3X1VB

Crystal structure of nucleosome core particle in the presence of histone variant involved in reprogramming
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3x1vB00
1WWIA 5B0YA 5AY8B 5B24D 3LELD 3REIB 3X1TC 4R8PD 3O62A 3WKJB 3UTBB 1KU5A 3AFAB 4J8XC 3TU4C 3X1TD 1ID3A 5AVCB 2CWEA 3X1SC 5GSUC 3AZEB 3R45A 3UT9A 3WTPB 3KUYB 1JFIB 4J8XD 3TU4D 3X1SD 5GSUD 3LZ1A 1KX3A 5CPKB 4J8UB 5AV8C 5B40B 5BNXA 4H9PB 4G92B 5B1MC 1N1JA 2YFVA 5G49B 3W96A 5AV8D 2IO5B 5E5AC 3AV1B 3WAAC 3MGQC 5B1MD 5B2JB 4WU9C 3AZIC 4E44A 5E5AD 5FUGA 5B0YB 3VH6T 3RELB 4XUJA 1P3OC 1F66C 4WU9D 1P34C 3AN2C 1P3AC 3AZID 3B6GA 5GT3A 5F99A 3AZJA 1P3OD 1F66D 5DNNA 1P34D 3AN2D 3LZ0A 4JJNA 2BYKA 4J8WA 3AYWC 1M18A 3UT9B 4KGCA 3B0CT 5DNMA 4H9SA 5GXQA 1KX3B 3AYWD 3LJAA 4DRBA 5JRGC 3AZKB 5B1LD 5BNXB 5AVBA 5CPJC 2CV5D 5B32C 3X1VC 1Q9CA 3W96B 5JRGD 3MNNB 3KWQA 5CPJD 5AV6C 3MGSD 5B31B 2NQBC 4CSRA 5B32D 5KDMA 3X1VD 3AZNC 5FUGB 4HGAB 3AZMD 4XUJB 2AROA 4QLCC 5AV9C 4XZQC 4YS3A 3B6FC 5C3IB 3AZND 3WTPE 4Z66A 3B6GB 5F99B 4X23A 2F8NB 4QLCD 3AZJB 5AV9D 4XZQD 3B6FD 5DNNB 3LZ0B 3X1UC 4JJNB 1M18B 2RVQD 3MGPC 1S32B 3X1UD 3MVDA 4YM6A 5JA4A 5AV5C 1ZLAA 3AZFA 1P3FA 3KXBC 2HIOA 4NFTA 3W99A 4WU8C 4LD9D 3C1BB 5AV5D 3AZLB 1KX5B 1A7WA 5GT0A 5B2IC 5AY8A 3KXBD 3AZGD 4WU8D 5BS7A 1P3BC 5B33A 3WA9A 4CSRB 5B2ID 5KDMB 4KUDB 3AV2A 3AFAA 3A6NB 2AROB 1P3BD 3UTAA 4YS3B 1P3LC 3VH6A 4J8VA 4Z66B 1KX4B 4X23B 1TAFA 2NZDC 4Z5TC 1P3MC 4NE6A 1P3LD 3VH5A 3LELA 2L5AA 2NZDD 4Z5TD 5B40A 4R8PA 1P3GD 1P3MD 2F8NK 1P3ID 4YM6B 1AOIB 3W98C 3X1TA 3AV1A 3AZFB 4G91C 5B24C 5B2JA 4J8XA 3TU4A 3W98D 5GT0B 3RELA 5GSUA 4M6BA 5B33B 3WA9B 3REKB 4WV4B 3AV2B 2HUEC 3UTAB 3REHC 3W97C 4J8VB 1P3PB 4ZBJB 5CPIC 4AWLC 3MGRC 1TAFB 3WTPD 3REHD 3W97D 4EO5B 3MGQA 3WAAA 5CPID 3LELB 5CPKD 3MGRD 4WU9A 3AZKA 4R8PB 3AZIA 4ZUXC 1B6WA 1P3OA 1F66A 3MNNA 2F8NH 3X1TB 3AN2A 1P3AA 4ZUXD 5B31A 4J8XB 3TU4B 3B0BA 4UUZA 3O62C 3X1SB 5GSUB 3AYWA 4H9RB 1ID3C 3O62D 3AZHC 2F8NA 3VH5T 5JRGA 1ID3D 5AV8B 3AZHD 5CPJA 3LZ1C 5B1MB 3UT9D 3B0DC 5B32A 1S32A 5B1LC 2CV5C 5E5AB 4NE5A 3MGQB 3WAAB 5AV6A 3LZ1D 1KX3D 2NQBA 4WU9B 3AZNA 3C1BA 3KSYA 3MGSC 3AZIB 3AZLA 1M1AC 1KX5A 1P3OB 1F66B 3B6FA 1P34B 3AN2B 3AZMC 1P3AB 1M1AD 4KUDA 3A6NA 4UUZB 1EQZC 5GT3C 3AYWB 1KX4A 1EQZD 4Z2MH 3MGPA 3REJC 1P3KC 5GT3D 5F99D 4H9OA 2RVQC 2FJ7C 4J8WC 4KGCC 3KXBA 5JRGB 5DNND 3REJD 5GXQC 5B31G 4WU8A 3LZ0D 1P3KD 2FJ7D 5CPJB 4J8WD 4KGCD 5B32B 5B2IA 3LJAC 3X1VB 4LD9C 5DNMD 1AOIA 5GXQD 5AV6B 5AVBC 2NQBB 3AZGC 1M19C 3LJAD 3AZNB 2F8NG 3NQJA 3KWQC 4QLCB 5AVBD 5AV9B 4XZQB 1M19D 3B6FB 1HQ3C 3REKA 3KWQD 4H9NB 4Z5TA 1P3MA 1H3OA 3V9RB 3C1CC 3X1UB 1HQ3D 1P3PA 1TZYC 3MGPB 3C1CD 1P3GC 4H9OB 5AV5B 5CP6C 1P3IC 5B24A 1TZYD 3KXBB 3AZGB 4WU8B 3MVDC 5CP6D 1R4VA 1ZLAC 5B0ZC 5B2IB 1U35C 1P3FC 2PYOC 2HIOC 3W99C 3MVDD 1P3BB 1ZLAD 5B0ZD 1U35D 5AY8C 1P3FD 2PYOD 3REIC 2HIOD 3NQJB 3W99D 4WNNA 3W97A 5BS7C 3X1SA 3REHA 1P3LB 3WKJC 5AY8D 4KHAB 2JSSA 3REID 3UTBC 3AFAC 4H9RA 3MGRA 2NZDB 5AVCC 4Z5TB 5B33D 1H3OB 1P3MB 3WKJD 1P3IB 4WZSB 4H9QB 3AV2D 3AZEC 3UTBD 3WTPC 3KUYC 3AFAD 5AV8A 5AVCD 5B1MA 5CPKC 3AZED 3KUYD 4J8UC 3W98B 4DRAA 5E5AA 4G91B 5B40C 5B24B 4G92C 4J8UD 2IO5C 5B40D 3AV1C 5B2JC 1P34A 3AV1D 5B0YC 3RELC 3AZHA 2HUEB 4CAYA 5B2JD 4WNNB 3REHB 3W97B 1HTAA 5B0YD 3RELD 5CPIB 4AWLB 1F1EA 5BT1C 3MGRB 5B1LA 2CV5A 1BH9A 3UT9C 1ULYA 5BT1D 3MGSA 4ZUXB 1M1AA 1KX3C 3X1VA 3AZKC 3AZMA 3MGQD 3WAAD 3W96C 5BNVA 3MNNC 3AZKD 1EQZA 1BH8A 3O62B 4QLCA 5AV9A 4XZQA 5B31C 3W96D 3MNND 3NQUA 1ID3B 3REJA 4HGAC 3AZHB 1P3AD 4H9NA 4XUJC 1P3KA 4CAYB 5B31D 1B67A 2FJ7A 3V9RA 3R45B 5C3IC 3X1UA 3B6GC 5F99C 4XUJD 3AZJC 3LZ1B 5DNNC 3B0DB 5B1LB 3LZ0C 4LD9A 3B6GD 4JJNC 5AV5A 2CV5B 2F8ND 1BH9B 3AZJD 1M18C 2BYMA 3AZGA 5DNMC 1M19A 1N1JB 4H9SC 2YFVB 1S32C 4JJND 4NE3A 3MGSB 1M1AB 1M18D 4E45A 1S32D 3AZMB 5BO0A 3C1BC 1P3BA 1HQ3A 3AZLC 1KX5C 5AV6D 2NQBD 5BNVB 1EQZB 1WWSA 1BH8B 3C1BD 3C1CA 5GT3B 3AZLD 1P3LA 1KX5D 4KUDC 4KHAA 1TZYA 3NQUB 3A6NC 3REJB 2NZDA 2AROC 1P3KB 1P3GA 5B32G 4YS3C 3VH6W 5CP6A 2BYKB 4J8WB 4H9QA 1P3IA 2FJ7B 4KGCB 4KUDD 4Z66C 5DNMB 1KX4C 3A6ND 4X23C 5GXQB 2AROD 4YS3D 2YFWA 3VH5W 5B0ZA 3LJAB 1U35A 4Z66D 1KX4D 4LD9B 2PYOA 4X23D 3MGPD 3W98A 2BYMB 5AVBB 1M19B 3B0CW 3REIA 4YM6C 1AOIC 3KWQB 3AZFC 3WKJA 5BO0B 5CHLB 3UTBA 4YM6D 1HQ3B 1AOID 5AVCA 5GT0C 3AZFD 3AZEA 3C1CB 3WTPA 3KUYA 1JFIA 5B33C 3WA9C 3REKC 5GT0D 3AV2C 5CPIA 1TZYB 1BFMA 5CPKA 4J8UA 3UTAC 1P3GB 3REKD 3WA9D 5CP6B 4J8VC 1P3PC 4ZBJC 4Z2MG 4H9PA 5G49A 3MVDB 2LY8A 3UTAD 2YFWB 5JA4B 1ZLAB 4ZUXA 4J8VD 5B0ZB 4EO5C 1U35B 1P3PD 1P3FB 3LELC 2PYOB 2HIOB 3W99B 4R8PC
