E5AC 3A1KA 5GT0A 5AV5D 4Z66B 5JRGA 3REJB 4KUDB 5GT0D 3MGRB 5CP6A 4ZUXD 2ZY4A 3LJAD 4Z66D 3REIB 2FJ7A 3KUYD 5G49B 4R8PA 5BNXA 3H0RC 5BNVB 5B0YC 5AV8A 2VQRA 3MGSA 3IP4C 3MNND 2HIOA 5CPJB 1AOID 1P3MC 1KX4C 3AZED 4H9SA 3A6NB 3LJAA 3AZNA 3WTPA 4XUJB 3AZMB 3C1CC 1EQZC 4R8PB 4H9OA 4JJND 5AVCC 4WU9D 3X1TD 5F99B 3UTAD 3TU4C 3B0BA 4J8WB 3WA9C 2YFVB 3KXBD 2PYOA 2AROD 2RVQC 3AN2D 3B6GB 4WZSB 4J8UD 3R45B 2JSSA 5FUGA 3H0LC 5B31G 2ZM5A 5CPKC 4J8VC 3V9RA 3VH6T 3AZJA 3MGPA 3X1SD 1M19D 4LD9C 2YFWB 1P3GD 3REJC 5DNMC 3KWQD 5CPKB 5GXQB 5AV6A 2L5AA 4H9NA 1WWSA 5B1MB 5F99A 2F8NH 4X23D 3B6GC 3NQUB 3MGQD 1P3MA 3B0CT 4WV4B 3X1UB 1ID3B 3AZLD 3RELC 3AL0C 5B1LB 1ZLAB 1HQ3B 2Y2IA 4Z2MG 3WAAB 1M18C 5B1LD 5AVBC 4YS3C 5AV9A 3W99C 2XD1A 1BH8A 2AROA 1TAFA 2CV5C 3W99B 5B31D 3LELB 1P3BB 2FFFB 2Y2OA 1H3OA 3REHA 1P3GB 1M18B 3AZND 5BNXB 1P3FC 2IO5C 1P3MB 2UWXA 3WA9A 4AWLB 4WJ3C 5B24A 3AZEB 4KHAB 3X1UD 4WU8C 1ID3D 2NZDB 4EO5C 2PYOC 2AROB 4XZQA 1P34D 1P3AD 3AFAA 3AYWA 3WTPB 4R8PD 5AV5C 5E5AD 4JJNB 5AV8C 3TU4B 4Z5TA 1M18A 3LJAC 5CPIB 4Z66C 5KDMB 3B0CW 1H3OB 1P3GA 3AFAC 3REIA 5CP6B 3AZFD 2FJ7B 5AV6B 3VH5A 5G49A 5GT3C 5GXQA 3X1SB 2RIQA 3MGPC 3C1BA 3AFAB 1P3ID 4KUDA 4YM6A 5AV6C 1ZLAD 2NZDA 3LZ0C 3VH5W 2F2AC 4J8UB 1P3KB 1KX4B 5CPJA 5GSUD 3REHC 3W97A 3KXBB 3EPHA 1EQZD 1TZYD 3UTAC 3AZHA 4NE5A 3B6FC 4KGCC 3TU4D 1P3FB 1EQZA 1F66A 2DQNC 5B40D 1M1AC 5B31A 2NZDC 3W99A 5AV9C 3UTBC 3WKJC 5AV9B 5CPKD 1P3KA 4CSRB 4LD9D 1P3GC 5DNMD 4E44A 4WU9B 5B0YA 3MGSC 1F66B 5B31B 2BYMA 1KX5A 5CP6C 4H9NB 2FJ7C 3AV2C 1KX3C 5JRGD 1A7WA 5CPID 5F99D 5B2JC 1KX5D 2YFWA 4H9RA 1M18D 5B1LC 4ZBJC 1S32A 4YS3D 1P3OA 2Y2PA 1KU5A 4XZQD 1P34A 2CV5D 5B33C 3KFUG 3MGQB 5BT1D 5B32B 1B6WA 4J8XB 1Z2CB 3WAAA 1HTAA 5CHLB 1P3LA 3WAAD 3UTBA 4G92B 3AZLB 2HIOC 4H9OB 5AVBA 5DNNC 5B33B 1TZYA 5JRGB 2CWEA 3EPLA 1P3AC 2IO5B 3LELC 1P3BC 2Y2QA 3W97C 4R8PC 5AV8D 4J8WC 4XZQB 3KSYA 3O62C 3AZFA 3WA9B 4M6BA 3W96A 4KHAA 5DNNB 5GT0C 4ZUXC 3KUYC 5AY8B 5B0ZB 4EO5B 5CPIA 5B0YD 4H9PB 5JA4A 3AYWD 5E5AB 3MNNC 1ZLAC 2J8PA 3X1SA 3C1BB 4Z5TC 5C3IB 1P34B 4E45A 4DQYB 3KUYB 4HGAB 3AZKC 1TZYC 4KGCD 5B2JB 3X1TA 1P3KC 3WA9D 3X1TC 3KXBA 3REKA 5BNVA 3X1VA 1M1AD 1P3PB 3MVDB 3KXBC 3AV1D 5B2IB 2G5HC 5BO0B 1KX4A 1P3FA 1P3AB 1P3PC 4J8UC 3W97B 4XUJC 3AZMC 3VH6A 1AOIA 5GSUA 4KUDD 5B24B 3AZEA 3NQJA 1M19C 5AVCB 3VH5T 2BYKB 1ZLAA 5B1LA 5B40B 3MGSD 5AV8B 4J8WA 4YS3A 1P3OD 5CP6D 2JCHA 5BS7C 4ZUXA 3AV2D 5JRGC 1KX3D 2FJ7D 2PYOB 3B6GD 2Y2HA 5CPIC 5B2JD 3LZ1D 1KX5C 1TAFB 3KWQA 3AZID 3REIC 3AZNB 4UPKA 5AY8C 5B0ZC 2LY8A 3O62A 1P3LC 2Y2NA 1S32B 4WNNB 4LD9A 5B31C 3AZGD 5DNNA 2BG1A 3UTAA 3WAAC 5B32A 4J8XA 4YS3B 3W98C 1P3FD 3VH6W 4WU9A 3V9RB 3AZJB 3WTPD 1W2EA 3TU4A 1BH8B 3MVDC 3LELD 1P3BD 4CAYB 5B33A 5AVBB 5CPJD 1AOIB 2CV5A 4J8VB 1HQ3D 3WKJB 1F1EA 3REKB 2W8SA 3X1VB 4ZUXB 2BYKA 1U35A 1ULYA 3AYWC 5GT3D 1JFIB 3MGPD 3W96B 1P3IC 5AV6D 3MGSB 1F66C 4H9RB 3MGPB 3W96D 5E5AA 3AZKD 3WKJA 2Y2LA 1P3KD 3MGRA 3X1UA 1ID3A 3FDDA 1P3IB 4YM6C 3X1TB 1B67A 3EG5B 4QLCC 3C1BC 3UTBD 1WWIA 4JJNA 1S32C 5GXQC 5B0YB 2HIOB 4HGAC 4KUDC 4AWLC 4KGCB 1U35C 3EPJA 2ZY5A 3LZ0A 5FUGB 4CAYA 5B2IA 2F8NK 5B2ID 1P3IA 4WU8B 3LZ1C 2YFVA 3REID 5F99C 2CV5B 3A6ND 5AY8D 5B0ZD 3UT9B 5B24C 3B0DC 3MGQA 4J8VA 1P3MD 1KX4D 2ZY2A 3AV1A 1P3LD 4XZQC 2HUEC 4QLCA 3EPKA
chains in the Genus database with same CATH topology
