3X1WA

Ras-related protein rap1b with gdp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
167
structure length
167
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and conformational switching of Rap1B
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Ras-related protein Rap-1b
total genus 60
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x1wA00
4TLEA 4DRZA 5DE3A 4DKXA 2R44A 3RC3A 2GBLA 2ZRFA 3FKSA 3OE7D 3W90A 1NSFA 4Q18A 4W7SA 5CJ2A 1E1RD 2Q9BA 2YJTD 3K0AA 2J0UA 2F3TA 2CE2X 1X6VA 2D62A 1ETUA 2JASA 3SHFA 3M6AA 4UNRA 3EAQA 1IN6A 4LX0A 1N5IA 4NCIA 2BCJQ 3D8BA 1E1QD 2ZI3A 1IM2A 1LNZA 3AP2A 3RRNA 1FPMA 1T5LA 2VRWA 5AJWA 1TADA 3THYA 5FOSA 5KNBA 1YZLA 4K8OA 1KI8A 4MRRA 4F4IA 4R71A 3E70C 4OJKA 5EUQB 2UVQA 1XU4A 2O52A 8OHMA 4GNKA 5KUTA 3T35A 4M9ZA 3GPLA 2FPLA 1UKEA 3DKPA 4AYXA 3L0PA 4TL7A 5J40A 1XJQA 4DWJA 2AFIE 4LHVA 5JFGA 1KOFA 2BV3A 1E98A 1Q1QA 4LPKA 4TTQA 2ORWA 1KZ7B 3KB2A 2NG1A 4ZCIA 4AKEA 1US8A 3RDPA 2FV8A 1YZTA 2XJ9A 1OYWA 1M34E 1S9HA 2XZPA 3SJZA 4B33A 3B1VA 4N0EA 2WIBA 3WRXC 2XOKD 1ZD1A 1T3LA 2C04A 5FL3A 2HV8A 2R6CA 2GWHA 2JIZD 4A0HA 4BLPA 1KAGA 2UZ3A 3FMIA 5F9FA 2J46A 5LD2B 3CX6A 4IDNA 3M0EA 3TH5A 1M1YE 5DISB 2NQ2C 1HE1C 4JSYA 4WBSA 3U3OA 2C98A 2E1RA 4C30A 3AUXA 2WTUA 3KJGA 2P5SA 1QHXA 4B34A 1ZMXA 3A4MA 3IPXA 1IJEA 5EXPA 2ZI5A 3JVVA 4A6PA 4HAZA 2PT7A 4MRSA 2QE7A 5DHAA 1JR3D 2NO9A 2Q9AA 2W58A 3LD9A 5B58C 4V0NA 2ZS9A 3IGFA 3A58B 1KJZA 3DL0A 2OSBA 1G9XA 3W3AA 4XVQA 2VF8A 2QUZA 3ZZUA 2WBLC 3D6TB 3RS5A 2OCYC 4HI0E 3JZMA 4IXNA 1WBBA 5JJKA 2GXSA 1E2LA 3CONA 3CH4B 4B3BA 5JZVA 1NY6A 2P0EA 1GTVA 2C5LA 3F5FA 3AKYA 3VNUA 1E6CA 2JGNA 1G17A 2I1QA 1KK1A 5EZ6B 4ESHA 1CTQA 3ICEA 1EFTA 3ZS9A 1VCOA 1SXJA 3MFYA 1Q1BA 4UNPA 1H65A 4Q66C 1RVDA 5HPYB 1QBKC 4C7OB 1KGDA 4P3YA 4KFTA 1EWRA 2H8KA 2W6JA 2ZJYA 4GP7A 3AKCA 5FPYA 4AD8A 1JPNA 1Q21A 2QEQA 2XNDA 4NONA 1KK0A 3TR5A 2R8RA 4PSKA 2AWOA 4H1UA 1LY1A 3ZIAA 4DLZA 1FTNA 1W5SA 1KSGA 4DBLC 2OLJA 4M9QA 3NBZC 4LJ9A 3IHLA 3EPKA 2J7PD 3VR4A 2FSHA 2XXAB 4LSGA 2WPDD 4ZIRB 4N0DA 1N0UA 1CJMA 3GLGA 4Q9LA 1S8FA 1ZCBA 1O87A 4BQSA 3ZD6A 2J1LA 4AY2A 1KDOA 3QEOA 1SKQA 4DXAA 4LJ7A 4EJSB 3BWDD 2X2EA 1P5ZB 1N6NA 4JVSB 4I81A 1FUUA 1ZU4A 4GOKA 4IOKA 4KBGA 4TT3D 2FNAA 5C46F 1GOTA 2OBNA 2EYUA 1RFLA 1XTKA 2GF9A 4KO8A 5L3QB 1DAEA 3BH6A 4KYUA 2YOFA 3QPUA 2GCNA 4CT4B 1TF7A 4R9UC 3QUSA 2EVWX 5IK2A 2IUUA 2XNDD 1JPJA 1JXMA 1UKVY 3H1TA 2A3RA 1T3HA 2GJ8A 3R20A 3OAAA 2D7CA 3MWJA 3UANA 4AWXA 1Q3TA 2BVNA 3C41J 3Q72A 3QVUA 1ZP6A 2F43B 1M8PA 2QP9X 1Z0FA 3I1FA 4RZXA 3CF0A 4MYHA 4W5WA 4HUTA 1JI0A 4P31A 3QXSA 4Q4AA 1KMQA 1GAJA 5FBVB 1MKYA 1U0LA 1Z29A 2RCNA 2ANCA 2R6AA 4RY2A 4UNQA 3F8TA 2QM8A 1LS1A 5EJEA 4EFNA 5FPTA 3SC3A 3QG1A 1D9XA 4MRVA 4D0LB 2VLIA 1YHNA 4X8MA 5EP3A 4IEIA 2EFHB 4UJ5A 5TY0A 3W6NA 4ZDJA 2R6GA 2JA1A 2ODWA 1Z6XA 4ZI3A 2OCAA 3IIJA 3LAWA 3OEHD 5BYKA 5JSZA 2IHYA 2AK2A 2OM2A 5IHPA 4M1KA 2V6JA 2KBFA 2ZAOA 4R2HA 4KLZA 4Q1FA 5IK2D 2F55A 3DM9B 1W0KA 1XD2A 2ONKA 5EP4A 3C15C 4ZCMA 2WICA 1E2NA 2D3WA 3A1TA 1XCMA 1FMLA 1CR1A 3SFVA 1TEVA 1II9A 1US8B 5B64A 3KKQA 3MGCA 2PX0A 1IY0A 1ZNWA 2QQ0A 1OKKA 3MCAA 5GJWC 4HAUA 4JLVA 4NYIQ 4CT5A 2WOJA 3O8BA 3OIYA 4DCTA 3QKSB 4LZZA 2Z0MA 1XXHB 5L3QA 1G3IA 2BJVA 3NWJA 1NVUQ 2HCJB 3L8ZA 3RS3A 1KDTA 1Z07A 1J2JA 3E5HA 2K5UA 1OFIA 3WMGA 3NH6A 1XJ0A 1GL7A 4QM7A 3BXZA 2AL7A 2IYXA 4HDOB 4LWZA 1G7TA 4B3GA 1CLUA 3QBVA 4HEJA 1X8LA 1PV4A 4G0NA 1XEXB 1YRAA 5JSZB 2F1JA 1P2VA 4B73A 3B13B 2RMKA 3TE6A 5EE9A 4B35A 4AG6A 1CIPA 4V02A 2AXPA 4DUGA 3THWB 2IX3A 3PUYA 1IY1A 3GMTA 3C14C 1BS1A 2CVFA 2EFDB 5L3VA 2EFCB 3BB1A 2LKDA 3MG9A 1RW4A 1KHTA 4Q4AB 5LB4A 3VR3A 4C0KA 1XBTA 1X8JA 3B60A 1HY3A 1ZW6A 4NCKA 1E1QA 3CZPA 3TW8B 2V4ZA 3ETLA 4US1R 1JR3A 3ZH9B 2ZYVX 4Q1BA 5FPKA 1F3OA 5J5CA 2QMUA 3VHLB 3OHMA 1G6HA 1NSTA 2CL7X 2DY1A 3MUFA 1LB1B 1W4CA 2EU8A 2WSMA 4TQ9A 2HDNB 4ZPXA 2HUPA 1KJYA 3EA5A 1COWD 3HR7A 3CIOA 4IKEA 3U5ZB 1RC8A 4YDSA 2G9NA 1G8HA 1G1MA 2VP9A 1EXMA 1WF3A 4JLOA 1H8HD 4CW7A 1VKJA 1LF5A 2WJVA 3MSXA 2ZUBA 3SOPA 4DDWA 1N6HA 4PC6A 1BYUA 3THWA 3Q9LA 1WP9A 3T5DA 2BEKA 1ONBA 1RZ3A 2GXQA 2HLDA 2QT1A 3AP3A 4II7A 2R9VA 4KFSA 1R6BX 1QHHA 3AVQA 5C4GB 1P2UA 1UDXA 2A2ZA 3AF1A 1SULA 3X1DA 3RSOA 5CIWA 3BGWA 4B32A 1Q57A 4BASA 1HUQA 3FPAA 4PO1A 1D8TA 1KO8A 2WJHA 2ZE5A 2WSSD 2KE5A 4LJAA 4BGDA 4PHGA 5L3SA 2OCBA 4MGKR 3IEVA 1OFTA 4RKFA 4BZXA 3MJRA 1N6LA 1RIFA 2IYRA 2ZRDA 4GI7A 2RGNC 4BFVA 1ZIPA 2REXB 2RGDA 1U9IC 2FU5C 4JJZA 4C0HA 4IVPA 3GJ7A 5AJZA 3CR7A 3N70A 3KDSE 1II8B 6Q21A 1YZNA 3A4NA 4DCUA 1XJCA 2V54A 3SFZA 2BHRA 2CLSA 2A5FA 3MAAC 2KWIA 2CXXA 1R5NA 1W2GA 2QTFA 1W46A 1KTVA 2PEZA 2P6UA 4QM6A 3QENA 1H8HA 5FPHA 1OFHA 3X1WA 4X8OA 2XB2A 3FHCB 2WHXA 2GZHA 2RGBA 1OXSC 2F9LA 2QRNA 4TLAA 2QQEA 1VCNA 1VHLA 1XTJA 5FR1A 2DFTA 1OE0A 3EARA 1OB5A 4V0MA 3BOSA 4LJ5A 2CCJA 1FFHA 3NDPA 1NY5A 4TL9A 2W6IA 2ZRKA 3K9NA 3L82B 2PMKA 3QXJA 3GLFE 3KQUA 2ZAMA 1VIAA 1E9RA 4Q9IA 1F6BA 1OYYA 1E32A 2EYQA 3W8RA 1E2FA 1II0A 3HDTA 1K5GA 2CNWD 3CNOA 5FFMA 5KYKA 1HQYE 2V7QD 4FIDA 1FP7A 1SXJB 1E2KA 1LF0A 3IPYA 2XJ4A 1A2KC 1TNDA 2PX3A 4PHFA 2C8VA 