3X1VB

Crystal structure of nucleosome core particle in the presence of histone variant involved in reprogramming
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1vB00
4X23B 4NFTA 4WV4B 1N1JA 3REKB 1BH8B 1P34A 3W96A 3MGRD 5B40B 5B2JC 5CP6C 2HIOD 3AZGB 3MVDB 4ZBJB 3AZEA 2AROD 5AY8A 2F8ND 3C1CA 3LELA 3REJA 1H3OB 5BT1D 4KGCC 4H9OA 4YM6C 3W98D 3KXBD 4WNNB 5B24D 4J8WA 1P3OB 1KX3C 2NZDB 5AV6D 3R45A 3W97B 3REIB 3MGPA 3AZLB 5CPKB 3REKA 2CV5A 1BH8A 3X1SC 1P3GD 3X1VB 3AV1D 3AZGA 5GSUD 5B0ZC 3AFAB 1KX4C 5E5AD 5B32B 4WU9C 3REHB 3X1TA 3UTBC 3B6FB 1U35A 1P3IB 2NZDA 5BNXB 1S32B 3UT9C 1F66D 4H9QA 5B1MC 5GT3C 4ZUXB 3W97A 3AZNC 4H9RB 5C3IC 1ZLAD 5CPJC 1P3MC 3AYWD 4XUJB 4NE5A 1AOIA 4NE6A 3WTPA 1EQZD 2YFWA 5KDMB 1KU5A 3AZMC 5BO0A 1B67A 5GT0A 5B31G 4R8PD 3AN2C 4Z5TA 5JRGA 3O62C 4H9SA 3MGSD 4Z66C 4H9RA 1P3KA 3AZKA 5B0YC 3WKJB 5AVCD 2LY8A 5G49B 5F99C 4Z2MH 4J8UD 1P3BC 3WA9D 4KUDC 4UUZB 4AWLB 4EO5B 3X1SB 5B2JA 1HQ3D 1ID3B 5CP6A 3VH6T 1M1AC 4WU8D 3AZHB 1M19A 1KX5B 3LZ1C 3W99C 1KX4B 4WU9B 1P34D 4KGCA 4YM6A 3NQJB 3W96D 5DNNC 3MNNC 3KUYD 3KWQC 4NE3A 4QLCC 1KX3A 4X23C 3AZED 3B6GC 5AY8D 5DNMC 5B40C 3C1CD 3AZIC 3LELD 3REJD 5C3IB 4J8XB 3MVDC 4ZBJC 4J8WD 5JA4A 3C1BB 3X1SA 3WAAB 5B0ZA 3AZFB 1KX4A 1P3OC 5B2IB 5AVBB 4WU9A 5B1LB 3MGPD 2CV5D 3UTBA 1M18D 3REIC 3AZLC 3AN2B 5CPKC 3UT9A 5GT3A 5B1MA 3AZNA 1P3LB 4G92C 3X1VC 4Z66B 1TZYC 3X1TD 2PYOB 1U35D 5CPJA 1P3MA 3AFAC 2NQBA 5B32C 2NZDD 3REHC 4CAYA 3NQUB 1P3IC 2F8NG 4DRAA 1S32C 3AZMA 4ZUXC 5FUGA 1AOID 2YFVB 3WTPD 5AV9B 3LZ1B 3W99B 3LJAC 4H9NA 3O62A 4J8VA 4Z66A 5DNNB 1Q9CA 1P3PB 3KWQB 4XZQB 4QLCB 5B0YA 5B31B 3B6GB 5GT0D 4LD9B 5DNMB 3AZIB 4Z5TD 5JRGD 3MGQB 5F99A 5AV8B 4M6BA 1P3BA 4KUDA 1P3KD 3X1UC 3AZKD 3MGRC 1M1AA 5BS7C 3LZ1A 3W99A 3WKJC 5DNNA 5B2JD 3MNNA 5GXQB 5BT1C 5CP6D 4QLCA 3KWQA 3W98C 3A6ND 4X23A 1M19D 3B6GA 4AWLC 4EO5C 5B40A 5DNMA 3VH5W 3AZIA 4G92B 1ID3C 1TZYB 4KGCD 4YM6D 3MVDA 3AZHC 5B33C 1KX5C 4JJNC 3LZ0C 3TU4B 1KX3D 1BFMA 2FJ7B 1H3OA 3AV2D 3RELD 4WNNA 1B6WA 1P3OA 5CPIB 5B0ZD 3REIA 3LJAB 4J8XC 3AZLA 5CPKA 3C1BC 1KX4D 4WU9D 3WAAC 3X1VA 4YS3D 1TZYA 3UTBD 4CSRB 3AZFC 3AFAA 5B32A 5B2IC 5AVBC 2HUEB 5B1LC 3REHA 3UT9D 3B6FA 5GT3D 5B1MD 1P3AB 3AZND 3WTPE 5AV5B 3AV2B 3UTAD 1P3IA 3X1UB 5BNXA 5CPJD 1S32A 2IO5C 1P3MD 3MGRB 2NQBD 4ZUXA 1P3LC 2HIOB 2PYOC 2CWEA 2BYKB 2F8NB 2RVQC 4XUJA 3W98B 4CSRA 3KXBB 3AZMD 5B24B 5KDMA 5AV6B 3O62D 4J8VD 4Z66D 5B33B 3X1UA 5AV9C 4JJNB 3LZ0B 5B0YD 3MGRA 1P3GB 3AV1B 5GSUB 1P3PC 4XZQC 5F99D 2BYKA 1P3BD 5B31C 3WKJA 4KUDD 3AZJC 4LD9C 5G49A 3MGQC 3W98A 1M1AD 5AV8C 3KUYC 4UUZA 1ID3A 1F66B 3AZHA 3VH5A 5DNND 5B33A 3MNND 3REJC 4JJNA 1KX5A 4QLCD 1ZLAB 3LZ0A 4J8WC 4X23D 3B6GD 3REKD 3AYWB 3NQJA 5B40D 5DNMD 1EQZB 5GXQC 3AZGD 3MVDD 2IO5B 3KSYA 4J8XA 1M18C 3C1BA 1P3OD 4R8PB 3TU4C 3WAAA 2F8NK 4E45A 3MGSB 2FJ7C 3AZFA 3W97D 5B2IA 5AVBA 5B1LA 3REID 3AZLD 5AVCB 5CPKD 1TAFB 3X1VD 3B0CW 5CPIC 1TZYD 2F8NH 4E44A 4J8UB 3AN2A 3AFAD 3VH6W 5B32D 1HQ3B 1P3LA 3B0DB 3REHD 4WU8B 2PYOA 3B6FD 1P3ID 3AZJB 2HUEC 1S32D 1P3FC 1N1JB 1P34B 3W96B 1P3AC 3KUYB 4ZUXD 5AV5C 3AV2C 3NQUA 3AZEB 5GT0C 5AY8B 3C1CB 1TAFA 3REJB 4XUJD 2HIOC 1WWIA 2YFVA 5AV9A 4H9OB 4J8WB 2AROC 1ULYA 1P3PA 4XZQA 3R45B 4H9PB 5B24C 3KXBC 5B31A 3X1UD 3AZJA 3MGPB 4LD9A 2CV5B 5AV6C 3MGQA 5CHLB 5AV8A 3KUYA 2JSSA 1M18B 3A6NC 1M19C 1A7WA 3WKJD 1P3GC 3AV1C 3X1TB 5GSUC 1U35B 5E5AC 4KHAB 3X1SD 5GXQA 1ID3D 4H9QB 3RELC 4H9PA 3AZHD 5B33D 1KX5D 4JJND 3LZ0D 1F66C 1AOIB 3WTPB 1M18A 1ZLAC 3TU4A 2FJ7A 1P3FB 3B0BA 2YFWB 5BNVB 4YS3C 3AYWC 1EQZC 5BO0B 4J8XD 1WWSA 5GT0B 1R4VA 4KHAA 3C1BD 4Z5TB 5JRGB 3WAAD 5CPIA 3LJAA 3UTAC 3AZFD 1F1EA 1P3KB 3AZKB 2AROB 4R8PC 5B2ID 5AVBD 5B1LD 2NQBC 3MGSC 3VH6A 1HTAA 1P3FA 3AN2D 5AVCC 2BYMB 5BNVA 4DRBA 5B2JB 1P3AA 5CP6B 5AV5A 3AV2A 1P3LD 2PYOD 3A6NB 1M19B 4J8UC 1JFIB 3WA9C 1HQ3C 2RVQD 3B0DC 2HIOA 5BS7A 4J8VC 4KGCB 4WU8C 4YM6B 4HGAC 2AROA 5E5AB 1KX3B 2F8NA 4Z2MG 1P34C 3W96C 3RELB 3KXBA 5B24A 4G91C 5AV9D 3B0CT 3W99D 3LZ1D 3AZEC 5AV6A 5JA4B 2BYMA 5AY8C 3C1CC 3LELC 5B0ZB 3KWQD 4XZQD 3A6NA 1P3PD 1JFIA 5B31D 1P3GA 3AZJD 4YS3B 4LD9D 3AV1A 3AZID 5GSUA 3MGQD 3UTBB 5AV8D 2L5AA 5E5AA 5B32G 3MGPC 3REKC 3UT9B 2CV5C 5GT3B 5B1MB 3RELA 3AZNB 3UTAB 3AZGC 5CPJB 1P3MB 1F66A 2NQBB 5GXQD 3X1TC 4CAYB 1U35C 1ZLAA 2NZDC 3AYWA 4YS3A 1EQZA 4WZSB 3AZMB 3VH5T 3W97C 5FUGB 3WA9B 3V9RB 3TU4D 4H9NB 3O62B 4J8VB 2FJ7D 4HGAB 3UTAA 1AOIC 3WTPC 1BH9B 4R8PA 5B0YB 3MGSA 5F99B 5CPID 3B6FC 4G91B 1P3BB 3LJAD 4KUDB 5AVCA 4Z5TC 5JRGC 3LELB 1M1AB 4H9SC 4J8UA 3WA9A 3V9RA 1P3KC 3AZKC 1HQ3A 1P3FD 4WU8A 3MNNB 4XUJC 1P3AD 5AV5D 1BH9A