3W98A 3MVDA 3AZGC 4JJNC 4H9QB 5AVCD 3AZGA 4WU9C 5KDMA 4WU8A 3NQUA 2AROC 5B32C 3MNNB 4J8XC 5B1MC 3AN2C 5AVCA 3MGRC 3UTAB 3WTPC 4LD9B 5B40A 3MVDD 5GT3A 3AV1B 3H0MC 4ZBJB 3W98B 4QLCB 3AZHD 4H9SC 3REJD 4X23B 3KWQC 3W97D 3R45A 3B6GA 5AY8A 5B0ZA 2Y2GA 4J8WD 2NQBC 3RELA 5DNMA 3REHB 3AZJC 1EQZB 5CPKA 5BS7A 3LZ0B 3REJA 5AVBD 3W99D 3LZ1B 2NQBB 2JE5A 5AV5B 4X23A 4CSRA 3C1CB 3W96C 1JFIA 3AYWB 4Z5TD 1R4VA 1P3LB 3X1VC 3REKC 5BO0A 3UT9A 1P3AA 2BYMB 1KX5B 3AZNC 3AN2B 3AZKA 3UT9D 4DRBA 3AV1C 3C1BD 3AV2B 1KX3B 2PYOD 4G91B 3C1CA 1P3PD 3AZFB 1N1JA 2Y2JA 4YM6B 4XUJD 5GT3B 3AZMD 1U35D 3LZ1A 2DF4C 5B2IC 2XD5A 4H9PA 5JA4B 1P3OC 3MNNA 3AFAD 3UTBB 3AZFC 2ZY3A 3A6NC 1PZRA 5B24D 4WNNA 3AZIC 3LELA 1P3BA 1N1JB 3KUYA 4G92C 5GSUB 4XUJA 3LZ0D 3A1IA 3AZMA 1AOIC 4DRAA 2F8NG 4Z2MH 3AZEC 3B6FB 5GSUC 3REHD 4NE3A 3B6FD 1M1AB 3C1CD 1P3PA 5DNMB 5B40C 5B32D 4J8XD 5B1MD 1Q9CA 2NZDD 3AZGB 5AV9D 4H9QA 5GT0B 3MGRD 3AN2A 3F6TA 2RVQD 5B1MA 3W98D 3WKJD 3O62B 3AZHC 3B6FA 4UUZB 4J8VD 3A6NA 3LJAB 3X1SC 4NFTA 5CPJC 2NQBD 3AV2A 1KX3A 3AZIA 1U35B 1HQ3A 5B2JA 4X23C 1BH9B 3KWQB 3MGQC 3AZJD 1M19A 3AZKB 1HQ3C 1T3UA 3AZLC 3RELD 2F8NB 4J8UA 4UUZA 3WTPE 4Z66A 2G5IC 3NQJB 5B33D 1F66D 2NQBA 2Y2KA 5BT1C 4NE6A 1P3OB 3REKD 5AV5A 3X1VD 2HUEB 1M19B 2Y2MA 1BH9A 5B32G 1M1AA 3UT9C 3AZIB 2F8NA 2HIOD 3B0DB 5DNND 4KGCA 4YM6D 3X1UC 1ID3C 4WU8D 4QLCD 3AZHB 3RELB 2F8ND 1S32D 5GXQD 4Z5TB 5C3IC 1P34C 1BFMA 3AZLA 3P5JB 4G91C 3O62D 1TZYB 5E5AC 3A1KA 5GT0A 5AV5D 4Z66B 5JRGA 3REJB 4KUDB 5GT0D 3MGRB 5CP6A 4ZUXD 2ZY4A 3LJAD 4Z66D 3REIB 2FJ7A 3KUYD 5G49B 4R8PA 5BNXA 3H0RC 5BNVB 5B0YC 5AV8A 2VQRA 3MGSA 3IP4C 3MNND 2HIOA 5CPJB 1AOID 1P3MC 1KX4C 3AZED 4H9SA 3A6NB 3LJAA 3AZNA 3WTPA 4XUJB 3AZMB 3C1CC 1EQZC 4R8PB 4H9OA 4JJND 5AVCC 4WU9D 3X1TD 5F99B 3UTAD 3TU4C 3B0BA 4J8WB 3WA9C 2YFVB 3KXBD 2PYOA 2AROD 2RVQC 3AN2D 3B6GB 4WZSB 4J8UD 3R45B 2JSSA 5FUGA 3H0LC 5B31G 2ZM5A 5CPKC 4J8VC 3V9RA 3VH6T 3AZJA 3MGPA 3X1SD 1M19D 4LD9C 2YFWB 1P3GD 3REJC 5DNMC 3KWQD 5CPKB 5GXQB 5AV6A 2L5AA 4H9NA 1WWSA 5B1MB 5F99A 2F8NH 4X23D 3B6GC 3NQUB 3MGQD 1P3MA 3B0CT 4WV4B 3X1UB 1ID3B 3AZLD 3RELC 3AL0C 5B1LB 1ZLAB 1HQ3B 2Y2IA 4Z2MG 3WAAB 1M18C 5B1LD 5AVBC 4YS3C 5AV9A 3W99C 2XD1A 1BH8A 2AROA 1TAFA 2CV5C 3W99B 5B31D 3LELB 1P3BB 2FFFB 2Y2OA 1H3OA 3REHA 1P3GB 1M18B 3AZND 5BNXB 1P3FC 2IO5C 1P3MB 2UWXA 3WA9A 4AWLB 4WJ3C 5B24A 3AZEB 4KHAB 3X1UD 4WU8C 1ID3D 2NZDB 4EO5C 2PYOC 2AROB 4XZQA 1P34D 1P3AD 3AFAA 3AYWA 3WTPB 4R8PD 5AV5C 5E5AD 4JJNB 5AV8C 3TU4B 4Z5TA 1M18A 3LJAC 5CPIB 4Z66C 5KDMB 3B0CW 1H3OB 1P3GA 3AFAC 3REIA 5CP6B 3AZFD 2FJ7B 5AV6B 3VH5A 5G49A 5GT3C 5GXQA 3X1SB 2RIQA 3MGPC 3C1BA 3AFAB 1P3ID 4KUDA 4YM6A 5AV6C 1ZLAD 2NZDA 3LZ0C 3VH5W 2F2AC 4J8UB 1P3KB 1KX4B 5CPJA 5GSUD 3REHC 3W97A 3KXBB 3EPHA 1EQZD 1TZYD 3UTAC 3AZHA 4NE5A 3B6FC 4KGCC 3TU4D 1P3FB 1EQZA 1F66A 2DQNC 5B40D 1M1AC 5B31A 2NZDC 3W99A 5AV9C 3UTBC 3WKJC 5AV9B 5CPKD 1P3KA 4CSRB 4LD9D 1P3GC 5DNMD 4E44A 4WU9B 5B0YA 3MGSC 1F66B 5B31B 2BYMA 1KX5A 5CP6C 4H9NB 2FJ7C 3AV2C 1KX3C 5JRGD 1A7WA 5CPID 5F99D 5B2JC 1KX5D 2YFWA 4H9RA 1M18D 5B1LC 4ZBJC 1S32A 4YS3D 1P3OA 2Y2PA 1KU5A 4XZQD 1P34A 2CV5D 5B33C 3KFUG 3MGQB 5BT1D 5B32B 1B6WA 4J8XB 1Z2CB 3WAAA 1HTAA 5CHLB 1P3LA 3WAAD 3UTBA 4G92B 3AZLB 2HIOC 4H9OB 5AVBA 5DNNC 5B33B 1TZYA 5JRGB 2CWEA 3EPLA 1P3AC 2IO5B 3LELC 1P3BC 2Y2QA 3W97C 4R8PC 5AV8D 4J8WC 4XZQB 3KSYA 3O62C 3AZFA 3WA9B 4M6BA 3W96A 4KHAA 5DNNB 5GT0C 4ZUXC 3KUYC 5AY8B 5B0ZB 4EO5B 5CPIA 5B0YD 4H9PB 5JA4A 3AYWD 5E5AB 3MNNC 1ZLAC 2J8PA 3X1SA 3C1BB 4Z5TC 5C3IB 1P34B 4E45A 4DQYB 3KUYB 4HGAB 3AZKC 1TZYC 4KGCD 5B2JB 3X1TA 1P3KC 3WA9D 3X1TC 3KXBA 3REKA 5BNVA 3X1VA 1M1AD 1P3PB 3MVDB 3KXBC 3AV1D 5B2IB 2G5HC 5BO0B 1KX4A 1P3FA 1P3AB 1P3PC 4J8UC 3W97B 4XUJC 3AZMC 3VH6A 1AOIA 5GSUA 4KUDD 5B24B 3AZEA 3NQJA 1M19C 5AVCB 3VH5T 2BYKB 1ZLAA 5B1LA 5B40B 3MGSD 5AV8B 4J8WA 4YS3A 1P3OD 5CP6D 2JCHA 5BS7C 4ZUXA 3AV2D 5JRGC 1KX3D 2FJ7D 2PYOB 3B6GD 2Y2HA 5CPIC 5B2JD 3LZ1D 