3WRYC 1ZM9A 1YRBA 4US2R 1OB2A 1X3SA 2Q3HA 1KI9A 4A1FA 1Q1ZA 4MKIA 4DUGD 1OH6A 3ZD7A 5G41A 2QAGA 3ZDQA 3CB4A 4MITA 5ANRB 2H7VA 3LWNA 3PV0A 2Q21A 4NYJR 3UK6A 5CM9C 4X8LA 5IF9A 2PZGA 4DEYA 2G0TA 2F1HA 2QA5A 3V4FA 3SNHA 4AI6A 2IUTA 1YQTA 1UM8A 2OBLA 1F5NA 3AVWA 2IWRA 1BMFA 1B0UA 1XMVA 3PIRA 2MSDB 1TU4A 3X1XA 3IO5A 2OEPA 1XMSA 3EZ6A 4IEEA 5CLLA 2BBOA 4B44A 4FWIB 1G16A 2FEMA 2OXCA 3UMFA 1GRQA 2G88A 3BB4A 3I5XA 4CYMA 4DLRA 1E0AA 1T0HB 4GBMA 3C8UA 2O8EB 4KSBA 4KJZA 4OHZA 4HDCA 1HEIA 1WXQA 1DAIA 5IRCD 4ZIRA 2NZ8A 3U44A 1R0XA 4OK3A 1ZC3A 3CNLA 2LWIA 2CDNA 1KYIA 1DBSA 4AC9A 3SYLA 2ODEA 2NZJA 1XPOA 1UFQA 5TVKA 4HAWA 3BS4A 3TAHA 1MOZA 2ZE6A 3K0AB 3W9YA 3W6PA 3U60B 2DWPA 4LBVA 2O0KA 4BRUA 2R6DA 1F2TA 1F48A 1NBMD 3CRVA 3GLIA 2JJ1D 1W4BA 4ILEA 4D80A 3FOZA 2JLUA 1XXHA 1QZXA 4TLCA 4DCNA 1G4UR 1AS3A 5F2EA 1YZQA 3TKLA 1KI7A 3I3SR 2H1LA 1PLLA 2ZRGA 1CR2A 4QOSA 1IXRC 1E0SA 1UEIA 3WMFA 3EZ2A 4N3NA 1AKYA 4C4PA 4JT4A 2ZANA 3PFIA 1SXJE 3PG5A 2YNMA 2IYQA 5FTJA 5UKDA 5BN5A 4ITRC 2QPTA 3L2OB 4R7ZA 2DFLA 1IQPA 4PAOA 4QBHA 3P4YA 5HE9A 3H2YA 3VR6A 3SEAA 821PA 4PPQA 3PUWA 1R8SA 1W4AA 2ZRJA 1UADA 1VG0B 5LBIA 4TYWA 4DCSA 2GJKA 1W5TA 4L8GA 4BFXA 1KI2A 1W0JA 2VP5A 2YWEA 2FOLA 4PHHA 2ERXA 2J0UB 5GJCA 2G77B 3SR0A 4AYWA 2C99A 4JLPA 2IS4A 2V3CC 1DE0A 3QSYA 2W83A 4DLSA 4EJSC 1XP8A 4ZCLA 3GLIE 3UPUA 3GJ8A 2Z43A 5J4HA 2VHUA 1DO2A 3N2EA 3N5CA 3BERA 3SJCA 2D2FA 2QZ4A 2TMKA 3ZYCA 4Q1AA 2IC5A 1AQYA 3AV0B 2YWGA 3T06B 2BCGY 1OIWA 1KI1A 1G20E 2FZ4A 1J8MF 5G3YA 4OBEA 3IBGA 4JLNA 1KAOA 4B71A 1FX0A 4G5QA 3AVXA 1QG2A 3QKSA 4LHXA 4QL3A 1JQLB 3IIKA 2XX3A 4PC1A 2KSQA 2G1JA 2QI9C 4QG7A 3T1VA 1U8AA 4TQAA 4B3XA 2VL7A 4EQ6B 1LFDB 4KHZA 2HEIA 4AKHA 3R7WB 1DAGA 1DS6A 2ONJA 1RE0A 1Y3AA 1ZNXA 4Q7LA 3B1ZA 1IN5A 4YMVA 2RB4A 4PSVA 2FPMA 4A2WA 2HCBA 2JJ1A 1U0HC 1GSIA 1E94E 1JNYA 3K53A 2VHJA 3U7EB 4EPRA 2GETA 1S0UA 3ZQ6A 2OFXA 5J4YA 3GJ3A 1CULC 3EIHA 1D9ZA 2J9RA 5H1YA 5FUWA 4ARZA 3GFTA 4DT1A 1Z28A 3LXXA 3K70B 1L8QA 1Z6TA 4AURA 4BFWA 1CF4A 1RJ9A 1FOEB 3CPJB 3FMPB 1ZUNB 1A4RA 4C7OA 4MDFA 2GEDA 4LRWA 2ATXA 3FDIA 2ORVA 1G5PA 3BK7A 4AIIA 2ZJBA 5EE1A 4Z51A 5J47A 2A5YB 2WWIA 3RVBA 4JYBA 3QKRB 3SBDA 4C0JA 5BN4A 4CGZA 1M74A 4PPNA 5CYOA 1Z0DA 4D4JA 4TT3A 2BJWA 1G18A 2V9PA 4U5XA 1YR8A 1AA9A 3CUEF 2XZOA 4A36A 3B1WA 2B6HA 1E0KA 2ZVQX 2ZRLA 4Y0VA 5HKKA 2IF0A 4EAQA 3NBYC 4DLXA 1CR0A 4HB2A 1L4UA 1PUIA 2GVDC 3WBJA 1CP2A 2GVZC 3R8CA 4CEIB 2D7DA 2ZI9A 4A2PA 1IONA 3UMSA 2OFWA 4UXIA 2FSGA 2D74A 4KAXA 2GESA 2J0QA 3MJHA 3Q3JB 4HLUA 2BM1A 1G8FA 1I2MA 3KUDA 3W5IA 1MT0A 4UJ3A 4Q9KA 4XWAA 4NH0A 5E4FA 3RANA 2R6FA 4LJYA 2PZEA 4RFVA 1Q0UA 3QF4A 4D82A 3IUYA 2O8EA 2CBZA 4TMXA 1T91A 1OKKD 3BRWD 4LC1A 4BWYA 5JS8A 4MH0R 4OI2A 1GFIA 4WIAA 4DVGA 2FF7A 5JWHA 3GLHA 3NG1A 4H1VA 4HZUB 5EE5B 1NI3A 1GILA 4P32A 3I4LA 2FE4A 2JLZA 2AHOA 1YZKA 1E9DA 3P26A 3PUVA 4QJ4A 4O2RA 1AJEA 1RKBA 1WMSA 4G5OA 1FMJA 3GJXC 4C0AC 5EXXA 4J0QA 4RZ3A 4A0GA 4P4SB 3KJIA 5B2ZA 3DOEA 1BH2A 1XMIA 3B85A 3AVUA 2GJ9A 3CZQA 1D5CA 2BMFA 1TX4B 1HURA 3K09A 4JYCA 4US0R 3QE0A 1P9NA 3EZ9A 2Q6TA 4E22A 1NN3A 3RWOA 5JWOA 1SKYE 3HWSA 4AKIA 2BBSA 5P21A 1VG9B 3AVVA 4IDPA 2JJ2D 4EDHA 3RS7A 3R9XA 1P9WA 5FBLB 2IXGA 3LW7A 4V0KA 1TPZA 1T6NA 4XWOA 1NVWQ 1XMJA 2YVUA 2GAAA 1P2SA 1N6OA 2YZ2A 2OBMA 1AS2A 4I1VA 1SVIA 3J81k 3AF3A 1N6IA 4PPFA 2VSFA 2EWVA 1HE8B 4TLBA 2CL6X 2AR7A 2P5TB 3ND8A 4QC2A 3R9IA 4BFZA 1G6OA 4ERNA 4XTRA 2RGGA 4RJLA 3AEZA 5D3MB 4GT1A 4NTZA 2H57A 3HU2A 5B57C 2REOA 3SS8A 4TYQA 1UAAA 3NDBB 2X8AA 4Q00A 5FI0B 2UKDA 1OIVA 5EE3A 1NN1A 1S4QA 3LX8A 2XAUA 2Y8EA 4BFUA 1JBKA 1D2MA 1E9CA 1OHHD 4LHWA 3KKOA 3AUYA 1YVDA 3HR8A 3OIWA 2V1XA 3WHKA 4U00A 1K6MA 3RRMA 4MDEA 2FMXA 5TB5A 1R5BA 5AUQA 4D6PA 4EPXA 1G41A 3D3QA 1N5LA 3U3KA 2WM9B 5DI9A 3O8CA 4QBFA 2ZRMA 2J5XA 2CEAA 2ZUDA 1D6JA 3I72A 3N2IA 4FMDB 1NLZA 5AR1A 1P9RA 3UATA 1IHUA 4PQYA 1NLFA 1MRNA 4P0TA 4L9SA 5DI3B 1CJUC 2EFEB 1G7CA 4BPBA 3BB3A 4TTPA 2Q3FA 3H0KA 1FNNA 1SVLA 3OEEA 3OEED 5DGXA 4NHOA 1XEWY 1GNQA 2IYZA 3OZXA 1OW3B 1MO4A 2B7CA 2ZJZA 4K46A 4NMMA 5F3WB 1MR3F 1UKZA 4B3DA 1XRJA 4C0QC 4OYHA 1U99A 5DN6D 1A82A 3NKVA 4KLNA 1G21E 1TQ4A 1WQ1R 1NIJA 4KI0A 5G3ZA 4Q7JB 421PA 3I32A 1EWQA 4FW9A 4OK6A 5CK5A 2VO1A 3AF0A 3KX2A 1P60A 3A1SA 4XH9B 1R0YA 2MSCB 2KBEA 2FFHA 4IDOA 1DG1G 2QSZA 4PSAA 3S1AA 1J8YF 2A7QA 1AGRA 5JEEA 2ZSAA 3FB4A 3A1UA 3BD9A 4MKFA 4WOPA 2WMOB 3EWSA 4IHQA 4OQNA 5HCIA 4GZMA 3KQLA 2FWRA 4GZLA 1W44A 2PMDA 2ZSDA 4BECA 5J4KA 2RGAA 2XOKA 4LBWA 4NE2A 5JBQA 3P32A 3QBTA 1KIMA 3BFVA 2ZETA 3LXRA 3B2EA 2OAQ1 4Z8XA 3SHWA 3FWYA 3KUCA 2BBWA 1VECA 3CKLA 1FTSA 2V8OA 4CEHA 2O0HA 2ZXUA 1DO0A 2GZDA 2WV9A 1Z47A 1RYHA 2V7QA 1Z6GA 1KK2A 1KJWA 3ASZA 3QOFA 2CNWA 1P2TA 1W48A 3BJIC 2IXEA 3MWYW 3SBEA 3PUZA 2IYLD 5IT5A 3R9WA 1GRNA 4DDVA 4EPYA 3SI7A 4KSCA 4Q4JB 3IHWA 4I99A 5FI1B 3U7GA 1AQUA 1YR7A 2ZPTX 3L43A 3F0TA 1T8UA 2CL0X 2VP6A 3VX4A 1A2BA 1GVNB 2FN4A 4CZ2A 2QNRA 3V00A 5JJLA 2WWXA 1R0WA 3B5JA 4G01B 1S2MA 3F3YA 1P61B 5CB8A 2QY9A 3U7FB 4OJQA 4V0OA 4QGAA 2QENA 3QVVA 3RWMB 4M0LA 3THYB 1Z5ZA 2J0VA 2JJ8A 4KV9A 4URYR 4O3MA 1KNXA 3ZLJA 1XD2B 4FMCB 