chains in the Genus database with same CATH superfamily
1WWIA 5B0YA 5AY8B 5B24D 3LELD 3REIB 3X1TC 4R8PD 3O62A 3WKJB 3UTBB 1KU5A 3AFAB 4J8XC 3TU4C 3X1TD 1ID3A 5AVCB 2CWEA 3X1SC 5GSUC 3AZEB 3R45A 3UT9A 3WTPB 3KUYB 1JFIB 4J8XD 3TU4D 3X1SD 2J8PA 5GSUD 3LZ1A 1KX3A 5CPKB 4J8UB 5AV8C 5B40B 5BNXA 4H9PB 4G92B 5B1MC 1N1JA 2YFVA 5G49B 3W96A 5AV8D 2IO5B 2ZY2A 5E5AC 3WAAC 3MGQC 3AV1B 1T3UA 2FFFB 5B1MD 5B2JB 4WU9C 3AZIC 4E44A 5E5AD 5FUGA 5B0YB 3VH6T 3RELB 4XUJA 3KFUG 1P3OC 1F66C 4WU9D 1P34C 3AN2C 2Y2QA 1P3AC 3AZID 3B6GA 5GT3A 5F99A 3AZJA 1P3OD 3EPJA 1F66D 5DNNA 1P34D 3AN2D 3LZ0A 4JJNA 2BYKA 4J8WA 3AYWC 1M18A 3UT9B 4KGCA 3B0CT 1W2EA 5DNMA 4H9SA 5GXQA 1KX3B 3AYWD 3LJAA 4DRBA 2Y2IA 5JRGC 3AZKB 5B1LD 5BNXB 5AVBA 5CPJC 2CV5D 5B32C 3X1VC 1Q9CA 3W96B 5JRGD 3MNNB 3KWQA 2UWXA 5CPJD 5AV6C 2XD1A 3MGSD 5B31B 2NQBC 4CSRA 5B32D 5KDMA 3X1VD 2Y2HA 3AZNC 2Y2MA 5FUGB 4HGAB 3AZMD 4XUJB 2AROA 4QLCC 5AV9C 4XZQC 4YS3A 3B6FC 5C3IB 3AZND 3WTPE 4Z66A 3B6GB 5F99B 4X23A 2F8NB 4QLCD 3AZJB 5AV9D 4XZQD 3B6FD 5DNNB 3LZ0B 3X1UC 4JJNB 1M18B 2RVQD 3MGPC 1S32B 3X1UD 3MVDA 4YM6A 5JA4A 5AV5C 1ZLAA 3AZFA 1P3FA 3KXBC 2HIOA 4NFTA 3W99A 4WU8C 4LD9D 3C1BB 4WJ3C 2DQNC 5AV5D 3AZLB 1KX5B 1A7WA 5GT0A 5B2IC 5AY8A 3KXBD 3AZGD 4WU8D 5BS7A 1P3BC 5B33A 3WA9A 4CSRB 5B2ID 5KDMB 4KUDB 3AV2A 3AFAA 3A6NB 2AROB 3P5JB 3UTAA 4YS3B 1P3BD 1P3LC 3VH6A 4J8VA 4Z66B 1KX4B 4X23B 1TAFA 2NZDC 4Z5TC 1P3MC 4NE6A 1P3LD 3VH5A 3LELA 2L5AA 2NZDD 4Z5TD 5B40A 4R8PA 1P3GD 1P3MD 2F8NK 1P3ID 4YM6B 1AOIB 3W98C 3X1TA 3AV1A 3AZFB 4G91C 5B24C 5B2JA 3AL0C 4J8XA 3TU4A 3W98D 5GT0B 3RELA 5GSUA 4M6BA 5B33B 3WA9B 3REKB 4WV4B 2Y2PA 3AV2B 3H0LC 2HUEC 3UTAB 3REHC 3W97C 4J8VB 1P3PB 4ZBJB 5CPIC 4AWLC 3MGRC 1TAFB 3WTPD 3REHD 3W97D 2ZY5A 4EO5B 3MGQA 3WAAA 5CPID 3LELB 5CPKD 3MGRD 4WU9A 3AZKA 4R8PB 3AZIA 4ZUXC 1B6WA 1P3OA 1F66A 3MNNA 2F8NH 3X1TB 3AN2A 1P3AA 4ZUXD 5B31A 4J8XB 3TU4B 3F6TA 3B0BA 4UUZA 3O62C 3X1SB 5GSUB 3AYWA 4H9RB 1ID3C 3O62D 3AZHC 2F8NA 3VH5T 2ZY4A 5JRGA 1ID3D 5AV8B 3AZHD 5CPJA 3LZ1C 5B1MB 3UT9D 3B0DC 5B32A 1S32A 5B1LC 2CV5C 5E5AB 4NE5A 3MGQB 3WAAB 3A1IA 5AV6A 2G5HC 3LZ1D 1KX3D 2NQBA 4WU9B 3AZNA 3C1BA 3KSYA 2G5IC 3MGSC 3AZIB 3AZLA 1M1AC 1KX5A 3EPHA 1P3OB 1F66B 3B6FA 1P34B 3AN2B 3AZMC 1P3AB 1M1AD 4KUDA 3A6NA 4UUZB 1EQZC 5GT3C 3AYWB 1KX4A 1EQZD 4Z2MH 3MGPA 3REJC 1P3KC 5GT3D 5F99D 4H9OA 2RVQC 2FJ7C 4J8WC 4KGCC 3KXBA 5JRGB 5DNND 3REJD 5GXQC 5B31G 4WU8A 3LZ0D 1P3KD 2FJ7D 5CPJB 2Y2GA 4J8WD 4KGCD 5B32B 5B2IA 3LJAC 3X1VB 4LD9C 5DNMD 2Y2OA 1AOIA 5GXQD 5AV6B 5AVBC 2NQBB 3AZGC 1M19C 3LJAD 3AZNB 2F8NG 3NQJA 3KWQC 4QLCB 5AVBD 5AV9B 4XZQB 1M19D 3B6FB 1HQ3C 3REKA 3KWQD 4H9NB 4Z5TA 1P3MA 1H3OA 3V9RB 3C1CC 3X1UB 1HQ3D 1P3PA 2W8SA 1TZYC 3MGPB 3C1CD 1P3GC 4H9OB 5AV5B 5CP6C 1P3IC 3IP4C 5B24A 1TZYD 3KXBB 3AZGB 4WU8B 3MVDC 5CP6D 1R4VA 1ZLAC 3EPKA 5B0ZC 5B2IB 1U35C 1P3FC 2PYOC 2HIOC 3W99C 3MVDD 1P3BB 1ZLAD 5B0ZD 1U35D 5AY8C 1P3FD 2PYOD 3REIC 2HIOD 3NQJB 3W99D 4WNNA 3W97A 5BS7C 3X1SA 3REHA 1P3LB 3WKJC 5AY8D 4KHAB 2XD5A 2JSSA 3REID 3H0RC 3UTBC 2JE5A 3AFAC 2F2AC 4H9RA 3MGRA 2NZDB 5AVCC 4Z5TB 5B33D 1H3OB 1P3MB 3WKJD 2ZY3A 4WZSB 4H9QB 1P3IB 3AV2D 3AZEC 3UTBD 3WTPC 3KUYC 3AFAD 5AV8A 5AVCD 5B1MA 5CPKC 3AZED 3KUYD 4J8UC 3W98B 4DRAA 2Y2JA 5E5AA 4G91B 5B40C 5B24B 4G92C 4J8UD 2IO5C 5B40D 3AV1C 1Z2CB 5B2JC 1P34A 3AV1D 5B0YC 3RELC 3AZHA 2HUEB 4CAYA 5B2JD 2DF4C 4WNNB 3REHB 3W97B 1HTAA 5B0YD 3RELD 5CPIB 4AWLB 3EPLA 1F1EA 5BT1C 3MGRB 2Y2LA 5B1LA 2CV5A 2RIQA 1BH9A 3UT9C 1ULYA 5BT1D 2Y2NA 2BG1A 3MGSA 4ZUXB 1M1AA 1KX3C 3X1VA 4UPKA 3AZKC 3AZMA 3MGQD 3WAAD 3W96C 5BNVA 3MNNC 3AZKD 1EQZA 1BH8A 3O62B 4QLCA 5AV9A 4XZQA 5B31C 3W96D 3MNND 3NQUA 1ID3B 3REJA 4HGAC 3AZHB 1P3AD 4H9NA 4XUJC 1P3KA 4CAYB 5B31D 1B67A 2FJ7A 1PZRA 3V9RA 3R45B 3EG5B 5C3IC 3X1UA 3B6GC 5F99C 4XUJD 3AZJC 4DQYB 3LZ1B 5DNNC 3B0DB 5B1LB 3LZ0C 4LD9A 3B6GD 4JJNC 5AV5A 2CV5B 2F8ND 1BH9B 3AZJD 1M18C 2BYMA 3AZGA 5DNMC 1M19A 1N1JB 4H9SC 2YFVB 1S32C 4JJND 4NE3A 3MGSB 2ZM5A 1M1AB 1M18D 4E45A 1S32D 3AZMB 5BO0A 3C1BC 1P3BA 1HQ3A 3AZLC 1KX5C 5AV6D 2NQBD 5BNVB 1EQZB 1WWSA 1BH8B 3C1BD 3C1CA 5GT3B 3AZLD 1P3LA 1KX5D 3FDDA 4KUDC 4KHAA 1TZYA 3NQUB 3A6NC 3REJB 2NZDA 2AROC 1P3KB 1P3GA 5B32G 4YS3C 3VH6W 5CP6A 2BYKB 4J8WB 4H9QA 1P3IA 2FJ7B 4KGCB 4KUDD 2Y2KA 4Z66C 5DNMB 1KX4C 3A6ND 4X23C 5GXQB 2AROD 4YS3D 2YFWA 3VH5W 5B0ZA 3LJAB 1U35A 4Z66D 1KX4D 4LD9B 2PYOA 4X23D 3MGPD 3W98A 2BYMB 5AVBB 1M19B 3B0CW 3REIA 4YM6C 1AOIC 3KWQB 3AZFC 3WKJA 3A1KA 5BO0B 5CHLB 3UTBA 3H0MC 1HQ3B 4YM6D 1AOID 5AVCA 5GT0C 3AZFD 3AZEA 3C1CB 3WTPA 3KUYA 1JFIA 5B33C 3WA9C 3REKC 5GT0D 3AV2C 5CPIA 2JCHA 1TZYB 1BFMA 5CPKA 4J8UA 3UTAC 1P3GB 3REKD 3WA9D 5CP6B 4J8VC 1P3PC 4ZBJC 4Z2MG 4H9PA 5G49A 3MVDB 2LY8A 3UTAD 2YFWB 5JA4B 1ZLAB 4ZUXA 4J8VD 5B0ZB 2VQRA 4EO5C 1U35B 1P3PD 1P3FB 3LELC 2PYOB 2HIOB 3W99B 4R8PC