1KX5C 1TAFB 3KWQA 3AZID 3REIC 3AZNB 4UPKA 5AY8C 5B0ZC 2LY8A 3O62A 1P3LC 2Y2NA 1S32B 4WNNB 4LD9A 5B31C 3AZGD 5DNNA 2BG1A 3UTAA 3WAAC 5B32A 4J8XA 4YS3B 3W98C 1P3FD 3VH6W 4WU9A 3V9RB 3AZJB 3WTPD 1W2EA 3TU4A 1BH8B 3MVDC 3LELD 1P3BD 4CAYB 5B33A 5AVBB 5CPJD 1AOIB 2CV5A 4J8VB 1HQ3D 3WKJB 1F1EA 3REKB 2W8SA 3X1VB 4ZUXB 2BYKA 1U35A 1ULYA 3AYWC 5GT3D 1JFIB 3MGPD 3W96B 1P3IC 5AV6D 3MGSB 1F66C 4H9RB 3MGPB 3W96D 5E5AA 3AZKD 3WKJA 2Y2LA 1P3KD 3MGRA 3X1UA 1ID3A 3FDDA 1P3IB 4YM6C 3X1TB 1B67A 3EG5B 4QLCC 3C1BC 3UTBD 1WWIA 4JJNA 1S32C 5GXQC 5B0YB 2HIOB 4HGAC 4KUDC 4AWLC 4KGCB 1U35C 3EPJA 2ZY5A 3LZ0A 5FUGB 4CAYA 5B2IA 2F8NK 5B2ID 1P3IA 4WU8B 3LZ1C 2YFVA 3REID 5F99C 2CV5B 3A6ND 5AY8D 5B0ZD 3UT9B 5B24C 3B0DC 3MGQA 4J8VA 1P3MD 1KX4D 2ZY2A 3AV1A 1P3LD 4XZQC 2HUEC 4QLCA 3EPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W98 A;  3MVD A;  3AZG C;  4JJN C;  4H9Q B;  5AVC D;  3AZG A;  4WU9 C;  5KDM A;  4WU8 A;  3NQU A;  2ARO C;  5B32 C;  3MNN B;  4J8X C;  5B1M C;  3AN2 C;  5AVC A;  3MGR C;  3UTA B;  3WTP C;  4LD9 B;  5B40 A;  3MVD D;  5GT3 A;  3AV1 B;  4ZBJ B;  3W98 B;  4QLC B;  3AZH D;  4H9S C;  3REJ D;  4X23 B;  3KWQ C;  3W97 D;  3R45 A;  3B6G A;  5AY8 A;  5B0Z A;  4J8W D;  2NQB C;  3REL A;  5DNM A;  3REH B;  3AZJ C;  1EQZ B;  5CPK A;  5BS7 A;  3LZ0 B;  3REJ A;  5AVB D;  3W99 D;  3LZ1 B;  2NQB B;  4X23 A;  5AV5 B;  4CSR A;  3C1C B;  3W96 C;  1JFI A;  3AYW B;  4Z5T D;  1R4V A;  1P3L B;  3X1V C;  3REK C;  5BO0 A;  3UT9 A;  1P3A A;  2BYM B;  1KX5 B;  3AZN C;  3AN2 B;  3AZK A;  3UT9 D;  4DRB A;  3AV1 C;  3C1B D;  3AV2 B;  1KX3 B;  2PYO D;  4G91 B;  3C1C A;  1P3P D;  3AZF B;  1N1J A;  4YM6 B;  4XUJ D;  5GT3 B;  3AZM D;  1U35 D;  3LZ1 A;  5B2I C;  4H9P A;  5JA4 B;  1P3O C;  3MNN A;  3AFA D;  3UTB B;  3AZF C;  3A6N C;  5B24 D;  4WNN A;  3AZI C;  3LEL A;  1P3B A;  1N1J B;  3KUY A;  4G92 C;  5GSU B;  4XUJ A;  3LZ0 D;  3AZM A;  1AOI C;  4DRA A;  2F8N G;  4Z2M H;  3AZE C;  3B6F B;  5GSU C;  3REH D;  4NE3 A;  3B6F D;  1M1A B;  3C1C D;  1P3P A;  5DNM B;  5B40 C;  5B32 D;  4J8X D;  5B1M D;  1Q9C A;  2NZD D;  3AZG B;  5AV9 D;  4H9Q A;  5GT0 B;  3MGR D;  3AN2 A;  2RVQ D;  5B1M A;  3W98 D;  3WKJ D;  3O62 B;  3AZH C;  3B6F A;  4UUZ B;  4J8V D;  3A6N A;  3LJA B;  3X1S C;  4NFT A;  5CPJ C;  2NQB D;  3AV2 A;  1KX3 A;  3AZI A;  1U35 B;  1HQ3 A;  5B2J A;  4X23 C;  1BH9 B;  3KWQ B;  3MGQ C;  3AZJ D;  1M19 A;  3AZK B;  1HQ3 C;  3AZL C;  3REL D;  2F8N B;  4J8U A;  4UUZ A;  3WTP E;  4Z66 A;  3NQJ B;  5B33 D;  1F66 D;  2NQB A;  5BT1 C;  4NE6 A;  1P3O B;  3REK D;  5AV5 A;  3X1V D;  2HUE B;  1M19 B;  1BH9 A;  5B32 G;  1M1A A;  3UT9 C;  3AZI B;  2F8N A;  2HIO D;  3B0D B;  5DNN D;  4KGC A;  4YM6 D;  3X1U C;  1ID3 C;  4WU8 D;  4QLC D;  3AZH B;  3REL B;  2F8N D;  1S32 D;  5GXQ D;  4Z5T B;  5C3I C;  1P34 C;  1BFM A;  3AZL A;  4G91 C;  3O62 D;  1TZY B;  5E5A C;  5GT0 A;  5AV5 D;  5JRG A;  4Z66 B;  3REJ B;  4KUD B;  5GT0 D;  3MGR B;  5CP6 A;  4ZUX D;  3LJA D;  3REI B;  4Z66 D;  2FJ7 A;  3KUY D;  5G49 B;  4R8P A;  5BNX A;  5B0Y C;  5BNV B;  5AV8 A;  3MGS A;  3MNN D;  2HIO A;  5CPJ B;  1AOI D;  1P3M C;  1KX4 C;  3AZE D;  4H9S A;  3A6N B;  3LJA A;  3AZN A;  3WTP A;  4XUJ B;  3AZM B;  3C1C C;  1EQZ C;  4R8P B;  4H9O A;  4JJN D;  5AVC C;  4WU9 D;  3X1T D;  5F99 B;  3UTA D;  3TU4 C;  3B0B A;  4J8W B;  3WA9 C;  2YFV B;  3KXB D;  2PYO A;  2ARO D;  2RVQ C;  3AN2 D;  3B6G B;  4WZS B;  4J8U D;  3R45 B;  2JSS A;  5FUG A;  5B31 G;  5CPK C;  4J8V C;  3V9R A;  3VH6 T;  3AZJ A;  3MGP A;  3X1S D;  1M19 D;  4LD9 C;  2YFW B;  1P3G D;  3REJ C;  5DNM C;  3KWQ D;  5CPK