3O8RA 4QGFA 1OHHA 3P20A 3EZFA 1YR6A 1ZBDA 4O0MA 3OE7A 2GNOA 4M9XA 1KKLA 1XPRA 2W6ID 3B6EA 3SJAA 3VU9A 1WDTA 3HP1A 1J7KA 3VR2A 4UNSA 3KB1A 2PZFA 2BC9A 2HYIC 2J7PA 3WYFA 3SU8A 1D2EA 3WYGA 3DEFA 1LS6A 3C5CA 4L16A 2WJGA 3CNNA 3CRMA 3SE0A 3AVYA 3SYNA 2N1BA 4FXPA 2CJWB 2I3BA 3AKDA 1C4OA 3THXA 4G3XA 5AUNB 2RGEA 1KO4A 3VFDA 1UPTA 1Z83A 3OF5A 4D0NA 1W1WA 3IBYA 1W36B 3C5HA 4ZI2A 4U7DA 1TTTA 4GRAA 2IUSA 3B9QA 4OHXA 3REGA 1VTKA 3TUJC 2FJUA 5DH9A 5KDLA 3W6OA 1AZSC 5FR2A 3EPLA 4YMSA 4PPGA 1G3UA 1GNPA 3EC2A 1ZJ6A 2ERYA 2VIIA 2ZS8A 4S2EA 1BIFA 3UWKA 1CR4A 3PVSA 5DLQC 1B23P 3FHTA 4YMTA 4JLJA 2WWFA 1E99A 4TN1A 1EFRD 4Q4LA 1TQ2A 5CIQA 3TIFA 4KITB 1O3YA 1KMHB 3GEEA 3OESA 4GMDA 4NKRA 5E95A 1E9BA 1KNQA 3CWZA 3K70C 3B7GA 4TYPA 4TMZA 2ZITA 2XXAA 3AF4A 2KI5A 2KB0A 3L8YA 4LCBA 4B48A 5CM8B 3OEHA 3TSOA 4QNMA 5DN6A 1MO3A 1XDBA 1ZM4A 1ZM7A 1MABB 1WB9A 5FOXA 4A8JA 3HU1A 2NGRA 4MGYR 3K0CA 5FUXA 5A4JA 5SZIA 1DARA 3DKVA 3NHAA 4PAMA 5SZHB 1TUIA 2JLVA 4KCGA 3KQNA 3SQXA 4LYFA 1J70A 5HZKA 4CEJB 5AWFC 2YWHA 2ANBA 4E5UA 1AIPA 4HB0A 1VYUA 1OH7A 3NBFA 4JIMA 4JBYA 3RYTC 3OAAD 2MMCA 4L4UA 4MGIR 1XX6A 2QAJA 2W2XA 1QRAA 4JVNA 4ACAA 1P75A 3CW2A 2PLFA 4CVNA 5GADl 2YC4C 4D25A 1T3SA 2BEJA 4WVFA 4GSYA 5SZJA 1KI4A 3QIAA 4YXWD 2GBLC 3HYRA 4TSFA 5BW8A 1VCIA 3Q8XB 2WAYA 4BRWA 3NVAA 2GHIA 5DO9A 1Z6YA 2OILA 3OFNA 1F2UA 2X19A 4HLCA 1XPUA 3CRQA 1EFHA 1ZUIA 4MYUA 2A78A 2ZEJA 3PENA 2AN9A 2PLRA 1TF5A 1ZINA 1BO6A 1I2DA 3OIVA 5FOWA 2H16A 3VKHA 1N2CE 1ZNYA 2R62A 2ZROA 3KXKA 2ZREA 1NBME 1KSJA 5FL7A 1CJTC 4HAYA 2JCSA 2O8BA 3U4QA 2O8CB 5FBWB 3FFBA 3UG7A 2ZRBA 2VSOA 1HTWA 2O8DA 2R65A 3TBKA 3BFXA 2ZJAA 2C78A 3TMKA 2ZQ5A 1XTIA 2QGZA 2ZYUX 2AD1A 2JLYA 1P7CA 4LYAA 1GP2A 1Z0AA 2VP2A 2GK7A 3TGPA 1T4GA 1XTQA 1XNJA 2GRJA 4Q03A 3RNLA 5JCZA 4JL6A 3PR1A 2C9OA 2RH5A 2WOOA 1JJVA 3IKJA 1K5DA 3ZQJA 1U98A 2XSZA 2ZSEA 3WNCA 4QNRA 2DHRA 4QHTA 2OAP1 3NEJA 2RAPA 2YC2C 4G5SA 4CIDA 2ECKA 5HKKD 5TMPA 2LCFA 3GJ4A 1P72A 2WJIA 1G7SA 3VNVA 3GLHE 2H17A 3U6KA 2BIFA 2CHVA 2R2AA 2WJJA 2JLRA 4HLUC 2ZVPX 3DO6A 1W47A 4XJXA 3VKGA 5CLQA 3LQRA 1M2OB 2AK3A 1N3BA 1LV7A 2X2FA 4LHYA 3TVTA 4Q9JA 1NBMA 2JEOA 4XD7D 2F1IA 2YOGA 4B3CA 2V1UA 4CRWB 2XEXA 2YWFA 4IXMA 3SDZA 3THXB 1JXOA 3PEVA 2IF2A 4HUQB 5FOUA 4EFMA 3QJYA 2BMDA 2VHTA 3X1YA 1R10A 4HAXA 4MUBA 4DSTA 3CRW1 1TUEA 4HLDA 1SKYB 2QAGC 4JSTA 4URZR 2ZU6A 2WIAA 1YZUA 1W49A 5JJIA 1E4VA 1XZPA 4F91B 3K09C 4LDJA 1NN5A 1UBCA 2QN6A 2PT5A 3GLFB 1P3JA 1ZVQA 4DLUA 2DBYA 2NTYC 4KODA 3WNBA 3FHOA 2OHFA 4Q1EA 4FI3C 4Q1DA 1NVVQ 2RGXA 1ZUHA 2V55B 1DEKA 5JRJA 1FP6A 4C9BA 2WVJA 1SXJD 2G3YA 2QG6A 1NN0A 4M1SA 5DSZA 1VG8A 2F1RA 1JJ7A 5KSYA 1HT1E 4IDQA 4OI1A 1SZPA 2XITA 4OKSA 4IOJA 4DSOA 3ZZTA 3HPQA 4NBSA 4XVUA 2EW1A 3TVDA 4D2IA 3KFXA 1G7RA 2NPIA 3G82C 1I4DD 2BWJA 2G83A 3H84A 4TMWA 4FWTA 4OHYA 4R98A 1SVKA 3DZDA 1V5WA 3NH9A 1G8GA 4RD6A 3Q85A 2CK3A 4Q4HA 2H5EA 2UZIR 1Q12A 3LBIA 3PJRA 2OT3B 2QBYB 3KKMA 4ZKEA 2O8CA 1AM4D 1Z3IX 1Z2AA 3GCGA 3LW8A 4KFRA 1Q22A 2JATA 2GCOB 4PC3A 3U6BA 4RZ2A 1SVMA 4LJ8A 3TQFA 3C4JA 2OZEA 2QORA 3TSWA 1OLOA 4JVMA 2YHSA 2IWHA 1KMHA 4DIEA 2NMVA 4GDFA 3FFAA 5JCPA 4M9SA 4WXPA 5JI2E 3FGNA 4CDGA 5KU1A 4KVGA 4QJ5A 2HF9A 1P73A 1G4AE 4GOXA 2WMNB 2AD5A 3BIFA 3H86A 4RCZA 1EFCA 2MSEB 2XTZA 5AUOB 2ATVA 4IOLA 2NO1A 3TUZC 5AUPB 2OE2A 4JMPA 4IOMA 4NL4H 3W8NA 1E4YA 5GVSA 5H8WA 3EZ7A 1ZRHA 2RGNA 2ZUCA 1LVGA 2ZJ8A 4F93B 3RS0A 1RRGA 2QSYA 3KJHA 3PQCA 2RHMA 1YR9A 2W00A 3GD7A 521PA 2ZR7A 4BLSA 3TRFA 4HLQB 2BOVA 3NXSA 4W5JA 3U3RA 3A6PC 1G5RA 3TUIC 4NDZA 1RRCA 1ANKA 1DG3A 2EFGA 4LJ6A 1R0ZA 1YZGA 1KO7A 4FMCF 4RFSA 1CS4C 1GZSA 2JLWA 2W0MA 1HH4A 2D06A 5SZKB 3LH5A 1TQ6A 2HJGA 3UWOA 4XTCS 4O2LA 5JWRA 2DB3A 5GJBA 2QTHA 3PEUA 5C18A 4Q48A 1SVOA 1J90A 4UKDA 1NMYA 2ZE7A 1U90A 1TMKA 4C0LA 3TR0A 1S9DA 3LLMA 2FGKA 1U81A 2J41A 3AB3A 4PO8A 4ZDIA 4XWKA 4JBWA 5E7MA 1SVWA 5HR5A 1BMFD 3WXMA 3K0SA 2J87A 2OXRA 3CLVA 1XXHE 4DC9A 2YV5A 4JKYA 2NOAA 4FMDF 5CK4A 1S3SA 4LV8B 5KPDA 2QTVB 2CLCX 1E2IA 4PC2A 4OI4A 2AXNA 1IN8A 1M6NA 2G1KA 2ZRNA 3UKDA 2EWWA 2HXYA 1GWNA 3EIEA 3ZVMA 2IYWA 1E2JA 4B2IA 4P4UA 4QFMA 2PCLA 5KSZA 4QKQA 4JLBA 2CVHA 3H4MA 4L9WA 1FL9A 3W34A 1C1YA 2FFAA 3K9GA 3GEIA 1E9EA 1P4SA 1WBDA 2ZSFA 2O8BB 4IW3B 1UBFA 1VCMA 4GMXA 1KDPA 1NVVR 5DNYB 1IOZA 1JECA 4PQRA 3THOA 1EX7A 1QHSA 1SGWA 1YE8A 4PHTA 4BLQA 3NBXX 4JLAA 3CPEA 2GJAA 4FCWA 4V03A 4WW0A 1QHHB 1IXZA 5L3RA 2ZRHA 1OH5A 3EXAA 3EWAA 4UXHA 4URVR 2C03A 2J59A 4N1AA 5HZHA 3ZS8A 3JVUA 1Z08A 1R7RA 3LDAA 3LY5A 4LC0A 3W3ZB 1CXZA 4UXJA 3T12A 1N0VC 2VP0A 3A36A 5CITA 1JR6A 2LKCA 4HYYA 1S96A 3C16C 4RKEA 4X8HA 4DDUA 1Z06A 5DYIA 1ZM2A 5CDFE 3ADDA 4IFBA 3DZ8A 1WRBA 5CB6A 2ZI4A 5G40A 2W6JD 3ZVNA 2GEVA 2A5GA 3I5YA 3B1YA 1I4TD 3I62A 4PFSA 4KFUA 5C2JB 3A8TA 2VF7A 3EW9A 1OSNA 4EPVA 1IJFA 1XD8A 2C77A 1M7BA 1CJKC 1VMAA 5BQ5A 4MKGA 2E87A 1YU9A 4XD7A 4NZYA 1ZAKA 3KTAB 3GLFA 3Q7PA 3QXHA 2AKAB 4JZKA 4F38A 4M53A 1S1CA 2KJQA 5KSPA 4IDHA 1E9SA 1E3MA 4HDQB 5CJPA 2REBA 4KXFB 3TJZA 4DCVA 1A5TA 4V0ME 3BE4A 5GVRA 5C4MA 3BH7A 4ZO4A 3GFPA 4A8JB 1MABA 1RJ9B 3NC1C 3B82A 5JHGB 1KO5A 1NIPA 3MMPA 