chains in the Genus database with same CATH topology
1WWIA 5B0YA 5AY8B 5B24D 3LELD 3REIB 3X1TC 4R8PD 3O62A 3WKJB 3UTBB 1KU5A 3AFAB 4J8XC 3TU4C 3X1TD 1ID3A 5AVCB 2CWEA 3X1SC 5GSUC 3AZEB 3R45A 3UT9A 3WTPB 3KUYB 1JFIB 4J8XD 3TU4D 3X1SD 2J8PA 5GSUD 3LZ1A 1KX3A 5CPKB 4J8UB 5AV8C 5B40B 5BNXA 4H9PB 4G92B 5B1MC 1N1JA 2YFVA 5G49B 3W96A 5AV8D 2IO5B 2ZY2A 5E5AC 3WAAC 3MGQC 3AV1B 1T3UA 2FFFB 5B1MD 5B2JB 4WU9C 3AZIC 4E44A 5E5AD 5FUGA 5B0YB 3VH6T 3RELB 4XUJA 3KFUG 1P3OC 1F66C 4WU9D 1P34C 3AN2C 2Y2QA 1P3AC 3AZID 3B6GA 5GT3A 5F99A 3AZJA 1P3OD 3EPJA 1F66D 5DNNA 1P34D 3AN2D 3LZ0A 4JJNA 2BYKA 4J8WA 3AYWC 1M18A 3UT9B 4KGCA 3B0CT 1W2EA 5DNMA 4H9SA 5GXQA 1KX3B 3AYWD 3LJAA 4DRBA 2Y2IA 5JRGC 3AZKB 5B1LD 5BNXB 5AVBA 5CPJC 2CV5D 5B32C 3X1VC 1Q9CA 3W96B 5JRGD 3MNNB 3KWQA 2UWXA 5CPJD 5AV6C 2XD1A 3MGSD 5B31B 2NQBC 4CSRA 5B32D 5KDMA 3X1VD 2Y2HA 3AZNC 2Y2MA 5FUGB 4HGAB 3AZMD 4XUJB 2AROA 4QLCC 5AV9C 4XZQC 4YS3A 3B6FC 5C3IB 3AZND 3WTPE 4Z66A 3B6GB 5F99B 4X23A 2F8NB 4QLCD 3AZJB 5AV9D 4XZQD 3B6FD 5DNNB 3LZ0B 3X1UC 4JJNB 1M18B 2RVQD 3MGPC 1S32B 3X1UD 3MVDA 4YM6A 5JA4A 5AV5C 1ZLAA 3AZFA 1P3FA 3KXBC 2HIOA 4NFTA 3W99A 4WU8C 4LD9D 3C1BB 4WJ3C 2DQNC 5AV5D 3AZLB 1KX5B 1A7WA 5GT0A 5B2IC 5AY8A 3KXBD 3AZGD 4WU8D 5BS7A 1P3BC 5B33A 3WA9A 4CSRB 5B2ID 5KDMB 4KUDB 3AV2A 3AFAA 3A6NB 2AROB 3P5JB 3UTAA 4YS3B 1P3BD 1P3LC 3VH6A 4J8VA 4Z66B 1KX4B 4X23B 1TAFA 2NZDC 4Z5TC 1P3MC 4NE6A 1P3LD 3VH5A 3LELA 2L5AA 2NZDD 4Z5TD 5B40A 4R8PA 1P3GD 1P3MD 2F8NK 1P3ID 4YM6B 1AOIB 3W98C 3X1TA 3AV1A 3AZFB 4G91C 5B24C 5B2JA 3AL0C 4J8XA 3TU4A 3W98D 5GT0B 3RELA 5GSUA 4M6BA 5B33B 3WA9B 3REKB 4WV4B 2Y2PA 3AV2B 3H0LC 2HUEC 3UTAB 3REHC 3W97C 4J8VB 1P3PB 4ZBJB 5CPIC 4AWLC 3MGRC 1TAFB 3WTPD 3REHD 3W97D 2ZY5A 4EO5B 3MGQA 3WAAA 5CPID 3LELB 5CPKD 3MGRD 4WU9A 3AZKA 4R8PB 3AZIA 4ZUXC 1B6WA 1P3OA 1F66A 3MNNA 2F8NH 3X1TB 3AN2A 1P3AA 4ZUXD 5B31A 4J8XB 3TU4B 3F6TA 3B0BA 4UUZA 3O62C 3X1SB 5GSUB 3AYWA 4H9RB 1ID3C 3O62D 3AZHC 2F8NA 3VH5T 2ZY4A 5JRGA 1ID3D 5AV8B 3AZHD 5CPJA 3LZ1C 5B1MB 3UT9D 3B0DC 5B32A 1S32A 5B1LC 2CV5C 5E5AB 4NE5A 3MGQB 3WAAB 3A1IA 5AV6A 2G5HC 3LZ1D 1KX3D 2NQBA 4WU9B 3AZNA 3C1BA 3KSYA 2G5IC 3MGSC 3AZIB 3AZLA 1M1AC 1KX5A 3EPHA 1P3OB 1F66B 3B6FA 1P34B 3AN2B 3AZMC 1P3AB 1M1AD 4KUDA 3A6NA 4UUZB 1EQZC 5GT3C 3AYWB 1KX4A 1EQZD 4Z2MH 3MGPA 3REJC 1P3KC 5GT3D 5F99D 4H9OA 2RVQC 2FJ7C 4J8WC 4KGCC 3KXBA 5JRGB 5DNND 3REJD 5GXQC 5B31G 4WU8A 3LZ0D 1P3KD 2FJ7D 5CPJB 2Y2GA 4J8WD 4KGCD 5B32B 5B2IA 3LJAC 3X1VB 4LD9C 5DNMD 2Y2OA 1AOIA 5GXQD 5AV6B 5AVBC 2NQBB 3AZGC 1M19C 3LJAD 3AZNB 2F8NG 3NQJA 3KWQC 4QLCB 5AVBD 5AV9B 4XZQB 1M19D 3B6FB 1HQ3C 3REKA 3KWQD 4H9NB 4Z5TA 1P3MA 1H3OA 3V9RB 3C1CC 3X1UB 1HQ3D 1P3PA 2W8SA 1TZYC 3MGPB 3C1CD 1P3GC 4H9OB 5AV5B 5CP6C 1P3IC 3IP4C 5B24A 1TZYD 3KXBB 3AZGB 4WU8B 3MVDC 5CP6D 1R4VA 1ZLAC 3EPKA 5B0ZC 5B2IB 1U35C 1P3FC 2PYOC 2HIOC 3W99C 3MVDD 1P3BB 1ZLAD 5B0ZD 1U35D 5AY8C 1P3FD 2PYOD 3REIC 2HIOD 3NQJB 3W99D 4WNNA 3W97A 5BS7C 3X1SA 3REHA 1P3LB 3WKJC 5AY8D 4KHAB 2XD5A 2JSSA 3REID 3H0RC 3UTBC 2JE5A 3AFAC 2F2AC 4H9RA 3MGRA 2NZDB 5AVCC 4Z5TB 5B33D 1H3OB 1P3MB 3WKJD 2ZY3A 4WZSB 4H9QB 1P3IB 3AV2D 3AZEC 3UTBD 3WTPC 3KUYC 3AFAD 5AV8A 5AVCD 5B1MA 5CPKC 3AZED 3KUYD 4J8UC 3W98B 4DRAA 2Y2JA 5E5AA 4G91B 5B40C 5B24B 4G92C 4J8UD 2IO5C 5B40D 3AV1C 1Z2CB 5B2JC 1P34A 3AV1D 5B0YC 3RELC 3AZHA 2HUEB 4CAYA 5B2JD 2DF4C 4WNNB 3REHB 3W97B 1HTAA 5B0YD 3RELD 5CPIB 4AWLB 3EPLA 1F1EA 5BT1C 3MGRB 2Y2LA 5B1LA 2CV5A 2RIQA 1BH9A 3UT9C 1ULYA 5BT1D 2Y2NA 2BG1A 3MGSA 4ZUXB 1M1AA 1KX3C 3X1VA 4UPKA 3AZKC 3AZMA 3MGQD 3WAAD 3W96C 5BNVA 3MNNC 3AZKD 1EQZA 1BH8A 3O62B 4QLCA 5AV9A 4XZQA 5B31C 3W96D 3MNND 3NQUA 1ID3B 3REJA 4HGAC 3AZHB 1P3AD 4H9NA 4XUJC 1P3KA 4CAYB 5B31D 1B67A 2FJ7A 1PZRA 3V9RA 3R45B 3EG5B 5C3IC 3X1UA 3B6GC 5F99C 4XUJD 3AZJC 4DQYB 3LZ1B 5DNNC 3B0DB 5B1LB 3LZ0C 