B;  5GXQ B;  5AV6 A;  2L5A A;  4H9N A;  1WWS A;  5B1M B;  5F99 A;  2F8N H;  4X23 D;  3B6G C;  3NQU B;  3MGQ D;  1P3M A;  3B0C T;  4WV4 B;  3X1U B;  1ID3 B;  3AZL D;  3REL C;  5B1L B;  1ZLA B;  1HQ3 B;  4Z2M G;  3WAA B;  1M18 C;  5B1L D;  5AVB C;  4YS3 C;  5AV9 A;  3W99 C;  1BH8 A;  2ARO A;  1TAF A;  2CV5 C;  3W99 B;  5B31 D;  3LEL B;  1P3B B;  3REH A;  1H3O A;  1P3G B;  1M18 B;  3AZN D;  5BNX B;  1P3F C;  2IO5 C;  1P3M B;  3WA9 A;  4AWL B;  5B24 A;  3AZE B;  4KHA B;  3X1U D;  4WU8 C;  1ID3 D;  2NZD B;  4EO5 C;  2PYO C;  2ARO B;  4XZQ A;  1P34 D;  1P3A D;  3AFA A;  3AYW A;  3WTP B;  4R8P D;  5AV5 C;  5E5A D;  4JJN B;  5AV8 C;  3TU4 B;  4Z5T A;  1M18 A;  3LJA C;  5CPI B;  4Z66 C;  5KDM B;  3B0C W;  1H3O B;  1P3G A;  3AFA C;  3REI A;  5CP6 B;  3AZF D;  2FJ7 B;  5AV6 B;  3VH5 A;  5G49 A;  5GT3 C;  5GXQ A;  3X1S B;  3C1B A;  3MGP C;  3AFA B;  1P3I D;  4KUD A;  4YM6 A;  5AV6 C;  1ZLA D;  2NZD A;  3LZ0 C;  3VH5 W;  4J8U B;  1P3K B;  1KX4 B;  5CPJ A;  5GSU D;  3REH C;  3W97 A;  3KXB B;  1EQZ D;  1TZY D;  3UTA C;  3AZH A;  4NE5 A;  3B6F C;  4KGC C;  3TU4 D;  1P3F B;  1EQZ A;  1F66 A;  5B40 D;  1M1A C;  5B31 A;  2NZD C;  3W99 A;  5AV9 C;  3UTB C;  3WKJ C;  5AV9 B;  5CPK D;  1P3K A;  4CSR B;  4LD9 D;  1P3G C;  5DNM D;  4E44 A;  4WU9 B;  5B0Y A;  3MGS C;  1F66 B;  5B31 B;  2BYM A;  1KX5 A;  5CP6 C;  4H9N B;  2FJ7 C;  3AV2 C;  1KX3 C;  5JRG D;  1A7W A;  5CPI D;  5F99 D;  5B2J C;  1KX5 D;  2YFW A;  4H9R A;  1M18 D;  5B1L C;  4ZBJ C;  1S32 A;  4YS3 D;  1P3O A;  1KU5 A;  4XZQ D;  1P34 A;  2CV5 D;  5B33 C;  3MGQ B;  5BT1 D;  5B32 B;  1B6W A;  4J8X B;  3WAA A;  1HTA A;  5CHL B;  1P3L A;  3WAA D;  3UTB A;  4G92 B;  3AZL B;  2HIO C;  4H9O B;  5AVB A;  5DNN C;  5B33 B;  1TZY A;  5JRG B;  2CWE A;  1P3A C;  2IO5 B;  3LEL C;  1P3B C;  3W97 C;  4R8P C;  5AV8 D;  4J8W C;  4XZQ B;  3KSY A;  3O62 C;  3AZF A;  3WA9 B;  4M6B A;  3W96 A;  4KHA A;  5DNN B;  5GT0 C;  4ZUX C;  3KUY C;  5AY8 B;  5B0Z B;  4EO5 B;  5CPI A;  5B0Y D;  4H9P B;  5JA4 A;  3AYW D;  5E5A B;  3MNN C;  1ZLA C;  3X1S A;  3C1B B;  4Z5T C;  5C3I B;  1P34 B;  4E45 A;  3KUY B;  4HGA B;  3AZK C;  1TZY C;  4KGC D;  5B2J B;  3X1T A;  1P3K C;  3WA9 D;  3X1T C;  3KXB A;  3REK A;  5BNV A;  3X1V A;  1M1A D;  1P3P B;  3MVD B;  3KXB C;  3AV1 D;  5B2I B;  5BO0 B;  1KX4 A;  1P3F A;  1P3A B;  1P3P C;  4J8U C;  3W97 B;  4XUJ C;  3AZM C;  3VH6 A;  1AOI A;  5GSU A;  4KUD D;  5B24 B;  3AZE A;  3NQJ A;  1M19 C;  5AVC B;  3VH5 T;  2BYK B;  1ZLA A;  5B1L A;  5B40 B;  3MGS D;  5AV8 B;  4J8W A;  4YS3 A;  1P3O D;  5CP6 D;  5BS7 C;  4ZUX A;  3AV2 D;  1KX3 D;  5JRG C;  2FJ7 D;  2PYO B;  3B6G D;  5CPI C;  5B2J D;  3LZ1 D;  1KX5 C;  1TAF B;  3KWQ A;  3AZI D;  3REI C;  3AZN B;  5AY8 C;  5B0Z C;  2LY8 A;  3O62 A;  1P3L C;  1S32 B;  4WNN B;  4LD9 A;  5B31 C;  3AZG D;  5DNN A;  3UTA A;  3WAA C;  5B32 A;  4J8X A;  4YS3 B;  3W98 C;  1P3F D;  3VH6 W;  4WU9 A;  3V9R B;  3AZJ B;  3WTP D;  3TU4 A;  1BH8 B;  3MVD C;  3LEL D;  1P3B D;  4CAY B;  5B33 A;  5AVB B;  5CPJ D;  1AOI B;  2CV5 A;  4J8V B;  1HQ3 D;  3WKJ B;  1F1E A;  3REK B;  3X1V B;  4ZUX B;  2BYK A;  1U35 A;  1ULY A;  3AYW C;  5GT3 D;  1JFI B;  3MGP D;  3W96 B;  1P3I C;  5AV6 D;  3MGS B;  1F66 C;  4H9R B;  3MGP B;  3W96 D;  5E5A A;  3AZK D;  3WKJ A;  1P3K D;  3MGR A;  3X1U A;  1ID3 A;  1P3I B;  4YM6 C;  3X1T B;  1B67 A;  4QLC C;  3C1B C;  3UTB D;  1WWI A;  4JJN A;  1S32 C;  5GXQ C;  5B0Y B;  2HIO B;  4HGA C;  4KUD C;  4AWL C;  4KGC B;  1U35 C;  3LZ0 A;  5FUG B;  4CAY A;  5B2I A;  2F8N K;  5B2I D;  1P3I A;  4WU8 B;  3LZ1 C;  2YFV A;  3REI D;  5F99 C;  2CV5 B;  3A6N D;  5AY8 D;  5B0Z D;  3UT9 B;  5B24 C;  3B0D C;  3MGQ A;  4J8V A;  1P3M D;  1KX4 D;  3AV1 A;  1P3L D;  4XZQ C;  2HUE C;  4QLC A; 