chains in the Genus database with same CATH superfamily
4X23B 4NFTA 4WV4B 1N1JA 2Y2OA 1BH8B 3REKB 3W96A 2J8PA 5B2JC 5B40B 3MGRD 1P34A 5CP6C 2HIOD 3AZGB 3MVDB 2FFFB 4ZBJB 3AZEA 2AROD 5AY8A 3A1IA 2F8ND 3C1CA 3LELA 3REJA 1H3OB 5BT1D 4KGCC 4H9OA 4YM6C 3W98D 3KXBD 4WNNB 5B24D 4J8WA 1P3OB 1KX3C 2NZDB 5AV6D 3R45A 3W97B 3REIB 3MGPA 3AZLB 5CPKB 3REKA 2CV5A 1BH8A 3X1SC 1P3GD 3X1VB 3AV1D 3AZGA 5GSUD 5B0ZC 2Y2QA 3AFAB 1KX4C 5E5AD 5B32B 4WU9C 3REHB 3X1TA 3UTBC 3B6FB 1U35A 3FDDA 1P3IB 2NZDA 5BNXB 1S32B 3UT9C 1F66D 4H9QA 5B1MC 5GT3C 4ZUXB 3W97A 3AZNC 4H9RB 5C3IC 1ZLAD 5CPJC 1P3MC 3AYWD 4XUJB 4NE5A 1AOIA 4NE6A 3WTPA 1EQZD 2ZY3A 2YFWA 5KDMB 1KU5A 3AZMC 5BO0A 1B67A 5GT0A 5B31G 2RIQA 4R8PD 3AN2C 4Z5TA 5JRGA 3O62C 4H9SA 3MGSD 4Z66C 2Y2JA 4H9RA 1P3KA 3AZKA 5B0YC 3WKJB 5AVCD 2G5IC 2LY8A 2ZY5A 5G49B 5F99C 4Z2MH 4J8UD 3EG5B 1P3BC 3WA9D 4UUZB 4AWLB 4EO5B 4KUDC 3X1SB 5B2JA 1HQ3D 1ID3B 5CP6A 3VH6T 1M1AC 4WU8D 3AZHB 1M19A 1KX5B 3LZ1C 3W99C 1KX4B 4WU9B 1P34D 4KGCA 4YM6A 3NQJB 3W96D 5DNNC 3MNNC 3KUYD 3KWQC 4NE3A 4QLCC 1KX3A 4X23C 3AZED 3B6GC 5AY8D 5DNMC 2ZM5A 3C1CD 5B40C 3AZIC 3LELD 3REJD 5C3IB 4J8XB 3MVDC 4ZBJC 4J8WD 5JA4A 3C1BB 3X1SA 3WAAB 5B0ZA 3AZFB 1KX4A 1P3OC 5B2IB 5AVBB 4WU9A 2F2AC 5B1LB 3MGPD 2CV5D 3UTBA 4UPKA 1M18D 3REIC 3AZLC 3AN2B 5CPKC 3UT9A 5GT3A 5B1MA 3AZNA 1P3LB 4G92C 3X1VC 4Z66B 1TZYC 3X1TD 2PYOB 1U35D 5CPJA 1P3MA 3AFAC 2NQBA 5B32C 2NZDD 3REHC 4CAYA 3NQUB 1P3IC 2F8NG 4DRAA 1S32C 3AZMA 4ZUXC 5FUGA 1AOID 2YFVB 3WTPD 5AV9B 3LZ1B 3W99B 3LJAC 4H9NA 3O62A 4J8VA 4Z66A 5DNNB 1Q9CA 1P3PB 3KWQB 4XZQB 4QLCB 5B0YA 2Y2GA 5B31B 3B6GB 5GT0D 4LD9B 5DNMB 3AZIB 4Z5TD 5JRGD 3MGQB 5F99A 5AV8B 4M6BA 1P3BA 4KUDA 1P3KD 3X1UC 3AZKD 3EPLA 3MGRC 1M1AA 5BS7C 3EPJA 3EPKA 3LZ1A 3W99A 3WKJC 2VQRA 5DNNA 5B2JD 3MNNA 5GXQB 5BT1C 5CP6D 4QLCA 3KWQA 3W98C 3A6ND 4X23A 1M19D 3B6GA 4AWLC 4EO5C 5B40A 5DNMA 3VH5W 3AZIA 4G92B 1ID3C 1TZYB 2Y2NA 4KGCD 4YM6D 3MVDA 3AZHC 5B33C 1KX5C 4JJNC 3LZ0C 3TU4B 1KX3D 1BFMA 2FJ7B 1H3OA 3AV2D 3RELD 4WNNA 1B6WA 1P3OA 5CPIB 5B0ZD 3REIA 3LJAB 4J8XC 3AZLA 5CPKA 2Y2PA 3C1BC 1KX4D 4WU9D 3WAAC 3X1VA 4YS3D 1TZYA 3UTBD 4CSRB 3AZFC 3F6TA 3AFAA 5B32A 5B2IC 5AVBC 2HUEB 5B1LC 3REHA 3UT9D 3B6FA 5GT3D 5B1MD 1P3AB 3AZND 3WTPE 3H0LC 5AV5B 3AV2B 3UTAD 1P3IA 3X1UB 5BNXA 5CPJD 1S32A 2IO5C 1P3MD 3MGRB 2NQBD 4ZUXA 1P3LC 3AL0C 2HIOB 2JCHA 2PYOC 2CWEA 2BYKB 2F8NB 2RVQC 4XUJA 3W98B 4CSRA 3KXBB 3AZMD 2ZY2A 5B24B 5KDMA 5AV6B 3KFUG 3O62D 4J8VD 4Z66D 5B33B 3X1UA 5AV9C 4JJNB 3A1KA 3LZ0B 5B0YD 3MGRA 1P3GB 3AV1B 5GSUB 1P3PC 4XZQC 5F99D 2BYKA 1P3BD 5B31C 3WKJA 4KUDD 3AZJC 4LD9C 5G49A 2W8SA 3MGQC 3W98A 1M1AD 5AV8C 3KUYC 2G5HC 4UUZA 1ID3A 1F66B 3AZHA 3VH5A 5DNND 5B33A 3MNND 2Y2IA 4JJNA 3REJC 4QLCD 1KX5A 1ZLAB 3LZ0A 4J8WC 4X23D 3B6GD 2Y2KA 3REKD 3AYWB 3NQJA 5B40D 5DNMD 1EQZB 5GXQC 3AZGD 3MVDD 2IO5B 2XD1A 3KSYA 4J8XA 1M18C 3C1BA 1P3OD 4R8PB 3TU4C 3WAAA 2F8NK 4E45A 3MGSB 2FJ7C 3AZFA 3W97D 5B2IA 5AVBA 5B1LA 4DQYB 3REID 3AZLD 5AVCB 5CPKD 1TAFB 3X1VD 3B0CW 5CPIC 1TZYD 2F8NH 4E44A 4J8UB 3AN2A 3AFAD 3VH6W 5B32D 1HQ3B 1P3LA 3B0DB 3REHD 4WU8B 2PYOA 3B6FD 1P3ID 3AZJB 2HUEC 1S32D 1P3FC 1N1JB 1P34B 3W96B 1P3AC 3KUYB 4ZUXD 5AV5C 3AV2C 2DF4C 3NQUA 3AZEB 5GT0C 5AY8B 3C1CB 1TAFA 3REJB 4XUJD 2HIOC 1WWIA 2YFVA 5AV9A 4H9OB 4J8WB 2AROC 1ULYA 1P3PA 4XZQA 3EPHA 3R45B 4H9PB 5B24C 3KXBC 5B31A 3X1UD 3AZJA 3MGPB 4LD9A 2CV5B 5AV6C 3MGQA 3P5JB 5CHLB 5AV8A 3KUYA 2JSSA 1M18B 3A6NC 1M19C 1A7WA 3WKJD 1P3GC 3AV1C 3X1TB 5GSUC 1U35B 5E5AC 4KHAB 3X1SD 5GXQA 1ID3D 4H9QB 3RELC 4H9PA 3AZHD 5B33D 1KX5D 4JJND 3LZ0D 1F66C 1AOIB 3WTPB 1M18A 1ZLAC 3TU4A 2UWXA 2FJ7A 1P3FB 2BG1A 2XD5A 3B0BA 2YFWB 5BNVB 2JE5A 4YS3C 3AYWC 1EQZC 5BO0B 4J8XD 1WWSA 5GT0B 1R4VA 4KHAA 3C1BD 4Z5TB 5JRGB 3WAAD 5CPIA 3LJAA 2Y2MA 2DQNC 3UTAC 1F1EA 3AZFD 3AZKB 2AROB 1P3KB 4R8PC 5B2ID 5AVBD 5B1LD 2NQBC 3MGSC 3VH6A 1HTAA 2ZY4A 1P3FA 3AN2D 5AVCC 2BYMB 5BNVA 4DRBA 5B2JB 1P3AA 5CP6B 5AV5A 3AV2A 1P3LD 2PYOD 3A6NB 1M19B 4J8UC 1JFIB 3WA9C 2Y2HA 1HQ3C 2RVQD 3B0DC 2HIOA 5BS7A 4J8VC 4KGCB 4WU8C 4YM6B 4HGAC 2AROA 3H0RC 5E5AB 1KX3B 2F8NA 4Z2MG 1P34C 3W96C 3RELB 3KXBA 5B24A 4G91C 5AV9D 3B0CT 3W99D 3LZ1D 3AZEC 5AV6A 5JA4B 2BYMA 5AY8C 3C1CC 3LELC 5B0ZB 3KWQD 4XZQD 3A6NA 1P3PD 1JFIA 5B31D 2Y2LA 1P3GA 3AZJD 4YS3B 4LD9D 3AV1A 3AZID 5GSUA 3MGQD 3UTBB 5AV8D 2L5AA 5E5AA 5B32G 3MGPC 3REKC 3UT9B 2CV5C 5GT3B 5B1MB 3RELA 3AZNB 3UTAB 3AZGC 5CPJB 1Z2CB 1P3MB 1F66A 2NQBB 5GXQD 3X1TC 4CAYB 1U35C 1ZLAA 1W2EA 2NZDC 3AYWA 4YS3A 1EQZA 4WZSB 3AZMB 3VH5T 3W97C 5FUGB 3WA9B 3V9RB 3TU4D 4H9NB 3O62B 4J8VB 2FJ7D 4HGAB 3UTAA 1AOIC 3WTPC 1BH9B 4R8PA 5B0YB 1T3UA 3MGSA 3H0MC 5F99B 5CPID 3B6FC 4G91B 1P3BB 3LJAD 4KUDB 5AVCA 3IP4C 4Z5TC 5JRGC 3LELB 1M1AB 4H9SC 4WJ3C 4J8UA 3WA9A 3V9RA 1P3KC 1PZRA 3AZKC 1HQ3A 1P3FD 4WU8A 3MNNB 4XUJC 1P3AD 5AV5D 1BH9A