4LD9A 3B6GD 4JJNC 5AV5A 2CV5B 2F8ND 1BH9B 3AZJD 1M18C 2BYMA 3AZGA 5DNMC 1M19A 1N1JB 4H9SC 2YFVB 1S32C 4JJND 4NE3A 3MGSB 2ZM5A 1M1AB 1M18D 4E45A 1S32D 3AZMB 5BO0A 3C1BC 1P3BA 1HQ3A 3AZLC 1KX5C 5AV6D 2NQBD 5BNVB 1EQZB 1WWSA 1BH8B 3C1BD 3C1CA 5GT3B 3AZLD 1P3LA 1KX5D 3FDDA 4KUDC 4KHAA 1TZYA 3NQUB 3A6NC 3REJB 2NZDA 2AROC 1P3KB 1P3GA 5B32G 4YS3C 3VH6W 5CP6A 2BYKB 4J8WB 4H9QA 1P3IA 2FJ7B 4KGCB 4KUDD 2Y2KA 4Z66C 5DNMB 1KX4C 3A6ND 4X23C 5GXQB 2AROD 4YS3D 2YFWA 3VH5W 5B0ZA 3LJAB 1U35A 4Z66D 1KX4D 4LD9B 2PYOA 4X23D 3MGPD 3W98A 2BYMB 5AVBB 1M19B 3B0CW 3REIA 4YM6C 1AOIC 3KWQB 3AZFC 3WKJA 3A1KA 5BO0B 5CHLB 3UTBA 3H0MC 1HQ3B 4YM6D 1AOID 5AVCA 5GT0C 3AZFD 3AZEA 3C1CB 3WTPA 3KUYA 1JFIA 5B33C 3WA9C 3REKC 5GT0D 3AV2C 5CPIA 2JCHA 1TZYB 1BFMA 5CPKA 4J8UA 3UTAC 1P3GB 3REKD 3WA9D 5CP6B 4J8VC 1P3PC 4ZBJC 4Z2MG 4H9PA 5G49A 3MVDB 2LY8A 3UTAD 2YFWB 5JA4B 1ZLAB 4ZUXA 4J8VD 5B0ZB 2VQRA 4EO5C 1U35B 1P3PD 1P3FB 3LELC 2PYOB 2HIOB 3W99B 4R8PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWI A;  5B0Y A;  5AY8 B;  5B24 D;  3LEL D;  3REI B;  3X1T C;  4R8P D;  3O62 A;  3WKJ B;  3UTB B;  1KU5 A;  3AFA B;  4J8X C;  3TU4 C;  3X1T D;  1ID3 A;  5AVC B;  2CWE A;  3X1S C;  5GSU C;  3AZE B;  3R45 A;  3UT9 A;  3WTP B;  3KUY B;  1JFI B;  4J8X D;  3TU4 D;  3X1S D;  5GSU D;  3LZ1 A;  1KX3 A;  5CPK B;  4J8U B;  5AV8 C;  5B40 B;  5BNX A;  4H9P B;  4G92 B;  5B1M C;  1N1J A;  2YFV A;  5G49 B;  3W96 A;  5AV8 D;  2IO5 B;  5E5A C;  3AV1 B;  3WAA C;  3MGQ C;  5B1M D;  5B2J B;  4WU9 C;  3AZI C;  4E44 A;  5E5A D;  5FUG A;  5B0Y B;  3VH6 T;  3REL B;  4XUJ A;  1P3O C;  1F66 C;  4WU9 D;  1P34 C;  3AN2 C;  1P3A C;  3AZI D;  3B6G A;  5GT3 A;  5F99 A;  3AZJ A;  1P3O D;  1F66 D;  5DNN A;  1P34 D;  3AN2 D;  3LZ0 A;  4JJN A;  2BYK A;  4J8W A;  3AYW C;  1M18 A;  3UT9 B;  4KGC A;  3B0C T;  5DNM A;  4H9S A;  5GXQ A;  1KX3 B;  3AYW D;  3LJA A;  4DRB A;  5JRG C;  3AZK B;  5B1L D;  5BNX B;  5AVB A;  5CPJ C;  2CV5 D;  5B32 C;  3X1V C;  1Q9C A;  3W96 B;  5JRG D;  3MNN B;  3KWQ A;  5CPJ D;  5AV6 C;  3MGS D;  5B31 B;  2NQB C;  4CSR A;  5B32 D;  5KDM A;  3X1V D;  3AZN C;  5FUG B;  4HGA B;  3AZM D;  4XUJ B;  2ARO A;  4QLC C;  5AV9 C;  4XZQ C;  4YS3 A;  3B6F C;  5C3I B;  3AZN D;  3WTP E;  4Z66 A;  3B6G B;  5F99 B;  4X23 A;  2F8N B;  4QLC D;  3AZJ B;  5AV9 D;  4XZQ D;  3B6F D;  5DNN B;  3LZ0 B;  3X1U C;  4JJN B;  1M18 B;  2RVQ D;  3MGP C;  1S32 B;  3X1U D;  3MVD A;  4YM6 A;  5JA4 A;  5AV5 C;  1ZLA A;  3AZF A;  1P3F A;  3KXB C;  2HIO A;  4NFT A;  3W99 A;  4WU8 C;  4LD9 D;  3C1B B;  5AV5 D;  3AZL B;  1KX5 B;  1A7W A;  5GT0 A;  5B2I C;  5AY8 A;  3KXB D;  3AZG D;  4WU8 D;  5BS7 A;  1P3B C;  5B33 A;  3WA9 A;  4CSR B;  5B2I D;  5KDM B;  4KUD B;  3AV2 A;  3AFA A;  3A6N B;  2ARO B;  1P3B D;  3UTA A;  4YS3 B;  1P3L C;  3VH6 A;  4J8V A;  4Z66 B;  1KX4 B;  4X23 B;  1TAF A;  2NZD C;  4Z5T C;  1P3M C;  4NE6 A;  1P3L D;  3VH5 A;  3LEL A;  2L5A A;  2NZD D;  4Z5T D;  5B40 A;  4R8P A;  1P3G D;  1P3M D;  2F8N K;  1P3I D;  4YM6 B;  1AOI B;  3W98 C;  3X1T A;  3AV1 A;  3AZF B;  4G91 C;  5B24 C;  5B2J A;  4J8X A;  3TU4 A;  3W98 D;  5GT0 B;  3REL A;  5GSU A;  4M6B A;  5B33 B;  3WA9 B;  3REK B;  4WV4 B;  3AV2 B;  2HUE C;  3UTA B;  3REH C;  3W97 C;  4J8V B;  1P3P B;  4ZBJ B;  5CPI C;  4AWL C;  3MGR C;  1TAF B;  3WTP D;  3REH D;  3W97 D;  4EO5 B;  3MGQ A;  3WAA A;  5CPI D;  3LEL B;  5CPK D;  3MGR D;  4WU9 A;  3AZK A;  4R8P B;  3AZI A;  4ZUX C;  1B6W A;  1P3O A;  1F66 A;  3MNN A;  2F8N H;  3X1T B;  3AN2 A;  1P3A A;  4ZUX D;  5B31 A;  4J8X B;  3TU4 B;  3B0B A;  4UUZ A;  3O62 C;  3X1S B;  5GSU B;  3AYW A;  4H9R B;  1ID3 C;  3O62 D;  3AZH C;  2F8N A;  3VH5 T;  5JRG A;  1ID3 D;  5AV8 B;  3AZH D;  5CPJ A;  3LZ1 C;  5B1M B;  3UT9 D;  3B0D C;  5B32 A;  1S32 A;  5B1L C;  2CV5 C;  5E5A B;  4NE5 A;  3MGQ B;  3WAA B;  5AV6 A;  3LZ1 D;  1KX3 D;  2NQB A;  4WU9 B;  3AZN A;  3C1B A;  3KSY A;  3MGS C;  3AZI B;  3AZL A;  1M1A C;  1KX5 A;  1P3O B;  1F66 B;  3B6F A;  1P34 B;  3AN2 B;  3AZM C;  1P3A B;  1M1A D;  4KUD A;  3A6N A;  4UUZ B;  1EQZ C;  5GT3 C;  3AYW B;  1KX4 A;  1EQZ D;  4Z2M H;  3MGP A;  3REJ C;  1P3K C;  5GT3 D;  5F99 D;  4H9O A;  2RVQ C;  2FJ7 C;  4J8W C;  4KGC C;  3KXB A;  5JRG B;  5DNN D;  3REJ D;  5GXQ C;  5B31 G;  4WU8 A;  3LZ0 D;  1P3K D;  2FJ7 D;  5CPJ B;  4J8W D;  4KGC D;  5B32 B;  5B2I A;  3LJA C;  