#chains in the Genus database with same CATH topology
 3W98 A;  3MVD A;  3AZG C;  4JJN C;  4H9Q B;  5AVC D;  3AZG A;  4WU9 C;  5KDM A;  4WU8 A;  3NQU A;  2ARO C;  5B32 C;  3MNN B;  4J8X C;  5B1M C;  3AN2 C;  5AVC A;  3MGR C;  3UTA B;  3WTP C;  4LD9 B;  5B40 A;  3MVD D;  5GT3 A;  3AV1 B;  3H0M C;  4ZBJ B;  3W98 B;  4QLC B;  3AZH D;  4H9S C;  3REJ D;  4X23 B;  3KWQ C;  3W97 D;  3R45 A;  3B6G A;  5AY8 A;  5B0Z A;  2Y2G A;  4J8W D;  2NQB C;  3REL A;  5DNM A;  3REH B;  3AZJ C;  1EQZ B;  5CPK A;  5BS7 A;  3LZ0 B;  3REJ A;  5AVB D;  3W99 D;  3LZ1 B;  2NQB B;  2JE5 A;  5AV5 B;  4X23 A;  4CSR A;  3C1C B;  3W96 C;  1JFI A;  3AYW B;  4Z5T D;  1R4V A;  1P3L B;  3X1V C;  3REK C;  5BO0 A;  3UT9 A;  1P3A A;  2BYM B;  1KX5 B;  3AZN C;  3AN2 B;  3AZK A;  3UT9 D;  4DRB A;  3AV1 C;  3C1B D;  3AV2 B;  1KX3 B;  2PYO D;  4G91 B;  3C1C A;  1P3P D;  3AZF B;  1N1J A;  2Y2J A;  4YM6 B;  4XUJ D;  5GT3 B;  3AZM D;  1U35 D;  3LZ1 A;  2DF4 C;  5B2I C;  2XD5 A;  4H9P A;  5JA4 B;  1P3O C;  3MNN A;  3AFA D;  3UTB B;  3AZF C;  2ZY3 A;  3A6N C;  1PZR A;  5B24 D;  4WNN A;  3AZI C;  3LEL A;  1P3B A;  1N1J B;  3KUY A;  4G92 C;  5GSU B;  4XUJ A;  3LZ0 D;  3A1I A;  3AZM A;  1AOI C;  4DRA A;  2F8N G;  4Z2M H;  3AZE C;  3B6F B;  5GSU C;  3REH D;  4NE3 A;  3B6F D;  1M1A B;  3C1C D;  1P3P A;  5DNM B;  5B40 C;  5B32 D;  4J8X D;  5B1M D;  1Q9C A;  2NZD D;  3AZG B;  5AV9 D;  4H9Q A;  5GT0 B;  3MGR D;  3AN2 A;  3F6T A;  2RVQ D;  5B1M A;  3W98 D;  3WKJ D;  3O62 B;  3AZH C;  3B6F A;  4UUZ B;  4J8V D;  3A6N A;  3LJA B;  3X1S C;  4NFT A;  5CPJ C;  2NQB D;  3AV2 A;  1KX3 A;  3AZI A;  1U35 B;  1HQ3 A;  5B2J A;  4X23 C;  1BH9 B;  3KWQ B;  3MGQ C;  3AZJ D;  1M19 A;  3AZK B;  1HQ3 C;  1T3U A;  3AZL C;  3REL D;  2F8N B;  4J8U A;  4UUZ A;  3WTP E;  4Z66 A;  2G5I C;  3NQJ B;  5B33 D;  1F66 D;  2NQB A;  2Y2K A;  5BT1 C;  4NE6 A;  1P3O B;  3REK D;  5AV5 A;  3X1V D;  2HUE B;  1M19 B;  2Y2M A;  1BH9 A;  5B32 G;  1M1A A;  3UT9 C;  3AZI B;  2F8N A;  2HIO D;  3B0D B;  5DNN D;  4KGC A;  4YM6 D;  3X1U C;  1ID3 C;  4WU8 D;  4QLC D;  3AZH B;  3REL B;  2F8N D;  1S32 D;  5GXQ D;  4Z5T B;  5C3I C;  1P34 C;  1BFM A;  3AZL A;  3P5J B;  4G91 C;  3O62 D;  1TZY B;  5E5A C;  3A1K A;  5GT0 A;  5AV5 D;  4Z66 B;  5JRG A;  3REJ B;  4KUD B;  5GT0 D;  3MGR B;  5CP6 A;  4ZUX D;  2ZY4 A;  3LJA D;  4Z66 D;  3REI B;  2FJ7 A;  3KUY D;  5G49 B;  4R8P A;  5BNX A;  3H0R C;  5BNV B;  5B0Y C;  5AV8 A;  2VQR A;  3MGS A;  3IP4 C;  3MNN D;  2HIO A;  5CPJ B;  1AOI D;  1P3M C;  1KX4 C;  3AZE D;  4H9S A;  3A6N B;  3LJA A;  3AZN A;  3WTP A;  4XUJ B;  3AZM B;  3C1C C;  1EQZ C;  4R8P B;  4H9O A;  4JJN D;  5AVC C;  4WU9 D;  3X1T D;  5F99 B;  3UTA D;  3TU4 C;  3B0B A;  4J8W B;  3WA9 C;  2YFV B;  3KXB D;  2PYO A;  2ARO D;  2RVQ C;  3AN2 D;  3B6G B;  4WZS B;  4J8U D;  3R45 B;  2JSS A;  5FUG A;  3H0L C;  5B31 G;  2ZM5 A;  5CPK C;  4J8V C;  3V9R A;  3VH6 T;  3AZJ A;  3MGP A;  3X1S D;  1M19 D;  4LD9 C;  2YFW B;  1P3G D;  3REJ C;  5DNM C;  3KWQ D;  5CPK B;  5GXQ B;  5AV6 A;  2L5A A;  4H9N A;  1WWS A;  5B1M B;  5F99 A;  2F8N H;  4X23 D;  3B6G C;  3NQU B;  3MGQ D;  1P3M A;  3B0C T;  4WV4 B;  3X1U B;  1ID3 B;  3AZL D;  3REL C;  3AL0 C;  5B1L B;  1ZLA B;  1HQ3 B;  2Y2I A;  4Z2M G;  3WAA B;  1M18 C;  5B1L D;  5AVB C;  4YS3 C;  5AV9 A;  3W99 C;  2XD1 A;  1BH8 A;  2ARO A;  1TAF A;  2CV5 C;  3W99 B;  5B31 D;  3LEL B;  1P3B B;  2FFF B;  2Y2O A;  1H3O A;  