5B30A 4Q9HA 4A92A 4Q4HB 3ASYA 5KHOC 3OIUA 4JKIA 1X1RA 5M04A 1QHYA 1OFUX 2QMEA 4IRUB 4WZBE 3KQHA 3LNCA 2GAOA 2ZYTX 1G8PA 3AP1A 4PTLA 2CCGA 1PLKA 3FVQA 2QMHA 221PA 2JDID 2DYKA 3L0SA 4QXAA 4Q01A 1N6RA 1TQDA 3P27A 4TL6A 3K0CC 4FD2A 2CMKA 1KI6B 4F4CA 1E9AA 2O8FB 3R7WA 2PH1A 4B6FA 5BWMA 3AGPA 4YDHB 3B8HA 2YINC 3QF7A 3EC1A 1C9KA 2JAQA 2GEUA 4NCJA 4LOAA 3PEWA 1E2QA 4ESVA 3A4LA 5HCNA 3EA0A 1GUAA 2IS2A 1NJGA 1JB1A 5DYGA 1HYQA 2DFKB 4H9GA 2FZLA 2J45A 3GLGE 5FTLA 1XCPA 1XZQA 4Y0AA 3Q5DA 1UKYA 4PZLA 5DIFA 1X86B 1JQJC 1SQ5A 2OV2A 3LBHA 2QP3A 4LJ4A 4L15A 3OFND 4A8JC 4C3ZA 3PITA 3GEHA 2ODNA 3JZAA 4XIGS 1S1MA 1DVRA 3PXGA 1E96A 2J7KA 121PA 3FMOB 2W2TA 1GDDA 1DAKA 3AGQA 2N46A 2OFOA 3LV8A 5G53C 4DDTA 3REFA 2PEYA 4B43A 2OLKA 4XSGA 2IHBA 4JL5A 3HJNA 1NP6A 3K70D 1F2UB 4XOIA 4EPTA 2ZJ2A 2GDJA 4E07A 2A30A 3CBQA 2D4HA 4JLMA 4ZDKA 2ZJ5A 2FFBA 1KSHA 4RD2A 4G5GA 3RS2A 5EE0A 5ELXA 1AS0A 1IXSB 2F7SA 5H68A 3NTUA 3TW4A 1YJ5A 4M1MA 4A15A 3DDCA 1ZM3A 1E2MA 2P2LA 4DEXA 1GKUB 2VA8A 1LW7A 2ZRIA 1OT3A 3IO3A 4MRPA 1W36C 3K9LA 2QROA 4Q47A 1FZQA 1PVOA 3ONWA 5CYPA 4C2UA 2ORIA 1II8A 2OCPA 3MD0A 1QHIA 2WKQA 4I4LA 5FTKA 1MO5A 1NKSA 4DIDA 4OHVA 4A0FA 5LD2C 2IW3A 1CRPA 2CLDX 4DSNA 1DELA 2PJRA 4RZUA 2ZI6A 1NMZA 3U2QA 1GITA 1RRPA 1ZNZA 2CK3D 3GLHB 1GL6A 2O8DB 4HUQA 1E2EA 4MKHA 3DMDA 2SHKA 4GP6A 1G3MA 1OPXA 4I1SA 5FTNA 4C0BA 1G8YA 3IIMA 4M1TA 5JLJA 1U8YA 2B7BA 1SXJC 1EFUA 3DMNA 1SHZA 3G5UA 1M7HA 1FUKA 2FX3A 4E09A 4W5HA 2QL6A 2VBCA 3CF2A 4XVRA 3KTAA 3VR5A 4B75A 4EPWA 4DZZA 3T1TA 4D4KA 2IEZA 1RYFA 3T61A 5F98A 2ZS7A 2BMEA 3TNFA 2A5DA 4PZYA 3IQWA 4AG5A 4ABYA 4KBFA 4UQOA 2RKOA 3BORA 5KNCA 4LYHA 3FKQA 1Z0IA 2FG5A 1N6PA 2PBRA 1QHGA 1ODFA 3AVOA 3C7KA 4IVQA 4JS0A 4KYIB 2VP4A 4M22A 5JRZA 5A0FA 2Z5FA 1W2HA 3QKUA 4PQFA 5FOVA 1P6XA 2A5JA 4LPSA 4B2LA 4MUAA 3CR8A 4EKDA 4JVLA 3DPUA 1TAGA 1P62B 2IK8A 2HJVA 2ZR9A 5JHHB 1COWA 2NIPA 3NIBA 3SZRA 4P4SA 1HT2E 1VYVA 621PA 2GZAA 3SYKA 4D81A 1CKEA 2GXAA 4CEJA 4V0LA 4D4LA 2IYSA 3CX7A 3EG5A 1CRQA 3P1JA 3LO5A 2ASEA 4M4SA 2CHQA 4MYTA 3VR1A 1XCGB 3DOFA 1UBEA 3WBKA 3WNDA 5K8TA 3K8YA 1G3QA 1U8ZA 1V43A 3GJ0A 3O8DA 4NCNA 2P65A 1PUJA 1AK2A 3LLUA 4OQXA 2JLSA 1E69A 2GKSA 3QPVA 1QHNA 1T5IA 2CHGA 1Q44A 3K0EA 3TLXA 1H8ED 2IEYA 2Z4SA 2WWYA 1LTQA 1E0JA 1XB2A 2Z6VA 2P67A 5KOYA 3CM0A 5TXGA 4QHSA 2JDIA 2ZYWX 3WP0A 3HPRA 1DAMA 4LY6A 1QF9A 5EXTA 3RRZA 4PX9A 3ZZ0A 1KY2A 4R2IA 5FTMA 4OI0A 2C96A 4TMTA 2Z4RA 3B78A 3X2SA 4F7WA 2X77A 3Q5EA 1KI6A 4NYIR 4DHEA 1HV8A 2C9CA 4Z1MD 2NO6A 2AKYA 2F3RA 2N42A 3VTKA 1FX0B 2ZRPA 2J3EA 1N5JA 2QAGB 1TU3A 1A7JA 1Q20A 1XEFA 2QE7D 3IQXA 1NJFA 1UJ2A 4KVAA 5FL7D 5K8LA 1D2NA 3I92A 5BN3A 4B6EA 5L3SB 3U4QB 3BFKA 4OQLA 3AM1A 4MRNA 3WMEA 4Q19A 2CE7A 3VMFA 4TWZA 4I1OA 4B74A 2HXSA 1DADA 2Q0HA 3M4YA 4Q02A 4MYCA 1J99A 3R8FA 4G5RA 1JALA 4RCYA 1AGPA 2O5VA 3I73A 3FYHA 5L8VA 4A4DA 3WYAA 2NPFA 3GJ6A 2Z83A 4A6XA 3LBNA 4RD3A 2WKPA 5KO2A 2VEDA 1QG4A 4GPTA 5JS7A 3U3JA 4ZV4A 5LPNA 3GJ5A 3I61A 5HE8A 1XD9A 2Q9CA 3AKEA 1X8KA 4P33A 4Z1MA 1PJRA 1MV5A 4OQFA 4A2QA 1FQKA 3ZGXA 1JEDA 3WHLA 1NKTA 4ON9A 2HYDA 3ZVLA 3NHBA 4GOJA 3M1IA 2YOHA 2QGNA 3I8XA 1SHKA 1G3RA 4YMUA 1GNRA 3P4XA 4PXAA 4HAVA 4PC7A 1OJLA 3A1VA 3CRRA 2BBTA 4D26A 5FBQB 3VHXA 4U02A 1G64A 1KZGB 2CCKA 3BAFA 4BE7B 2EQBA 5KTYA 4B3FX 3EPHA 3BBPA 3DVLA 1A1VA 1GG2A 4TMKA 1W7AA 5EUMA 1GRRA 1L2TA 4TL8A 1H8EA 1NF3A 1E79D 1VPLA 3FTQA 1DPFA 3CH5A 2VHCA 1QVRA 3RSLA 5BYJA 2HT6A 4QBGB 4O25A 1OH8A 3QXXA 2DPXA 1YKSA 1Z0JA 3CPHA 2W2VA 1FQJA 3ND9A 5AK0A 2HT1A 1R2QA 1R8QA 3QF4B 3T5GA 1G5TA 1IN7A 2FA9A 3U44B 4A0RA 4BFSA 2WAXA 4OQMA 2IS1A 1E2HA 3D7MA 2ZRAA 1OXXK 1IAQA 5EQTA 1R4AA 3BC1A 3QG5A 3T1OA 2DCUA 4JLDA 3KXIA 4PANA 4QRHA 1E2DA 2PJZA 1NVXQ 2IL1A 2L0XA 3GFOA 4LGMA 3LFUA 3KKNA 5JECA 3ZIAD 2ZJOA 3SQWA 3EPJA 1Z0KA 2FSFA 1KI3A 1JAIA 4EUNA 721PA 2IYUA 4URUR 4K81B 3RAPR 3X1ZA 4WXRA 3LVQE 3GP8A 1IBRA 2GILA 2PL3A 3QKTA 4WZAE 5J4LA 2IS6A 1GKIA 1OF1A 4LK2A 1E9FA 2QBYA 2ODBA 3Q7QA 2B8WA 2BM0A 4BZQA 4TZ6A 4TSFD 5BXQC 2GK6A 1UDWA 4NP6A 2IA5A 4QGHA 2XNSA 1Z22A 4TZ0A 2P3SA 2GA8A 4QJ3A 1IN4A 3LQQA 1JEEA 2GCPA 4BLRA 1W36D 4BEJA 4OHWA 2ZR0A 2AWNA 2RHDA 1GL9B 2X1VA 3CX8A 4RFSB 3UIEA 5LDDC 4C0SA 4FCVA 1Z63A 2E9SA 1Q1EA 1T8TA 4PAQA 2GJSA 4MA4A 4BLOA 4MQBA 5D3QA 1OV4A 1XTRA 3MRSA 4EFLA 3TK1A 2BKUA 5DI3A 1ZIOA 4L5BA 3RRYA 2ZM5A 3VX3A 1NLYA 4NYJQ 2FDCA 3ADBA 4P4TA 1NL3A 4RVCA 1MO6A 2YKGA 2WWHA 3PCRB 1E1RA 3QXCA 2BMJA 3W5JA 2I1VB 3KKPA 1NRJB 3A1WA 2XZLA 3SN6A 4AK9A 1ESMA 2BKEA 5AJVB 3CWQA 4BLTA 1S3GA 5KNDA 1UEJA 4M8NE 2HF8A 2O8FA 2JLXA 1OIXA 3NEYA 3UG6A 2ZI7A 1F60A 3KXLA 4HSEA 4M2LA 2QPOA 4POAA 5H70A 3QEJA 3V4RA 2WZQA 2G6BA 1ZYUA 2H92A 2OG2A 2VH5R 3CO5A 4M1YA 4NPHA 5A5GA 1UBGA 3MWLA 2OESA 3K0FB 3NC0C 4D0GA 2AFHE 2WKRA 3K1JA 2RGCA 3LRPA 3PUXA 1HQCA 4XSHA 4Q4JA 3IDQA 3KFVA 3QI2A 2FSIA 4DB2A 4DLWA 2C95A 3QQ5A 3ECCA 5FOTA 2VHQA 3D31A 2IXFA 3AVTA 1VG1A 4LBZA 4HB4A 3K9HA 4Q5IA 5TDHA 1ELOA 3T15A 5LB2A 3QY0A 2XTMA 2QPAA 4DJTA 2QM7A 4PO9A 1IY2A 2PCJA 2VYFA 3GLGB 4JBXA 3AVPA 1U0JA 1CJVC 1DTSA 2F9MA 4F4JA 1KY3A 2DFNA 4KU4A 3U61B 5E7IA 4QHYA 1CU1A 5JEDA 