chains in the Genus database with same CATH topology
4X23B 4NFTA 4WV4B 1N1JA 2Y2OA 1BH8B 3REKB 3W96A 2J8PA 5B2JC 5B40B 3MGRD 1P34A 5CP6C 2HIOD 3AZGB 3MVDB 2FFFB 4ZBJB 3AZEA 2AROD 5AY8A 3A1IA 2F8ND 3C1CA 3LELA 3REJA 1H3OB 5BT1D 4KGCC 4H9OA 4YM6C 3W98D 3KXBD 4WNNB 5B24D 4J8WA 1P3OB 1KX3C 2NZDB 5AV6D 3R45A 3W97B 3REIB 3MGPA 3AZLB 5CPKB 3REKA 2CV5A 1BH8A 3X1SC 1P3GD 3X1VB 3AV1D 3AZGA 5GSUD 5B0ZC 2Y2QA 3AFAB 1KX4C 5E5AD 5B32B 4WU9C 3REHB 3X1TA 3UTBC 3B6FB 1U35A 3FDDA 1P3IB 2NZDA 5BNXB 1S32B 3UT9C 1F66D 4H9QA 5B1MC 5GT3C 4ZUXB 3W97A 3AZNC 4H9RB 5C3IC 1ZLAD 5CPJC 1P3MC 3AYWD 4XUJB 4NE5A 1AOIA 4NE6A 3WTPA 1EQZD 2ZY3A 2YFWA 5KDMB 1KU5A 3AZMC 5BO0A 1B67A 5GT0A 5B31G 2RIQA 4R8PD 3AN2C 4Z5TA 5JRGA 3O62C 4H9SA 3MGSD 4Z66C 2Y2JA 4H9RA 1P3KA 3AZKA 5B0YC 3WKJB 5AVCD 2G5IC 2LY8A 2ZY5A 5G49B 5F99C 4Z2MH 4J8UD 3EG5B 1P3BC 3WA9D 4UUZB 4AWLB 4EO5B 4KUDC 3X1SB 5B2JA 1HQ3D 1ID3B 5CP6A 3VH6T 1M1AC 4WU8D 3AZHB 1M19A 1KX5B 3LZ1C 3W99C 1KX4B 4WU9B 1P34D 4KGCA 4YM6A 3NQJB 3W96D 5DNNC 3MNNC 3KUYD 3KWQC 4NE3A 4QLCC 1KX3A 4X23C 3AZED 3B6GC 5AY8D 5DNMC 2ZM5A 3C1CD 5B40C 3AZIC 3LELD 3REJD 5C3IB 4J8XB 3MVDC 4ZBJC 4J8WD 5JA4A 3C1BB 3X1SA 3WAAB 5B0ZA 3AZFB 1KX4A 1P3OC 5B2IB 5AVBB 4WU9A 2F2AC 5B1LB 3MGPD 2CV5D 3UTBA 4UPKA 1M18D 3REIC 3AZLC 3AN2B 5CPKC 3UT9A 5GT3A 5B1MA 3AZNA 1P3LB 4G92C 3X1VC 4Z66B 1TZYC 3X1TD 2PYOB 1U35D 5CPJA 1P3MA 3AFAC 2NQBA 5B32C 2NZDD 3REHC 4CAYA 3NQUB 1P3IC 2F8NG 4DRAA 1S32C 3AZMA 4ZUXC 5FUGA 1AOID 2YFVB 3WTPD 5AV9B 3LZ1B 3W99B 3LJAC 4H9NA 3O62A 4J8VA 4Z66A 5DNNB 1Q9CA 1P3PB 3KWQB 4XZQB 4QLCB 5B0YA 2Y2GA 5B31B 3B6GB 5GT0D 4LD9B 5DNMB 3AZIB 4Z5TD 5JRGD 3MGQB 5F99A 5AV8B 4M6BA 1P3BA 4KUDA 1P3KD 3X1UC 3AZKD 3EPLA 3MGRC 1M1AA 5BS7C 3EPJA 3EPKA 3LZ1A 3W99A 3WKJC 2VQRA 5DNNA 5B2JD 3MNNA 5GXQB 5BT1C 5CP6D 4QLCA 3KWQA 3W98C 3A6ND 4X23A 1M19D 3B6GA 4AWLC 4EO5C 5B40A 5DNMA 3VH5W 3AZIA 4G92B 1ID3C 1TZYB 2Y2NA 4KGCD 4YM6D 3MVDA 3AZHC 5B33C 1KX5C 4JJNC 3LZ0C 3TU4B 1KX3D 1BFMA 2FJ7B 1H3OA 3AV2D 3RELD 4WNNA 1B6WA 1P3OA 5CPIB 5B0ZD 3REIA 3LJAB 4J8XC 3AZLA 5CPKA 2Y2PA 3C1BC 1KX4D 4WU9D 3WAAC 3X1VA 4YS3D 1TZYA 3UTBD 4CSRB 3AZFC 3F6TA 3AFAA 5B32A 5B2IC 5AVBC 2HUEB 5B1LC 3REHA 3UT9D 3B6FA 5GT3D 5B1MD 1P3AB 3AZND 3WTPE 3H0LC 5AV5B 3AV2B 3UTAD 1P3IA 3X1UB 5BNXA 5CPJD 1S32A 2IO5C 1P3MD 3MGRB 2NQBD 4ZUXA 1P3LC 3AL0C 2HIOB 2JCHA 2PYOC 2CWEA 2BYKB 2F8NB 2RVQC 4XUJA 3W98B 4CSRA 3KXBB 3AZMD 2ZY2A 5B24B 5KDMA 5AV6B 3KFUG 3O62D 4J8VD 4Z66D 5B33B 3X1UA 5AV9C 4JJNB 3A1KA 3LZ0B 5B0YD 3MGRA 1P3GB 3AV1B 5GSUB 1P3PC 4XZQC 5F99D 2BYKA 1P3BD 5B31C 3WKJA 4KUDD 3AZJC 4LD9C 5G49A 2W8SA 3MGQC 3W98A 1M1AD 5AV8C 3KUYC 2G5HC 4UUZA 1ID3A 1F66B 3AZHA 3VH5A 5DNND 5B33A 3MNND 2Y2IA 4JJNA 3REJC 4QLCD 1KX5A 1ZLAB 3LZ0A 4J8WC 4X23D 3B6GD 2Y2KA 3REKD 3AYWB 3NQJA 5B40D 5DNMD 1EQZB 5GXQC 3AZGD 3MVDD 2IO5B 2XD1A 3KSYA 4J8XA 1M18C 3C1BA 1P3OD 4R8PB 3TU4C 3WAAA 2F8NK 4E45A 3MGSB 2FJ7C 3AZFA 3W97D 5B2IA 5AVBA 5B1LA 4DQYB 3REID 3AZLD 5AVCB 5CPKD 1TAFB 3X1VD 3B0CW 5CPIC 1TZYD 2F8NH 4E44A 4J8UB 3AN2A 3AFAD 3VH6W 5B32D 1HQ3B 1P3LA 3B0DB 3REHD 4WU8B 2PYOA 3B6FD 1P3ID 3AZJB 2HUEC 1S32D 1P3FC 1N1JB 1P34B 3W96B 1P3AC 3KUYB 4ZUXD 5AV5C 3AV2C 2DF4C 3NQUA 3AZEB 5GT0C 5AY8B 3C1CB 1TAFA 3REJB 4XUJD 2HIOC 1WWIA 2YFVA 5AV9A 4H9OB 4J8WB 2AROC 1ULYA 1P3PA 4XZQA 3EPHA 3R45B 4H9PB 5B24C 3KXBC 5B31A 3X1UD 3AZJA 3MGPB 4LD9A 2CV5B 5AV6C 3MGQA 3P5JB 5CHLB 5AV8A 3KUYA 2JSSA 1M18B 3A6NC 1M19C 1A7WA 3WKJD 1P3GC 3AV1C 3X1TB 5GSUC 1U35B 5E5AC 4KHAB 3X1SD 5GXQA 1ID3D 4H9QB 3RELC 4H9PA 3AZHD 5B33D 1KX5D 4JJND 3LZ0D 1F66C 1AOIB 3WTPB 1M18A 1ZLAC 3TU4A 2UWXA 2FJ7A 1P3FB 2BG1A 2XD5A 3B0BA 2YFWB 5BNVB 2JE5A 4YS3C 3AYWC 1EQZC 5BO0B 4J8XD 1WWSA 5GT0B 1R4VA 4KHAA 3C1BD 4Z5TB 5JRGB 3WAAD 5CPIA 3LJAA 2Y2MA 2DQNC 3UTAC 1F1EA 3AZFD 3AZKB 2AROB 1P3KB 4R8PC 5B2ID 5AVBD 5B1LD 