3REH A;  1P3G B;  1M18 B;  3AZN D;  5BNX B;  1P3F C;  2IO5 C;  1P3M B;  2UWX A;  3WA9 A;  4AWL B;  4WJ3 C;  5B24 A;  3AZE B;  4KHA B;  3X1U D;  4WU8 C;  1ID3 D;  2NZD B;  4EO5 C;  2PYO C;  2ARO B;  4XZQ A;  1P34 D;  1P3A D;  3AFA A;  3AYW A;  3WTP B;  4R8P D;  5AV5 C;  5E5A D;  4JJN B;  5AV8 C;  3TU4 B;  4Z5T A;  1M18 A;  3LJA C;  5CPI B;  4Z66 C;  5KDM B;  3B0C W;  1H3O B;  1P3G A;  3AFA C;  3REI A;  5CP6 B;  3AZF D;  2FJ7 B;  5AV6 B;  3VH5 A;  5G49 A;  5GT3 C;  5GXQ A;  3X1S B;  2RIQ A;  3MGP C;  3C1B A;  3AFA B;  1P3I D;  4KUD A;  4YM6 A;  5AV6 C;  1ZLA D;  2NZD A;  3LZ0 C;  3VH5 W;  2F2A C;  4J8U B;  1P3K B;  1KX4 B;  5CPJ A;  5GSU D;  3REH C;  3W97 A;  3KXB B;  3EPH A;  1EQZ D;  1TZY D;  3UTA C;  3AZH A;  4NE5 A;  3B6F C;  4KGC C;  3TU4 D;  1P3F B;  1EQZ A;  1F66 A;  2DQN C;  5B40 D;  1M1A C;  5B31 A;  2NZD C;  3W99 A;  5AV9 C;  3UTB C;  3WKJ C;  5AV9 B;  5CPK D;  1P3K A;  4CSR B;  4LD9 D;  1P3G C;  5DNM D;  4E44 A;  4WU9 B;  5B0Y A;  3MGS C;  1F66 B;  5B31 B;  2BYM A;  1KX5 A;  5CP6 C;  4H9N B;  2FJ7 C;  3AV2 C;  1KX3 C;  5JRG D;  1A7W A;  5CPI D;  5F99 D;  5B2J C;  1KX5 D;  2YFW A;  4H9R A;  1M18 D;  5B1L C;  4ZBJ C;  1S32 A;  4YS3 D;  1P3O A;  2Y2P A;  1KU5 A;  4XZQ D;  1P34 A;  2CV5 D;  5B33 C;  3KFU G;  3MGQ B;  5BT1 D;  5B32 B;  1B6W A;  4J8X B;  1Z2C B;  3WAA A;  1HTA A;  5CHL B;  1P3L A;  3WAA D;  3UTB A;  4G92 B;  3AZL B;  2HIO C;  4H9O B;  5AVB A;  5DNN C;  5B33 B;  1TZY A;  5JRG B;  2CWE A;  3EPL A;  1P3A C;  2IO5 B;  3LEL C;  1P3B C;  2Y2Q A;  3W97 C;  4R8P C;  5AV8 D;  4J8W C;  4XZQ B;  3KSY A;  3O62 C;  3AZF A;  3WA9 B;  4M6B A;  3W96 A;  4KHA A;  5DNN B;  5GT0 C;  4ZUX C;  3KUY C;  5AY8 B;  5B0Z B;  4EO5 B;  5CPI A;  5B0Y D;  4H9P B;  5JA4 A;  3AYW D;  5E5A B;  3MNN C;  1ZLA C;  2J8P A;  3X1S A;  3C1B B;  4Z5T C;  5C3I B;  1P34 B;  4E45 A;  4DQY B;  3KUY B;  4HGA B;  3AZK C;  1TZY C;  4KGC D;  5B2J B;  3X1T A;  1P3K C;  3WA9 D;  3X1T C;  3KXB A;  3REK A;  5BNV A;  3X1V A;  1M1A D;  1P3P B;  3MVD B;  3KXB C;  3AV1 D;  5B2I B;  2G5H C;  5BO0 B;  1KX4 A;  1P3F A;  1P3A B;  1P3P C;  4J8U C;  3W97 B;  4XUJ C;  3AZM C;  3VH6 A;  1AOI A;  5GSU A;  4KUD D;  5B24 B;  3AZE A;  3NQJ A;  1M19 C;  5AVC B;  3VH5 T;  2BYK B;  1ZLA A;  5B1L A;  5B40 B;  3MGS D;  5AV8 B;  4J8W A;  4YS3 A;  1P3O D;  5CP6 D;  2JCH A;  5BS7 C;  4ZUX A;  3AV2 D;  5JRG C;  1KX3 D;  2FJ7 D;  2PYO B;  3B6G D;  2Y2H A;  5CPI C;  5B2J D;  3LZ1 D;  1KX5 C;  1TAF B;  3KWQ A;  3AZI D;  3REI C;  3AZN B;  4UPK A;  5AY8 C;  5B0Z C;  2LY8 A;  3O62 A;  1P3L C;  2Y2N A;  1S32 B;  4WNN B;  4LD9 A;  5B31 C;  3AZG D;  5DNN A;  2BG1 A;  3UTA A;  3WAA C;  5B32 A;  4J8X A;  4YS3 B;  3W98 C;  1P3F D;  3VH6 W;  4WU9 A;  3V9R B;  3AZJ B;  3WTP D;  1W2E A;  3TU4 A;  1BH8 B;  3MVD C;  3LEL D;  1P3B D;  4CAY B;  5B33 A;  5AVB B;  5CPJ D;  1AOI B;  2CV5 A;  4J8V B;  1HQ3 D;  3WKJ B;  1F1E A;  3REK B;  2W8S A;  3X1V B;  4ZUX B;  2BYK A;  1U35 A;  1ULY A;  3AYW C;  5GT3 D;  1JFI B;  3MGP D;  3W96 B;  1P3I C;  5AV6 D;  3MGS B;  1F66 C;  4H9R B;  3MGP B;  3W96 D;  5E5A A;  3AZK D;  3WKJ A;  2Y2L A;  1P3K D;  3MGR A;  3X1U A;  1ID3 A;  3FDD A;  1P3I B;  4YM6 C;  3X1T B;  1B67 A;  3EG5 B;  4QLC C;  3C1B C;  3UTB D;  1WWI A;  4JJN A;  1S32 C;  5GXQ C;  5B0Y B;  2HIO B;  4HGA C;  4KUD C;  4AWL C;  4KGC B;  1U35 C;  3EPJ A;  2ZY5 A;  3LZ0 A;  5FUG B;  4CAY A;  5B2I A;  2F8N K;  5B2I D;  1P3I A;  4WU8 B;  3LZ1 C;  2YFV A;  3REI D;  5F99 C;  2CV5 B;  3A6N D;  5AY8 D;  5B0Z D;  3UT9 B;  5B24 C;  3B0D C;  3MGQ A;  4J8V A;  1P3M D;  1KX4 D;  2ZY2 A;  3AV1 A;  1P3L D;  4XZQ C;  2HUE C;  4QLC A;  3EPK A; 
