3X1WA

Ras-related protein rap1b with gdp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
167
structure length
167
Chain Sequence
b'MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQINR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1b
publication title The structure and conformational switching of Rap1B
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 60
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x1wA00
4HLCA 1XXHB 1XF9A 2GJ8A 1N3BA 3NVAA 3QEJA 1CS4C 2OBLA 5L3VA 4AY2A 4EJSC 5IDVA 1KDRA 2IYRA 1WRBA 5FUWA 1IJEA 2CL0X 5J40A 4YXWD 3GLFB 5KOYA 4OQXA 4LYFA 1R0WA 2B6HA 4ZI2A 1TQDA 1L7VC 2X2EA 3DKPA 4Q48A 4EFNA 1CKEA 1X1SA 1W2GA 1TUIA 3CWZA 3FKSA 4ZI3A 3ZIAA 1E2GA 1HTWA 4TMWA 2EFGA 4Q4JB 2JJ1A 2AX4A 4LBYA 4FMCB 2W83A 2HXSA 3EC1A 1AZSC 3UATA 1NJGA 2AD1A 2KJQA 1W7AA 1XU4A 2BBWA 1JPNA 1PLJA 5FBWB 4YMTA 1N5JA 3AP2A 3VKGA 4XWOA 2V6JA 2ERXA 3HJNA 4GPTA 4Q00A 1GKUB 4JLBA 4NZYA 2QAGA 1F2TB 1CF4A 2Y8EA 4A2QA 4EQ6A 5L3SA 4YLGA 4XVQA 3WMFA 4C0SA 3WYAA 1Z8FA 3OEED 1ZNWA 3W6OA 1OYWA 2Q0HA 3ICQB 1SVKA 2OESA 1YZQA 2XEXA 4TTRA 1RYFA 1OH8A 1FX0A 5CDFA 5J4VA 3ZQJA 3W6PA 2ASEA 3ZVMA 4LBVA 1BMFD 1SQ5A 2IA5A 4LC1A 1KO7A 2QRZA 3EZ9A 4UKDA 3CNLA 3T15A 3NEYA 1YU9A 1GRQA 4C0AC 2A5GA 4BLTA 5A4JA 2WWXA 1G291 4XVUA 3PUWA 3ZZ0A 1KI7A 1KSGA 1Q57A 3FMPB 5JBQA 2W6IA 4TL7A 3A8TA 4URZR 1AS0A 3L0SA 1II0A 1A2BA 3PUYA 1T3SA 1XTJA 4DLYA 2JLYA 2REXB 3QKUA 1BH2A 4A0RA 2IEZA 4RJLA 2WM9B 4M1OA 1QDEA 3U3JA 3AF3A 4DLWA 2FDCA 1YR7A 4Q9HA 3ZVLA 1UPTA 2C78A 1UDXA 2C98A 2QY9A 5GVSA 4MYUA 2H1LA 4HB0A 3MWYW 5K8TA 1G4UR 5J5CA 4B2IA 4B3XA 4DCSA 2DB3A 5KDLA 3EZ7A 4GNKA 5FUVA 2OFOA 3NG1A 1IXZA 4BLRA 5CB6A 4KSCA 4LHZA 2FSGA 3C41J 4IDOA 4JBYA 1GKYA 4DSTA 2GCPA 1FUKA 1X1RA 1SHKA 3ZYCA 1U94A 4A82A 2ZRMA 4DIDA 4KVGA 1R5NA 4FD2A 2NG1A 2OILA 3U7EB 4D4LA 1NSFA 4JYBA 4QGFA 3E70C 4G5SA 5BN4A 2JEOA 2PLFA 1GNPA 3IO3A 2ECKA 5A0FA 1U98A 3AP3A 2KBFA 3Q5DA 1NLFA 2QTFA 2JIZA 3FVQA 4PC3A 4HAUA 3MMPA 4M9ZA 1A5TA 2RMKA 4JBXA 2QQ0A 1DAGA 4OL0A 4AYWA 2R9VA 1IN8A 4B32A 2WJIA 4NCIA 4M21A 5A5GA 2VHUA 1GIAA 4NE2A 5L3RA 2A5FA 3EA5A 2D2EA 4CEHB 4ZDKA 2OLKA 1Q3TA 3M1IA 4P31A 1G9XA 4BFVA 1FFHA 4I4LA 2J7PD 1GVNB 2XSZA 2ZI5A 1DAKA 1ZUHA 3B6EA 3JVUA 4FIDA 4P3YA 1G17A 4P4TA 3B78A 2FH5B 3D6TB 3ECCA 1XJ0A 2QSZA 3RRNA 3ICEA 4O3MA 1RRFA 3TQFA 2Z0MA 1C1YA 4Q1FA 4NYMR 121PA 4UNQA 4OI1A 3W3ZB 5B2ZA 2OLJA 3NXSA 4N0EA 2PZFA 3QI2A 4XTCS 1QHHA 3PQCA 2ZQ5A 3QPUA 2OBMA 4QHTA 1NVXQ 1TQ6A 1QHXA 3OE7D 2P6UA 3U44B 3GMTA 3NDBB 4A92A 3GCGA 1OKKA 1E1QD 1XMVA 3WMEA 3KQLA 3V4FA 3Q5EA 5JCZA 1MO4A 1XJCA 3AH8A 1R0XA 3QUSA 3X1XA 3SFVA 1ZU5A 3SU8A 1NG9A 1U8ZA 3BAFA 2GXUA 1IN5A 5FOUA 2ZSBA 4AYXA 2QENA 1G18A 2D7CA 3QIAA 3R7WB 2EW1A 4IVPA 1V5WA 5FPHA 3U5ZB 3NIBA 3KJGA 4BRUA 1J70A 4DUGD 1OSNA 1YE8A 2CVFA 3A1WA 3FYHA 1FMLA 4M0LA 2OZEA 1FMJA 1GG2A 1UDWA 2REBA 1TQ2A 2XTNA 1AM4D 1W4CA 3MJHA 3P20A 4HUQA 5EP2A 5J4KA 3KFXA 1KOFA 4TLAA 4C0LA 2OFWA 2IXGA 1PLLA 1IN6A 4RFSB 3W5JA 2YOHA 1VYVA 2Z83A 1A2KC 3AVWA 1QG2A 3IGFA 4TLBA 1SZPA 2DWPA 2CMKA 4EDHA 2PBRA 3U3MA 3KX2A 2QBYB 1U8AA 1ZNYA 1UFQA 3X1YA 1XCPA 4B35A 4JLNA 2YINC 2AK2A 1SXJB 1MH1A 1ZUNB 1W47A 3K9LA 1G3QA 1R5OA 3RRZA 5CLLA 4MYCA 2OHFA 3RANA 5LD2C 1SVOA 4B44A 1P7CA 3NH9A 4OI4A 5JFGA 1VMAA 5EXSA 1ZVQA 1AZTA 4WA7A 3VU9B 4Q7MB 2D62A 5FOTA 4IXNA 3W3AA 4V0ME 2GA8A 1E2IA 4UJ5A 4P4UA 4AD8A 4BZXA 1GRNA 3BFVA 2G1KA 2OAQ1 5D3MA 5K8LA 3W5IA 4LI0A 3VX4A 5BXQC 3TBKA 2NO9A 3PEVA 1NKSA 4G5GA 1Y3AA 1NNEA 2O8FA 5D3QA 4C2TA 2FV8A 2VP4A 3EPJA 2QPAA 1U8YA 2P6NA 1DO0A 1EXMA 5HCNA 4XOIA 3UG7A 3X2SA 1DG1G 1DELA 1U9IC 4ZDWA 3AQ4A 1YKSA 2P65A 4NBSA 3LH5A 4HLUA 3LQRA 3LBHA 2ZXUA 4OQMA 2VYFA 2BDTA 3KQUA 3SEAA 2C2HA 2VA8A 2JLRA 3RRYA 3AEZA 5CK5A 5AJVB 2IUTA 1OJLA 2QSYA 1FX0B 5DNYB 1QHNA 1T3LA 3K0FA 3GLGA 2ZRHA 2IHYA 3L8ZA 2CHQA 2PCJA 4AG5A 3CBQA 2O8EA 2W2TA 3SBEA 3SHFA 3WRXC 4TSFD 5JS7A 1US8A 2FWRA 1VIAA 4KYIB 2NIPA 4M1WA 5FPTA 3WMGA 3F5FA 5AUQA 1WQ1R 1B23P 3K0SA 2AL7A 2LKDA 3N2EA 3NBYC 4HLQB 1MOZA 4D4KA 2GTPA 1ZNXA 2CE2X 4K8OA 2XZOA 2OM2A 5BYJA 2NTYC 4KFRA 2Q6TA 4X8OA 1EFCA 3B9PA 3B1ZA 3LVRE 1S1CA 2OO7A 3K0CC 3OIWA 2FE4A 3MWJA 1KSFX 2C9OA 2PZEA 2VQSA 1VIYA 4AI6A 3AKEA 3A58B 3U3RA 4AKIA 2VEDA 2QN6A 3T61A 2XAUA 4ABYA 1ELOA 3RC8A 2B8WA 4HB2A 2QP9X 5FPYA 4RVCA 2WOJA 2IYQA 2WPDD 1WA5A 2ZSDA 3TKLA 4MA4A 3B7GA 3GFTA 1Q0UA 4PAMA 1N5LA 4HAVA 5F98A 4H1VA 2CE7A 1AS3A 2H92A 3GLIE 1RE0A 1TF2A 2HF9A 2PEZA 2QE7A 5H70A 2FPKA 2QTVB 2A5DA 1SXJC 2GBLA 1Z0JA 1ZNZA 4O0MA 1NIPA 4FXPA 5KYKA 5GVRA 3KKNA 4C3ZA 1XJQA 3U2QA 2WTUA 2FPLA 3GJ5A 2XNDA 2RB4A 3KUDA 5BWMA 2J9RA 3EXAA 4LHXA 2AD5A 1KZ7B 1VYTA 1DPFA 1C4OA 2PT7A 4M9XA 5EXTA 2XITA 4B6FA 4I99A 5FTKA 2P3SA 3C15C 2HYIC 4I1VA 4JLVA 2QA5A 4HAWA 4KXFB 1DAMA 3TVDA 1GNRA 2FSHA 2D06A 3DMDA 3AGQA 1QHSA 5C18A 5EE1A 1T6NA 4NCKA 3QG1A 3QBVA 2QG6A 3Q85A 1S1MA 1OHHD 2ZJZA 2ZJ8A 2BJWA 1JEEA 1XTQA 5TY0A 1M7HA 3W34A 1EESA 4IOJA 3B1WA 3UMFA 2ODEA 5LBIA 1QHHB 2RCNA 3CX8A 4BFXA 1DG3A 2Z4RA 1VG9B 1DOAA 1HUQA 2ZVQX 3HYRA 2MSEB 1JECA 4HDQB 4P4SA 5FI0B 1S8FA 1OYYA 5K8IA 3AF0A 1T5IA 5JHGB 