2NQBC 3MGSC 3VH6A 1HTAA 2ZY4A 1P3FA 3AN2D 5AVCC 2BYMB 5BNVA 4DRBA 5B2JB 1P3AA 5CP6B 5AV5A 3AV2A 1P3LD 2PYOD 3A6NB 1M19B 4J8UC 1JFIB 3WA9C 2Y2HA 1HQ3C 2RVQD 3B0DC 2HIOA 5BS7A 4J8VC 4KGCB 4WU8C 4YM6B 4HGAC 2AROA 3H0RC 5E5AB 1KX3B 2F8NA 4Z2MG 1P34C 3W96C 3RELB 3KXBA 5B24A 4G91C 5AV9D 3B0CT 3W99D 3LZ1D 3AZEC 5AV6A 5JA4B 2BYMA 5AY8C 3C1CC 3LELC 5B0ZB 3KWQD 4XZQD 3A6NA 1P3PD 1JFIA 5B31D 2Y2LA 1P3GA 3AZJD 4YS3B 4LD9D 3AV1A 3AZID 5GSUA 3MGQD 3UTBB 5AV8D 2L5AA 5E5AA 5B32G 3MGPC 3REKC 3UT9B 2CV5C 5GT3B 5B1MB 3RELA 3AZNB 3UTAB 3AZGC 5CPJB 1Z2CB 1P3MB 1F66A 2NQBB 5GXQD 3X1TC 4CAYB 1U35C 1ZLAA 1W2EA 2NZDC 3AYWA 4YS3A 1EQZA 4WZSB 3AZMB 3VH5T 3W97C 5FUGB 3WA9B 3V9RB 3TU4D 4H9NB 3O62B 4J8VB 2FJ7D 4HGAB 3UTAA 1AOIC 3WTPC 1BH9B 4R8PA 5B0YB 1T3UA 3MGSA 3H0MC 5F99B 5CPID 3B6FC 4G91B 1P3BB 3LJAD 4KUDB 5AVCA 3IP4C 4Z5TC 5JRGC 3LELB 1M1AB 4H9SC 4WJ3C 4J8UA 3WA9A 3V9RA 1P3KC 1PZRA 3AZKC 1HQ3A 1P3FD 4WU8A 3MNNB 4XUJC 1P3AD 5AV5D 1BH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 B;  4NFT A;  4WV4 B;  1N1J A;  3REK B;  1BH8 B;  1P34 A;  3W96 A;  3MGR D;  5B40 B;  5B2J C;  5CP6 C;  2HIO D;  3AZG B;  3MVD B;  4ZBJ B;  3AZE A;  2ARO D;  5AY8 A;  2F8N D;  3C1C A;  3LEL A;  3REJ A;  1H3O B;  5BT1 D;  4KGC C;  4H9O A;  4YM6 C;  3W98 D;  3KXB D;  4WNN B;  5B24 D;  4J8W A;  1P3O B;  1KX3 C;  2NZD B;  5AV6 D;  3R45 A;  3W97 B;  3REI B;  3MGP A;  3AZL B;  5CPK B;  3REK A;  2CV5 A;  1BH8 A;  3X1S C;  1P3G D;  3X1V B;  3AV1 D;  3AZG A;  5GSU D;  5B0Z C;  3AFA B;  1KX4 C;  5E5A D;  5B32 B;  4WU9 C;  3REH B;  3X1T A;  3UTB C;  3B6F B;  1U35 A;  1P3I B;  2NZD A;  5BNX B;  1S32 B;  3UT9 C;  1F66 D;  4H9Q A;  5B1M C;  5GT3 C;  4ZUX B;  3W97 A;  3AZN C;  4H9R B;  5C3I C;  1ZLA D;  5CPJ C;  1P3M C;  3AYW D;  4XUJ B;  4NE5 A;  1AOI A;  4NE6 A;  3WTP A;  1EQZ D;  2YFW A;  5KDM B;  1KU5 A;  3AZM C;  5BO0 A;  1B67 A;  5GT0 A;  5B31 G;  4R8P D;  3AN2 C;  4Z5T A;  5JRG A;  3O62 C;  4H9S A;  3MGS D;  4Z66 C;  4H9R A;  1P3K A;  3AZK A;  5B0Y C;  3WKJ B;  5AVC D;  2LY8 A;  5G49 B;  5F99 C;  4Z2M H;  4J8U D;  1P3B C;  3WA9 D;  4KUD C;  4UUZ B;  4AWL B;  4EO5 B;  3X1S B;  5B2J A;  1HQ3 D;  1ID3 B;  5CP6 A;  3VH6 T;  1M1A C;  4WU8 D;  3AZH B;  1M19 A;  1KX5 B;  3LZ1 C;  3W99 C;  1KX4 B;  4WU9 B;  1P34 D;  4KGC A;  4YM6 A;  3NQJ B;  3W96 D;  5DNN C;  3MNN C;  3KUY D;  3KWQ C;  4NE3 A;  4QLC C;  1KX3 A;  4X23 C;  3AZE D;  3B6G C;  5AY8 D;  5DNM C;  5B40 C;  3C1C D;  3AZI C;  3LEL D;  3REJ D;  5C3I B;  4J8X B;  3MVD C;  4ZBJ C;  4J8W D;  5JA4 A;  3C1B B;  3X1S A;  3WAA B;  5B0Z A;  3AZF B;  1KX4 A;  1P3O C;  5B2I B;  5AVB B;  4WU9 A;  5B1L B;  3MGP D;  2CV5 D;  3UTB A;  1M18 D;  3REI C;  3AZL C;  3AN2 B;  5CPK C;  3UT9 A;  5GT3 A;  5B1M A;  3AZN A;  1P3L B;  4G92 C;  3X1V C;  4Z66 B;  1TZY C;  3X1T D;  2PYO B;  1U35 D;  5CPJ A;  1P3M A;  3AFA C;  2NQB A;  5B32 C;  2NZD D;  3REH C;  4CAY A;  3NQU B;  1P3I C;  2F8N G;  4DRA A;  1S32 C;  3AZM A;  4ZUX C;  5FUG A;  1AOI D;  2YFV B;  3WTP D;  5AV9 B;  3LZ1 B;  3W99 B;  3LJA C;  4H9N A;  3O62 A;  4J8V A;  4Z66 A;  5DNN B;  1Q9C A;  1P3P B;  3KWQ B;  4XZQ B;  4QLC B;  5B0Y A;  5B31 B;  3B6G B;  5GT0 D;  4LD9 B;  5DNM B;  3AZI B;  4Z5T D;  5JRG D;  3MGQ B;  5F99 A;  5AV8 B;  4M6B A;  1P3B A;  4KUD A;  1P3K D;  3X1U C;  3AZK D;  3MGR C;  1M1A A;  5BS7 C;  3LZ1 A;  3W99 A;  3WKJ C;  5DNN A;  5B2J D;  3MNN A;  5GXQ B;  5BT1 C;  5CP6 D;  4QLC A;  3KWQ A;  3W98 C;  3A6N D;  4X23 A;  1M19 D;  3B6G A;  4AWL C;  4EO5 C;  5B40 A;  5DNM A;  3VH5 W;  3AZI A;  4G92 B;  1ID3 C;  1TZY B;  4KGC D;  4YM6 D;  3MVD A;  3AZH C;  5B33 C;  1KX5 C;  4JJN C;  3LZ0 C;  3TU4 B;  1KX3 D;  1BFM A;  2FJ7 B;  1H3O A;  3AV2 D;  3REL D;  4WNN A;  1B6W A;  1P3O A;  5CPI B;  5B0Z D;  3REI A;  3LJA B;  4J8X C;  3AZL A;  5CPK A;  3C1B C;  1KX4 D;  4WU9 D;  3WAA C;  3X1V A;  4YS3 D;  1TZY A;  3UTB D;  4CSR B;  3AZF C;  3AFA A;  5B32 A;  5B2I C;  5AVB C;  2HUE B;  5B1L C;  3REH A;  3UT9 D;  3B6F A;  5GT3 D;  5B1M D;  1P3A B;  3AZN D;  3WTP E;  5AV5 B;  3AV2 B;  3UTA D;  1P3I A;  3X1U B;  5BNX A;  5CPJ D;  1S32 A;  2IO5 C;  1P3M D;  3MGR B;  2NQB D;  4ZUX A;  1P3L C;  2HIO B;  2PYO C;  2CWE A;  2BYK B;  2F8N B;  2RVQ C;  4XUJ A;  3W98 B;  4CSR A;  3KXB B;  3AZM D;  5B24 B;  5KDM A;  5AV6 B;  3O62 D;  4J8V D;  4Z66 D;  5B33 B;  3X1U A;  5AV9 C;  4JJN