#chains in the Genus database with same CATH homology
 3W98 A;  3MVD A;  3AZG C;  4JJN C;  4H9Q B;  5AVC D;  3AZG A;  4WU9 C;  5KDM A;  4WU8 A;  3NQU A;  2ARO C;  5B32 C;  3MNN B;  4J8X C;  5B1M C;  3AN2 C;  5AVC A;  3MGR C;  3UTA B;  3WTP C;  4LD9 B;  5B40 A;  3MVD D;  5GT3 A;  3AV1 B;  3H0M C;  4ZBJ B;  3W98 B;  4QLC B;  3AZH D;  4H9S C;  3REJ D;  4X23 B;  3KWQ C;  3W97 D;  3R45 A;  3B6G A;  5AY8 A;  5B0Z A;  2Y2G A;  4J8W D;  2NQB C;  3REL A;  5DNM A;  3REH B;  3AZJ C;  1EQZ B;  5CPK A;  5BS7 A;  3LZ0 B;  3REJ A;  5AVB D;  3W99 D;  3LZ1 B;  2NQB B;  2JE5 A;  5AV5 B;  4X23 A;  4CSR A;  3C1C B;  3W96 C;  1JFI A;  3AYW B;  4Z5T D;  1R4V A;  1P3L B;  3X1V C;  3REK C;  5BO0 A;  3UT9 A;  1P3A A;  2BYM B;  1KX5 B;  3AZN C;  3AN2 B;  3AZK A;  3UT9 D;  4DRB A;  3AV1 C;  3C1B D;  3AV2 B;  1KX3 B;  2PYO D;  4G91 B;  3C1C A;  1P3P D;  3AZF B;  1N1J A;  2Y2J A;  4YM6 B;  4XUJ D;  5GT3 B;  3AZM D;  1U35 D;  3LZ1 A;  2DF4 C;  5B2I C;  2XD5 A;  4H9P A;  5JA4 B;  1P3O C;  3MNN A;  3AFA D;  3UTB B;  3AZF C;  2ZY3 A;  3A6N C;  1PZR A;  5B24 D;  4WNN A;  3AZI C;  3LEL A;  1P3B A;  1N1J B;  3KUY A;  4G92 C;  5GSU B;  4XUJ A;  3LZ0 D;  3A1I A;  3AZM A;  1AOI C;  4DRA A;  2F8N G;  4Z2M H;  3AZE C;  3B6F B;  5GSU C;  3REH D;  4NE3 A;  3B6F D;  1M1A B;  3C1C D;  1P3P A;  5DNM B;  5B40 C;  5B32 D;  4J8X D;  5B1M D;  1Q9C A;  2NZD D;  3AZG B;  5AV9 D;  4H9Q A;  5GT0 B;  3MGR D;  3AN2 A;  3F6T A;  2RVQ D;  5B1M A;  3W98 D;  3WKJ D;  3O62 B;  3AZH C;  3B6F A;  4UUZ B;  4J8V D;  3A6N A;  3LJA B;  3X1S C;  4NFT A;  5CPJ C;  2NQB D;  3AV2 A;  1KX3 A;  3AZI A;  1U35 B;  1HQ3 A;  5B2J A;  4X23 C;  1BH9 B;  3KWQ B;  3MGQ C;  3AZJ D;  1M19 A;  3AZK B;  1HQ3 C;  1T3U A;  3AZL C;  3REL D;  2F8N B;  4J8U A;  4UUZ A;  3WTP E;  4Z66 A;  2G5I C;  3NQJ B;  5B33 D;  1F66 D;  2NQB A;  2Y2K A;  5BT1 C;  4NE6 A;  1P3O B;  3REK D;  5AV5 A;  3X1V D;  2HUE B;  1M19 B;  2Y2M A;  1BH9 A;  5B32 G;  1M1A A;  3UT9 C;  3AZI B;  2F8N A;  2HIO D;  3B0D B;  5DNN D;  4KGC A;  4YM6 D;  3X1U C;  1ID3 C;  4WU8 D;  4QLC D;  3AZH B;  3REL B;  2F8N D;  1S32 D;  5GXQ D;  4Z5T B;  5C3I C;  1P34 C;  1BFM A;  3AZL A;  3P5J B;  4G91 C;  3O62 D;  1TZY B;  5E5A C;  3A1K A;  5GT0 A;  5AV5 D;  4Z66 B;  5JRG A;  3REJ B;  4KUD B;  5GT0 D;  3MGR B;  5CP6 A;  4ZUX D;  2ZY4 A;  3LJA D;  4Z66 D;  3REI B;  2FJ7 A;  3KUY D;  5G49 B;  4R8P A;  5BNX A;  3H0R C;  5BNV B;  5B0Y C;  5AV8 A;  2VQR A;  3MGS A;  3IP4 C;  3MNN D;  2HIO A;  5CPJ B;  1AOI D;  1P3M C;  1KX4 C;  3AZE D;  4H9S A;  3A6N B;  3LJA A;  3AZN A;  3WTP A;  4XUJ B;  3AZM B;  3C1C C;  1EQZ C;  4R8P B;  4H9O A;  4JJN D;  5AVC C;  4WU9 D;  3X1T D;  5F99 B;  3UTA D;  3TU4 C;  3B0B A;  4J8W B;  3WA9 C;  2YFV B;  3KXB D;  2PYO A;  2ARO D;  2RVQ C;  3AN2 D;  3B6G B;  4WZS B;  4J8U D;  3R45 B;  2JSS A;  5FUG A;  3H0L C;  5B31 G;  2ZM5 A;  5CPK C;  4J8V C;  3V9R A;  3VH6 T;  3AZJ A;  3MGP A;  3X1S D;  1M19 D;  4LD9 C;  2YFW B;  1P3G D;  3REJ C;  5DNM C;  3KWQ D;  5CPK B;  5GXQ B;  5AV6 A;  2L5A A;  4H9N A;  1WWS A;  5B1M B;  5F99 A;  2F8N H;  4X23 D;  3B6G C;  3NQU B;  3MGQ D;  1P3M A;  3B0C T;  4WV4 B;  3X1U B;  1ID3 B;  3AZL D;  3REL C;  3AL0 C;  5B1L B;  1ZLA B;  1HQ3 B;  2Y2I A;  4Z2M G;  3WAA B;  1M18 C;  5B1L D;  5AVB C;  4YS3 C;  5AV9 A;  3W99 C;  2XD1 A;  1BH8 A;  2ARO A;  1TAF A;  2CV5 C;  3W99 B;  5B31 D;  3LEL B;  1P3B B;  2FFF B;  2Y2O A;  1H3O A;  3REH A;  1P3G B;  1M18 B;  3AZN D;  5BNX B;  1P3F C;  2IO5 C;  1P3M B;  2UWX A;  3WA9 A;  4AWL B;  4WJ3 