1TF7A 4IXMA 4QNRA 1HV8A 5GJBA 4FI3C 1KDTA 1D2NA 2B7CA 3BH6A 4PZLA 1UBEA 2RGCA 4S2EA 3RS7A 4F7WA 2ZI7A 1KNQA 221PA 1ZJ6A 1U99A 1R8SA 1VTKA 3PITA 2IWHA 3WYFA 4KFTA 3K0EA 5KDOA 2OG2A 2ZANA 2RGGA 2FEOA 4Z8XA 2W0MA 3K9NA 2WMNB 2CCKA 1KY3A 3DM5A 1MT0A 4BUJA 1SXJD 4EIWA 4M1TA 4PPFA 3I73A 3I62A 4PC6A 3RS0A 1BOFA 4M1MA 1HEIA 1ZC3A 3WY9A 3ONWA 1HYQA 1KSHA 1LVGA 2BKUA 2NO0A 3TIFA 3UANA 2P6RA 2K5UA 1W4RA 1VHLA 2RGDA 5AK0A 3T34A 4MH0R 4BFWA 4DRZA 1U90A 2JLUA 1NLZA 1U0JA 2J1LA 4JJKA 2B8TA 4JLDA 4NCJA 5BW8A 1UJ2A 5HCIA 3T1VA 1IN4A 2C04A 2ERYA 2CCGA 2O0HA 3SR0A 3VR4A 4YDSA 1KY2A 4DLXA 2W6JA 4AYTA 2NO1A 2DYKA 2WWWA 3B85A 1ZCBA 1TAGA 4F4CA 4AKHA 4BEBA 2ZJYA 3QPWA 3AUYA 1ZM2A 3H2YA 4IOMA 1XP8A 3Q72A 4EFMA 1Q22A 4YMSA 4Q19A 5JS8A 2VP6A 1II8A 1G6OA 3QKTA 2FZLA 4OJQA 1R10A 4U5XA 2R6GA 4RCZA 1VG8A 2EYUA 1FP6A 1XBTA 1YHNA 2O8FB 2WOOA 1RRGA 1G5TA 1I2DA 4EPTA 5JSZB 1II9A 1SGWA 4LGMA 4PAOA 5FBVB 2J0QA 1GDDA 4YQFA 1Z28A 1Z22A 3R9XA 3IBYA 2X19A 3MD0A 2GVZC 4ESHA 4DB4A 1YZGA 1FNMA 3SQWA 2GCOA 5AUPB 4Q18A 1H8ED 1KDPA 2D74A 4IVQA 3FGNA 4IFBA 4QC2A 2HUPA 2JCSA 2MMGA 2QM7A 5G3YA 3KZ1E 3ND9A 4D81A 1DAHA 1J8MF 1MR3F 1N0WA 2I1VB 1XX6A 4QRHA 5DI3A 4LJYA 1E0SA 3EG5A 2BEKA 1NY6A 4A8JB 2ORVA 3ADKA 4B3DA 821PA 4YONB 1DE0A 3NWJA 4PSVA 3CF0A 4YMUA 2X77A 1ZMXA 4BFYA 1S2MA 1W0JD 2ZYVX 2GK7A 2JASA 3GEIA 1KNXA 3IPYA 2JAQA 3K0FB 3OIYA 1KO8A 3DOFA 5AJYA 2GJKA 2O8EB 3DZDA 4Q66C 2QGNA 4UXIA 4FCTA 2HLDA 1X86B 3U3KA 1US8B 4NMMA 1M34E 4DLRA 2R2AA 2PMDA 4MITA 3NTUA 3GJ6A 4ZIRA 2QL6A 1YRBA 2JDIA 4ITRC 5JEEA 2VO1A 4YMVA 3P1JA 2MSDB 4IKEA 1EWQA 1QRAA 1UKZA 2ZJAA 1KYIA 4ZPXA 3F8TA 3AF4A 2BM0A 4GT1A 3ZGXA 3AP1A 4Q7JB 1G6HA 2NPIA 4DDVA 3WP1B 4QXAA 5JRJA 1Z6XA 4JKYA 4M1SA 3I32A 4LPSA 1K8RA 1KK1A 3Q9LA 2JIZD 2IHBA 1M74A 3VHLB 5B57C 3BRWD 4NHOA 4OK6A 2C5LA 2BJVA 4WZAE 1JJVA 3CPJB 5KSPA 1Z6YA 1JI0A 2UZ3A 2ZE5A 3QKRA 4EPRA 3SS8A 2O8BA 1E0JA 4N1AA 2WSMA 1GOTA 2BCGY 4V0LA 2GWHA 1F5NA 1DVRA 2IYLD 2V7QA 3GJ8A 4Q02A 4A0HA 5IRCD 2EFEB 3QNUA 2IYTA 2YWGA 4CIDA 3SOPA 1JAIA 2GEDA 4JS0A 3IO5A 1E6CA 3QXJA 3CPHA 4KSBA 3ZLJA 3L82B 2WAYA 3OF5A 3OAAD 4Q9JA 3VKHA 1UKEA 1CJUC 3TSZA 4IEIA 1WP9A 1IM2A 4M4SA 4C7OA 4H1UA 3CRMA 4LOAA 1WB9A 3K09A 2LCFA 3N70A 1VCOA 1COWD 4OHZA 1MKYA 4CEJA 2KSQA 3B82A 2D2FA 3PEWA 3VMFA 1NN0A 4IVRA 1Q21A 1B0UA 1E9FA 2O52A 1P2UA 4YMWA 1F3OA 1VCMA 3K53A 2PJRA 4EAQA 5DSZA 3MGCA 3TR5A 3MUFA 2ZVPX 1JXOA 2N46A 3B1YA 2XGJA 1Z0FA 1ZC4A 4IRUB 3QG5A 5DIFA 4TTPA 2NZJA 2YWEA 4HEJA 4HZIA 5FTLA 1U2RA 2OBNA 3LA6A 3N2IA 3B8HA 5TDHA 4E09A 3T5DA 3TUZC 1KMHB 2V3CC 1HE8B 3HU3A 1OXVA 2J45A 3EW9A 3KKMA 4GP6A 5FR1A 3WRYC 3LW8A 3QF7A 4A8JC 2O0JA 4KHZA 1N6KA 1OLOA 2R65A 1ZP6A 3W6NA 3EPKA 1F2UA 4KFUA 4M1KA 4URYR 4WXPA 3RWOA 2ZR9A 4C0KA 3F3YA 1XPUA 2BEJA 4PO9A 2CHGA 5E3HA 4DCUA 2C77A 2ZUDA 3BH7A 1R2QA 4M9SA 1WBDA 2QP3A 2F1IA 1UBGA 4WIAA 4XIGS 3NC1C 3RWMB 4TZ0A 2IXEA 2ZUBA 3KXKA 5HE8A 3EWSA 3AVPA 5J4YA 4JLMA 1OE0A 3TK1A 5IF9A 4Z51A 2JLXA 1P2SA 2F6RA 3TNFA 2ZJBA 2RGBA 4CT5A 4D0GA 5FOWA 5FL7D 1OIWA 3THYB 2HXYA 2QEQA 3BFXA 4L9SA 4DT1A 3LAWA 4PO1A 1P4SA 2B7BA 1W36B 1KJWA 3AKYA 3U61B 3SQXA 4HLDA 4D0NA 1Z0AA 2VIIA 4RZ2A 3VR1A 4DLZA 1NRJB 1P9WA 3PXGA 3FB4A 2CVHA 1WE2A 5CJ2A 3WNDA 3GLHB 3DZ8A 1XPOA 2L0XA 2I1QA 1KO5A 1OXXK 1MRNA 2J0SA 1RJ9B 4QG7A 1L4YA 1UM8A 4Z8YA 1E2DA 2HV8A 2OUKA 1FW6A 1UEJA 4A2PA 1KI9A 1XTIA 5JWOA 1II8B 3M4YA 4FWTA 4W9MC 1GZSA 2ZI4A 3LD9A 4C0BA 2GXQA 3FPAA 4QGAA 3ZS9A 3HP1A 4OHXA 2O8DA 1ZM7A 2O0KA 2RHMA 4ON9A 4DDTA 2PH1A 4TYPA 1XXHE 5AUOB 2QQEA 3MJRA 4PPGA 1MABA 1D9XA 4NCHA 4DEXA 1D2EA 1VCIA 1L2TA 2CNWD 1ZAKA 2QI9C 4IDNA 4RZXA 3RSLA 3LLMA 3GLFE 4KO8A 3GEEA 3CZPA 3WP0A 4E03A 5JI3E 4LCBA 4LY6A 3I5XA 3Q8XB 1ESMA 1TU4A 4W7SA 5JJKA 2VP2A 3CNOA 3OEHD 3PFIA 4DDWA 2WSSD 2N1BA 1Q1BA 3BK7A 3THOA 3VQTA 3QEOA 2RGNA 3CB4A 1YJ5A 4NTZA 3GJXC 1QHIA 2QPTA 2ZRFA 3EC2A 1PV4A 4TZ6A 5IK2D 4AWXA 4QHYA 4Q4HB 4QBHA 4BZPA 2ZSAA 1H8HA 2DFLA 4TT3D 2ONJA 3AF1A 1E79A 5JRZA 1U81A 3EARA 5P21A 2ORIA 2G0TA 3EAQA 4JSYA 3THWA 4MKIA 4QM6A 1IY1A 5C2JB 3ZD7A 3DM9B 2ANBA 4IDPA 1CJTC 2BHRA 2YOFA 2ANCA 4AK9A 3C8UA 2OCBA 5HR5A 1W0KD 1PVOA 1EFRD 1G7SA 4XSGA 1AKYA 2WKPA 2ZSFA 1EFHA 1LTQA 3E5HA 1NBMA 2X2FA 2GKSA 1X6VA 3B13B 3PG5A 4F4IA 2IX3A 1EFUA 1Q3HA 1YR9A 2IYXA 2ZPTX 1JNYA 2ZREA 4MDFA 1G3UA 4OBEA 1D9ZA 4HZUA 2GHIA 2XNDD 3PUXA 1I4DD 1IY2A 4V0NA 4AKEA 4ESVA 1KJYA 4BLSA 3EZ2A 3D7MA 2XOKD 1FPMA 3KJIA 1W36C 4UXHA 2IYZA 4UJ3A 1YZLA 1WCV1 5SZJA 5L3QA 3KXIA 4BECA 1YR8A 2D4HA 3QKRB 1QHGA 3KL4A 4LHVA 1N2CE 1F6BA 2ZYTX 4NH0A 3RAPR 4B34A 2O8BB 1L4UA 3CUEF 4XD7D 1XTRA 2GJAA 2GF0A 3KB2A 1Y63A 2TMKA 1E9EA 3BORA 4O2RA 4IOLA 1HQCA 2AHOA 4BEJA 4OHWA 2P2LA 3BB1A 2ZS7A 4PHTA 2F43B 4CZ2A 4Q9LA 4Y0VA 5EP3A 1KI8A 2Q3FA 3WXMA 3V00A 2JATA 1CJMA 1EX6A 1Z2CA 4C7OB 4J0QA 3VR2A 1CULC 2BC9A 5AUNB 4OJKA 4HB3A 2V8OA 2FPMA 521PA 4HI0E 2CL7X 4FMCF 4BGDA 5AR1A 1GITA 3THXB 4ASUD 1RW4A 4B2LA 2ZJ5A 2ODWA 4RD4A 4URUR 3RS4A 4NPHA 1ZM4A 2WHXA 1SKQA 1TTTA 1IXRC 1HH4A 2EFDB 2DFTA 4WVFA 5BN3A 1J2JA 3ZZTA 2G77B 4B71A 2MMCA 3WBKA 5CK4A 1CR4A 2H17A 4X8MA 4KV9A 1Z63A 2HT1A 4WBSA 1D2MA 