B;  3LZ0 B;  5B0Y D;  3MGR A;  1P3G B;  3AV1 B;  5GSU B;  1P3P C;  4XZQ C;  5F99 D;  2BYK A;  1P3B D;  5B31 C;  3WKJ A;  4KUD D;  3AZJ C;  4LD9 C;  5G49 A;  3MGQ C;  3W98 A;  1M1A D;  5AV8 C;  3KUY C;  4UUZ A;  1ID3 A;  1F66 B;  3AZH A;  3VH5 A;  5DNN D;  5B33 A;  3MNN D;  3REJ C;  4JJN A;  1KX5 A;  4QLC D;  1ZLA B;  3LZ0 A;  4J8W C;  4X23 D;  3B6G D;  3REK D;  3AYW B;  3NQJ A;  5B40 D;  5DNM D;  1EQZ B;  5GXQ C;  3AZG D;  3MVD D;  2IO5 B;  3KSY A;  4J8X A;  1M18 C;  3C1B A;  1P3O D;  4R8P B;  3TU4 C;  3WAA A;  2F8N K;  4E45 A;  3MGS B;  2FJ7 C;  3AZF A;  3W97 D;  5B2I A;  5AVB A;  5B1L A;  3REI D;  3AZL D;  5AVC B;  5CPK D;  1TAF B;  3X1V D;  3B0C W;  5CPI C;  1TZY D;  2F8N H;  4E44 A;  4J8U B;  3AN2 A;  3AFA D;  3VH6 W;  5B32 D;  1HQ3 B;  1P3L A;  3B0D B;  3REH D;  4WU8 B;  2PYO A;  3B6F D;  1P3I D;  3AZJ B;  2HUE C;  1S32 D;  1P3F C;  1N1J B;  1P34 B;  3W96 B;  1P3A C;  3KUY B;  4ZUX D;  5AV5 C;  3AV2 C;  3NQU A;  3AZE B;  5GT0 C;  5AY8 B;  3C1C B;  1TAF A;  3REJ B;  4XUJ D;  2HIO C;  1WWI A;  2YFV A;  5AV9 A;  4H9O B;  4J8W B;  2ARO C;  1ULY A;  1P3P A;  4XZQ A;  3R45 B;  4H9P B;  5B24 C;  3KXB C;  5B31 A;  3X1U D;  3AZJ A;  3MGP B;  4LD9 A;  2CV5 B;  5AV6 C;  3MGQ A;  5CHL B;  5AV8 A;  3KUY A;  2JSS A;  1M18 B;  3A6N C;  1M19 C;  1A7W A;  3WKJ D;  1P3G C;  3AV1 C;  3X1T B;  5GSU C;  1U35 B;  5E5A C;  4KHA B;  3X1S D;  5GXQ A;  1ID3 D;  4H9Q B;  3REL C;  4H9P A;  3AZH D;  5B33 D;  1KX5 D;  4JJN D;  3LZ0 D;  1F66 C;  1AOI B;  3WTP B;  1M18 A;  1ZLA C;  3TU4 A;  2FJ7 A;  1P3F B;  3B0B A;  2YFW B;  5BNV B;  4YS3 C;  3AYW C;  1EQZ C;  5BO0 B;  4J8X D;  1WWS A;  5GT0 B;  1R4V A;  4KHA A;  3C1B D;  4Z5T B;  5JRG B;  3WAA D;  5CPI A;  3LJA A;  3UTA C;  3AZF D;  1F1E A;  1P3K B;  3AZK B;  2ARO B;  4R8P C;  5B2I D;  5AVB D;  5B1L D;  2NQB C;  3MGS C;  3VH6 A;  1HTA A;  1P3F A;  3AN2 D;  5AVC C;  2BYM B;  5BNV A;  4DRB A;  5B2J B;  1P3A A;  5CP6 B;  5AV5 A;  3AV2 A;  1P3L D;  2PYO D;  3A6N B;  1M19 B;  4J8U C;  1JFI B;  3WA9 C;  1HQ3 C;  2RVQ D;  3B0D C;  2HIO A;  5BS7 A;  4J8V C;  4KGC B;  4WU8 C;  4YM6 B;  4HGA C;  2ARO A;  5E5A B;  1KX3 B;  2F8N A;  4Z2M G;  1P34 C;  3W96 C;  3REL B;  3KXB A;  5B24 A;  4G91 C;  5AV9 D;  3B0C T;  3W99 D;  3LZ1 D;  3AZE C;  5AV6 A;  5JA4 B;  2BYM A;  5AY8 C;  3C1C C;  3LEL C;  5B0Z B;  3KWQ D;  4XZQ D;  3A6N A;  1P3P D;  1JFI A;  5B31 D;  1P3G A;  3AZJ D;  4YS3 B;  4LD9 D;  3AV1 A;  3AZI D;  5GSU A;  3MGQ D;  3UTB B;  5AV8 D;  2L5A A;  5E5A A;  5B32 G;  3MGP C;  3REK C;  3UT9 B;  2CV5 C;  5GT3 B;  5B1M B;  3REL A;  3AZN B;  3UTA B;  3AZG C;  5CPJ B;  1P3M B;  1F66 A;  2NQB B;  5GXQ D;  3X1T C;  4CAY B;  1U35 C;  1ZLA A;  2NZD C;  3AYW A;  4YS3 A;  1EQZ A;  4WZS B;  3AZM B;  3VH5 T;  3W97 C;  5FUG B;  3WA9 B;  3V9R B;  3TU4 D;  4H9N B;  3O62 B;  4J8V B;  2FJ7 D;  4HGA B;  3UTA A;  1AOI C;  3WTP C;  1BH9 B;  4R8P A;  5B0Y B;  3MGS A;  5F99 B;  5CPI D;  3B6F C;  4G91 B;  1P3B B;  3LJA D;  4KUD B;  5AVC A;  4Z5T C;  5JRG C;  3LEL B;  1M1A B;  4H9S C;  4J8U A;  3WA9 A;  3V9R A;  1P3K C;  3AZK C;  1HQ3 A;  1P3F D;  4WU8 A;  3MNN B;  4XUJ C;  1P3A D;  5AV5 D;  1BH9 A; 
#chains in the Genus database with same CATH topology
 4X23 B;  4NFT A;  4WV4 B;  1N1J A;  2Y2O A;  1BH8 B;  3REK B;  3W96 A;  2J8P A;  5B2J C;  5B40 B;  3MGR D;  1P34 A;  5CP6 C;  2HIO D;  3AZG B;  3MVD B;  2FFF B;  4ZBJ B;  3AZE A;  2ARO D;  5AY8 A;  3A1I A;  2F8N D;  3C1C A;  3LEL A;  3REJ A;  1H3O B;  5BT1 D;  4KGC C;  4H9O A;  4YM6 C;  3W98 D;  3KXB D;  4WNN B;  5B24 D;  4J8W A;  1P3O B;  1KX3 C;  2NZD B;  5AV6 D;  3R45 A;  3W97 B;  3REI B;  3MGP A;  3AZL B;  5CPK B;  3REK A;  2CV5 A;  1BH8 A;  3X1S C;  1P3G D;  3X1V B;  3AV1 D;  3AZG A;  5GSU D;  5B0Z C;  2Y2Q A;  3AFA B;  1KX4 C;  5E5A D;  5B32 B;  4WU9 C;  3REH B;  3X1T A;  3UTB C;  3B6F B;  1U35 A;  3FDD A;  1P3I B;  2NZD A;  5BNX B;  1S32 B;  3UT9 C;  1F66 D;  4H9Q A;  5B1M C;  5GT3 C;  4ZUX B;  3W97 A;  3AZN C;  4H9R B;  5C3I C;  1ZLA D;  5CPJ C;  1P3M C;  3AYW D;  4XUJ B;  4NE5 A;  1AOI A;  4NE6 A;  3WTP A;  1EQZ D;  2ZY3 A;  2YFW A;  5KDM B;  1KU5 A;  3AZM C;  5BO0 A;  1B67 A;  5GT0 A;  5B31 G;  2RIQ A;  4R8P D;  3AN2 C;  4Z5T A;  5JRG A;  3O62 C;  4H9S A;  3MGS D;  4Z66 C;  2Y2J A;  4H9R A;  1P3K A;  3AZK A;  5B0Y C;  3WKJ B;  5AVC D;  2G5I C;  2LY8 