2B21A 1EX6A 3KJEA 5EP1A 3GQBA 2GXUA 4FMBB 1TF2A 1E2PA 4CF7A 1NG1A 1ZD9A 2IYVA 4IFEA 5FH9A 4IJMA 4OL0A 2W0SA 1G291 1N25A 3L0OA 5KPJA 5J4VA 1ESNA 3V9PA 1DAFA 1Z2CA 1JR3E 3S1AB 2QT0A 3IEUA 3KZ1E 2VTKA 3ADKA 1W0JD 4DLVA 3A37A 3G0HA 4BUJA 5JI3E 4ZKDA 2WJYA 1SVSA 4C2TA 1E2GA 3RC8A 2XGJA 4YMWA 3RLFA 2P6NA 1QVAA 1UF9A 3DHWC 4ACBA 3GLIB 1EESA 1AKEA 1Z8FA 1K8RA 4Q21A 4A82A 1R5OA 4B47A 1N6KA 3CF6R 2B92A 1E79A 1WA5A 4LV5B 2FFQA 2C9YA 1BYIA 4JLKA 4EJSA 5TARA 1EFRA 4BFTA 1PZNA 4B2PA 3MWKA 3VU9B 2IYTA 3U3MA 5EXSA 4Z8YA 5F9HA 3ADCA 1WE2A 3MLEA 1PLJA 4OK5A 4URWR 4AYTA 4IVRA 4TLDA 1XEXA 3ZJYA 1T9HA 4ASUD 1AZTA 1N5KA 2O0JA 2XSZD 3RABA 1JAHA 2FH5B 2WSSA 3QPWA 4BZPA 4TYYA 2ZE8A 5EP2A 2OO7A 2FEOA 1OXUA 1VYTA 1ZU5A 3B9PA 1GKYA 4ZDWA 4NYMR 4DB4A 4EQ6A 3L0IB 1ZD8A 4NYMQ 4M1OA 4TTRA 3RS4A 3TAUA 2HLDD 4M1WA 1KDRA 1ZC4A 4DSUA 5HTKA 2I4IA 3T34A 3K0FA 3LVRE 3I8SA 5FBRB 4LV6A 2DWOA 3VAAA 5KSOA 1ZCAA 4DLTA 2WWWA 2XB4A 4B76A 4RD0A 1DAHA 1X1SA 4LUCA 4YONB 4HZUA 2IBMA 1EG7A 3LX5A 4RD1A 5K8UA 4QBIA 4TQUS 4PZZA 1CBUA 4G1UC 4RSGA 2NO0A 5CDFA 1N0WA 3QKRA 4RD4A 4TMVA 4NCHA 3ZVRA 1L4YA 2BDTA 1L7VC 3BH0A 1U94A 2V6IA 4YC7A 3VQTA 4CEHB 2QRZA 2B8TA 1CEEA 1Z6AA 1KK3A 2IYYA 2Q3MA 1XFAA 3KL4A 3ICQB 1VDZA 3O47A 2JLQA 3EASA 1NNEA 2YYZA 2FPKA 4YXWA 2WPDA 4UNNA 2MMGA 4MGZR 1TEXA 5E7JA 4W9MC 1NMXA 3SJBA 1NG9A 3B1XA 4I1UA 4ARZB 4DT1B 5FUYA 4F92B 4TYNA 3E1SA 2DR3A 3LA6A 4GFDA 5EZ5A 4LHZA 3AH8A 2F43A 4AKGA 1DOAA 2GTPA 1M7GA 3VKWA 1WCV1 3DM5A 4GL2A 2P6RA 4WZ6A 2GF0A 4Q7KA 4JJKA 4Z54A 3HU3A 4QGGA 5DHFA 3UMRA 5KDDA 1BKDR 1KO1A 1I4LD 5AJXA 5FUVA 3IILA 4LI0A 1U2RA 4EIWA 2QU8A 2C2HA 4M21A 1MRSA 5C1BA 3WY9A 4YLGA 4BFYA 5JMTA 3TQCA 4WA7A 1VIYA 4JL8A 1KSFX 2VPPA 2GCOA 2JIZA 4WAUA 4FCTA 1FW6A 4FN5A 3FE2A 4BEBA 4HATA 1AN0A 1F2TB 2QP4A 1XTSA 3EIQA 1EGAA 4HZIA 1VHTA 2VSXA 4E03A 1BOFA 1T0JB 4PR0A 4D4MA 2A9KA 2F6RA 1W4RA 1XWIA 2ZTSA 1FNMA 3WP1B 5TV2A 3AF2A 4HB3A 4YQFA 2IT1A 5AJYA 4NU0A 1U9IA 3KQKA 2JJ2A 2WWGA 5FPSA 2ZIAA 4S35A 1GM5A 5GJVC 3RHFA 1TL7C 1HA3A 1W0KD 3HYTA 4Q7MB 4JT2A 2D2EA 2QMOA 1XEWX 2VQSA 4ASUA 4CEIA 1KKMA 3E2IA 2H18A 1Y63A 1GIAA 2AX4A 2ZRCA 1MH1A 4A9AA 2ZU0C 4Q1CA 3EX7C 2ZSBA 4FINA 3T1QA 3FMFA 1EK0A 2J0SA 2DWQA 5D3MA 3TSZA 5K8IA 3U7HB 1RRFA 3QNUA 3AQ4A 1OXVA 1XF9A 4URXR 1RPZA 3FKSD 2XTNA 5KDOA 3PEYA 3UXMA 4LBYA 1QDEA 2CJWA 2OUKA 1OXTA 5IDVA 2NO7A 5E3HA 1G19A 2FGJA 1Q3HA 4DLYA 4LYJA 2G0NA
chains in the Genus database with same CATH superfamily
3R2JA 5B4TA 2F90A 5DLEA 3DFIA 1LU9A 2P77A 2R44A 3IAAA 2ZRFA 3FKSA 3VKFA 3OE7D 1U11A 1NSFA 1SCNE 3IUMA 2GO1A 3NXKA 4Q18A 3WGNA 5K6AA 3Q1LA 5KZMB 2VJBA 3O0DA 2DR2A 2IJGX 2WJ6A 1S2LA 3U3XA 1V35A 4ZI7B 2VQ6A 2W2KB 4UNRA 2FPUA 1O6FA 3HBMA 5FWNA 4NCAA 2HA3A 2FDXA 3ST7A 3FDZB 1IN6A 2E5WA 1N5IA 5D86A 3T54A 4L3WA 1W85A 5B1EA 1NWCA 1QH8B 3GEBA 3A31A 3AP2A 4YWJA 3RRNA 2QVLA 1LCIA 1V6CA 2CWWA 4XSVA 3GCZA 5IKPA 4X71A 1T5LA 4RJIA 3IP9A 5AJWA 2VWHA 5KNBA 4K8OA 4R71A 1TAUA 4MI3A 5LJLA 5EUQB 5A7GA 1XLTC 2ERCA 3PWTA 5T3UA 4FB4A 2EL9A 2XRYA 8OHMA 2IY9A 4HNHA 4E3ZA 5I7UA 3QFCA 4QSMA 1ISMA 3DKPA 4CMKA 4WKCA 4TL7A 1GRVA 3GLQA 1MVNA 2Z6QA 1G0OA 4WFKA 5LQRA 1A9YA 2E6KA 4GDMA 5JFGA 4GLFA 3JQDA 1FUYB 1HNNA 2HU8A 1PV1A 2PH7A 3DPIA 2OCDA 2EW8A 3RVMA 4CNBA 4Z99A 2DKOA 1TZJA 2RHRA 4BCDA 2JFWA 1YR1A 4OXNA 4KGDA 1GPWB 3AG5A 4NPCA 1BU5A 5KVQA 3FJYA 5C1DA 1M34E 1S9HA 2NVUA 2XZPA 4N0EA 1EP9A 3MMNA 3PGKA 2GUGA 1VOTA 2HV8A 2XTAA 4OGLA 1KDYA 1I33A 5CAEA 5CD1A 2GWHA 3DZHA 3K1YA 4DNPA 1A9XA 3E27A 3FMIA 3PGXA 3CX6A 4BNXA 3M0EA 3WIVA 5EMKA 3R6WA 4QLBA 1PGOA 3TSYA 1EDEA 2C61A 1G21B 2KYRA 2WIJA 1W59A 3AUXA 4HDRA 4REOA 1LSSA 5TPWB 4LJRA 1O94C 2JLBA 5KYGA 1ZMXA 3SQMA 3IPXA 2PKRA 1A9XB 3KVVA 3DE7X 5E2BA 1IEWA 2PT7A 4FTWA 4MA5A 1T25A 1FVFA 4O4IA 3WE7A 3PHGA 3LD9A 3UUWA 3OT1B 1EJBA 3JVIA 2AUTA 1DXOA 5BR1A 1DIHA 1MW9X 1Q91A 2GEJA 4XVQA 2ZWIA 1KMMA 3ZZUA 1F06A 2MCFA 3A6JA 5EHQA 4HI0E 3JZMA 4EMBA 5JJKA 1JSRA 1Y5IA 2GXSA 6NULA 2HHAA 3LIPA 2P0EA 4OHUA 1SKBA 1GTVA 3AKYA 1I7QB 4KQIA 4UTXA 3MQFA 2Y05A 3CB2A 4ZP1A 3FI0A 3DZBA 1E6CA 1HBJA 1G17A 5EZ6B 4ESHA 4EKGA 3L1HA 1D1SA 3D7SA 1VCOA 2O2XA 3MFYA 4RJ2A 1TEZA 4FFRA 1MA3A 2CY0A 1QBKC 4FP9A 3ZWXA 2HK8A 1KGDA 2IPLA 3EYWA 3OQPA 5FPYA 4C7OB 1BXGA 1YDFA 1EGQA 2NTNA 2XNDA 4NONA 4TV9B 1J1IA 2AWOA 4G24A 1I32A 4JDPA 1FTNA 1IK4A 3GJZA 4MVCA 4DBLC 2Y2VA 4C6TA 1DJLA 5CT4A 3EPKA 5BSUA 1CUVA 1V3QE 3JD0A 2Y1KA 4LC9A 2WPDD 1RXIA 1SY7A 4CLHA 1A98A 1SWWA 4ZIRB 4IL5A 1CJMA 3WMXA 4D8XA 2H85A 3KALA 4BQSA 2GN9A 4AY2A 4WJKB 3MUEA 4DJJA 1SKQA 4DXAA 4BQEA 3BG5A 3VKVA 3OBIA 5AKZA 1N6NA 4CCYB 5BMOA 1KERA 4JVSB 1YV9A 2FMUA 5TQ2B 1Z6QA 4Y6SA 5BQXA 1L8XA 3ONDA 3UV6A 4LF7B 2AOUB 4RMJA 5C46F 5HM8A 2OBNA 5K4GA 2JFPA 1JJBA 3FETA 3FJ1A 2H3HA 2P2YA 3MYYA 3RBZA 4I5GA 3ISTA 2XUOA 3VOAA 4AMUA 1PZFA 3BH6A 1Y8ZA 5LD2B 1L3IA 1I3MA 3D54D 5DM70 4AKTA 2EVWX 5JAZA 1EUZA 4RY0A 4JU9A 2IUUA 2UYHA 3STVA 2XE7A 3M2PA 4E14A 2YFKA 3GL9A 5GONB 1UKVY 3V8BA 5KNDH 1JN0A 4BB0A 2AKEA 3NHSA 2A3RA 4ZOAA 4MW6A 5L4LA 2VQEB 5JAQA 1DB3A 3OPNA 4P4GA 4CMGA 4DPMA 4G8CA 1UXKA 3MWJA 4ZU3A 3OQ1A 3AEYA 3V4OA 