4BFTA 3W9YA 1E2LA 3CF6R 4Q4LA 2IL1A 2IYUA 4JJZA 3T35A 3KQKA 5C46F 4LBZA 2J7KA 5BN5A 2BKEA 4US0R 3IBGA 3QPVA 1XTKA 5AJXA 2LWIA 1JR3E 1LV7A 2HJVA 4G01B 3S1AA 1XPRA 4JVNA 3L2OB 4NCNA 1R4AA 2FEMA 1F2UB 1XEWX 3KDSE 3W8NA 2AFHE 2AXPA 2Q9CA 1HT1E 1Z47A 2RGEA 2ZRNA 5FFMA 1LF0A 1W46A 3ASYA 1W36D 3O47A 3RS3A 2D7DA 3FMIA 4DCVA 3QSYA 2F7SA 3WHKA 2VP0A 2ZS8A 1J7KA 5EP4A 3B9QA 2E87A 1SHZA 2HDNB 4YXWA 1QF9A 5UKDA 2AFIE 2ORWA 3FHOA 2QGZA 1G21E 2GK6A 4LWZA 4B2PA 4MRVA 4YDHB 3TR0A 4A2WA 1KIMA 3F0TA 1GNQA 1JR6A 2R62A 4OHVA 3PJRA 3R20A 3NKVA 1IAQA 3GP8A 5TXGA 3SYLA 4G5QA 1YZTA 1G7CA 2V1XA 4DT1B 1C9KA 3B1XA 2Z5FA 2VF7A 2VTKA 2RKOA 3IPXA 2X8AA 1SVMA 3T12A 1M7GA 1J90A 2QAGB 4TTQA 3RNLA 5DHAA 4EQ6B 1Z08A 1Z0KA 5L3SB 3RDPA 5DYGA 2O5VA 4G3XA 3AUXA 4LV5B 1SKYB 3W8RA 4LV8B 5E7IA 4FCVA 4TL6A 3A1SA 5AJZA 2Q3MA 4L16A 2ZU6A 4LJ8A 5FUYA 3OFND 1ZCAA 3CONA 3CRVA 2ZJOA 3I8SA 4Q5IA 2ZU0C 3OHMA 4PSAA 2NPFA 3KKOA 2XZLA 4XH9B 3SHWA 4WW0A 4EPVA 5AWFC 1KI3A 3GJ3A 2ZRLA 4KAXA 4Q47A 5B30A 3LX8A 4CYMA 1G3RA 3O8BA 1AK2A 1E4YA 1OPXA 1OH6A 3IIMA 4XTRA 4CT4B 4CRWB 3A36A 3ZH9B 4KITB 1F60A 3U7FB 1N6PA 3QKSA 5FOVA 1SXJE 3L8YA 1Q20A 1TF5A 4OKSA 2XNSA 1DTSA 1GWNA 1MABB 2W58A 3B5JA 4FN5A 5FH9A 2HLDD 2FJUA 4EJSA 4HDCA 2C03A 2YYZA 4KYUA 4ZCLA 4DEYA 3PUVA 5F9FA 3E2IA 3ASZA 2PZGA 4MRRA 2F55A 4MKHA 2P67A 4ZV4A 2GNOA 4Q1BA 4RD6A 2R6CA 3LXXA 4Q7KA 4OYHA 3T06B 1JR3D 2V6IA 1CLUA 2R6AA 1TL7C 1E2KA 1TX4B 2BBTA 3G5UA 1HQYE 2RGAA 3THWB 2CK3A 4B43A 1VCNA 1ZRHA 3DDCA 2CL6X 1FOEB 2FG5A 5EUQB 1KJZA 3I92A 3GD7A 5TARA 5IT5A 2FFHA 1PUJA 3BGWA 5K8UA 4MGKR 1KGDA 3HPRA 3FOZA 1WMSA 2VP9A 4W5WA 2V7QD 2BVNA 2WMOB 2A3RA 1T8TA 1PLKA 3PVSA 4PHGA 3UMRA 1AN0A 1LB1B 5F3WB 2IWRA 4LJ6A 2NQ2C 2OV2A 5BYKA 1KHTA 1W49A 1CRQA 2FFAA 5SZKB 3TLXA 1CR2A 4HZUB 4MGZR 4MKFA 4TYWA 1ODFA 3DO6A 4ZO4A 2C99A 2PLRA 1Z0DA 1RPZA 4BASA 2J5XA 5BQ5A 1Z3IX 4B3CA 5L3QB 4DSOA 2IXFA 2J3EA 4UXJA 2QAGC 3HU1A 4GZLA 1OXTA 2Z6VA 3ADDA 2FGKA 3HWSA 4BLOA 2KWIA 2O8CA 4DCNA 5TV2A 2OAP1 2F3RA 4P33A 1ZM9A 3GJ0A 2ZROA 2YZ2A 2C95A 2GCNA 3ZZUA 4UNRA 5M04A 3WYGA 2HF8A 3EZ6A 1P75A 1G4AE 1BO6A 2IYWA 3OE7A 4HSEA 1S9DA 5CB8A 2G3YA 4TLEA 2P0EA 1E1QA 4TL9A 5KPDA 2JLQA 2OSBA 1T0HB 2A78A 1FTNA 1JJ7A 1ZIPA 2V1UA 3DEFA 1NMZA 3UWOA 4DWJA 3H86A 4WZBE 2WJYA 4EKDA 3O8CA 3CX7A 3KTAA 3A4MA 3I72A 3CPEA 3PUZA 4LZZA 3HDTA 4A36A 5DISB 1LNZA 1P60A 3REGA 2H57A 3UKDA 4DUGA 2WJVA 4QGHA 1XXHA 3H84A 5DGXA 5JJLA 2ZRAA 4HUQB 1NSTA 5B64A 1XZPA 3KQHA 5TVKA 1PUIA 1U0HC 4Q21A 1XFAA 2PX0A 3FKSD 4F92B 4JVSB 3RYTC 3ZIAD 4QBFA 1G16A 1G1MA 1T3HA 3EIEA 1X8KA 1F48A 5E7MA 5KSYA 3BFKA 3U6KA 1GILA 4L4UA 4BLQA 2JJ1D 3JZAA 1UF9A 3S1AB 5FPSA 4F91B 3C7KA 5FBLB 2ZI3A 3IDQA 1G3MA 4KCGA 2GDJA 3IIKA 5KSZA 1VHTA 3K70B 3C16C 3OESA 4B47A 1YQTA 1QG4A 2QT1A 3I8XA 2ZE7A 2PMKA 2RH5A 3BE4A 3CF2A 3H0KA 4EUNA 1AIPA 2J59A 3RABA 4D4JA 4L9WA 5CYOA 2I3BA 2ZRDA 2JLSA 2Z43A 4PZZA 5D3MB 3GJ4A 4NYJR 1N6OA 3QJYA 3AVXA 1ONBA 3KKPA 1SVSA 5DLQC 4RSGA 5JCPA 4UNNA 3WNCA 2ZTSA 3NH6A 4O2LA 3R9IA 4QJ4A 1KZGB 1G8GA 1R7RA 1RKBA 1T5LA 1E1RA 4RY2A 3M6AA 5DH9A 1G8HA 3A1VA 4P0TA 1T4GA 2C9YA 3PR1A 2D3WA 2EFHB 4LV6A 4BQSA 3ZDQA 1E2JA 3CKLA 2W6ID 5CITA 2SHKA 4M1YA 5G53C 4C0JA 1E9BA 1E9CA 4PSKA 4NYJQ 3HR7A 2WWYA 3TUJC 5EQTA 3FHTA 4OQFA 3AF2A 1DS6A 4I1UA 4RFVA 2VHQA 2X1VA 4XWAA 1XNJA 3TMKA 3GLGB 1OFTA 5EUMA 4OHYA 4G0NA 2YC2C 3CLVA 5JHHB 4ILEA 2ZI9A 1NVVR 3NC0C 4BFUA 1FUUA 1G8PA 4LX0A 1IY0A 2BBOA 3BERA 3CO5A 2OCPA 2Z4SA 3EPHA 3L0IB 2ZRBA 3MCAA 4TSFA 1M7BA 1RYHA 3QKSB 2YC4C 4A15A 4D6PA 3NDPA 2VH5R 1W5SA 5HKKA 1H8HD 5CJPA 2PEYA 2H8KA 4PR0A 1KK0A 1NL3A 4OI2A 1FQKA 4E22A 1FQJA 3TSOA 3CM0A 2J87A 3C14C 3IILA 4MGYR 3A1TA 1L8QA 1TEVA 4KODA 4EJSB 4DDUA 4R71A 1EGAA 4NU0A 4TMKA 4TWZA 1XTSA 1Z6GA 1ZM3A 4KBGA 4TN1A 1BS1A 1NVVQ 2JJ2A 3SYNA 3CR7A 4JLJA 1H65A 5DE3A 1NN5A 3U6BA 5C1BA 1A7JA 4QM7A 4MYTA 2RHDA 1D6JA 4TMTA 4RKFA 2NZ8A 4BFZA 3TW8B 1OW3B 3WHLA 3B2EA 3FHCB 3AM1A 2WPDA 5TB5A 2BWJA 2QPOA 3LVQE 4ACBA 2XSZD 2DR3A 1M6NA 1KI1A 3ADCA 4C0HA 2ZIAA 1I4TD 4FWIB 3A4NA 1RC8A 3E1SA 1JPJA 1CJVC 1GP2A 5LB4A 2A5YB 3SJAA 2MSCB 2ZJ2A 3CZQA 3CRW1 3QENA 1IONA 3U4QA 1W44A 1VPLA 1X8JA 4LYHA 5FPKA 1UEIA 4MUBA 1U9IA 5FTNA 4GDFA 1GL9B 2CJWA 1N6LA 5EE3A 4ZDIA 4QHSA 1P9NA 2WWHA 2IUUA 3PV0A 2OXRA 2E9SA 4TLDA 4JZKA 3X1ZA 2NMVA 1Q12A 1A4RA 5G3ZA 1KDOA 3B1VA 1EK0A 4ZCMA 4V0MA 2EU8A 3CH4B 4KLNA 3VX3A 2LKCA 1OKKD 2HCBA 3QF4A 1LF5A 1Z06A 2QP4A 4HDOB 2ZM5A 2EFCB 3DMNA 4JLAA 2YNMA 2HYDA 1OB2A 3T1TA 3U44A 3P27A 1UBCA 1XWIA 1TNDA 4BFSA 1Z5ZA 2ZR0A 4JT2A 1J8YF 4QNMA 1N6IA 3SFZA 1SULA 3LNCA 5HZKA 1T0JB 5DN6A 5FBQB 5HTKA 1OHHA 1X3SA 4GZMA 2YWFA 4PPQA 2WJJA 5EE0A 3R7WA 4HLUC 3X1WA 3LLUA 4Q9IA 2VLIA 4TQUS 1P62B 1W1WA 4P4SB 3GFOA 4NL4H 1DARA 1NN3A 1Q1ZA 2ZSEA 3K0CA 2R44A 1CRPA 2JA1A 1G19A 2RAPA 5H68A 2FU5C 4H9GA 4Q9KA 4D4MA 3IQWA 4RFSA 1JQLB 3NHBA 5F2EA 2VPPA 3SBDA 2FNAA 2A2ZA 3RC3A 4JMPA 3QVVA 5C4MA 1XEFA 2WJGA 1M1YE 1XCMA 3KTAB 4DZZA 1EWRA 1PJRA 3QXHA 4TYQA 4FCWA 5KU1A 3K70D 4WOPA 1MO3A 3BB3A 1G20E 4UNPA 1SXJA 4MYHA 5HPYB 1XD9A 2CXXA 2KI5A 3ETLA 2CLDX 1W4BA 2CLSA 4CW7A 4UQOA 2B92A 