A;  2ZY5 A;  5G49 B;  5F99 C;  4Z2M H;  4J8U D;  3EG5 B;  1P3B C;  3WA9 D;  4UUZ B;  4AWL B;  4EO5 B;  4KUD C;  3X1S B;  5B2J A;  1HQ3 D;  1ID3 B;  5CP6 A;  3VH6 T;  1M1A C;  4WU8 D;  3AZH B;  1M19 A;  1KX5 B;  3LZ1 C;  3W99 C;  1KX4 B;  4WU9 B;  1P34 D;  4KGC A;  4YM6 A;  3NQJ B;  3W96 D;  5DNN C;  3MNN C;  3KUY D;  3KWQ C;  4NE3 A;  4QLC C;  1KX3 A;  4X23 C;  3AZE D;  3B6G C;  5AY8 D;  5DNM C;  2ZM5 A;  3C1C D;  5B40 C;  3AZI C;  3LEL D;  3REJ D;  5C3I B;  4J8X B;  3MVD C;  4ZBJ C;  4J8W D;  5JA4 A;  3C1B B;  3X1S A;  3WAA B;  5B0Z A;  3AZF B;  1KX4 A;  1P3O C;  5B2I B;  5AVB B;  4WU9 A;  2F2A C;  5B1L B;  3MGP D;  2CV5 D;  3UTB A;  4UPK A;  1M18 D;  3REI C;  3AZL C;  3AN2 B;  5CPK C;  3UT9 A;  5GT3 A;  5B1M A;  3AZN A;  1P3L B;  4G92 C;  3X1V C;  4Z66 B;  1TZY C;  3X1T D;  2PYO B;  1U35 D;  5CPJ A;  1P3M A;  3AFA C;  2NQB A;  5B32 C;  2NZD D;  3REH C;  4CAY A;  3NQU B;  1P3I C;  2F8N G;  4DRA A;  1S32 C;  3AZM A;  4ZUX C;  5FUG A;  1AOI D;  2YFV B;  3WTP D;  5AV9 B;  3LZ1 B;  3W99 B;  3LJA C;  4H9N A;  3O62 A;  4J8V A;  4Z66 A;  5DNN B;  1Q9C A;  1P3P B;  3KWQ B;  4XZQ B;  4QLC B;  5B0Y A;  2Y2G A;  5B31 B;  3B6G B;  5GT0 D;  4LD9 B;  5DNM B;  3AZI B;  4Z5T D;  5JRG D;  3MGQ B;  5F99 A;  5AV8 B;  4M6B A;  1P3B A;  4KUD A;  1P3K D;  3X1U C;  3AZK D;  3EPL A;  3MGR C;  1M1A A;  5BS7 C;  3EPJ A;  3EPK A;  3LZ1 A;  3W99 A;  3WKJ C;  2VQR A;  5DNN A;  5B2J D;  3MNN A;  5GXQ B;  5BT1 C;  5CP6 D;  4QLC A;  3KWQ A;  3W98 C;  3A6N D;  4X23 A;  1M19 D;  3B6G A;  4AWL C;  4EO5 C;  5B40 A;  5DNM A;  3VH5 W;  3AZI A;  4G92 B;  1ID3 C;  1TZY B;  2Y2N A;  4KGC D;  4YM6 D;  3MVD A;  3AZH C;  5B33 C;  1KX5 C;  4JJN C;  3LZ0 C;  3TU4 B;  1KX3 D;  1BFM A;  2FJ7 B;  1H3O A;  3AV2 D;  3REL D;  4WNN A;  1B6W A;  1P3O A;  5CPI B;  5B0Z D;  3REI A;  3LJA B;  4J8X C;  3AZL A;  5CPK A;  2Y2P A;  3C1B C;  1KX4 D;  4WU9 D;  3WAA C;  3X1V A;  4YS3 D;  1TZY A;  3UTB D;  4CSR B;  3AZF C;  3F6T A;  3AFA A;  5B32 A;  5B2I C;  5AVB C;  2HUE B;  5B1L C;  3REH A;  3UT9 D;  3B6F A;  5GT3 D;  5B1M D;  1P3A B;  3AZN D;  3WTP E;  3H0L C;  5AV5 B;  3AV2 B;  3UTA D;  1P3I A;  3X1U B;  5BNX A;  5CPJ D;  1S32 A;  2IO5 C;  1P3M D;  3MGR B;  2NQB D;  4ZUX A;  1P3L C;  3AL0 C;  2HIO B;  2JCH A;  2PYO C;  2CWE A;  2BYK B;  2F8N B;  2RVQ C;  4XUJ A;  3W98 B;  4CSR A;  3KXB B;  3AZM D;  2ZY2 A;  5B24 B;  5KDM A;  5AV6 B;  3KFU G;  3O62 D;  4J8V D;  4Z66 D;  5B33 B;  3X1U A;  5AV9 C;  4JJN B;  3A1K A;  3LZ0 B;  5B0Y D;  3MGR A;  1P3G B;  3AV1 B;  5GSU B;  1P3P C;  4XZQ C;  5F99 D;  2BYK A;  1P3B D;  5B31 C;  3WKJ A;  4KUD D;  3AZJ C;  4LD9 C;  5G49 A;  2W8S A;  3MGQ C;  3W98 A;  1M1A D;  5AV8 C;  3KUY C;  2G5H C;  4UUZ A;  1ID3 A;  1F66 B;  3AZH A;  3VH5 A;  5DNN D;  5B33 A;  3MNN D;  2Y2I A;  4JJN A;  3REJ C;  4QLC D;  1KX5 A;  1ZLA B;  3LZ0 A;  4J8W C;  4X23 D;  3B6G D;  2Y2K A;  3REK D;  3AYW B;  3NQJ A;  5B40 D;  5DNM D;  1EQZ B;  5GXQ C;  3AZG D;  3MVD D;  2IO5 B;  2XD1 A;  3KSY A;  4J8X A;  1M18 C;  3C1B A;  1P3O D;  4R8P B;  3TU4 C;  3WAA A;  2F8N K;  4E45 A;  3MGS B;  2FJ7 C;  3AZF A;  3W97 D;  5B2I A;  5AVB A;  5B1L A;  4DQY B;  3REI D;  3AZL D;  5AVC B;  5CPK D;  1TAF B;  3X1V D;  3B0C W;  5CPI C;  1TZY D;  2F8N H;  4E44 A;  4J8U B;  3AN2 A;  3AFA D;  3VH6 W;  5B32 D;  1HQ3 B;  1P3L A;  3B0D B;  3REH D;  4WU8 B;  2PYO A;  3B6F D;  1P3I D;  3AZJ B;  2HUE C;  1S32 D;  1P3F C;  1N1J B;  1P34 B;  3W96 B;  1P3A C;  3KUY B;  4ZUX D;  5AV5 C;  3AV2 C;  2DF4 C;  3NQU A;  3AZE B;  5GT0 C;  5AY8 B;  3C1C B;  1TAF A;  3REJ B;  4XUJ D;  2HIO C;  1WWI A;  2YFV A;  5AV9 A;  4H9O B;  4J8W B;  2ARO C;  1ULY A;  1P3P A;  4XZQ A;  3EPH A;  3R45 B;  4H9P B;  5B24 C;  3KXB C;  5B31 A;  3X1U D;  3AZJ A;  3MGP B;  4LD9 A;  2CV5 B;  5AV6 C;  3MGQ A;  3P5J B;  5CHL B;  5AV8 A;  3KUY A;  2JSS A;  1M18 B;  3A6N C;  1M19 C;  1A7W A;  3WKJ D;  1P3G C;  3AV1 C;  3X1T B;  5GSU C;  1U35 B;  5E5A C;  4KHA B;  3X1S D;  5GXQ A;  1ID3 D;  4H9Q B;  3REL C;  4H9P A;  3AZH D;  5B33 D;  1KX5 D;  4JJN D;  3LZ0 D;  1F66 C;  1AOI B;  3WTP B;  1M18 A;  1ZLA C;  3TU4 A;  2UWX A;  2FJ7 A;  1P3F B;  2BG1 A;  2XD5 A;  3B0B A;  2YFW B;  5BNV B;  2JE5 A;  4YS3 C;  3AYW C;  1EQZ C;  5BO0 B;  4J8X D;  1WWS A;  5GT0 B;  1R4V A;  4KHA A;  3C1B D;  4Z5T B;  5JRG B;  3WAA D;  5CPI A;  3LJA