1ENPA 1EYZA 1ZONA 2P9HA 1GA6A 5AI9A 1RWKA 5EC8A 5EIWA 4AMBA 2CV1A 4JEUA 1YQWA 5E6UA 1QTNA 1ZP6A 1STOA 3LSTA 2F43B 4J29A 1UMCB 1M8PA 3PPYA 5FPQA 1UPCA 2UVPA 4W5WA 4RZXA 3VVMA 4R69A 5M3BA 4EMUA 3RYCA 4PRZA 4QLOA 3QXSA 2ZVJA 1KMQA 4NEHB 2H2WA 3BMQA 1AO3A 1U0LA 3U37A 2R6AA 4O1MA 4L8WB 4WFQA 2EKDA 2WHQA 4XKJA 4EELA 5EJEA 2Y4NA 2BLNA 5FPTA 3E18A 4X8MA 5EP3A 2YJ6A 4IEIA 3UWDA 4KR7A 2HA4A 4HH4A 4ZODA 1EQAA 4RH0A 3PCXA 4PGGA 4Q0MA 3ROXA 5BYKA 3T6KA 2OM2A 3KQOA 3RAJA 1LPAB 2KBFA 2ZAOA 4P3XA 2H9IA 3I4CA 4LJKA 1T43A 4TROA 4XPZA 4ZCMA 3C15C 1ORTA 2A33A 2WF9A 1JKIA 1E2NA 2D3WA 3W8NA 1FPQA 2N9UA 4OGGA 1TM2A 1YDGA 3KYDA 1TEVA 4E12A 5EA2A 3WC4A 4KNVA 5T57A 3JPWA 2C3YA 1P0FA 3KKQA 2D1SA 3KQWA 3X43A 4YUWA 4YY3B 1NUSA 4FMPA 4NPAA 1X42A 1GPAA 4B81A 3PZRA 2QQ0A 1L5MA 4J8PA 2WUFA 2G40A 2I55A 4NYIQ 4GUDA 3WGMA 4YT4A 3ZCRA 3TGLA 1QFYA 1GZ7A 5LQJA 5E1OA 4Q3AA 3L8MA 3NWJA 1BCRB 2HCJB 3L8ZA 5C5EA 1CZOA 2C0QA 3K1AB 3P0RA 1ENYA 1Q7EA 5GGXA 1KDTA 3ZQKA 4BWFB 3L1JA 4DTCA 2VYNA 5JQGA 4DRYA 1OZ0A 2PGLA 1U7WA 1ZN9A 4YR9A 4HDOB 4ZI5A 4OSEA 1QGAA 4B3GA 4K6KA 4F6LA 5JJ5A 3CV3A 1TO2E 3QBVA 2AOXA 5IVHA 3IB6A 4UREA 2JFOA 1XEXB 1VSVA 3D0QA 4IQ4A 5AK4A 2HMYB 3C2QA 3B13B 4MYSA 2C7RA 2RMKA 2CMDA 1O57A 3TN7A 1N33B 1TAHA 2AXPA 3DMGA 1E6KA 4F2HA 4YPVA 3FRHA 2RE8A 1DX9A 3JAWB 3HBFA 2CVFA 3E05A 1RHJA 3JQAB 1HSOA 4HYTA 4MWSA 5HJ7A 5BYAA 2PXHA 4JBHA 4JNCA 1KHTA 3QFTA 3QE3A 3C3MA 1Z4MA 1FTGA 2WU0A 3IKMB 3V2HA 1OASA 2OG1A 1DZ3A 1HY3A 5ABPA 3IQHX 3HUFA 3M6LA 4BBZA 2IU0A 4US1R 3B89A 3G1TA 4JJGA 1EXNA 1JHVA 2MU1A 2HBQA 1T6BY 4QICA 3FCUB 3T9CA 2XUKA 5J1TB 2V3VA 5IZCC 2QMUA 1K6XA 3VHLB 2ZLBA 2IODA 1G6HA 2CL7X 1I3NA 5IAAA 2C8JA 1ORIA 3TX6A 4GM1A 3LBFA 1Q84A 1LB1B 5GQSA 4Q9NA 1DRUA 1W4CA 1B8OA 2EU8A 4TQ9A 4BX9A 2ZK7A 1T9AA 3GJYA 1EZ1A 2Q6KA 3NHKA 4DJEC 3EGDB 4EENA 3VC1A 3WGIA 4MVJM 1U5BB 4YRCA 2QR2A 3W6ZA 3C1TA 3D8RA 3KOOA 4DDMA 2DKNA 4YDSA 1G8HA 1E63A 1HTBA 2XVXA 3NNDA 2OK7A 5IJ9A 1WF3A 4HQ0A 4JLOA 4W5RA 4L50A 4NMWA 4HVTA 5DLDA 5BW5A 5AK3A 1KBZA 4CIDA 4DDWA 4MW0A 2PUCA 4BN0A 2NT4A 4U7PB 3T5DA 1S02A 1V5IA 3EWNA 4LXUA 1RZ3A 2PBZA 2HLDA 1QV6A 2EBWA 4II7A 4L22A 4BATA 4CM7A 4KPYA 5DTIA 3SQDA 3VZCA 2NU6A 2H0QA 2A2ZA 2IPXA 4HNQA 1SULA 4UMFA 3X1DA 1AGXA 3X0DA 2H6EA 4B32A 3H75A 5IAGA 1HUQA 3FPAA 2J5KA 1D8TA 3S55A 2ZE5A 3EGOA 3FA2A 3E5MA 3BDIA 1RWVA 2R0QC 1L7RA 1OFTA 2WJ3A 3ER9A 3KZOA 5ETJA 2ACEA 4BZXA 3PE4A 1MFPA 2WSBA 4E30A 1H2YA 1QONA 2TSYB 3S2YA 4P86A 3BGOS 4JJZA 1EA7A 1U9IC 3N28A 5AO9A 4G8JA 5AJZA 4ZEVA 1PT7A 4M49A 3N70A 6Q21A 1YZNA 3FCXA 2WHEA 3ZDAA 2H4FA 2Z2XA 1NLMA 3EG9A 4M36A 3GF4A 3G9XA 2H54A 4MUXA 3DULA 2BHRA 3ASUA 4I1IA 1JKFA 3ROZA 1QO0D 3L46A 4AN1A 4HQRA 2P6UA 1JFSA 2OQVA 2AE2A 3WMRA 4J16A 4J75A 5FI5A 4O29A 4CLXA 2W71A 3PHJA 4CQMA 3FJOA 1Z7GA 3BSYA 4RY9A 4XDHA 2AR9A 2F9LA 1GPKA 2QRNA 3JD3A 4ODIA 1Z17A 4TLAA 3VNQA 3ODGA 1OE0A 3ICEA 4OXIA 2B7LA 4V0MA 2EIXA 1OFUA 1FFHA 3MMZA 4TL9A 3FPCA 2W6IA 2D1FA 2ZRKA 3RK4A 4BN4A 4P53A 3GLFE 1XHFA 2AG1A 2AZTA 3BEOA 4IQGA 1L5SA 5HQTA 2QTZA 4YFVA 2H07A 2JZNA 1UXGA 5ALQA 2HW8A 1FXWF 3R3YA 1EVYA 1E32A 2Z5VA 3QLUC 1P7PA 2WB2A 3HDTA 1YO6A 1ZS9A 1M54A 2ACWA 2C4KA 1BWSA 2BEVB 4JQCA 3ZJ4A 1YF3A 1UWCA 5ERXA 4DLAA 1E2KA 2H1IA 1KGSA 2A88A 5AYVA 5T4HA 3RASA 4CDNA 2O7NA 4A26A 2VF2A 3PXAA 4NI5A 4MWCA 2BEWA 4GXNA 4Q7QA 4PHFA 1XG5A 2X5KO 3DXFA 1UBKS 2PD4A 4QU0A 2C8VA 4X6YA 4BX8A 3LHKA 1OB2A 4UAJA 1XCOA 2CSXA 4A1FA 4IJQA 4R40A 3VNSA 4C4ZA 1G6Q1 3GO4A 3ZDQA 3CB4A 3ZD7A 3O21A 5EXDA 1EU1A 5IF9A 5F1PA 1UT8A 2F1HA 3HBAA 2QA5A 3IH5A 4RLSA 2PMEA 4AI6A 1ONPA 3X3HA 1F5NA 4CF4A 1BMFA 1B0UA 1VL2A 4KQJA 1JTFA 4ZHQA 5EYPB 1I13A 3WGOA 5C52B 2HDOA 2P6MA 3MPOA 5T4EA 4MRMA 3PDCA 4DGQA 3ZLUA 5CLLA 3T99A 3U13A 1UXIA 4B44A 4CL3A 1LQUA 4G36A 1Y1LA 2G88A 1HFJA 2H65A 2R47A 3BB4A 4MVJF 3UMFA 4DLRA 4WLEA 3AUKA 1XU9A 3OI7A 3Q87B 2O50A 2HQRA 5H02A 3C8UA 3UWPA 2X8BA 2WNSA 3E7XA 4ZYTA 5B5SA 4HDCA 1AF7A 3HXKA 4O4HF 1EINA 5IRCD 1M76A 2HFJA 1KYYA 4ZIRA 1UMKA 3WLJA 2OBXA 3MA0A 1UBNA 3VOSA 1KYIA 3DDSA 4N49A 4YO7A 4AC9A 1YQEA 1U3FA 2I4RA 1FYEA 1UFQA 3T0IA 1Y4UA 3KV1A 2VQFB 2NUAB 3WWZA 1UJ4A 3G8BA 1R6DA 3EZXA 3K0AB 4Q3DA 4L6IA 3QLTA 3W6PA 3U60B 2DWPA 3E03A 1YDWA 2JAUA 3C74A 3YASA 2FW1A 1E8NA 1JRLA 1F2TA 2H4XA 3A2NA 3RCBA 3W5UA 4BP1A 1W4BA 2O7RA 1UFVA 1OX6A 2ST1A 3M5WA 4IKPA 2JLUA 3ZIDA 3IAS1 2UUAB 4YXFA 3H2BA 5TT1A 4LXYA 4DMLA 2DBVO 2V74B 5F2EA 1YZQA 1LW6E 3I3SR 2R7KA 1PLLA 3ISJA 4JHXA 4Z9BA 2C0PA 1QZUA 5LQNA 3WRXA 1PJ8A 3R23A 1UEIA 1Y9DA 1V9SA 4FGJA 3WDKA 4B84A 2F4VB 1LI7A 3EZ2A 1LWNA 2Y71A 4BNHA 3PG5A 3QUQA 1SXJE 2YNMA 2PUVA 3AY0A 1K63A 4HPJB 4OA5A 2QPTA 4FJ0A 1CETA 1FZTA 3EGIA 5J23A 5DWDA 1VM6A 1GUFA 1ZI8A 4PAOA 3MT0A 3P4YA 5DN9A 5J63A 4GR4A 3UMJA 4TX1A 4YK7A 3SEAA 4BO7A 2XUZA 2RI1A 3ESXA 3WWOA 3AILA 3VOBA 1CUZA 3PUWA 3K4PA 2Y68A 3G0GA 3KOWA 4X97A 1VG0B 3M5CA 3NDIA 3N0TA 4DCSA 3NYIA 4W6QA 3NS7A 4WLVA 5C32A 5JSUA 1GHTA 3DV0A 2Y99A 4PHHA 1M2FA 2FOLA 3QVWA 2YHIB 2J0UB 3BRWA 4UVHA 3SR0A 4EH1A 3OVMA 4JLPA 1XZCA 3FZQA 4NH4A 4ZAGA 1ZLXA 2JKVA 1L7NA 2R96A 2W83A 4AS2A 4EB8A 1TQ8A 1Z0ZA 