1DEKA 1AGRA 3UWKA 4ZDJA 3A37A 3SJCA 3VU9A 1RRPA 1ZUIA 1NP6A 4RZ3A 4D26A 2FA9A 4G5OA 4IEEA 4IFEA 1N6HA 4LBWA 4M2LA 3AVUA 2VHCA 1KK2A 1Q1EA 3TSWA 5C4GB 3SZRA 3TGPA 1G5PA 3RS5A 5JEDA 1E2QA 3R9WA 2IC5A 2QNRA 2XXAA 4D2IA 2IS1A 3I5YA 421PA 1FP7A 1OXSC 3AVVA 1I2MA 2FN4A 2GBLC 1P2VA 3GLIA 2VP5A 3GFPA 3RHFA 3VFDA 4GL2A 3ND8A 4D80A 3FTQA 2J0VA 5EE5B 5E7JA 2JJ8A 2BV3A 3HYTA 4PHHA 2ATVA 2WV9A 2FX3A 1OIXA 3AVOA 3ZD6A 1G7RA 1IJFA 4I1SA 2GJ9A 3KXLA 1Z07A 1YVDA 3BXZA 2IS4A 3FMOB 1LY1A 3C5HA 4QFMA 1BYUA 1AA9A 4D0LB 4DIEA 1ANKA 1KI2A 4PQYA 2GEUA 4GMDA 4JSTA 2QM8A 2GCOB 2VBCA 4DSNA 2AWOA 4TQAA 5KUTA 1Z0IA 2P5SA 4HB4A 4JVLA 4X8LA 3DPUA 6Q21A 3QXSA 1H8EA 3G0HA 4A9AA 3KKQA 5DI3B 3LY5A 1RFLA 1OFHA 4V03A 1NMYA 1WXQA 1OFIA 3M0EA 721PA 2FSFA 2H16A 3IHWA 1OV4A 4BRWA 4I81A 1P72A 4R7ZA 4LSGA 1Q44A 2E1RA 1FZQA 1W0JA 5E95A 1EX7A 2F9MA 2H7VA 3UG6A 5KPJA 4N3NA 3HR8A 5ELXA 1S0UA 4NONA 4POAA 4RD2A 4Z1MA 3QXCA 1QZXA 3VNVA 1U0LA 1NN1A 2IBMA 4ZIRB 4F93B 3GLHE 4LRWA 2QTHA 1KO1A 3KUCA 4PC7A 3K8YA 1S4QA 4NDZA 3AVTA 4AKGA 1GL6A 2QE7D 1XD8A 4IHQA 4DHEA 5DHFA 1W5TA 3VAAA 2CCJA 2CK3D 4AURA 2UZIR 1DAEA 1SVWA 4WZ6A 5LD2B 2GJSA 2UKDA 3BB4A 3CW2A 3T5GA 3A1UA 4BWYA 3JVVA 4ACAA 4B6EA 5TMPA 2KBEA 4RZUA 2HT6A 1HY3A 1T9HA 3LRPA 1G5RA 3H4MA 2DWQA 4M8NE 4BLPA 2DHRA 3NEJA 4A1FA 1OT3A 4R98A 4DLVA 3CRQA 3T1OA 4XVRA 2FOLA 3R8CA 3BC1A 1P61B 5JWRA 2QRNA 4GOXA 2IS2A 4KLZA 2AN9A 4PHFA 1DAIA 1S3GA 4KI0A 3ZS8A 4TYNA 4LJ5A 3QE0A 2W0SA 4RD0A 1RVDA 3MWKA 3SE0A 3SYKA 5EXXA 4MRNA 1CR0A 1YZNA 2HEIA 4OI0A 4JL6A 3U4QB 3P26A 1SVIA 2KB0A 4P32A 3GJ7A 8OHMA 1RIFA 1MO6A 4PZYA 2QMEA 1WDTA 5G41A 2CJWB 3SDZA 2PL3A 2YJTD 2WICA 2ZRGA 1NVWQ 2H18A 3OAAA 3AVQA 4XWKA 1E9SA 1M2OB 1XRJA 3QY0A 3LBIA 1XZQA 2G88A 4FW9A 4K46A 3TRFA 2KE5A 3C4JA 5LPNA 4E07A 2G6BA 2AWNA 4CEJB 3PEYA 4AG6A 1COWA 3QBTA 1O3YA 2QORA 5EJEA 3D8BA 1JXMA 3QF4B 4Q1EA 4RCYA 4ZKDA 3IHLA 5JMTA 1S9HA 1LS1A 3HPQA 4QBIA 1RRCA 4B75A 3R8FA 1XEWY 1HT2E 3OIVA 1E32A 5JJIA 2IUSA 4QBGB 1CTQA 3AKCA 2FGJA 3TUIC 4PTLA 4U00A 1CP2A 2CDNA 4NYMQ 4X8HA 4WAUA 5CM9C 4TMVA 1JAHA 4PPNA 4B74A 3BBPA 1D5CA 4GOJA 2EVWX 2ZRPA 3NBXX 1XEXA 2C8VA 3TAUA 1G7TA 1W2HA 5CLQA 3LX5A 3AKDA 5SZHB 3ZVRA 1P9RA 1QVAA 3FE2A 2DY1A 2G0NA 1UBFA 2F1JA 1XCGB 3EA0A 4GFDA 2REOA 4IW3B 4URWR 4DC9A 3VNUA 4PFSA 5H8WA 3U3OA 2JLZA 3SN6A 1GL7A 1VECA 4Q7LA 2G9NA 4LJAA 4GI7A 4BZQA 1OH5A 3FMFA 2XB4A 2V54A 2IT1A 2W2VA 1XMJA 3ZJYA 2VSOA 4OK5A 4XSHA 1O87A 3KJHA 1GSIA 1N0UA 3K0AA 1IXSB 2DCUA 2W6JD 2ZRJA 3PIRA 5FOXA 3A6PC 4MKGA 4W5JA 5GJCA 5J4HA 1G41A 4W5HA 4MGIR 2F1RA 2VHTA 3BD9A 3Q3JB 4O25A 3FKQA 4R2HA 5JECA 2ZRKA 1Z6AA 5DI9A 5EXPA 1UADA 4GP7A 2A9KA 4TL8A 1Z2AA 1IOZA 3PENA 3G82C 5EZ6B 2VF8A 2IK8A 3U60B 1S96A 2DWOA 4EPWA 4D82A 3HU2A 5FL7A 1CJKC 1LW7A 3AV0B 1JALA 2F9LA 4LJ4A 3MRSA 4B73A 3VR3A 4IOKA 1R0YA 2OT3B 1ZD9A 4ARZA 2BCJQ 3CR8A 1T91A 3FWYA 5HE9A 2BBSA 2QAJA 5FBRB 2GAOA 1BIFA 4KJZA 4PC1A 4NKRA 3UMSA 2V55B 2F3TA 4RKEA 4KBFA 1FTSA 1TPZA 2GXAA 4CDGA 2EQBA 4LC0A 1E1RD 2XXAB 1ESNA 2OCAA 4QKQA 2P5TB 5JSZA 3OEEA 3SJBA 4K81B 4CVNA 2EWWA 2JLWA 1P5ZB 3GLIB 5EP1A 3EPLA 3P4XA 4M9QA 2ZE6A 1XDBA 3TAHA 2ONKA 5HZHA 1KO4A 3GEHA 4B76A 4PQRA 4KFSA 4AC9A 4HAZA 4ZKEA 5F9HA 1BMFA 2ZETA 2BIFA 3MLEA 3K09C 1HURA 3BOSA 5AJWA 1GTVA 1ZBDA 1E9RA 1I4LD 2RGXA 4DBLC 2VL7A 4CF7A 2O8DB 2J41A 4A8JA 1GM5A 1XD2A 1M8PA 4U7DA 3TJZA 4UNSA 5GJVC 4DLUA 1AJEA 2IW3A 2IYYA 2J0UA 3L0PA 1PZNA 3ZQ6A 3RSOA 5IHPA 2WIAA 3OZXA 1QVRA 2N42A 2R6FA 2J46A 4A6PA 1E9AA 4B33A 1UKVY 4TMZA 4URVR 4QOSA 2IYSA 3C5CA 4A6XA 2CNWA 2JDID 1CU1A 3O8DA 5G40A 5GADl 3TE6A 4JL5A 1E4VA 4FMDB 3SNHA 5HKKD 1DAFA 2A30A 5FTJA 2WBLC 2ATXA 4FMBB 1XMSA 1OFUX 1EFTA 4RD1A 3OEHA 3WNBA 4EPYA 2XB2A 4JLOA 5CIQA 2WSSA 4DCTA 4BPBA 1OB5A 2NOAA 4LDJA 3X1DA 1AGPA 4DJTA 5GJWC 1TU3A 2JJ2D 1FL9A 4HAXA 1NF3A 1NLYA 1ZD1A 5J47A 5IK2A 3KQNA 1JQJC 1VDZA 4TT3A 3LO5A 1NKTA 3O8RA 2PX3A 2A7QA 3TQCA 3LBNA 4M53A 1YRAA 1SKYE 1AS2A 2CLCX 5KO2A 4V0KA 4NYIR 2WKRA 4JLPA 2W2XA 1R6BX 2ZYWX 1LFDB 1N5KA 1A82A 1W0KA 4JBWA 5CDFE 3EWAA 1EFRA 4TMXA 4Q03A 1R0ZA 2BMFA 3IEVA 3D31A 2FSIA 4BE7B 4JIMA 1HA3A 2YVUA 3NBFA 3BJIC 1E99A 4C9BA 4WXRA 3WBJA 4US1R 4V02A 1E2MA 5KSOA 1G8FA 3CX6A 1X8LA 2J7PA 2YHSA 2ZI6A 1IN7A 4KU4A 1OH7A 4CGZA 3EIQA 3LWNA 3IIJA 4DB2A 4DSUA 3EIHA 5KNCA 1Z29A 2XOKA 3GQBA 1CBUA 4NYIQ 4EPXA 2GEVA 1JEDA 4DLTA 3SJZA 2IEYA 4GBMA 2IF2A 4AIIA 1MV5A 2VSFA 3KFVA 3N5CA 3MFYA 2Q21A 3RS2A 4Q4AA 5FL3A 3AVYA 2XTMA 1JBKA 2A5JA 2EWVA 5FTMA 2GVDC 2GZHA 3A4LA 4XD7A 4PC2A 2ZR7A 2AR7A 2QU8A 3SC3A 2CHVA 1GFIA 4C30A 4F4JA 1P6XA 1KI6A 3FDIA 1KTVA 5DN6D 2G83A 2Q9AA 1E96A 2BMJA 4B3FX 4LYJA 4Q01A 2FFBA 4PO8A 1ZINA 3L0OA 3AB3A 3BIFA 2XJ9A 3BH0A 3MG9A 4M22A 3VKWA 4CEIA 3H1TA 3LFUA 4GSYA 3P4YA 2IF0A 4G5RA 1P3JA 2ZAOA 1W48A 1KMHA 4URXR 4R2IA 1CIPA 1ZD8A 4Q1CA 1GRRA 3UXMA 5JLJA 4MQBA 2AXNA 5DO9A 4ASUA 3CNNA 3EX7C 3P32A 5CIWA 1K5DA 4B3GA 2Q3HA 3EASA 2YV5A 3CRRA 4GMXA 2OEPA 1EG7A 5H1YA 1IHUA 2DPXA 2FFQA 2XX3A 3KB1A 3UPUA 3BWDD 5E4FA 3NBZC 2XZPA 3K9HA 3RRMA 3GLFA 1NBME 3MWLA 4ERNA 3OIUA 2HJGA 3VR6A 4HAYA 4C2UA 4DKXA 2YWHA 2V9PA 4U02A 1NVUQ 