3X1V B;  4LD9 C;  5DNM D;  1AOI A;  5GXQ D;  5AV6 B;  5AVB C;  2NQB B;  3AZG C;  1M19 C;  3LJA D;  3AZN B;  2F8N G;  3NQJ A;  3KWQ C;  4QLC B;  5AVB D;  5AV9 B;  4XZQ B;  1M19 D;  3B6F B;  1HQ3 C;  3REK A;  3KWQ D;  4H9N B;  4Z5T A;  1P3M A;  1H3O A;  3V9R B;  3C1C C;  3X1U B;  1HQ3 D;  1P3P A;  1TZY C;  3MGP B;  3C1C D;  1P3G C;  4H9O B;  5AV5 B;  5CP6 C;  1P3I C;  5B24 A;  1TZY D;  3KXB B;  3AZG B;  4WU8 B;  3MVD C;  5CP6 D;  1R4V A;  1ZLA C;  5B0Z C;  5B2I B;  1U35 C;  1P3F C;  2PYO C;  2HIO C;  3W99 C;  3MVD D;  1P3B B;  1ZLA D;  5B0Z D;  1U35 D;  5AY8 C;  1P3F D;  2PYO D;  3REI C;  2HIO D;  3NQJ B;  3W99 D;  4WNN A;  3W97 A;  5BS7 C;  3X1S A;  3REH A;  1P3L B;  3WKJ C;  5AY8 D;  4KHA B;  2JSS A;  3REI D;  3UTB C;  3AFA C;  4H9R A;  3MGR A;  2NZD B;  5AVC C;  4Z5T B;  5B33 D;  1H3O B;  1P3M B;  3WKJ D;  1P3I B;  4WZS B;  4H9Q B;  3AV2 D;  3AZE C;  3UTB D;  3WTP C;  3KUY C;  3AFA D;  5AV8 A;  5AVC D;  5B1M A;  5CPK C;  3AZE D;  3KUY D;  4J8U C;  3W98 B;  4DRA A;  5E5A A;  4G91 B;  5B40 C;  5B24 B;  4G92 C;  4J8U D;  2IO5 C;  5B40 D;  3AV1 C;  5B2J C;  1P34 A;  3AV1 D;  5B0Y C;  3REL C;  3AZH A;  2HUE B;  4CAY A;  5B2J D;  4WNN B;  3REH B;  3W97 B;  1HTA A;  5B0Y D;  3REL D;  5CPI B;  4AWL B;  1F1E A;  5BT1 C;  3MGR B;  5B1L A;  2CV5 A;  1BH9 A;  3UT9 C;  1ULY A;  5BT1 D;  3MGS A;  4ZUX B;  1M1A A;  1KX3 C;  3X1V A;  3AZK C;  3AZM A;  3MGQ D;  3WAA D;  3W96 C;  5BNV A;  3MNN C;  3AZK D;  1EQZ A;  1BH8 A;  3O62 B;  4QLC A;  5AV9 A;  4XZQ A;  5B31 C;  3W96 D;  3MNN D;  3NQU A;  1ID3 B;  3REJ A;  4HGA C;  3AZH B;  1P3A D;  4H9N A;  4XUJ C;  1P3K A;  4CAY B;  5B31 D;  1B67 A;  2FJ7 A;  3V9R A;  3R45 B;  5C3I C;  3X1U A;  3B6G C;  5F99 C;  4XUJ D;  3AZJ C;  3LZ1 B;  5DNN C;  3B0D B;  5B1L B;  3LZ0 C;  4LD9 A;  3B6G D;  4JJN C;  5AV5 A;  2CV5 B;  2F8N D;  1BH9 B;  3AZJ D;  1M18 C;  2BYM A;  3AZG A;  5DNM C;  1M19 A;  1N1J B;  4H9S C;  2YFV B;  1S32 C;  4JJN D;  4NE3 A;  3MGS B;  1M1A B;  1M18 D;  4E45 A;  1S32 D;  3AZM B;  5BO0 A;  3C1B C;  1P3B A;  1HQ3 A;  3AZL C;  1KX5 C;  5AV6 D;  2NQB D;  5BNV B;  1EQZ B;  1WWS A;  1BH8 B;  3C1B D;  3C1C A;  5GT3 B;  3AZL D;  1P3L A;  1KX5 D;  4KUD C;  4KHA A;  1TZY A;  3NQU B;  3A6N C;  3REJ B;  2NZD A;  2ARO C;  1P3K B;  1P3G A;  5B32 G;  4YS3 C;  3VH6 W;  5CP6 A;  2BYK B;  4J8W B;  4H9Q A;  1P3I A;  2FJ7 B;  4KGC B;  4KUD D;  4Z66 C;  5DNM B;  1KX4 C;  3A6N D;  4X23 C;  5GXQ B;  2ARO D;  4YS3 D;  2YFW A;  3VH5 W;  5B0Z A;  3LJA B;  1U35 A;  4Z66 D;  1KX4 D;  4LD9 B;  2PYO A;  4X23 D;  3MGP D;  3W98 A;  2BYM B;  5AVB B;  1M19 B;  3B0C W;  3REI A;  4YM6 C;  1AOI C;  3KWQ B;  3AZF C;  3WKJ A;  5BO0 B;  5CHL B;  3UTB A;  4YM6 D;  1HQ3 B;  1AOI D;  5AVC A;  5GT0 C;  3AZF D;  3AZE A;  3C1C B;  3WTP A;  3KUY A;  1JFI A;  5B33 C;  3WA9 C;  3REK C;  5GT0 D;  3AV2 C;  5CPI A;  1TZY B;  1BFM A;  5CPK A;  4J8U A;  3UTA C;  1P3G B;  3REK D;  3WA9 D;  5CP6 B;  4J8V C;  1P3P C;  4ZBJ C;  4Z2M G;  4H9P A;  5G49 A;  3MVD B;  2LY8 A;  3UTA D;  2YFW B;  5JA4 B;  1ZLA B;  4ZUX A;  4J8V D;  5B0Z B;  4EO5 C;  1U35 B;  1P3P D;  1P3F B;  3LEL C;  2PYO B;  2HIO B;  3W99 B;  4R8P C; 
#chains in the Genus database with same CATH topology
 1WWI A;  5B0Y A;  5AY8 B;  5B24 D;  3LEL D;  3REI B;  3X1T C;  4R8P D;  3O62 A;  3WKJ B;  3UTB B;  1KU5 A;  3AFA B;  4J8X C;  3TU4 C;  3X1T D;  1ID3 A;  5AVC B;  2CWE A;  3X1S C;  5GSU C;  3AZE B;  3R45 A;  3UT9 A;  3WTP B;  3KUY B;  1JFI B;  4J8X D;  3TU4 D;  3X1S D;  2J8P A;  5GSU D;  3LZ1 A;  1KX3 A;  5CPK B;  4J8U B;  5AV8 C;  5B40 B;  5BNX A;  4H9P B;  4G92 B;  5B1M C;  1N1J A;  2YFV A;  5G49 B;  3W96 A;  5AV8 D;  2IO5 B;  2ZY2 A;  5E5A C;  3WAA C;  3MGQ C;  3AV1 B;  1T3U A;  2FFF B;  5B1M D;  5B2J B;  4WU9 C;  3AZI C;  4E44 A;  5E5A D;  5FUG A;  5B0Y B;  3VH6 T;  3REL B;  4XUJ A;  3KFU G;  1P3O C;  1F66 C;  4WU9 D;  1P34 C;  3AN2 C;  2Y2Q A;  1P3A C;  3AZI D;  3B6G A;  5GT3 A;  5F99 A;  3AZJ A;  1P3O D;  3EPJ A;  1F66 D;  5DNN A;  1P34 D;  3AN2 D;  3LZ0 A;  4JJN A;  2BYK A;  4J8W A;  3AYW C;  1M18 A;  3UT9 B;  4KGC A;  3B0C T;  1W2E A;  5DNM A;  4H9S A;  5GXQ A;  1KX3 B;  3AYW D;  3LJA A;  4DRB A;  2Y2I A;  5JRG C;  3AZK B;  5B1L D;  5BNX B;  5AVB A;  5CPJ C;  2CV5 D;  5B32 C;  3X1V C;  1Q9C A;  3W96 B;  5JRG D;  3MNN B;  3KWQ A;  2UWX A;  5CPJ D;  5AV6 