A;  2Y2M A;  2DQN C;  3UTA C;  1F1E A;  3AZF D;  3AZK B;  2ARO B;  1P3K B;  4R8P C;  5B2I D;  5AVB D;  5B1L D;  2NQB C;  3MGS C;  3VH6 A;  1HTA A;  2ZY4 A;  1P3F A;  3AN2 D;  5AVC C;  2BYM B;  5BNV A;  4DRB A;  5B2J B;  1P3A A;  5CP6 B;  5AV5 A;  3AV2 A;  1P3L D;  2PYO D;  3A6N B;  1M19 B;  4J8U C;  1JFI B;  3WA9 C;  2Y2H A;  1HQ3 C;  2RVQ D;  3B0D C;  2HIO A;  5BS7 A;  4J8V C;  4KGC B;  4WU8 C;  4YM6 B;  4HGA C;  2ARO A;  3H0R C;  5E5A B;  1KX3 B;  2F8N A;  4Z2M G;  1P34 C;  3W96 C;  3REL B;  3KXB A;  5B24 A;  4G91 C;  5AV9 D;  3B0C T;  3W99 D;  3LZ1 D;  3AZE C;  5AV6 A;  5JA4 B;  2BYM A;  5AY8 C;  3C1C C;  3LEL C;  5B0Z B;  3KWQ D;  4XZQ D;  3A6N A;  1P3P D;  1JFI A;  5B31 D;  2Y2L A;  1P3G A;  3AZJ D;  4YS3 B;  4LD9 D;  3AV1 A;  3AZI D;  5GSU A;  3MGQ D;  3UTB B;  5AV8 D;  2L5A A;  5E5A A;  5B32 G;  3MGP C;  3REK C;  3UT9 B;  2CV5 C;  5GT3 B;  5B1M B;  3REL A;  3AZN B;  3UTA B;  3AZG C;  5CPJ B;  1Z2C B;  1P3M B;  1F66 A;  2NQB B;  5GXQ D;  3X1T C;  4CAY B;  1U35 C;  1ZLA A;  1W2E A;  2NZD C;  3AYW A;  4YS3 A;  1EQZ A;  4WZS B;  3AZM B;  3VH5 T;  3W97 C;  5FUG B;  3WA9 B;  3V9R B;  3TU4 D;  4H9N B;  3O62 B;  4J8V B;  2FJ7 D;  4HGA B;  3UTA A;  1AOI C;  3WTP C;  1BH9 B;  4R8P A;  5B0Y B;  1T3U A;  3MGS A;  3H0M C;  5F99 B;  5CPI D;  3B6F C;  4G91 B;  1P3B B;  3LJA D;  4KUD B;  5AVC A;  3IP4 C;  4Z5T C;  5JRG C;  3LEL B;  1M1A B;  4H9S C;  4WJ3 C;  4J8U A;  3WA9 A;  3V9R A;  1P3K C;  1PZR A;  3AZK C;  1HQ3 A;  1P3F D;  4WU8 A;  3MNN B;  4XUJ C;  1P3A D;  5AV5 D;  1BH9 A; 
#chains in the Genus database with same CATH homology
 4X23 B;  4NFT A;  4WV4 B;  1N1J A;  2Y2O A;  1BH8 B;  3REK B;  3W96 A;  2J8P A;  5B2J C;  5B40 B;  3MGR D;  1P34 A;  5CP6 C;  2HIO D;  3AZG B;  3MVD B;  2FFF B;  4ZBJ B;  3AZE A;  2ARO D;  5AY8 A;  3A1I A;  2F8N D;  3C1C A;  3LEL A;  3REJ A;  1H3O B;  5BT1 D;  4KGC C;  4H9O A;  4YM6 C;  3W98 D;  3KXB D;  4WNN B;  5B24 D;  4J8W A;  1P3O B;  1KX3 C;  2NZD B;  5AV6 D;  3R45 A;  3W97 B;  3REI B;  3MGP A;  3AZL B;  5CPK B;  3REK A;  2CV5 A;  1BH8 A;  3X1S C;  1P3G D;  3X1V B;  3AV1 D;  3AZG A;  5GSU D;  5B0Z C;  2Y2Q A;  3AFA B;  1KX4 C;  5E5A D;  5B32 B;  4WU9 C;  3REH B;  3X1T A;  3UTB C;  3B6F B;  1U35 A;  3FDD A;  1P3I B;  2NZD A;  5BNX B;  1S32 B;  3UT9 C;  1F66 D;  4H9Q A;  5B1M C;  5GT3 C;  4ZUX B;  3W97 A;  3AZN C;  4H9R B;  5C3I C;  1ZLA D;  5CPJ C;  1P3M C;  3AYW D;  4XUJ B;  4NE5 A;  1AOI A;  4NE6 A;  3WTP A;  1EQZ D;  2ZY3 A;  2YFW A;  5KDM B;  1KU5 A;  3AZM C;  5BO0 A;  1B67 A;  5GT0 A;  5B31 G;  2RIQ A;  4R8P D;  3AN2 C;  4Z5T A;  5JRG A;  3O62 C;  4H9S A;  3MGS D;  4Z66 C;  2Y2J A;  4H9R A;  1P3K A;  3AZK A;  5B0Y C;  3WKJ B;  5AVC D;  2G5I C;  2LY8 A;  2ZY5 A;  5G49 B;  5F99 C;  4Z2M H;  4J8U D;  3EG5 B;  1P3B C;  3WA9 D;  4UUZ B;  4AWL B;  4EO5 B;  4KUD C;  3X1S B;  5B2J A;  1HQ3 D;  1ID3 B;  5CP6 A;  3VH6 T;  1M1A C;  4WU8 D;  3AZH B;  1M19 A;  1KX5 B;  3LZ1 C;  3W99 C;  1KX4 B;  4WU9 B;  1P34 D;  4KGC A;  4YM6 A;  3NQJ B;  3W96 D;  5DNN C;  3MNN C;  3KUY D;  3KWQ C;  4NE3 A;  4QLC C;  1KX3 A;  4X23 C;  3AZE D;  3B6G C;  5AY8 D;  5DNM C;  2ZM5 A;  3C1C D;  5B40 C;  3AZI C;  3LEL D;  3REJ D;  5C3I B;  4J8X B;  3MVD C;  4ZBJ C;  4J8W D;  5JA4 A;  3C1B B;  3X1S A;  3WAA B;  5B0Z A;  3AZF B;  1KX4 A;  1P3O C;  5B2I B;  5AVB B;  4WU9 A;  2F2A C;  5B1L B;  3MGP D;  2CV5 D;  3UTB A;  4UPK A;  1M18 D;  3REI C;  3AZL C;  3AN2 B;  5CPK C;  3UT9 A;  5GT3 A;  5B1M A;  3AZN A;  1P3L B;  4G92 C;  3X1V C;  4Z66 B;  1TZY C;  3X1T D;  2PYO B;  1U35 D;  5CPJ A;  1P3M A;  3AFA C;  2NQB A;  5B32 C;  2NZD D;  3REH C;  4CAY A;  3NQU B;  1P3I C;  2F8N G;  4DRA A;  1S32 C;  3AZM A;  4ZUX C;  5FUG A;  1AOI D;  2YFV B;  3WTP D;  5AV9 B;  3LZ1 B;  3W99 B;  3LJA C;  4H9N A;  3O62 A;  4J8V A;  4Z66 A;  5DNN B;  1Q9C A;  1P3P B;  3KWQ B;  4XZQ B;  4QLC B;  5B0Y A;  2Y2G A;  5B31 B;  3B6G B;  5GT0 D;  4LD9 B;  5DNM B;  3AZI B;  4Z5T D;  5JRG D;  3MGQ B;  5F99 A;  5AV8 B;  4M6B A;  1P3B A;  4KUD A;  1P3K D;  3X1U C;  3AZK D;  3EPL A;  3MGR C;  1M1A A;  5BS7 C;  3EPJ A;  3EPK A;  3LZ1 A;  3W99 A;  3WKJ C;  2VQR A;  5DNN A;  5B2J D;  3MNN A;  5GXQ B;  5BT1 C;  5CP6 D;  4QLC A;  3KWQ A;  3W98 C;  3A6N D;  4X23 A;  1M19 D;  3B6G A;  4AWL C;  4EO5 C;  5B40 A;  5DNM A;  3VH5 W;  3AZI A;  4G92 B;  1ID3 