2VSXA 2ZRIA 1A1VA 2YKGA 4G1UC 3DOEA 1XEXB 2RGNC 3VHXA 2NGRA 2VHJA 5DYIA 1NY5A 4C0QC 1E2PA 4Q4JA 4QL3A 1UKYA 5JI2E 1E2HA 4Q1AA 4LK2A 1E0KA 3MSXA 4IJMA 4F38A 4PAQA 1GAJA 2OXCA 3THYA 4D25A 4JKIA 2BOVA 2IS6A 4LJ9A 4A4DA 1MRSA 5KDDA 4TQ9A 1F2TA 2W00A 3CH5A 3K0AB 4RD3A 1E9DA 4JVMA 1N0VC 4OK3A 3DL0A 1G3IA 5ANRB 3SI7A 4GOKA 5FOSA 1E3MA 4IDHA 2ZITA 3GLHA 1E69A 2B21A 2ODBA 4GRAA 1ZIOA 1VG0B 4TLCA 2HCJB 1RJ9A 1KMQA 2PJZA 4PXAA 3VR5A 2ZRCA 2WKQA 3CIOA 5CM8B 4FMDF 1V43A 2WJHA 3ADBA 5FI1B 1P2TA 3IKJA 3B60A 1VKJA 4KVAA 1KI4A 3TW4A 1KKMA 2JLVA 4ARZB 3AGPA 1WF3A 3Q7QA 1E2NA 4L15A 2H5EA 1KK3A 4V0OA 4L8GA 1FNNA 2Q9BA 2BMEA 2YOGA 3K1JA 4S35A 1IBRA 2R8RA 4LHYA 5KNBA 1IQPA 5FR2A 3JZMA 2F1HA 2G1JA 1YZKA 4Z54A 3UK6A 2WZQA 1QBKC 3OFNA 2I4IA 2BM1A 3L43A 5KTYA 4MRPA 2ZUCA 4TYYA 621PA 1Q1QA 2JGNA 1N25A 1K5GA 2ZS9A 4II7A 4PANA 1OF1A 1ZW6A 1Z83A 2CEAA 3KJEA 4I1OA 3U7GA 1RZ3A 2R6DA 1XD2B 3QOFA 5SZIA 5JZVA 2FMXA 4OQNA 4L5BA 3T1QA 3LQQA 1S3SA 4JL8A 1E79D 3MAAC 2NO6A 4HUTA 1KKLA 1T8UA 2J0UB 2OE2A 1NI3A 2UVQA 3LV8A 4Q4HA 3V9PA 1Z6TA 3BS4A 2FF7A 4Z1MD 4Y0AA 3J81k 3I4LA 4QJ3A 3CWQA 1GUAA 4LUCA 1R8QA 2PT5A 1W4AA 3V4RA 5FUXA 1G8YA 2QMHA 1CR1A 3RLFA 2ZAMA 3PCRB 3REFA 2GZDA 3DHWC 3I61A 1LS6A 3RVBA 2V4ZA 1BYIA 1NBMD 4LJ7A 1TQ4A 1ZYUA 2ZE8A 4MRSA 1E2EA 2GESA 4PQFA 3TVTA 1N6NA 1E0AA 2AKYA 3UIEA 4FINA 2QUZA 4XJXA 5KHOC 1DBSA 2WAXA 4CEHA 2NO7A 4ZCIA 4LHWA 2XTZA 4JLKA 3IQXA 3GPLA 4B48A 1JR3A 2VRWA 4JYCA 3K70C 1VG1A 5LDDC 5EE9A 4MDEA 3FFBA 2DFNA 3VTKA 1G64A 2WWFA 2WVJA 4PX9A 1HE1C 2C96A 3DKVA 4OQLA 1XB2A 1NJFA 1NIJA 4JT4A 3GLGE 1TMKA 2FZ4A 2ZEJA 2GZAA 2PCLA 2GRJA 3IEUA 4NP6A 4E5UA 1AQUA 2AKAB 3I3SR 4B3BA 2OFXA 3W90A 1R5BA 3LXRA 4N0DA 5LB2A 4DLSA 2XJ4A 2F43A 2GAAA 2ODNA 1NMXA 2QMOA 3PEUA 3NHAA 1K6MA 4LPKA 5JWHA 2DBYA 3Q7PA 1WBBA 3FFAA 1N6RA 2AK3A 1VYUA 1E94E 2BMDA 4Q1DA 2WIBA 4EFLA 3I1FA 3K9GA 4MUAA 4A0GA 2GETA 3TH5A 1AQYA 5CYPA 5L8VA 3QXXA 3D3QA 2QROA 4HYYA 2QZ4A 2O8CB 3IUYA 1ZU4A 4A0FA 1TUEA 2QMUA 2QT0A 1ETUA 1YR6A 3THXA 3DVLA 4Q4AB 1CEEA 4YC7A 2GF9A 4DVGA 1E2FA 1SVLA 1JB1A 3QVUA 1NG1A 1CXZA 4HATA 2GXSA 5KNDA 1UAAA 1OXUA 3LDAA 1KI6B 2WWGA 3LW7A 4C4PA 1BKDR 3EZFA 1DO2A 3ZVNA 1DADA 1XMIA 1QHYA 4DXAA 1KAOA 1TEXA 4LYAA 4CEIB 1D8TA 1MO5A 1KSJA 3QQ5A 4QJ5A 1E98A 2DFKB 4R9UC 1YZUA 2WWIA 1P73A 2OCYC 5B58C 5J4LA 1OIVA 1GKIA 3U7HB 1AKEA 2QBYA 2IYVA 4IDQA 1J99A 1N5IA 4US2R 1KAGA 2GILA 5EZ5A 2C9CA 2EYQA 2CBZA 4QGGA 1TADA 2ZYUX
chains in the Genus database with same CATH superfamily
2V6BA 4YH1A 3GVCA 3EFHA 1OWPA 2GJ8A 1TAQA 3IOMA 3NVAA 4K8RB 4REOA 4AY2A 4AF8A 4FB5A 1KDRA 4ZI5A 2CV0A 1WRBA 2JCYA 2YASA 3UFXA 3NONA 3TLMA 4WEOA 1SU8A 1Z37A 3NJ4A 3TE7A 4O33A 1V4BA 2MINB 4EJMA 4ZYTA 4ZI2A 4RIIA 4AP9A 5BQFA 1X1SA 3CWZA 1L5QA 2A6PA 4ARIA 4TMWA 3H42B 4B5KA 3KWFA 4PZ0A 4ENQA 4G2TA 1OOEA 4Q4JB 5IANA 2J3KA 3ZQUA 4FHFA 2YWBA 1AUPA 2W93A 2HXSA 2Q41A 2I62A 2VWGA 3FFXA 1QYDA 2WHEA 4HFNA 4MV4A 1OTXA 3MA0A 1RTTA 3KOUA 3UATA 2KJQA 4K6KA 5KJCA 1XU4A 3HB0A 3G0IA 5FBWB 3SAJA 4CTNA 1RPNA 1U7XA 9GPBA 3BCUA 3VKGA 1BCSA 2V6JA 3VNAA 1E92A 3GPBA 4GPTA 1JFVA 4IJVA 3LECA 1BCRB 3T0FA 3B6IA 2Y8EA 4Y8VA 2CDBA 2R1UA 1YK1A 3SCZA 4EKYA 1MIHA 1QIIA 3JARB 3R7LA 5CB4A 4C0SA 5F73A 3L8EA 4LCJA 3MRTA 1QK5A 1EQAA 1YBVA 4BWVA 1Z8FA 3NTLA 3OEED 1ZNWA 2JBHA 4W6ZA 5A05A 1M0SA 2OESA 3R6LA 2XEXA 3QV2A 3G2PA 5HQJA 5ESDA 1CQPA 1E6UA 3I52A 3O2JA 1CY8A 2A3NA 2PZAA 3AEUA 5AVWA 3WV5A 4CF5A 3ZVMA 2XT0A 4LBVA 4EY7A 1EFLA 1KO7A 1CX9B 4M7OA 2HA6A 2NW6A 2ZDQA 3EZ9A 4MDYA 2OD9A 3LJKA 3T15A 3AI3A 3E3NA 1TM4E 2I29A 4XRRA 2D5BA 3CLSC 2GBIA 2A5GA 2B8EA 1ZXBA 3M6WA 4Y9SA 2WWXA 1HKUA 4XVUA 3FUTA 1E1CA 3ZZ0A 4WFKA 2FPOA 2AEEA 1XHLA 3FTDA 3DAPA 3PKZA 5CB0A 4URZR 1AS0A 3G7UA 4MIOA 4F21A 2R1VB 1A2BA 4MEJA 4RDHA 2VA9A 5HRAA 4FHGA 1XTJA 5HG0A 5IMBA 3HYLA 4C89A 4DLYA 2JLYA 1GLGA 3QKUA 3UTCA 4DRXA 5KWJA 2PBFA 3E0XA 1K4YA 2GZMA 1P1BA 2HMWA 4M1OA 4RJLA 2RGRA 1E7QA 2FDCA 4NWIA 1P77A 5BXYA 2C98A 1HTTA 3K0SA 4MYUA 2H1LA 4HB0A 3A04A 4EG1A 3H1FA 5JQGF 2E21A 2XCLA 1E7SA 5A7GA 1G4UR 1T9CA 1BVUA 4KR2A 1PYGA 5BR4A 3N5KA 2OFOA 4CL0A 1IXZA 3VNRA 4BLRA 4N7BA 5HFAA 1CUFA 4IDOA 2WDPA 3OQIA 5B53A 3WA6A 3F67A 1VE3A 2ZT6A 1RXSA 4RK7A 4ZVVA 4ALLA 3GA7A 4WZBA 5HOQA 2ZRMA 3BXPA 1H3FA 4DIDA 5LXTB 1R5NA 3GIWA 1ZEJA 3LU1A 3G1TA 3DO8A 3QJ5A 4HRXA 1IUKA 1G8SA 3ESXA 4LOHA 4QGFA 1ZIDA 1D1TA 2TSYB 1GNPA 4QUJA 3NHJA 3EA4A 4JQOA 2ECKA 2AMFA 1U98A 3BICA 3TRJA 3AP3A 2KBFA 3EGCA 2FN3A 2Z6QA 3FVQA 2JIZA 4PC3A 5JAQA 1FDWA 3SG0A 1SZDA 1DUVG 4JP2A 1A5TA 5JR3A 1DAGA 2NVUA 5J2UA 1VDMA 4GYKA 4AYWA 5E0KB 1EFKA 2WJIA 1JQ5A 5H16A 3IR7A 4NE2A 1GIAA 5A5GA 1AQLA 1GGNA 4JU9A 3ZCTA 1Z7WA 2A5FA 2OV6A 4CEHB 1TYAE 4AP5A 5A4AA 1H4TA 5TMDA 5I7SA 4BFVA 1G9XA 3AESA 4E15A 3KHUA 1GVNB 4WUVA 1QKJA 3FPGA 1DAKA 1ZUHA 1R16A 3B6EA 3ANYB 3GVHA 4FIDA 4P4TA 3B78A 2O8DB 1EBFA 1SWVA 3ECCA 1L0BA 3O8QB 3L05A 4FGSA 5JXGA 1XJ0A 1KERA 3RRNA 2GO1A 4O3MA 3HJUA 2LUOA 4LX8A 2ACKA 3BQ9A 4NYMR 1Q16A 4OI1A 3T3NA 3FOBA 1E6EA 1KFJB 2Y1GA 3QV1A 2PZFA 4TX1A 3U37A 3OPNA 3PQCA 4D42A 5BSWA 1AVTA 4EW2A 3QPUA 2YXBA 2NV0A 1WHSB 4OSOA 5DSXA 