C;  5B24 A;  3AZE B;  4KHA B;  3X1U D;  4WU8 C;  1ID3 D;  2NZD B;  4EO5 C;  2PYO C;  2ARO B;  4XZQ A;  1P34 D;  1P3A D;  3AFA A;  3AYW A;  3WTP B;  4R8P D;  5AV5 C;  5E5A D;  4JJN B;  5AV8 C;  3TU4 B;  4Z5T A;  1M18 A;  3LJA C;  5CPI B;  4Z66 C;  5KDM B;  3B0C W;  1H3O B;  1P3G A;  3AFA C;  3REI A;  5CP6 B;  3AZF D;  2FJ7 B;  5AV6 B;  3VH5 A;  5G49 A;  5GT3 C;  5GXQ A;  3X1S B;  2RIQ A;  3MGP C;  3C1B A;  3AFA B;  1P3I D;  4KUD A;  4YM6 A;  5AV6 C;  1ZLA D;  2NZD A;  3LZ0 C;  3VH5 W;  2F2A C;  4J8U B;  1P3K B;  1KX4 B;  5CPJ A;  5GSU D;  3REH C;  3W97 A;  3KXB B;  3EPH A;  1EQZ D;  1TZY D;  3UTA C;  3AZH A;  4NE5 A;  3B6F C;  4KGC C;  3TU4 D;  1P3F B;  1EQZ A;  1F66 A;  2DQN C;  5B40 D;  1M1A C;  5B31 A;  2NZD C;  3W99 A;  5AV9 C;  3UTB C;  3WKJ C;  5AV9 B;  5CPK D;  1P3K A;  4CSR B;  4LD9 D;  1P3G C;  5DNM D;  4E44 A;  4WU9 B;  5B0Y A;  3MGS C;  1F66 B;  5B31 B;  2BYM A;  1KX5 A;  5CP6 C;  4H9N B;  2FJ7 C;  3AV2 C;  1KX3 C;  5JRG D;  1A7W A;  5CPI D;  5F99 D;  5B2J C;  1KX5 D;  2YFW A;  4H9R A;  1M18 D;  5B1L C;  4ZBJ C;  1S32 A;  4YS3 D;  1P3O A;  2Y2P A;  1KU5 A;  4XZQ D;  1P34 A;  2CV5 D;  5B33 C;  3KFU G;  3MGQ B;  5BT1 D;  5B32 B;  1B6W A;  4J8X B;  1Z2C B;  3WAA A;  1HTA A;  5CHL B;  1P3L A;  3WAA D;  3UTB A;  4G92 B;  3AZL B;  2HIO C;  4H9O B;  5AVB A;  5DNN C;  5B33 B;  1TZY A;  5JRG B;  2CWE A;  3EPL A;  1P3A C;  2IO5 B;  3LEL C;  1P3B C;  2Y2Q A;  3W97 C;  4R8P C;  5AV8 D;  4J8W C;  4XZQ B;  3KSY A;  3O62 C;  3AZF A;  3WA9 B;  4M6B A;  3W96 A;  4KHA A;  5DNN B;  5GT0 C;  4ZUX C;  3KUY C;  5AY8 B;  5B0Z B;  4EO5 B;  5CPI A;  5B0Y D;  4H9P B;  5JA4 A;  3AYW D;  5E5A B;  3MNN C;  1ZLA C;  2J8P A;  3X1S A;  3C1B B;  4Z5T C;  5C3I B;  1P34 B;  4E45 A;  4DQY B;  3KUY B;  4HGA B;  3AZK C;  1TZY C;  4KGC D;  5B2J B;  3X1T A;  1P3K C;  3WA9 D;  3X1T C;  3KXB A;  3REK A;  5BNV A;  3X1V A;  1M1A D;  1P3P B;  3MVD B;  3KXB C;  3AV1 D;  5B2I B;  2G5H C;  5BO0 B;  1KX4 A;  1P3F A;  1P3A B;  1P3P C;  4J8U C;  3W97 B;  4XUJ C;  3AZM C;  3VH6 A;  1AOI A;  5GSU A;  4KUD D;  5B24 B;  3AZE A;  3NQJ A;  1M19 C;  5AVC B;  3VH5 T;  2BYK B;  1ZLA A;  5B1L A;  5B40 B;  3MGS D;  5AV8 B;  4J8W A;  4YS3 A;  1P3O D;  5CP6 D;  2JCH A;  5BS7 C;  4ZUX A;  3AV2 D;  5JRG C;  1KX3 D;  2FJ7 D;  2PYO B;  3B6G D;  2Y2H A;  5CPI C;  5B2J D;  3LZ1 D;  1KX5 C;  1TAF B;  3KWQ A;  3AZI D;  3REI C;  3AZN B;  4UPK A;  5AY8 C;  5B0Z C;  2LY8 A;  3O62 A;  1P3L C;  2Y2N A;  1S32 B;  4WNN B;  4LD9 A;  5B31 C;  3AZG D;  5DNN A;  2BG1 A;  3UTA A;  3WAA C;  5B32 A;  4J8X A;  4YS3 B;  3W98 C;  1P3F D;  3VH6 W;  4WU9 A;  3V9R B;  3AZJ B;  3WTP D;  1W2E A;  3TU4 A;  1BH8 B;  3MVD C;  3LEL D;  1P3B D;  4CAY B;  5B33 A;  5AVB B;  5CPJ D;  1AOI B;  2CV5 A;  4J8V B;  1HQ3 D;  3WKJ B;  1F1E A;  3REK B;  2W8S A;  3X1V B;  4ZUX B;  2BYK A;  1U35 A;  1ULY A;  3AYW C;  5GT3 D;  1JFI B;  3MGP D;  3W96 B;  1P3I C;  5AV6 D;  3MGS B;  1F66 C;  4H9R B;  3MGP B;  3W96 D;  5E5A A;  3AZK D;  3WKJ A;  2Y2L A;  1P3K D;  3MGR A;  3X1U A;  1ID3 A;  3FDD A;  1P3I B;  4YM6 C;  3X1T B;  1B67 A;  3EG5 B;  4QLC C;  3C1B C;  3UTB D;  1WWI A;  4JJN A;  1S32 C;  5GXQ C;  5B0Y B;  2HIO B;  4HGA C;  4KUD C;  4AWL C;  4KGC B;  1U35 C;  3EPJ A;  2ZY5 A;  3LZ0 A;  5FUG B;  4CAY A;  5B2I A;  2F8N K;  5B2I D;  1P3I A;  4WU8 B;  3LZ1 C;  2YFV A;  3REI D;  5F99 C;  2CV5 B;  3A6N D;  5AY8 D;  5B0Z D;  3UT9 B;  5B24 C;  3B0D C;  3MGQ A;  4J8V A;  1P3M D;  1KX4 D;  2ZY2 A;  3AV1 A;  1P3L D;  4XZQ C;  2HUE C;  4QLC A;  3EPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...