4ZCLA 1CG6A 3A4IA 2Z43A 5JZMA 2VHUA 1DEXA 4L8FA 1DO2A 2A92A 3N2EA 3N5CA 3NX4A 4ME6A 1YB5A 1FSSA 2POCA 3SJCA 1A9TA 2QZ4A 4S0XA 4TTIA 4Q1AA 3QELA 2A0UA 1L5ZA 3AFHA 4EGJA 2NVUB 2YWGA 4QAJA 1FS5A 1KI1A 1G20E 1TTHA 3C6XA 4YWHA 5JS2A 2B0JA 7REQB 5IAJA 1NASA 3JQFA 2XUAA 1VPWA 1K2VN 3IBGA 4RA6A 1KAOA 3OOJA 5LZ4A 3OQBA 4AY6A 4G5QA 1Y4SA 5KYXA 1PS9A 3RG2A 9LDTA 3QKSA 2PWAA 1JQLB 1P80A 3IIKA 4FI3F 4PC1A 4R1UA 4WMLA 1O6ZA 1DXQA 5K2OA 3IBFA 4H3HB 3O4IA 1SB9A 4DV7B 2NZYA 2VL7A 3PLNA 2WD9A 4YGXB 2HEIA 5BMVF 1P4HA 1XZEA 4HQOA 3D3EA 4RHEA 4QUBA 4FWBA 1RE0A 5MGBA 1ZNXA 4G89A 2XLCA 1PS0A 4B7ZA 3FFWA 1OZGA 3A9SA 4PSVA 1HDEA 5IW8A 1FDIA 3USES 5LYJB 2CDRA 2FPMA 3DBIA 2JJ1A 4TT8A 1KWKA 3C97A 1U0HC 4GICA 3T8YA 2C9BA 2PGXA 1LRKA 2WSLA 3I2JA 2BM8A 2GETA 1C9NA 4Q37A 2R6R1 3U7EB 4AG3A 1X70A 2EX4A 1E6UA 2G8LA 3DZFA 3EIHA 3GJ3A 4O5OA 4R9NA 1SKMA 1UKAA 3M9LA 2B83A 3MCUA 2VT6A 2QN1A 4J1TC 4I4TB 3WKEA 4J3NA 4DT1A 5CBPB 3D0RA 1LUAA 1QG0A 3ANSA 2X6TA 3ND5A 1RJ9A 1ZRMA 1HDIA 3OZAA 1M0SA 4K9LA 4KWTA 4ZZ1A 1SUBA 1ATZA 3WQQA 4F2DA 3KSAC 3RU3A 4N5IX 4LRWA 2XCTB 4K6CA 2NM0A 2HBRA 2ORVA 1GPNA 3W8FA 1KMNA 2A1IA 4B3SB 4U2DA 3H8JA 2A5YB 2O2SA 2ZDHA 4JYBA 4K6MA 2I9PA 5FJIA 2VDKB 1V5FA 1FVXA 2WT8A 4PPNA 5CYOA 4LRYA 1QIHA 2JPDA 2ZTLA 5AHXA 3RYFB 4BE9A 1G18A 2V9PA 5BNFA 2YBDA 4PYKA 2EATA 2V9ZA 3TQQA 3PDIA 4YP6A 4C21A 1K9VF 3B1WA 4CMEA 1OI2A 2B6HA 2ZRLA 4LJLA 3ROEA 1SA0A 5KVCA 4EAQA 3QTBA 3LE8A 2M32A 4WASA 2J4DA 1ICEA 3RYHA 1M1XB 3SR4A 1YQQA 2ODPA 1SWVA 4EI2A 5JNRA 4HTFB 3L7BA 1CSEE 5CX1A 4YJGB 4CEIB 1RC1A 5IVPA 3TRKA 2BR5A 2C9DA 5AHOA 3U7RA 1ISSA 1JQEA 5TGZA 3ZHTA 4ZOQI 1GZ4A 2H9YA 4UXIA 2FSGA 1T26A 1YGYA 2XDYA 4F85A 3B8EA 1KEWA 3CZRA 3MJHA 4KGXA 3IDFA 3HP4A 4PVDA 5G4KB 3W4IA 5HUHA 1RAFA 4CMCA 1G8FA 1F0PA 1I2MA 2PKXA 3ZHSA 1KYTA 3S1SA 4LE0A 5AM5A 2WUWE 4JEMA 4ZGWA 3DCJA 1YONA 3TKYA 4TVBA 2LIPA 5C35A 2WMYA 3RD5A 4LJYA 1OAOA 3WVNA 2UZ1B 2BTOA 2PZEA 4RFVA 3VDRA 1Q0UA 4D82A 4UTZA 3IUYA 1Q6YA 1NF9A 1E66A 2NYUA 5T8KA 5JS8A 3NRJA 1KFCB 2O1WA 4MH0R 4MW4A 3VSDA 3T4EA 2FF7A 4G4JA 5JWHA 3GLHA 4CG2A 2VRBA 4H1VA 3ECAA 5E8RA 5DCUA 1T1SA 3PRJA 3UAZA 2JLZA 5TS3A 1YZKA 2WZCA 1B41A 2E18A 1T1JA 2H1WA 3PUVA 3N0XA 1WMBA 2F64A 4QJ4A 1WMSA 2NYVA 1ZNQO 3COSA 1AJEA 2Y1LA 4FSXA 1NHWA 4HRYA 4IGIA 3SWWA 2ZBPA 1U1IA 4HWKA 3BTUA 4J0QA 5BVGB 4AN4A 5A71A 4U2GA 2FN3A 1I0IA 3ZWNA 5E6RA 2P75A 4K03A 5B2ZA 1ZGAA 2BFEB 4QYXA 4YYEA 3CVOA 3B85A 3V1MA 5I4BA 3OEWA 2GJ9A 3CZQA 4MQMA 3NT4A 3SVLA 2JI7A 2Z5LA 3D3WB 4XM0A 4OO3A 2O20A 1VKOA 3T1YB 1TX4B 4H0NA 2FMIA 3OZCA 4JYCA 2FKNA 3QE0A 1P9NA 2Q6TA 5DTMA 2YL2A 2A1TS 1NN3A 1E61A 5BUZA 4P7FA 3I01A 5D3KA 1M2JA 5G0WA 4Q3OA 5FOQA 3WV5A 2XKKA 2VJQA 1T9GS 4R51A 3K9FC 4AKIA 2ILVA 2GKOA 4REQA 3AVVA 1C1HA 3B36A 5JW6A 2IOQA 4G41A 1PV2A 2B5OA 3R9XA 1P9WA 3PJEA 5FBLB 3ENQA 3Q3EA 1Y5NA 5IAKA 3G9UA 4E11A 4XWOA 3WIOA 1XMJA 3BWXA 5CYGA 1IPEA 2GAAA 2YWBA 3EY9A 3N87A 4ZCQA 3KQSA 1EZ4A 4ER7A 4P81A 4CTNA 1A3CA 3A2LA 2BGIA 1QQTA 1SVIA 2VN8A 3AF3A 3F67A 3Q10A 3MSCA 3C4QA 2AZXA 5H4HA 1M3SA 3WKCA 4L51A 2EWVA 4UAUA 3SSMA 4O5AA 3F8SA 1JR2A 4R9SA 1KEZA 1Z26A 4OG2A 2QTAA 5EWJA 2QM3A 5BN3B 9GPBA 5D3MB 2RGGA 4D3ZA 1OGYA 1ZKMA 4IILA 2JBWA 3FBWA 1BSVA 5B57C 3SS8A 5HYVA 1YBAA 1VJ1A 1JTEA 4P7JA 3ZC3A 3W5VA 3ZHZA 5CDYA 2X8AA 1X7HA 3N8KA 4OCZA 1OIVA 4BMVA 2PLNA 3LX8A 3V97A 2XAUA 2O07A 2HN9A 1VB5A 4LHWA 1OHHD 3ULKA 3KKOA 4GQBA 1XV5A 1U7UA 1E5DA 3UYLA 3HCCA 4MB0A 4U00A 1K6MA 3G0CA 3L02A 2ARKA 1P5FA 4BDTA 4N6OA 5TB5A 2YXDA 4RH3A 4MUMA 4FU0A 2DCMA 3UCEA 2MINB 1IVNA 3KAQA 4I3GA 5KSWB 1XJWA 4IO0A 4OQ4A 4QBFA 2BFFA 2J5XA 2CEAA 2QQGA 2ZUDA 2HJRA 4X66B 4DFDA 3N2IA 1C9DB 5CT6A 1WIWA 1NLZA 3G2IA 3SKVA 1CUAA 4I3HA 2GPSA 4PQYA 3IT0A 1TQHA 4UNIA 2I65A 1GKLA 4D3FA 3EDOA 3PXXA 3BB3A 3HKEB 1SQ6A 1QORA 1YT5A 4NS1A 4HFNA 3O26A 5CR9A 4ZCPA 2IEGA 2CJPA 2ZJZA 4JK3A 3N7AA 2I6QA 4D9GA 1FFBA 3G88A 2JGKA 4V24A 3FCAA 2IZ7A 3D6AA 5ENZA 4OYLA 3TIVA 5LZ2A 3FOAA 1BNCA 5FWXA 4EYKA 1A82A 1CQIB 4Y2SA 4KLNA 3SZGA 1YA6A 4ZC1A 1IDN1 4ETMA 1MB4A 1ZWLA 2FYTA 2CLFB 2J33A 3I32A 4G67A 4LXGA 4OBXA 3KSRA 4OHFA 4ROSA 3FD8A 1XAHA 2BP7A 3ETGA 5FUBA 4BB5A 1YJBA 4QDTA 3AF0A 3IXQA 3WQRA 5CCEA 3KZVA 3MS4A 2C2WA 4KLRA 2XUDA 3QTTA 1DG1G 3KO8A 2A7QA 2A9RA 3WNQA 2RONA 3GGGA 2DPYA 5JEEA 3L1VA 3D0OA 3FB4A 3A1UA 4K2AA 1J2UA 1E9VA 1I3CA 5FQOA 1F9AA 2J85A 1CC1S 4UPEA 3QK7A 4RF2A 5ESWA 4WLOA 5I4KA 4XX0B 3LTNC 1DAPA 1W44A 2QUHA 3E3MA 3WBFA 4D44A 1I7LA 3ITEA 2RGAA 4KN5A 2P0AA 4LBWA 4O4HA 4NE2A 2B82A 4E94A 4BO4A 1Y6QA 2VT3A 1C7ZA 1V45E 4Q9AA 1ZL2A 3RI3A 3QBTA 1KIMA 1BVRA 1NW9B 1G5QA 2VSQA 2ZETA 1R4NB 1HLPA 1WUYA 2OAQ1 2V5VA 4Z8XA 3NDRA 4U7HA 3UT5B 5DCYA 2YICA 1YNOA 1WL8A 1Q16A 1Z7BA 4MINA 1TUBB 2BBWA 3C3WA 3BWEA 5CGZA 3KETA 3UGTA 3GNSA 1QR6A 3DWIA 3R3SA 2PO5A 3DYIA 3IUBA 4L0MA 3NO4A 1SUWA 1C8LA 2WV9A 3EFEA 4LGVA 3O4JA 2QBYA 1KBOA 1KJWA 3WOVA 5BVHB 1OREA 3MWYW 2IXEA 3JYNA 2IDZA 1UK6A 2V7XA 3SBEA 3TM5A 3K94A 1DO8A 1W96A 3K1AA 1E20A 4A6DA 4DCGA 5IT5A 5EIOA 4CKBB 3H5VA 4EPYA 4PICA 4YUAA 2J3KA 1O89A 1YR7A 3IV9A 3E7WA 4GI5A 4PG7A 4UMEA 4E7PA 2ICAA 4B8YA 4EUFA 