1NVXQ 4JUBA 4GXRA 1WBJB 2ZB8A 3CHYA 4LN1A 4N0QA 4F6CA 1WLSA 2QQ5A 1USGA 3HA2A 2ODTX 2NUBA 5T4EA 3C5VA 3NDBB 3EG9B 3WMEA 3E61A 5C5IA 2H1OA 2O14A 3OJLA 3QUSA 3UK7A 1ORIA 1XL0A 3ZTTA 3Q0TA 4HH3C 1BVRA 3IAM1 3SU8A 3MSCA 4D1YA 2Y67A 3OOHA 1JEJA 4O4HB 4Q82A 3KALA 4PAWA 3EGDA 3FSGD 2ZSBA 5FWXA 4YRBA 4DJDC 2OVFA 2QENA 1G18A 2D7CA 2W6CX 3R7WB 5FPHA 1A71A 2UUOA 1RAFA 1F8XA 4BRUA 2C07A 3UA3A 4DUGD 1OSNA 3H6GA 4HHEA 4N5HX 5CFRA 1IK6A 1M1ZA 2QUJA 2ZTUA 1IATA 1NBAA 2XDQA 5CVUA 2I9KA 2XYQA 1FMJA 1GG2A 3IT2A 3KQMA 1TQ2A 1AM4D 2RIPA 1PGNA 4Y9DA 1DG9A 5A5DA 3ILHA 3DLTA 3T7DA 4HUQA 3H5VA 1I3MA 4BU0A 5B3KA 1RCTE 3FDZB 4C0LA 2IXGA 1JHYA 3BCSA 5LKAA 2ZRQA 3PL1A 5EY5B 4XKJA 3HL4A 3P2MA 3EFBA 2PFGA 2V98A 4H6VA 2BDUA 2Z83A 1IL0A 3OX3A 4UBIA 3TPZA 3HXOA 3FYSA 3ZWAA 1AO0A 4EBBA 3EQZA 4FE3A 1TAUA 1EVLA 3EXEB 3ZNPA 2A1UB 4EDHA 5AW5A 3UEOA 2MJLA 3W05A 1CVRA 3C5EA 3WLPA 5IC4A 3I6YA 2HDHA 3FUUA 4K7JA 3N58A 1XCPA 1H4SA 5CURA 1PR1A 5KCMA 1HDGO 4KN6A 3H1EA 2AK2A 1V7CA 5EJAA 5SYNA 1MH1A 1R5OA 2H2IA 4UU8A 1CQZA 3PICA 5LD2C 4YRMA 5KKAA 4LQDA 4BBJA 2C8LA 4B44A 3H7IA 1U8XX 3NH9A 3VU0A 5JFGA 2VUSA 4IH4A 4KMOA 3HMKA 4WA7A 1YOVB 1UK9A 1XKXA 4BNVA 2VRCA 3HNOA 4QICA 3K35A 3W3AA 4V0ME 4QL3A 1GZHB 3HUUA 2OAQ1 4B3SB 2ET6A 5EMNA 1ZIYA 4LI0A 4MROA 3SLKA 3VX4A 4ZEVA 1JU4A 2QR3A 3HXTA 2H1IA 2SBTA 5BXQC 5EI5A 4JIGA 1NNEA 2XTAA 4YVFA 2O8FA 3AW9A 3DXYA 1L1EA 4FOTA 2FV8A 3IMFA 1NHGA 3TLYA 1KMIY 2DR0A 2YJ5A 2O06A 4I9NA 1I80A 4YTEA 4P9NA 4B6RA 4F9GA 4LF8B 1VPDA 2VPWA 2WM2A 2BL4A 3KYCA 5HK9A 5HYVA 5K0CA 2CLLB 1QC5B 2HQ1A 3AQ4A 4ZDWA 4UTVA 5F2NA 3DUWA 3Q8WA 5C8VA 3ERCA 4DPLA 1GCAA 5EKUA 2WTMA 4TTJA 3O1JC 5LXTF 1OMOA 2VDWA 3RRFA 5BUCA 5AOCA 2XRMA 3WR5A 1D6NA 2BDTA 1ST3A 2VA8A 1MXFA 5CK5A 2CT8A 4F1WA 1WX1A 3JW8A 1C1HA 4RPIA 1UBJS 1IRXA 1LJUA 1T3LA 1UCFA 2M6RA 3G8CA 3K0FA 4MVJD 4RUKA 5CW1A 2ZRHA 2YQZA 2IHYA 1IPHA 1WPRA 4CQLA 3G8BA 3R7DA 2XVXA 2NAPA 4P82A 4YBRA 5GM1A 2CV1A 3IMEA 1D4FA 1Q2XA 5T4BA 4CKBA 1L5OA 3RVJA 3UV6A 1JG1A 3DULA 5JS7A 1VIAA 2YV2A 4KYIB 5G4KB 2OY0A 3BWXA 3TIGA 3WDLA 2NIPA 1L5HB 4G1BA 1M1UA 4Q3EA 4CLRB 1TW2A 3EOBI 3M9XA 4L73A 1DJPA 1M33A 3DWGA 4OCZA 4UVEA 2FB9A 2LKDA 3RU2A 4BYGA 4TKZA 5A7FA 1YCFA 2I78A 2IBTA 1W2WB 2W9XA 1TJPB 2IH4A 1A98A 4K8OA 2PUDA 3PLRA 3AM3A 5L51A 2AEMA 2NTYC 3RASA 4J4HA 4C6HA 3ABRB 2LDBA 1RJDA 1TLFA 5FWDA 1S1CA 2OO7A 1WSWA 4F12A 2C58A 3LQFA 4G1FA 5FUMA 3FOFC 2PZEA 5ENVA 2VQSA 3G0GA 3O0TA 3NDIA 2IXDA 3BREA 1U1GA 3H2JA 5IWAB 1N4DA 5EJ2A 3EQ7A 4F7DA 4AKIA 3T61A 1SD1A 1U7DA 3Q1LA 3SNKA 1ELOA 1BX1A 3RC8A 4HB2A 3WIVA 1C3OB 2QP9X 5FPYA 3AR2A 5JSKA 4YMIA 1SRQA 3GD5A 3LPLA 2ZSDA 4YGXB 3TKLA 2B5OA 4PN7A 5HWSA 1WOMA 2WHQA 2MYPA 3NKLA 4MA4A 4QWWA 3UA4A 4INPA 1WMBA 5IX8A 5F98A 4HAVA 5B36A 4M7RA 4N8EA 4MMXB 2I8AA 1RKUA 3NIWA 3OUTA 4MEBA 5LQDA 3KWJA 2G5PA 2HF9A 2OBXA 2PEZA 3OPYB 4M9UA 5KJEA 4EGJA 4JVOA 1M1YA 1GTRA 2AXQA 2A5DA 1SXJC 2QTVB 1Z0JA 1ZNZA 1EA7A 2WUFA 1ZKMA 2ZYAA 3H5IA 1A9XB 4FXPA 4O4HF 5KKCA 1N8KA 2WD7A 1JIKA 1H1TA 3FCUB 3TLKA 2PJDA 1EK2A 3F2IA 2IXBA 2Q1YA 4Y1FA 1AXGA 4L4SA 3AERA 5BWMA 1G6KA 2UUAB 2GASA 4LHXA 1GPDG 2AD5A 4QYSA 1DPFA 2PT7A 5ILQA 1JHXA 1UZAA 4A10A 2HYIC 4I1VA 4JLVA 3JQ6A 6GPBA 1ZZGA 2OPBA 4PGFA 4ZANA 3KRTA 3AUSA 3Q3EA 3WGMA 4V2IA 2GFQA 3C8ZA 1Y7IA 4RGVA 3ZG6A 4OB7A 1DAMA 2J32A 5GONA 3NOXA 3DMDA 4LE0A 3ZWMA 2HJSA 2QG6A 5ALGA 3R7NA 1S1MA 4YAWA 3KKEA 4J4BA 1P1HA 3B3AA 3FNQA 2P4HX 3EZYA 2BJWA 4EI9A 1XTQA 4G8CA 2LIPA 5KQMA 1ORRA 4LZJA 5DW0A 4IOJA 2W6ZA 3B1WA 1G2OA 1MJHA 4Q7EA 1QVVA 3UMFA 3WQRA 3CX8A 3IE2A 4IL5A 1RVV1 2ZT5A 2AVDA 2O3SA 5LR6A 2AEFA 1VG9B 1E58A 3HYRA 1G5IA 1Q2UA 1ZCFA 1YJCA 1NYQA 2ALJA 4EO4A 2OZVA 3OC0A 4DLNA 4ESOA 5K8IA 5JHGB 4IXMA 4WK4B 4V3BA 1J2RA 4QDJA 5GJBA 1TZBA 4UFNA 3F5MA 2G9ZA 1D2NA 4JDUA 1D2GA 2B7CA 4PZLA 4PYKA 1UBEA 2QR5A 3L4BC 4S2EA 2W98A 2PR2A 5BNFA 3EW7A 2PLAA 2PKYX 2IDKA 5AVKA 1CIVA 2QRKA 1U99A 2VZ8A 4J7AA 1UMBB 4DA9A 1TDJA 2GPJA 2QIOA 2UV8A 1KEPA 3WYFA 3TFOA 3K0EA 2CF6A 2OG2A 2CFOA 4KUHA 1EDBA 1Y3FE 4J3FA 4YREA 2W0MA 3K9NA 4DIMA 1QBGA 1MT0A 4BUJA 4EIWA 2I7TA 3PRJA 2Q4TA 3OZUA 1ACMA 1CUVA 4KGXA 4PC6A 1ZSYA 1BOFA 4J0GA 3VC7A 4MS1B 1ZC3A 1JHAA 5ICCA 4V3CA 1V5EA 1QWOA 3ONWA 3WY9A 4QG3A 1FFYA 4X1KB 1J1ZA 4ZD6A 5LMZA 3UANA 2K5UA 1AO3A 4KWTA 1VHLA 1EWVA 4IF4A 4RTMA 4KN9S 1V1MA 5CAEB 3EFOA 1TVEA 3OTGA 4OO3A 2PS1A 1NLZA 1U0JA 2J1LA 5EHGA 3T1NA 4ARUA 2B8TA 4PGAA 4NCJA 5ESRA 2QJRA 2FMFA 4KQ2A 2AV6A 3T94A 3HN7A 3T1VA 2IVZA 1E3LA 4XUCA 2ERYA 4K03A 4TOIA 2PUWA 4HAIA 1NM5C 3EWIA 1ZLYA 1UEXC 1UBSB 2J9YB 4XCXA 1KY2A 3PC4A 3STVA 1YD7A 3OZTA 1FFGA 4GGMX 1ZCBA 4RS3A 2WM8A 4X84A 4EA6A 4AKHA 3ZXIA 4BEBA 3FSEA 1WPGA 3AUYA 3QLUC 2EHJA 3EXIB 3MTDA 1Q22A 4YMSA 5YASA 4MWSA 3C8HA 1NHWA 1ULUA 4KQKA 4Q19A 4N18A 3IOCA 5C5DA 3WYBA 4C4OA 7MHTA 4OTZA 1Y1TA 5B55A 3U13A 4MO9A 2ATEA 1U2TA 2G9UA 2I4LA 3FF1A 4FMPA 2EYUA 1FP6A 4ZYLA 5FLXA 4PXSA 2HNBA 1U0BB 2P27A 3TKYA 5JY6A 2DLNA 1G5TA 2Q29A 5BPFA 5BR8B 1SGWA 3MJCA 1GYPA 1VP9A 3HE3A 1TIKA 4WLNA 1DLJA 1Z28A 5BV1A 1QGUA 4MW0A 2X19A 2C82A 3MD0A 1YO6A 2HJHA 1USVA 2V96A 4MKRA 1YZGA 4YK7A 5AHXA 5HSGA 