C;  1TZY B;  2Y2N A;  4KGC D;  4YM6 D;  3MVD A;  3AZH C;  5B33 C;  1KX5 C;  4JJN C;  3LZ0 C;  3TU4 B;  1KX3 D;  1BFM A;  2FJ7 B;  1H3O A;  3AV2 D;  3REL D;  4WNN A;  1B6W A;  1P3O A;  5CPI B;  5B0Z D;  3REI A;  3LJA B;  4J8X C;  3AZL A;  5CPK A;  2Y2P A;  3C1B C;  1KX4 D;  4WU9 D;  3WAA C;  3X1V A;  4YS3 D;  1TZY A;  3UTB D;  4CSR B;  3AZF C;  3F6T A;  3AFA A;  5B32 A;  5B2I C;  5AVB C;  2HUE B;  5B1L C;  3REH A;  3UT9 D;  3B6F A;  5GT3 D;  5B1M D;  1P3A B;  3AZN D;  3WTP E;  3H0L C;  5AV5 B;  3AV2 B;  3UTA D;  1P3I A;  3X1U B;  5BNX A;  5CPJ D;  1S32 A;  2IO5 C;  1P3M D;  3MGR B;  2NQB D;  4ZUX A;  1P3L C;  3AL0 C;  2HIO B;  2JCH A;  2PYO C;  2CWE A;  2BYK B;  2F8N B;  2RVQ C;  4XUJ A;  3W98 B;  4CSR A;  3KXB B;  3AZM D;  2ZY2 A;  5B24 B;  5KDM A;  5AV6 B;  3KFU G;  3O62 D;  4J8V D;  4Z66 D;  5B33 B;  3X1U A;  5AV9 C;  4JJN B;  3A1K A;  3LZ0 B;  5B0Y D;  3MGR A;  1P3G B;  3AV1 B;  5GSU B;  1P3P C;  4XZQ C;  5F99 D;  2BYK A;  1P3B D;  5B31 C;  3WKJ A;  4KUD D;  3AZJ C;  4LD9 C;  5G49 A;  2W8S A;  3MGQ C;  3W98 A;  1M1A D;  5AV8 C;  3KUY C;  2G5H C;  4UUZ A;  1ID3 A;  1F66 B;  3AZH A;  3VH5 A;  5DNN D;  5B33 A;  3MNN D;  2Y2I A;  4JJN A;  3REJ C;  4QLC D;  1KX5 A;  1ZLA B;  3LZ0 A;  4J8W C;  4X23 D;  3B6G D;  2Y2K A;  3REK D;  3AYW B;  3NQJ A;  5B40 D;  5DNM D;  1EQZ B;  5GXQ C;  3AZG D;  3MVD D;  2IO5 B;  2XD1 A;  3KSY A;  4J8X A;  1M18 C;  3C1B A;  1P3O D;  4R8P B;  3TU4 C;  3WAA A;  2F8N K;  4E45 A;  3MGS B;  2FJ7 C;  3AZF A;  3W97 D;  5B2I A;  5AVB A;  5B1L A;  4DQY B;  3REI D;  3AZL D;  5AVC B;  5CPK D;  1TAF B;  3X1V D;  3B0C W;  5CPI C;  1TZY D;  2F8N H;  4E44 A;  4J8U B;  3AN2 A;  3AFA D;  3VH6 W;  5B32 D;  1HQ3 B;  1P3L A;  3B0D B;  3REH D;  4WU8 B;  2PYO A;  3B6F D;  1P3I D;  3AZJ B;  2HUE C;  1S32 D;  1P3F C;  1N1J B;  1P34 B;  3W96 B;  1P3A C;  3KUY B;  4ZUX D;  5AV5 C;  3AV2 C;  2DF4 C;  3NQU A;  3AZE B;  5GT0 C;  5AY8 B;  3C1C B;  1TAF A;  3REJ B;  4XUJ D;  2HIO C;  1WWI A;  2YFV A;  5AV9 A;  4H9O B;  4J8W B;  2ARO C;  1ULY A;  1P3P A;  4XZQ A;  3EPH A;  3R45 B;  4H9P B;  5B24 C;  3KXB C;  5B31 A;  3X1U D;  3AZJ A;  3MGP B;  4LD9 A;  2CV5 B;  5AV6 C;  3MGQ A;  3P5J B;  5CHL B;  5AV8 A;  3KUY A;  2JSS A;  1M18 B;  3A6N C;  1M19 C;  1A7W A;  3WKJ D;  1P3G C;  3AV1 C;  3X1T B;  5GSU C;  1U35 B;  5E5A C;  4KHA B;  3X1S D;  5GXQ A;  1ID3 D;  4H9Q B;  3REL C;  4H9P A;  3AZH D;  5B33 D;  1KX5 D;  4JJN D;  3LZ0 D;  1F66 C;  1AOI B;  3WTP B;  1M18 A;  1ZLA C;  3TU4 A;  2UWX A;  2FJ7 A;  1P3F B;  2BG1 A;  2XD5 A;  3B0B A;  2YFW B;  5BNV B;  2JE5 A;  4YS3 C;  3AYW C;  1EQZ C;  5BO0 B;  4J8X D;  1WWS A;  5GT0 B;  1R4V A;  4KHA A;  3C1B D;  4Z5T B;  5JRG B;  3WAA D;  5CPI A;  3LJA A;  2Y2M A;  2DQN C;  3UTA C;  1F1E A;  3AZF D;  3AZK B;  2ARO B;  1P3K B;  4R8P C;  5B2I D;  5AVB D;  5B1L D;  2NQB C;  3MGS C;  3VH6 A;  1HTA A;  2ZY4 A;  1P3F A;  3AN2 D;  5AVC C;  2BYM B;  5BNV A;  4DRB A;  5B2J B;  1P3A A;  5CP6 B;  5AV5 A;  3AV2 A;  1P3L D;  2PYO D;  3A6N B;  1M19 B;  4J8U C;  1JFI B;  3WA9 C;  2Y2H A;  1HQ3 C;  2RVQ D;  3B0D C;  2HIO A;  5BS7 A;  4J8V C;  4KGC B;  4WU8 C;  4YM6 B;  4HGA C;  2ARO A;  3H0R C;  5E5A B;  1KX3 B;  2F8N A;  4Z2M G;  1P34 C;  3W96 C;  3REL B;  3KXB A;  5B24 A;  4G91 C;  5AV9 D;  3B0C T;  3W99 D;  3LZ1 D;  3AZE C;  5AV6 A;  5JA4 B;  2BYM A;  5AY8 C;  3C1C C;  3LEL C;  5B0Z B;  3KWQ D;  4XZQ D;  3A6N A;  1P3P D;  1JFI A;  5B31 D;  2Y2L A;  1P3G A;  3AZJ D;  4YS3 B;  4LD9 D;  3AV1 A;  3AZI D;  5GSU A;  3MGQ D;  3UTB B;  5AV8 D;  2L5A A;  5E5A A;  5B32 G;  3MGP C;  3REK C;  3UT9 B;  2CV5 C;  5GT3 B;  5B1M B;  3REL A;  3AZN B;  3UTA B;  3AZG C;  5CPJ B;  1Z2C B;  1P3M B;  1F66 A;  2NQB B;  5GXQ D;  3X1T C;  4CAY B;  1U35 C;  1ZLA A;  1W2E A;  2NZD C;  3AYW A;  4YS3 A;  1EQZ A;  4WZS B;  3AZM B;  3VH5 T;  3W97 C;  5FUG B;  3WA9 B;  3V9R B;  3TU4 D;  4H9N B;  3O62 B;  4J8V B;  2FJ7 D;  4HGA B;  3UTA A;  1AOI C;  3WTP C;  1BH9 B;  4R8P A;  5B0Y B;  1T3U A;  3MGS A;  3H0M C;  5F99 B;  5CPI D;  3B6F C;  4G91 B;  1P3B B;  3LJA D;  4KUD B;  5AVC A;  3IP4 C;  4Z5T C;  5JRG C;  3LEL B;  1M1A B;  4H9S C;  4WJ3 C;  4J8U A;  3WA9 A;  3V9R A;  1P3K C;  1PZR A;  3AZK C;  1HQ3 A;  1P3F D;  4WU8 A;  3MNN B;  4XUJ C;  1P3A D;  5AV5 D;  1BH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...