4PLVA 2CL0X 2K6GA 4YTEA 3TI7A 2VBGA 5HQ3B 5A9SA 1GVNB 1XQWA 1O94D 5JJLA 2AQ8A 4PONA 3GG9A 3JQQA 3QE4A 4J0GA 1OBCA 2J9FA 3U7FB 1NQUA 4AZ0A 1ZVJA 3PHLA 5FO0A 1GGVA 2H1FA 3RWMB 1Z5ZA 4X5OA 2E2WA 2JJ8A 3OZTA 4URYR 4I36A 5H3CA 3L7IA 4AJLA 3ZZ1A 4HMPA 3F97A 3C3CA 3DMYA 1WVMA 3DL4A 3N3AC 3PFKA 5AK5A 5BSTA 1PG0A 3EFOA 1GPLA 1ZBDA 5B3LA 1EQUA 2E4UA 3VJLA 1HPLA 2GNOA 4RV5A 3FDZA 4JJ6A 4BWGA 3P0EA 1U63A 1XPRA 2W6ID 3F5SA 2POQX 3MZ0A 3KSMA 3BMNA 4U8GA 4BKOA 3GGPA 1NZJA 3E8SA 2RJNA 3HP1A 1J7KA 3LBAA 3Q15C 2DUMA 1RQGA 2A67A 1FYWA 3UTDA 5JQGF 4Q3CA 4D9MA 2HYIC 3IVRA 1I6LA 4RTNA 5E0KB 4YV7A 4PX5A 3AVYA 4MV1A 1NVAA 5DULA 2N1BA 1QK4A 2J6BA 3U56A 4OKIA 2I3BA 3AKDA 3LXUX 4CM4B 3PTAA 3HVKA 5D5PA 4G3XA 3ZU6A 2GRAA 4AJEA 3PX7A 3CYFA 4ZJYA 2CLIB 1UPTA 3R76A 1MJ5A 2WU8A 5LL6P 1YR2A 3KP1A 4ZI2A 5F7XA 5KMGA 1TTTA 4GRAA 3B3GA 2IUSA 3B9QA 3BMCB 1KEEB 3W1VA 3WKAA 4ZMBA 3H9UA 1QCCA 3FUXA 5DH9A 2NU8B 1ZVMA 2VWPA 4BNDB 1EXDA 6YASA 1AZSC 5FR2A 2FR8A 1VYHA 3UUFA 4BXOB 2QYSA 1E3LA 4IDAA 3DB1A 2FPIB 4IZ6A 4YMSA 5AM0A 1XZAA 3OP4A 4ZK2A 5EKDA 3JQCA 1PJLA 4F4UA 1VGQA 4S2EA 2VIIA 1EP1B 3FBGA 3MJEA 4M8IA 4QYSA 4KNYA 3GJRA 4HDMB 4FGZA 1CR4A 2AVDA 3LY9A 5DLQC 2P41A 2PWYA 1MXFA 1E99A 1Y8QA 2H4YA 4GPIB 3TIXB 3TTYA 2O6LA 3HCNA 2WWRA 3ITDA 4Q4LA 3TIFA 3FPHA 4DLKA 4KITB 2B25A 4PLCA 1O3YA 1CZHA 5BUQA 3OESA 5E95A 3EXFA 3DBOB 3UCXA 4ZOLB 1Y5LA 2PAAA 3TD9A 2XXAA 1IM5A 2KB0A 2Y76A 2OCKA 4B48A 1BAPA 2GAIA 3QWBA 1S2DA 3PC8A 2Z8ZA 3TSOA 4MW7A 3WYBA 4A8TA 4C2AA 4QNMA 1XDBA 2BM9A 3GR6A 5NLLA 1QTRA 4TV9A 4CMAA 4N3BA 4PS1A 1MABB 5FYQA 4A8JA 3HEAA 1E3JA 1P0PA 2YQZA 1SXQA 1XELA 4HNAA 4MWBA 1Q0PA 1UDCA 2WDZA 1MFZA 1K27A 3FSJX 4FFOA 4G56A 4UEOA 4L5JA 4ZT6A 2K87A 3NHAA 1BX1A 4IM7A 5TGTA 3BCRA 2HTFA 3VMMA 1VQ1A 1R12A 1GPDG 1WR8A 5HZKA 3OM1A 4CEJB 3OLWA 3P2EA 4DM7A 4QRDA 3CCFA 1Y4AE 3LUCA 4IDBA 4E5UA 3VSBA 4IP0A 1AIPA 4FZRA 1ESDA 1Q17A 4RVHA 3NNSA 4JIMA 4YCBA 1PJTA 3DKIA 1Z5NA 4NBKA 2MMCA 1ESEA 2D54A 1Q77A 2QAJA 2VNKA 5FKJA 5GM2A 5BT9A 5EFZA 1CY0A 2CZCA 3H11B 3OHSX 1P75A 1XRPA 3EC7A 3IAUA 2HMVA 4F5EA 4ZJUA 2Q29A 2X8JB 2FXIA 2OXFA 4OVKA 4D25A 1NONA 2G82A 3LSYA 3MGKA 5SZJA 1NXTA 4IX9A 1XFDA 3PSAA 1PWYE 4YXWD 2B4QA 2YYAA 5FUMA 2EGGA 3C3XA 3NFYA 3BICA 3WAKA 2GFHA 4NQZA 4U2EA 5DO9A 2OILA 3OFNA 2P0YA 3C39A 4GWKA 2B2NA 3PLRA 1JU9A 5B1SA 1NJ5A 2OPHA 2A78A 3RVQA 1X7XA 2PLRA 3ZBTA 4B45A 4EYOA 2L18A 1I2DA 3H13A 3WAJA 3B6ZA 4NE7A 2X2PA 2AYZA 1GG5A 3KXKA 1J2YA 3AJEA 5CFOA 5BSGA 5K0BA 4YRTA 4DUZB 4MARA 3LVBA 1A88A 2YVQA 3DXXA 3PGA1 5FD8A 2IU3A 2PRKA 2JCSA 4H35A 2AQKA 3U4QA 4DR4B 3B12A 3TTUA 3ZGZA 4YRQA 5DCLA 1H0RA 3K0KA 5CBKA 5CX4A 2YJZA 2UUBB 4R6WA 3ZZ0A 2R65A 4X7PA 1NW6A 3BFXA 5BR4A 3O4VA 1N32B 1JP7A 2ZYUX 1L9XA 1ILWA 4LYAA 7YASA 3I04M 2VP2A 4PY2A 5E9QA 4BV2A 5HRUA 2OZVA 2P1ZA 1VGVA 1XMXA 2IZZA 2C9OA 2WI8A 3BSFA 2WOOA 1AUVA 4Q93A 3A14A 4C4XA 1K5HA 4E33A 4WT7A 1U98A 4A8HA 3O4GA 4HEHA 2OAP1 2RAPA 2YC2C 4KRXA 3VNVA 3JYOA 3U6KA 1OTXA 3E3OA 1TLLA 4WH0A 2Q46A 3JAMA 2AFIB 2WJJA 2B61A 3ML1A 4HLUC 2ZVPX 1N7JA 3DO6A 3M1LA 2YHAA 4JWKA 4K9DA 5K3CA 5AM4A 4YUXA 3G2LA 4K6FA 3PUJA 5CLQA 4OM7A 1UWVA 3Q88A 2AK3A 4LHYA 2CHUA 3JWIA 3TTXA 4YH1A 2YWJA 2YOGA 2W2PA 3O7WA 1V16B 5JYEA 5MDHA 2YWFA 1NZDA 3AETA 1IQRA 4IXMA 3GZNB 1QNFA 2UV8A 3PNPA 3SDZA 3VDNB 5I4IA 4EFMA 5IEBA 3FUVA 3QJYA 3R5XA 4OB6A 2RDMA 4A91A 5K3BA 1XN1A 1R10A 1N5DA 4MUBA 3RS8A 4BN5A 4CV1A 4DSTA 5CCXA 1MZPA 4X6LA 1JSLA 2JA2A 4URZR 2WIAA 1YZUA 2NV0A 1XZPA 2GT1A 3DTYA 1QIMA 3K09C 4LDJA 3RYIA 2PT5A 3I76A 4B6PA 3HCWA 4DLUA 2J48A 3RVJA 3RC1A 3H5LA 2DBYA 3GZNA 3KJFA 3IDSA 3QEMA 2OHFA 2GNPA 4UU7A 3UHJA 5A3QA 1OLSB 2O4UX 3NORA 4GKVA 4JUBA 1Q14A 4D3DA 5HCUA 1ZK3A 3GI1A 3SICE 2V55B 3HI4A 1JDJA 3FZEA 3SDSA 5CU7A 4JB2A 4Y67A 2Y0DA 5A3SA 3GW8A 1E92A 4GQAA 2DY0A 4Z53A 4M1SA 5DSZA 2F1RA 7ADHA 1JJ7A 2P1RA 3H2HA 4TOIA 9LDBA 3IMCA 3IPAA 1SZPA 5DX1A 4OKSA 4IOJA 3V6LA 1T2VA 3HPQA 1CUCA 5IT4A 1JLSA 2XZTA 5A6VA 3MCVA 1NNI1 1BKYA 1RQRA 3W8EA 3LC0A 2FUG1 4D2IA 3L5OA 1EIWA 4D57A 1QPGA 1UJMA 2FQQA 3G82C 1I4DD 4YI3A 1VE3A 2J08A 4Z0HO 4FYIA 4XIYA 5EI5A 1J22A 5GOZA 1J0EA 3E0QA 4R98A 4TYMA 3RVSA 1U28C 2C2YA 3COVA 3LJKA 3NH9A 3E8MA 3RSSA 5HOEA 1PYGA 4R0VA 6GPBA 3GGDA 4R1NA 3L8FA 2GLUA 3SEQA 2H5EA 2NZWA 2VOEA 4GI2A 3KUKA 3TD6A 4D3XA 5IWCA 2ZYSA 5ITZB 3AETB 3L77A 1K7FB 4ZKEA 4X1YB 1AM4D 2EERA 3QOWA 3AXTA 4NR0A 4KFRA 1GGMA 3EUFA 5AKIA 2JATA 3V46A 3AR9A 3IJPA 4GH5A 2J09A 3UT5A 1NR1A 3HO6A 3GFGA 2I4NA 3QVOA 4QUIA 3TQFA 1P1RA 5A0VA 3O84A 1DZIA 4JVMA 1XGKA 3KQVA 1RI3A 3ACCA 5U1PA 3FGNA 4RPKA 3H19A 4KVGA 1QIIA 3MUOA 2HF9A 3DEYX 1S8AA 3KPYA 3HN6A 3L1UA 1G4AE 3MRTA 4KUGA 5CURA 4PBTA 1Y1TA 1MG0A 4RCZA 1EFCA 1W19A 3EDMA 3K73O 1V7CA 3IELA 4QU5A 1YCGA 4UZEA 4BO5A 3QVTA 5LXTF 4DN6A 1E4YA 2JIDA 1J56A 5GVSA 2JC3A 1B93A 4F5DA 3EZ7A 2ZUCA 4HMOA 4I9GA 2HJ9A 2GYYA 2ZJ8A 4WNCA 1J09A 3O7MA 3PRHA 2RHMA 1AVTA 1OLXB 3DMRA 3GD7A 3S27A 2EHJA 2ZR7A 3SM9A 4LKOA 3TRFA 4BLSA 3JTMA 3A11A 2QAIA 3TUIC 4NDZA 1ANKA 3A6FA 2ZUWA 5LOVF 3KR0A 3KPVA 4R8MA 4IINA 1SBQA 3FCEA 2ZJFA 3QH4A 2NLOA 4YT2A 6ADHA 1JHMA 1GZSA 2JLWA