4U8HA 2GCOA 2XBUA 3BK2A 4I0WB 1YJXA 3Q3CA 3MJEA 3HO1A 2HUPA 2JCSA 4G2NA 3G6WA 4JI4B 1H9AA 5G3YA 3KZ1E 4WN3A 3OZ7A 1J8MF 1N0WA 4E4TA 3M2PA 2ZB4A 1ILWA 1GA4A 1E8DA 2DBVO 1C7EA 1PL8A 4MVJG 4A8JB 2ORVA 3NVDA 5JJBA 1HGXA 821PA 2XE8A 3WZ2A 4YCNA 3IUSA 5BWLA 3ONFA 3EVFA 3OA2A 3N7AA 4BFYA 4WXHA 1S2MA 2Y0CA 4D74A 4FFNA 1UK6A 2JPDA 1KO8A 3HVJA 2O8EB 3OECA 3FGOA 4NR0A 1P5RA 4BVHA 3ENNA 4RU1A 1R00A 1A0OA 4ZJUA 2JGKA 1PEAA 3GJYA 4NMMA 4CCAA 5IHXA 1EBBA 2PRIA 2YMMA 3HDYA 4GYYA 4DLRA 1U8EA 4UVDA 3C3AA 3IE1A 2AX3A 1KKUA 2QL6A 3H5LA 2JDIA 4WKGA 4R6XA 4RPJA 5ALLA 3FTNA 5JEEA 2VK2A 3FBGA 1WETA 4NC9A 3ICOA 2Q7DA 4HEA1 1KYIA 3E82A 1RQPA 4BNUA 2FE1A 4GT1A 2BM0A 5FX2A 3AP1A 2R1TA 4D9EA 3D5QA 1IVYA 2EEPA 3M6UA 1OBVA 1HMPA 1Q1GA 2NPIA 4OFBA 3HB5X 4DDVA 5JRJA 4TTVA 4MR8A 5LUBA 4JKYA 1NPYA 5L45A 1SHLA 1K8RA 2BI7A 3KVOA 3Q9LA 1V9SA 2EZUA 4IXWA 2IHBA 1M74A 1CZNA 2RHGB 3AONB 5HF8A 3GFGA 5A1TA 2C5BA 1VI5A 4JUDX 1CNEA 3BE5A 3RT9A 2BJVA 1A7KA 5FO1A 1E3EA 5B2EA 4K26A 4YRJA 4FZ5A 5KSPA 1Z6YA 1FX1A 4DC0A 2UZ3A 4WUTA 1DKRA 2ZE5A 1SQFA 1KJIA 1NVKA 2CVZA 2H5LA 3GVXA 2LDXA 2BP7A 3A05A 2GPNA 2R8ZA 3AR7A 2WHRA 5F1OA 3V8NA 1QRRA 1VE7A 2R1ZA 3EGWA 3PU6A 2IYTA 2HV9A 3D6UA 4CIDA 1H0KA 2Q5JA 5FV7A 1JAIA 4O4JF 1NBHA 4MW4A 4Z3KA 3PR2B 4KQMA 4AJKA 5A3RA 2RK3A 2RHRA 3TZBA 1Y1SA 2HA0A 4H15A 1RLOA 2WAYA 1E60A 2J0EA 1ODKA 2AHRA 2DUUA 2JH8A 3RVLA 1E89A 2R6JA 4IEIA 5AI0A 1DBQA 4ARVA 3CRMA 4LOAA 5CBPA 3K09A 4P7BA 1T4MA 4I4NA 4FBMA 3IQDB 4CEJA 3B82A 1SUSA 3ROXA 3KPUA 4MWTA 2Q6OA 2XUJA 3SF8A 4K0RA 3G79A 1AGNA 3R5HA 3JPYA 2ZTVA 1F3OA 2I6QA 1U5BA 5T64A 2VAPA 3L07A 4EG0A 4MRAA 3G9UA 4EAQA 5IM4F 3SHTA 3A0RB 1Z6PA 2C5EA 5GM2A 5I9BA 4N8SA 2Y2VA 2GERA 3W2FA 2XGJA 4UUPA 2VJPA 4POOA 3FWNA 1UR5A 1UXHA 1GUBA 3DDNA 5DDIP 5JH7B 4RULA 2ZAYA 1IEVA 1OH6A 3ZDBA 5KNBH 3U26A 5JNUA 2QD1A 2YWEA 2QJTA 5A71A 5DK6A 1JLHA 4FE4A 3L0YA 5FIUA 3SP1A 1SB9A 3HH8A 2VFAA 2JGMA 1AXRA 4E09A 2XB9A 8MHTA 5JO0A 1OXVA 3ND6A 1VKHA 4TV9B 3DBLA 3ILVA 3LW8A 3SKYA 1SEPA 1NFFA 3F71A 4KB5A 1G1AA 4ZICA 4YAEA 2HQSA 3DLCA 6YASA 1N6KA 1NXPA 3I58A 5E4YA 1OLOA 4ZCTA 1ZP6A 3DXZA 1RLUA 2GLTA 4R69A 4KFUA 4DM7A 2R8EA 3ZJ5A 1ZOSA 2CB9A 2DT8A 4HVTA 2HA5A 1CUHA 2BEJA 3G2LA 4MAFA 2FMHA 2ZUDA 1RI1A 2QD2A 4G0MA 1WBDA 2QJWA 3P0FA 3PP8A 3X3HA 4JQZA 5B2FA 1WZUA 3LUGA 1QH1A 5EQFA 4URFA 2AZXA 5T8KC 1CEXA 4TZ0A 2G07A 3NHLA 1NE7A 2ZUBA 4FDMA 3ZJTA 3KXKA 3EWSA 3ZBTA 5KYXA 4U0JA 1CF9A 3CO0S 3EEFA 3IS3A 4XM0A 5EIOA 3R3WA 1NRXA 4X95A 3QELA 5IF9A 4Z51A 1MB0A 3VSBA 3UJ3X 3WDMA 2ZTMA 1ORTA 4LC9A 3HFJA 5BVGA 3IQZA 1IOWA 1H6CA 4WL0A 3THYB 2BSXA 1QO7A 3IVAA 1UINA 4C20A 1UM9B 1SBNE 3DTYA 3GZNA 4UREA 2Y92A 2OK8A 4XR4A 3FWHA 3WK9A 3SQXA 2E5FA 4K9SA 1O94D 1VJ0A 2VIIA 3IE0A 3PUJA 3SS9X 2FTKE 3VR1A 2JIOA 1WE2A 3H6KA 4J9VA 4RVFA 3OOYA 5F4ZA 4MOWA 3T5MA 4E7PA 3WOHA 4A03A 3NT2A 3DV0B 3NJRA 1ZOPA 3VTFA 4OQEA 2OZLA 1RQNA 2QVLA 1B3RA 5DZSA 4EGQA 1DJMA 2VUUA 3TECE 4QG7A 5BRJA 3IQFA 3U81A 1UM8A 3KOXA 4ZEMA 5C9ZA 3FIJA 5IJZA 1H93A 3PPWA 1XROA 4KEAA 3AL0C 1GY8A 3ZY5A 5ITZB 1C4WA 2EHDA 2UYYA 3QVGB 4KXWA 1NUUA 1UEJA 2GDZA 3R3SA 4I1YA 5EOVA 5TT1A 1QO0D 4DF3A 1N7HA 2BGKA 4RHFA 5JANA 1QLJA 2CMGA 3LLVA 1II8B 3M4YA 1RXEA 4FZVA 4TWAA 3IYLW 3S3TA 3GNQA 2G0AA 3WIUA 1GZSA 2X0JA 1IZ0A 5JUWA 5GPBA 3FPAA 3HABA 1QO9A 2XT9A 4IWNA 3WDKA 5LYJB 4OJYA 4MB6A 4MV3A 4CM4A 4FFVA 3RAGA 4ON9A 2VDOB 4I9FA 1AV7A 4PRYA 4RZSA 3W77A 1F8UA 1PG5A 4PPGA 4HS9A 4CM8B 4I8DA 4IDNA 4RZXA 3RSLA 4Z0PA 2ZAGA 1HT3A 2O2GA 4IFTA 3GEEA 2AS0A 3ZU2A 5LUAA 1TFRA 2M32A 4E03A 3GDGA 4LCBA 3ROGA 1IRIA 3L8FA 4JR2A 1BVYF 1J7JA 2MSWA 4W8OA 5FP0A 8AT1A 1ONOA 3D2AA 4Y2VA 2H2AA 4EUFA 3I9KA 2ZYHA 2WSSD 3CTPA 1CYDA 4JB3A 4FX2A 2H08A 2Q5EA 2NZYA 3AM5A 2PMWB 4JBLA 4CFZA 3QEOA 2ZIXA 4HDNB 2JD2A 1ND6A 4KQJA 4CKWB 4PWZA 3O93A 5DTQA 4AWXA 5IK2D 1Y8QA 5I3CA 4GM1A 4TT3D 1Y7LA 3KNZA 3RREA 5AW7A 1E79A 2KHZA 1X1QA 3EARA 4UCXA 3EAQA 5DOVA 4DAEA 4ZT6A 4M0KA 5C2JB 1A96A 3BMCA 4W5NA 3DM9B 2QZPA 2P75A 3KR0A 1WHTB 4IDPA 1B3BA 1XA0A 3NHFA 4NZ9A 4R9RA 2ANCA 1NF8A 3PDWA 1U2ZA 5CX1B 5B1IA 3I9V1 2OCBA 3TPCA 1R6XA 5FLKA 1GKLA 2Q3EA 3F74A 5EIFA 1JMKC 2GN2A 2BTOA 4P5PA 1NQOA 4BVFA 5FYQA 2VNHA 4MULA 1UIMA 1AKYA 3RC9A 4Q3NA 3R2JA 1E66A 3PL5A 1RD4A 1X6VA 3B13B 4AMBA 3E7DA 1G2IA 1EFUA 1Q3HA 2O48X 2ZREA 4R1SA 1JNYA 3F5SA 5JH7F 5IVHA 1F7UA 1P44A 4GECA 4GUDA 4OBEA 4ZVPA 1D9ZA 5B3JA 4B80A 2GBFA 1I4DD 1IY2A 2B1JA 2EZ9A 4ESVA 1I9CA 1KJYA 1PSZA 1TMGE 3KAPA 3OU2A 5EEHA 3EZ2A 4X85A 5IAKA 1FPMA 3FUXA 1FLNA 4P92A 1D2AA 1XZMA 2R8OA 4RV5A 4UJ3A 2ENUA 4UXHA 4WY5A 3BDVA 4LTDA 1UL1X 1P8JA 1QHGA 2XMQA 2O8BB 3GF4A 4KO3S 4ZU3A 1L4UA 4OLAA 3LYLA 5ICEA 1WU7A 3AOGA 3BUSA 3V1MA 5KC8A 4A0SA 2PXXA 2VDRB 3HLKA 5BW6B 2GJAA 2B4AA 2CBGA 2TMKA 4UVGA 2CLMB 1P2BA 3NNNA 5AK5A 4RTRA 2ETXA 3WLJA 4KPFC 3DR5A 5DNWA 4QLBA 4YQEA 4OHWA 3VTAA 4UMDA 1NAIA 3JQGA 1H1LA 1BE1A 1UXKA 2JATA 3B6KA 4HJXA 3V00A 3WXMA 3MVEA 4C7OB 1MC4A 1ZI9A 2BC9A 2ZUSA 3X44A 4HB3A 1LW6E 1GPUA 1QIEA 1U4NA 3IX7A 3LF1A 3ZN2A 1PZMA 3ECSA 4URHA 4CKEA 1PX0A 2FPMA 3UWSA 4BGDA 1GITA 3UT0A 1ABFA 1OX4B 2IPOA 3F90A 1IPFA 1GUYA 1N7GA 2FEXA 