C;  2XD1 A;  3MGS D;  5B31 B;  2NQB C;  4CSR A;  5B32 D;  5KDM A;  3X1V D;  2Y2H A;  3AZN C;  2Y2M A;  5FUG B;  4HGA B;  3AZM D;  4XUJ B;  2ARO A;  4QLC C;  5AV9 C;  4XZQ C;  4YS3 A;  3B6F C;  5C3I B;  3AZN D;  3WTP E;  4Z66 A;  3B6G B;  5F99 B;  4X23 A;  2F8N B;  4QLC D;  3AZJ B;  5AV9 D;  4XZQ D;  3B6F D;  5DNN B;  3LZ0 B;  3X1U C;  4JJN B;  1M18 B;  2RVQ D;  3MGP C;  1S32 B;  3X1U D;  3MVD A;  4YM6 A;  5JA4 A;  5AV5 C;  1ZLA A;  3AZF A;  1P3F A;  3KXB C;  2HIO A;  4NFT A;  3W99 A;  4WU8 C;  4LD9 D;  3C1B B;  4WJ3 C;  2DQN C;  5AV5 D;  3AZL B;  1KX5 B;  1A7W A;  5GT0 A;  5B2I C;  5AY8 A;  3KXB D;  3AZG D;  4WU8 D;  5BS7 A;  1P3B C;  5B33 A;  3WA9 A;  4CSR B;  5B2I D;  5KDM B;  4KUD B;  3AV2 A;  3AFA A;  3A6N B;  2ARO B;  3P5J B;  3UTA A;  4YS3 B;  1P3B D;  1P3L C;  3VH6 A;  4J8V A;  4Z66 B;  1KX4 B;  4X23 B;  1TAF A;  2NZD C;  4Z5T C;  1P3M C;  4NE6 A;  1P3L D;  3VH5 A;  3LEL A;  2L5A A;  2NZD D;  4Z5T D;  5B40 A;  4R8P A;  1P3G D;  1P3M D;  2F8N K;  1P3I D;  4YM6 B;  1AOI B;  3W98 C;  3X1T A;  3AV1 A;  3AZF B;  4G91 C;  5B24 C;  5B2J A;  3AL0 C;  4J8X A;  3TU4 A;  3W98 D;  5GT0 B;  3REL A;  5GSU A;  4M6B A;  5B33 B;  3WA9 B;  3REK B;  4WV4 B;  2Y2P A;  3AV2 B;  3H0L C;  2HUE C;  3UTA B;  3REH C;  3W97 C;  4J8V B;  1P3P B;  4ZBJ B;  5CPI C;  4AWL C;  3MGR C;  1TAF B;  3WTP D;  3REH D;  3W97 D;  2ZY5 A;  4EO5 B;  3MGQ A;  3WAA A;  5CPI D;  3LEL B;  5CPK D;  3MGR D;  4WU9 A;  3AZK A;  4R8P B;  3AZI A;  4ZUX C;  1B6W A;  1P3O A;  1F66 A;  3MNN A;  2F8N H;  3X1T B;  3AN2 A;  1P3A A;  4ZUX D;  5B31 A;  4J8X B;  3TU4 B;  3F6T A;  3B0B A;  4UUZ A;  3O62 C;  3X1S B;  5GSU B;  3AYW A;  4H9R B;  1ID3 C;  3O62 D;  3AZH C;  2F8N A;  3VH5 T;  2ZY4 A;  5JRG A;  1ID3 D;  5AV8 B;  3AZH D;  5CPJ A;  3LZ1 C;  5B1M B;  3UT9 D;  3B0D C;  5B32 A;  1S32 A;  5B1L C;  2CV5 C;  5E5A B;  4NE5 A;  3MGQ B;  3WAA B;  3A1I A;  5AV6 A;  2G5H C;  3LZ1 D;  1KX3 D;  2NQB A;  4WU9 B;  3AZN A;  3C1B A;  3KSY A;  2G5I C;  3MGS C;  3AZI B;  3AZL A;  1M1A C;  1KX5 A;  3EPH A;  1P3O B;  1F66 B;  3B6F A;  1P34 B;  3AN2 B;  3AZM C;  1P3A B;  1M1A D;  4KUD A;  3A6N A;  4UUZ B;  1EQZ C;  5GT3 C;  3AYW B;  1KX4 A;  1EQZ D;  4Z2M H;  3MGP A;  3REJ C;  1P3K C;  5GT3 D;  5F99 D;  4H9O A;  2RVQ C;  2FJ7 C;  4J8W C;  4KGC C;  3KXB A;  5JRG B;  5DNN D;  3REJ D;  5GXQ C;  5B31 G;  4WU8 A;  3LZ0 D;  1P3K D;  2FJ7 D;  5CPJ B;  2Y2G A;  4J8W D;  4KGC D;  5B32 B;  5B2I A;  3LJA C;  3X1V B;  4LD9 C;  5DNM D;  2Y2O A;  1AOI A;  5GXQ D;  5AV6 B;  5AVB C;  2NQB B;  3AZG C;  1M19 C;  3LJA D;  3AZN B;  2F8N G;  3NQJ A;  3KWQ C;  4QLC B;  5AVB D;  5AV9 B;  4XZQ B;  1M19 D;  3B6F B;  1HQ3 C;  3REK A;  3KWQ D;  4H9N B;  4Z5T A;  1P3M A;  1H3O A;  3V9R B;  3C1C C;  3X1U B;  1HQ3 D;  1P3P A;  2W8S A;  1TZY C;  3MGP B;  3C1C D;  1P3G C;  4H9O B;  5AV5 B;  5CP6 C;  1P3I C;  3IP4 C;  5B24 A;  1TZY D;  3KXB B;  3AZG B;  4WU8 B;  3MVD C;  5CP6 D;  1R4V A;  1ZLA C;  3EPK A;  5B0Z C;  5B2I B;  1U35 C;  1P3F C;  2PYO C;  2HIO C;  3W99 C;  3MVD D;  1P3B B;  1ZLA D;  5B0Z D;  1U35 D;  5AY8 C;  1P3F D;  2PYO D;  3REI C;  2HIO D;  3NQJ B;  3W99 D;  4WNN A;  3W97 A;  5BS7 C;  3X1S A;  3REH A;  1P3L B;  3WKJ C;  5AY8 D;  4KHA B;  2XD5 A;  2JSS A;  3REI D;  3H0R C;  3UTB C;  2JE5 A;  3AFA C;  2F2A C;  4H9R A;  3MGR A;  2NZD B;  5AVC C;  4Z5T B;  5B33 D;  1H3O B;  1P3M B;  3WKJ D;  2ZY3 A;  4WZS B;  4H9Q B;  1P3I B;  3AV2 D;  3AZE C;  3UTB D;  3WTP C;  3KUY C;  3AFA D;  5AV8 A;  5AVC D;  5B1M A;  5CPK C;  3AZE D;  3KUY D;  4J8U C;  3W98 B;  4DRA A;  2Y2J A;  5E5A A;  4G91 B;  5B40 C;  5B24 B;  4G92 C;  4J8U D;  2IO5 C;  5B40 D;  3AV1 C;  1Z2C B;  5B2J C;  1P34 A;  3AV1 D;  5B0Y C;  3REL C;  3AZH A;  2HUE B;  4CAY A;  5B2J D;  2DF4 C;  4WNN B;  3REH B;  3W97 B;  1HTA A;  5B0Y D;  3REL D;  5CPI B;  4AWL B;  3EPL A;  1F1E A;  5BT1 C;  3MGR B;  2Y2L A;  5B1L A;  2CV5 A;  2RIQ A;  1BH9 A;  3UT9 C;  1ULY A;  5BT1 D;  2Y2N A;  2BG1 A;  3MGS A;  4ZUX B;  1M1A A;  1KX3 C;  3X1V A;  4UPK A;  3AZK C;  3AZM A;  3MGQ D;  3WAA D;  3W96 C;  5BNV A;  3MNN C;  3AZK D;  1EQZ A;  1BH8 A;  3O62 B;  4QLC A;  5AV9 A;  4XZQ A;  5B31 C;  3W96 D;  3MNN D;  3NQU A;  1ID3 B;  3REJ A;  4HGA C;  3AZH B;  1P3A D;  4H9N A;  4XUJ C;  1P3K A;  4CAY B;  5B31 D;  1B67 A;  2FJ7 A;  1PZR A;  3V9R A;  3R45 B;  3EG5 B;  5C3I C;  3X1U A;  3B6G C;  5F99 C;  4XUJ D;  3AZJ C;  4DQY B;  3LZ1 B;  5DNN C;  3B0D B;  5B1L B;  3LZ0 C;  4LD9 A;  3B6G D;  4JJN C;  5AV5 A;  2CV5 B;  2F8N D;  1BH9 B;  3AZJ D;  1M18 C;  2BYM A;  3AZG A;  5DNM C;  1M19 A;  1N1J B;  4H9S C;  2YFV B;  1S32 C;  4JJN D;  4NE3 A;  3MGS B;  2ZM5 A;  1M1A B;  1M18 D;  4E45 A;  1S32 D;  3AZM B;  5BO0 A;  3C1B C;  1P3B A;  1HQ3 A;  3AZL C;  1KX5 C;  5AV6 D;  2NQB D;  5BNV B;  1EQZ B;  1WWS A;  1BH8 B;  3C1B D;  3C1C A;  5GT3 B;  3AZL D;  1P3L A;  1KX5 D;  3FDD A;  4KUD C;  4KHA A;  1TZY A;  3NQU B;  3A6N C;  3REJ B;  2NZD A;  2ARO C;  1P3K B;  1P3G A;  5B32 G;  4YS3 C;  3VH6 W;  5CP6 A;  2BYK B;  4J8W B;  4H9Q A;  1P3I A;  2FJ7 B;  4KGC B;  4KUD D;  2Y2K A;  4Z66 C;  5DNM B;  1KX4 C;  3A6N D;  4X23 C;  5GXQ B;  2ARO D;  4YS3 D;  2YFW A;  3VH5 W;  5B0Z A;  3LJA B;  1U35 A;  4Z66 D;  1KX4 D;  4LD9 B;  2PYO A;  4X23 D;  3MGP D;  3W98 A;  2BYM B;  5AVB B;  1M19 B;  3B0C W;  3REI A;  4YM6 C;  1AOI C;  3KWQ B;  3AZF C;  3WKJ A;  3A1K A;  5BO0 B;  5CHL B;  3UTB A;  3H0M C;  1HQ3 B;  4YM6 D;  1AOI D;  5AVC A;  5GT0 C;  3AZF D;  3AZE A;  3C1C B;  3WTP A;  3KUY A;  1JFI A;  5B33 C;  3WA9 C;  3REK C;  5GT0 D;  3AV2 C;  5CPI A;  2JCH A;  1TZY B;  1BFM A;  5CPK A;  4J8U A;  3UTA C;  1P3G B;  3REK D;  3WA9 D;  5CP6 B;  4J8V C;  1P3P C;  4ZBJ C;  4Z2M G;  4H9P A;  5G49 A;  3MVD B;  2LY8 A;  3UTA D;  2YFW B;  5JA4 B;  1ZLA B;  4ZUX A;  4J8V D;  5B0Z B;  2VQR A;  4EO5 C;  1U35 B;  1P3P D;  1P3F B;  3LEL C;  2PYO B;  2HIO B;  3W99 B;  4R8P C; 
#chains in the Genus database with same CATH homology
 1WWI A;  5B0Y A;  5AY8 B;  5B24 D;  3LEL D;  3REI B;  3X1T C;  4R8P D;  3O62 A;  3WKJ B;  3UTB B;  1KU5 A;  3AFA B;  4J8X C;  3TU4 C;  3X1T D;  1ID3 A;  5AVC B;  2CWE A;  3X1S C;  5GSU C;  3AZE B;  3R45 A;  3UT9 A;  3WTP B;  3KUY B;  1JFI B;  4J8X D;  3TU4 D;  3X1S D;  2J8P A;  5GSU D;  3LZ1 A;  1KX3 A;  5CPK B;  4J8U B;  5AV8 C;  5B40 B;  5BNX A;  4H9P B;  4G92 B;  5B1M C;  1N1J A;  2YFV A;  5G49 B;  3W96 A;  5AV8 D;  2IO5 B;  2ZY2 A;  5E5A C;  3WAA C;  3MGQ C;  3AV1 B;  1T3U A;  2FFF B;  5B1M D;  5B2J B;  4WU9 C;  3AZI C;  4E44 A;  5E5A D;  5FUG A;  5B0Y B;  3VH6 T;  3REL B;  4XUJ A;  3KFU G;  1P3O C;  1F66 C;  4WU9 D;  1P34 C;  3AN2 C;  2Y2Q A;  1P3A C;  3AZI D;  3B6G A;  5GT3 A;  5F99 A;  3AZJ A;  1P3O D;  3EPJ A;  1F66 D;  5DNN A;  1P34 D;  3AN2 D;  3LZ0 A;  4JJN A;  2BYK A;  4J8W A;  3AYW C;  1M18 A;  3UT9 B;  4KGC A;  3B0C T;  1W2E A;  5DNM A;  4H9S A;  5GXQ A;  1KX3 B;  3AYW D;  3LJA A;  4DRB A;  2Y2I A;  5JRG C;  3AZK B;  5B1L D;  5BNX B;  5AVB A;  5CPJ C;  2CV5 D;  5B32 C;  3X1V C;  1Q9C A;  3W96 B;  5JRG D;  3MNN B;  3KWQ A;  2UWX A;  5CPJ D;  5AV6 C;  2XD1 A;  3MGS D;  5B31 B;  2NQB C;  4CSR A;  5B32 D;  5KDM A;  3X1V D;  2Y2H A;  3AZN C;  2Y2M A;  5FUG B;  4HGA B;  3AZM D;  4XUJ B;  2ARO A;  4QLC C;  5AV9 C;  4XZQ C;  4YS3 A;  3B6F C;  5C3I B;  3AZN D;  3WTP E;  4Z66 A;  3B6G B;  5F99 B;  4X23 A;  2F8N B;  4QLC D;  3AZJ B;  5AV9 D;  4XZQ D;  3B6F D;  5DNN B;  3LZ0 B;  3X1U C;  4JJN B;  1M18 B;  2RVQ D;  3MGP C;  1S32 B;  3X1U D;  3MVD A;  4YM6 A;  5JA4 A;  5AV5 C;  1ZLA A;  3AZF A;  1P3F A;  3KXB C;  2HIO A;  4NFT A;  3W99 A;  4WU8 C;  4LD9 D;  3C1B B;  4WJ3 C;  2DQN C;  5AV5 D;  3AZL B;  1KX5 B;  1A7W A;  5GT0 A;  5B2I C;  5AY8 A;  3KXB D;  3AZG D;  4WU8 D;  5BS7 A;  1P3B C;  5B33 A;  3WA9 A;  4CSR B;  5B2I D;  5KDM B;  4KUD B;  3AV2 A;  3AFA A;  3A6N B;  2ARO B;  3P5J B;  3UTA A;  4YS3 B;  1P3B D;  1P3L C;  3VH6 A;  4J8V A;  4Z66 B;  1KX4 B;  4X23 B;  1TAF A;  2NZD C;  4Z5T C;  1P3M C;  4NE6 A;  1P3L D;  3VH5 A;  3LEL A;  2L5A A;  2NZD D;  4Z5T D;  5B40 A;  4R8P A;  1P3G D;  1P3M D;  2F8N K;  1P3I D;  4YM6 B;  1AOI B;  3W98 C;  3X1T A;  3AV1 A;  3AZF B;  4G91 C;  5B24 C;  5B2J A;  3AL0 C;  4J8X A;  3TU4 A;  3W98 D;  5GT0 B;  3REL A;  5GSU A;  4M6B A;  5B33 B;  3WA9 B;  3REK B;  4WV4 B;  2Y2P A;  3AV2 B;  3H0L C;  2HUE C;  3UTA B;  3REH C;  3W97 C;  4J8V B;  1P3P B;  4ZBJ B;  5CPI C;  4AWL C;  3MGR C;  1TAF B;  3WTP D;  3REH D;  3W97 D;  2ZY5 A;  4EO5 B;  3MGQ A;  3WAA A;  5CPI D;  3LEL B;  5CPK D;  3MGR D;  4WU9 A;  3AZK A;  4R8P B;  3AZI A;  4ZUX C;  1B6W A;  1P3O A;  1F66 A;  3MNN A;  2F8N H;  3X1T B;  3AN2 A;  1P3A A;  4ZUX D;  5B31 A;  4J8X B;  3TU4 B;  3F6T