2NXEA 4LY9A 4NMLA 1HLDA 1HYGA 4B2LA 3HDQA 3DZJA 1EU1A 1G8AA 2WHXA 3COYA 5DBEX 1SKQA 4EGAA 1TTTA 1IXRC 2EP8A 2EFDB 2C2KA 2GH1A 2DFTA 3AK4A 4WVFA 1SC1A 4BX9A 1KS9A 1J2JA 5BN3A 4B71A 3G85A 3DVAB 3RROA 4A0QA 3MD9A 4G1CA 5IM5A 3WBKA 5CK4A 5BMVA 2H31A 4OEHA 1CR4A 4I9HA 3UICA 1Z63A 4LZWA 4PINA 3DR3A 4JEMA 4QUAA 4RW0A 1UJBA 1D2MA 3JALA 4ILKA 4BFTA 4F9TA 5JBNA 1YS6A 3KQKA 2IYUA 3AO0B 2KS6A 3PQ3A 5DU2A 4LBZA 2J7KA 5BN5A 3RSGA 2BKEA 3H17A 2WPNA 4US0R 4AVYA 1JQEA 3I37X 1LV7A 1QIGA 2N1MA 4N12A 2XMRA 5AJXA 4A26A 5JTTA 1DC3A 1JMVA 2GPYA 4QUIA 3TN7A 2FEMA 4MCAA 1F2UB 1NX6A 4AX4A 2VAMA 3W8NA 3WMWA 1J2UA 1U2GC 2P69A 1NJ1A 4QXRA 5FFMA 1W46A 1W36D 3RS3A 1VKNA 5D1HA 4F85A 1PWEA 3UFXB 2B6NA 2HRRA 4ZEWA 2VP0A 5LYJF 2ZS8A 1SUEA 1TGVA 5ALUA 5CD9A 4BKMA 1CZKA 5KB3A 1SHZA 3KSMA 3ESAA 4ZAGA 3E9EA 3HCFA 4C43A 3MC1A 1QQ5A 3PYMA 1QF9A 2IPXA 4RIFA 2ORWA 2QGZA 4LWZA 4ZVNA 1UK7A 1Q19A 2V65A 3FOCA 2ATCA 4YDHB 4B2PA 1EUDA 1PVVA 3MELA 3F0TA 1GNQA 1UDCA 1JKJA 1BROA 5IUNC 3NAMA 2JIBA 3KAKA 3NYRA 3R20A 2OO3A 4IGKA 1NNLA 4UZSA 1ABEA 1LLUA 3QHAA 1U1IA 4FKBA 1N8TA 4G5QA 4OMFG 5ALEA 5ECWA 3TW6A 1G7CA 2ZIVB 1Z4NA 4LJKA 1VLLA 4LDAA 1KYTA 3B1XA 3RIHA 3QIVA 2OORA 2VTKA 1JQ3A 1HEUA 3D3EA 5LP1A 1EVZA 4FOLA 5FI3A 1M7GA 2HK8A 1U9ZA 1GG9A 4KRXA 5DHAA 1KQ3A 1JKIA 4YRNA 2QQGA 5CB4B 3RDPA 1Q77A 1DCFA 5DYGA 3U9LA 1X87A 5KNBD 3S8EA 4PRZA 3W8RA 4FYHA 4JOBA 1F20A 4LV8B 3WMXA 1U7PA 4HX5A 1AOXA 1QSGA 5AJHA 2CF5A 4I5EA 4X71A 5AJZA 2Q3MA 1TO2E 5DNUA 4G5FA 2ZU6A 3QVLA 1DEOA 3C1UA 2YVLA 2XWPA 3K1ZA 4RORA 1GZDA 2V59A 3INNA 2ZJOA 3FGPA 4HL6A 4RXMA 4WMLA 4MI6A 3KD2A 1AN9A 3KKOA 4Y1RB 1WQ3A 3N3AC 3WLFA 1LDMA 4WFJA 2ZJ3A 5F5XA 5K0ZA 4WW0A 2EJCA 3T5CA 4QPDA 1KI3A 3V7YA 2EKBA 2FEWB 3HCNA 4OUDB 1OPXA 1RADA 3ML1A 2RAVA 2P1DA 3K1AA 4RZHA 3QUQA 3IIMA 4C7JA 4IQ4A 4EATA 2AKEA 3A36A 1E6LA 2OR3A 4TVBA 3ZH9B 2I03A 4Z1OA 3KJNA 3K6SB 3CVJA 1Q20A 2Q6VA 2QDXA 4K2HA 1U63A 4JXKA 1GWNA 3MJ4A 1K92A 2O4CA 3B5JA 4B3MB 2HLDD 4O8ZA 3IUNA 4CPDA 3IUMA 3DLAA 4EJSA 1UQRA 2C03A 2YYZA 4KXYA 2O6HA 1P7WA 2XR1A 1DKNA 1NF9A 2BELA 2H2GA 3K9QO 3SQNA 2EOAA 5C80A 1EWYA 3QNWA 3G6KA 1V8BA 3TZLA 1VXRA 2W43A 4MIEA 5D2CA 1IWBB 4NPAA 5EN4A 3N6XA 4XWWA 4NS1A 1Y3BE 1N5RA 1V9CA 2XDAA 4NESA 2GEFA 4ARAA 4GX2A 3LXXA 1A72A 1FXUA 1RWQA 1QR6A 3DE3X 4IIVA 4MR7B 1X2EA 2R6AA 3C6XA 4FK8A 4IWYA 1Y42X 3DNPA 2BBTA 2IOHA 2KQUA 2ORYA 4M0PA 3TOXA 2BZSA 2FQ1A 1MB9A 4P84A 3GFRA 3P0EA 1M10A 4MUFA 4OGGA 5EFOA 3SZOA 3NV7A 5EUQB 1KJZA 1PWYE 1XRSB 3UK0A 4EX7A 1WMAA 4WX2B 3NDJA 3Q15C 2XUGA 3ER8A 1VE1A 4IDCA 1E3QA 1F4LA 3HPRA 1U2DC 1WMSA 5A4DA 3A0UA 3H5AA 4W5WA 2NVUB 1DX6A 5LU8A 3V32A 4ZVKA 3TSYA 2BVNA 1FNDA 1QXSA 2A3RA 3GGGA 3OA0A 4QEKA 3KJXA 4C03A 4EZIA 3AUKA 3FFTA 1C9DB 4HOYA 4WJLA 5IJ9B 5GGYA 3ZVKA 3T4UA 5F3WB 3FNEA 4LJ6A 4WLUA 4I4TA 2YY6A 2C4HA 3DQZA 4WCVA 5SY4A 4UMEA 2CYBA 4D8UA 4KGDA 3UJ8A 3TBHA 1CRQA 3UXYA 3ZD9A 3TLXA 4C76A 2I2XB 3U40A 4HZUB 4MGZR 4UASA 4KQFA 5CX4A 4MQ4A 4TYWA 1UPXA 4NI5A 2C99A 4YJFB 2PLRA 4MUJA 4AJ1A 3W1VA 1SD2A 1P39A 4BASA 4C5CA 4CODB 4J0HA 3ZIUA 4L3VA 1W8IA 5L3QB 2XT6A 4RETA 2IXFA 2QAGC 1GSAA 3IP9A 4GZLA 2CFTA 4TKMA 3ADDA 3UJBA 5TV2A 3PCTA 1YI8A 1IVNA 1ZM9A 2WFLA 4LDNA 2FZCA 2JJYA 4WLOA 4Z9BA 5LMCA 4CQNA 1BHO1 2AC7A 1A3CA 2C95A 2GCNA 1PR9A 1NOIA 3N75A 4NBUA 2DOKA 1P75A 3T7EA 3AJ8A 3DHYA 1EUQA 4LVUA 3TQSA 3VAZA 2M1ZA 4JODA 3DMRA 4DMGA 4DA8A 3QX8A 1YI0A 1NP7A 1TM7E 1TM3E 3PFFA 4TLEA 5KPDA 5C81A 3DV9A 4IH9A 1FTNA 3OEYA 3WC4A 1JJ7A 1K7FB 1S7CA 3IAS6 3USZA 1D0IA 1X0VA 3H1AA 3E8XA 1QYIA 3O8CA 4ZWNA 3FSGA 5KOJA 1M6YA 5F2KA 4N7JA 3M2TA 5BP7A 3CPEA 3PUZA 4LZZA 4P8RA 2DT5A 2VQEB 1LNZA 2ZVDA 2H57A 4DUGA 2WJVA 4HGYA 1JEOA 2YBEA 4DIFA 4CQMA 2Z5LA 5JJLA 5CB4F 2R7AA 2ZRAA 4HUQB 4ZQEA 1KS2A 1H0SA 3PQ5A 3EMBA 3J80A 2G76A 4JB2A 1RKVA 1U0HC 5HP4A 2PUCA 5JAOA 2ON6A 5K01A 2W6OA 3FOWA 1F17A 1C5KA 3EIEA 3SZLA 3TOCA 3U6KA 1PS8A 1XAHA 4Z0TA 2IS4A 4BLQA 3WLAA 2IW1A 4LF4B 1SHJA 4QGBA 4LZAA 3C7KA 3WJ7A 4GLBA 3TX2A 4XM2A 1UODA 1UMCA 4KCGA 2GDJA 4RH0A 1JDVA 4F8EA 3C16C 2HADA 1NV8A 2B5WA 5JNVA 1PQYA 1D2RA 1KAQA 2D1QA 4BKRA 4X45A 4DBVO 3NYWA 3BE4A 3H0KA 3GBPA 4R6WA 1U3TA 4RMHA 1GV1A 2J59A 4MDHA 5EWMB 2FPGA 3RBXA 4ENPA 2BZ1A 3EEQA 3OKAA 3TLAA 5CYOA 3A9TA 2ZRDA 3T9DA 3TLJA 1U2EA 2H4ZA 1SC6A 1TM2A 1EE1A 4RS4A 4MV6A 1PJAA 4NYJR 2PRKA 3QJYA 3WWZA 1I32A 4EEZA 2VJYA 1X7YA 1CRLA 1SVSA 3KKPA 5DLQC 3STTA 4D41A 2PSFA 3GA0A 2IV3A 3CN9A 4RSMA 5DWDA 3AXSA 5CLFA 4AZTA 4NE9A 1XNHA 4EX6A 4G0PA 4D43A 3Q10A 3V8EA 4UBNA 3CEJA 3IRVA 5JD5A 1RKBA 2WP0A 3LT5A 2GOYA 5DBIA 4U2CA 4QWMA 2DSNA 3K96A 2J33A 3A1VA 4P0TA 3LGXA 2D3WA 2AOTA 2HO5A 3B70A 2R48A 3GEDA 1E2JA 1PWXA 3MMNA 3DC7A 5G53C 1CERA 3HWWA 1E9BA 1R50A 5CTAA 2ADMA 3HR7A 5IYZA 3TINA 1NW4A 1N2IA 2UUPA 3AF2A 1O08A 2A0WA 1P0MA 2G09A 3ESCA 3JYNA 1HG0A 1KF0A 4GI5A 4B0PA 1KU0A 1PZHA 4JZYA 2X41A 2AZTA 3GAMA 4XWAA 2IODA 4L7QA 1RACA 1V6SA 1P7VA 1JT9A 5AW2A 5JW6A 4AUKA 1VB5A 4C4YA 4G0NA 1RYNA 1QHFA 1ZCJA 3KQTA 3V55A 1VHDA 4MVJA 4C4AA 1DDGA 2FEPA 5E6SB 1L5SA 3E2MA 2ENWA 5K05A 3C3JA 2F67A 5KTPA 1FRNA 2Z4SA 2ZIEA 5M2QA 4S1WA 2ZRBA 1GV0A 3MCAA