A;  3B0B A;  4UUZ A;  3O62 C;  3X1S B;  5GSU B;  3AYW A;  4H9R B;  1ID3 C;  3O62 D;  3AZH C;  2F8N A;  3VH5 T;  2ZY4 A;  5JRG A;  1ID3 D;  5AV8 B;  3AZH D;  5CPJ A;  3LZ1 C;  5B1M B;  3UT9 D;  3B0D C;  5B32 A;  1S32 A;  5B1L C;  2CV5 C;  5E5A B;  4NE5 A;  3MGQ B;  3WAA B;  3A1I A;  5AV6 A;  2G5H C;  3LZ1 D;  1KX3 D;  2NQB A;  4WU9 B;  3AZN A;  3C1B A;  3KSY A;  2G5I C;  3MGS C;  3AZI B;  3AZL A;  1M1A C;  1KX5 A;  3EPH A;  1P3O B;  1F66 B;  3B6F A;  1P34 B;  3AN2 B;  3AZM C;  1P3A B;  1M1A D;  4KUD A;  3A6N A;  4UUZ B;  1EQZ C;  5GT3 C;  3AYW B;  1KX4 A;  1EQZ D;  4Z2M H;  3MGP A;  3REJ C;  1P3K C;  5GT3 D;  5F99 D;  4H9O A;  2RVQ C;  2FJ7 C;  4J8W C;  4KGC C;  3KXB A;  5JRG B;  5DNN D;  3REJ D;  5GXQ C;  5B31 G;  4WU8 A;  3LZ0 D;  1P3K D;  2FJ7 D;  5CPJ B;  2Y2G A;  4J8W D;  4KGC D;  5B32 B;  5B2I A;  3LJA C;  3X1V B;  4LD9 C;  5DNM D;  2Y2O A;  1AOI A;  5GXQ D;  5AV6 B;  5AVB C;  2NQB B;  3AZG C;  1M19 C;  3LJA D;  3AZN B;  2F8N G;  3NQJ A;  3KWQ C;  4QLC B;  5AVB D;  5AV9 B;  4XZQ B;  1M19 D;  3B6F B;  1HQ3 C;  3REK A;  3KWQ D;  4H9N B;  4Z5T A;  1P3M A;  1H3O A;  3V9R B;  3C1C C;  3X1U B;  1HQ3 D;  1P3P A;  2W8S A;  1TZY C;  3MGP B;  3C1C D;  1P3G C;  4H9O B;  5AV5 B;  5CP6 C;  1P3I C;  3IP4 C;  5B24 A;  1TZY D;  3KXB B;  3AZG B;  4WU8 B;  3MVD C;  5CP6 D;  1R4V A;  1ZLA C;  3EPK A;  5B0Z C;  5B2I B;  1U35 C;  1P3F C;  2PYO C;  2HIO C;  3W99 C;  3MVD D;  1P3B B;  1ZLA D;  5B0Z D;  1U35 D;  5AY8 C;  1P3F D;  2PYO D;  3REI C;  2HIO D;  3NQJ B;  3W99 D;  4WNN A;  3W97 A;  5BS7 C;  3X1S A;  3REH A;  1P3L B;  3WKJ C;  5AY8 D;  4KHA B;  2XD5 A;  2JSS A;  3REI D;  3H0R C;  3UTB C;  2JE5 A;  3AFA C;  2F2A C;  4H9R A;  3MGR A;  2NZD B;  5AVC C;  4Z5T B;  5B33 D;  1H3O B;  1P3M B;  3WKJ D;  2ZY3 A;  4WZS B;  4H9Q B;  1P3I B;  3AV2 D;  3AZE C;  3UTB D;  3WTP C;  3KUY C;  3AFA D;  5AV8 A;  5AVC D;  5B1M A;  5CPK C;  3AZE D;  3KUY D;  4J8U C;  3W98 B;  4DRA A;  2Y2J A;  5E5A A;  4G91 B;  5B40 C;  5B24 B;  4G92 C;  4J8U D;  2IO5 C;  5B40 D;  3AV1 C;  1Z2C B;  5B2J C;  1P34 A;  3AV1 D;  5B0Y C;  3REL C;  3AZH A;  2HUE B;  4CAY A;  5B2J D;  2DF4 C;  4WNN B;  3REH B;  3W97 B;  1HTA A;  5B0Y D;  3REL D;  5CPI B;  4AWL B;  3EPL A;  1F1E A;  5BT1 C;  3MGR B;  2Y2L A;  5B1L A;  2CV5 A;  2RIQ A;  1BH9 A;  3UT9 C;  1ULY A;  5BT1 D;  2Y2N A;  2BG1 A;  3MGS A;  4ZUX B;  1M1A A;  1KX3 C;  3X1V A;  4UPK A;  3AZK C;  3AZM A;  3MGQ D;  3WAA D;  3W96 C;  5BNV A;  3MNN C;  3AZK D;  1EQZ A;  1BH8 A;  3O62 B;  4QLC A;  5AV9 A;  4XZQ A;  5B31 C;  3W96 D;  3MNN D;  3NQU A;  1ID3 B;  3REJ A;  4HGA C;  3AZH B;  1P3A D;  4H9N A;  4XUJ C;  1P3K A;  4CAY B;  5B31 D;  1B67 A;  2FJ7 A;  1PZR A;  3V9R A;  3R45 B;  3EG5 B;  5C3I C;  3X1U A;  3B6G C;  5F99 C;  4XUJ D;  3AZJ C;  4DQY B;  3LZ1 B;  5DNN C;  3B0D B;  5B1L B;  3LZ0 C;  4LD9 A;  3B6G D;  4JJN C;  5AV5 A;  2CV5 B;  2F8N D;  1BH9 B;  3AZJ D;  1M18 C;  2BYM A;  3AZG A;  5DNM C;  1M19 A;  1N1J B;  4H9S C;  2YFV B;  1S32 C;  4JJN D;  4NE3 A;  3MGS B;  2ZM5 A;  1M1A B;  1M18 D;  4E45 A;  1S32 D;  3AZM B;  5BO0 A;  3C1B C;  1P3B A;  1HQ3 A;  3AZL C;  1KX5 C;  5AV6 D;  2NQB D;  5BNV B;  1EQZ B;  1WWS A;  1BH8 B;  3C1B D;  3C1C A;  5GT3 B;  3AZL D;  1P3L A;  1KX5 D;  3FDD A;  4KUD C;  4KHA A;  1TZY A;  3NQU B;  3A6N C;  3REJ B;  2NZD A;  2ARO C;  1P3K B;  1P3G A;  5B32 G;  4YS3 C;  3VH6 W;  5CP6 A;  2BYK B;  4J8W B;  4H9Q A;  1P3I A;  2FJ7 B;  4KGC B;  4KUD D;  2Y2K A;  4Z66 C;  5DNM B;  1KX4 C;  3A6N D;  4X23 C;  5GXQ B;  2ARO D;  4YS3 D;  2YFW A;  3VH5 W;  5B0Z A;  3LJA B;  1U35 A;  4Z66 D;  1KX4 D;  4LD9 B;  2PYO A;  4X23 D;  3MGP D;  3W98 A;  2BYM B;  5AVB B;  1M19 B;  3B0C W;  3REI A;  4YM6 C;  1AOI C;  3KWQ B;  3AZF C;  3WKJ A;  3A1K A;  5BO0 B;  5CHL B;  3UTB A;  3H0M C;  1HQ3 B;  4YM6 D;  1AOI D;  5AVC A;  5GT0 C;  3AZF D;  3AZE A;  3C1C B;  3WTP A;  3KUY A;  1JFI A;  5B33 C;  3WA9 C;  3REK C;  5GT0 D;  3AV2 C;  5CPI A;  2JCH A;  1TZY B;  1BFM A;  5CPK A;  4J8U A;  3UTA C;  1P3G B;  3REK D;  3WA9 D;  5CP6 B;  4J8V C;  1P3P C;  4ZBJ C;  4Z2M G;  4H9P A;  5G49 A;  3MVD B;  2LY8 A;  3UTA D;  2YFW B;  5JA4 B;  1ZLA B;  4ZUX A;  4J8V D;  5B0Z B;  2VQR A;  4EO5 C;  1U35 B;  1P3P D;  1P3F B;  3LEL C;  2PYO B;  2HIO B;  3W99 B;  4R8P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...