3X1WA

Ras-related protein rap1b with gdp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
167
structure length
167
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1b
publication title The structure and conformational switching of Rap1B
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 60
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x1wA00
3CRQA 2A9KA 2CLCX 1G1MA 2JLZA 2CL0X 5D3QA 4B76A 4E09A 3KKMA 3TSWA 3UKDA 4YMUA 1D2EA 5KTYA 2NPFA 5FTLA 1S96A 4CEJB 4LHZA 1GTVA 1TQ2A 3GLHB 4UXJA 3SR0A 2OAP1 4L15A 1JPJA 2J45A 3EZ6A 3WY9A 3VX3A 3CX7A 3A4NA 3KFVA 2ZU6A 3K9GA 4Q1BA 4MGYR 3TRFA 1A1VA 2RGNA 4L8GA 4GSYA 2QM8A 3BJIC 4V0NA 8OHMA 2Q3MA 3DKVA 4BECA 4QHYA 1FX0B 3KDSE 1XBTA 3RC8A 4AWXA 3GLGA 2KJQA 2RGEA 3RRZA 4LYHA 1YZUA 4HLUC 3FVQA 1E2KA 3U7EB 3RRMA 5J47A 1GRQA 1S4QA 1UBFA 4FIDA 4PO1A 1CJKC 3LW8A 4K8OA 4B48A 3T61A 4MGZR 2QGZA 3EWSA 3BB1A 2JLXA 3CPEA 4MYHA 1SHKA 2BHRA 4ERNA 1G19A 1W47A 1Z6AA 1XX6A 1KI4A 3LDAA 4RZ3A 2ZM5A 3SJCA 3DMNA 4BFSA 6Q21A 3U3OA 2YVUA 4MRNA 1OFTA 3EPJA 4UNQA 1P75A 1RYFA 3V00A 1GOTA 3I4LA 1CBUA 2IUUA 1TEVA 1WP9A 2C77A 1E0AA 2FX3A 2UVQA 4DSNA 4TT3D 1U94A 2ZAMA 5KNDA 3M1IA 2R6CA 1JAHA 2VEDA 2NPIA 4FCTA 4FD2A 3ZZTA 4G5SA 3KKOA 1U8YA 4A4DA 5HR5A 1KJYA 3HR8A 1G7RA 2QP9X 2O8BA 4UJ5A 3GJ4A 4TTPA 1XEXB 2RKOA 2YWGA 4PZYA 1G41A 4RD2A 1EX6A 1JR3E 1YZQA 2VHJA 1J2JA 3PUVA 1NI3A 1RJ9B 1NBMD 1NMYA 4C4PA 3EAQA 3AF1A 4MITA 5DI9A 2HT1A 2VSXA 1W5TA 4M1WA 3NHBA 5JCPA 1GUAA 2GRJA 1RRGA 2H8KA 2XNDA 1YQTA 4QL3A 4N1AA 5FPYA 1UJ2A 1B23P 3D3QA 3CLVA 4BRUA 3FFBA 4FMDB 4JLJA 3QE0A 4EKDA 3QXJA 4UKDA 4YDHB 1CR2A 1X8JA 2ZJBA 3AVQA 5JRZA 1M1YE 2FU5C 2WIBA 3EX7C 3ZD6A 2VP4A 3WP0A 1Q22A 2C95A 1G5RA 4Y0VA 1XTIA 2GHIA 3E70C 1XWIA 4YONB 3BFVA 4BE7B 3LAWA 2EWWA 3WBKA 2ZRKA 2O8BB 1DE0A 1JECA 2JCSA 5F9FA 2QP3A 4OQMA 3VR3A 1MR3F 4G5GA 4LYAA 3RS3A 1U9IC 1XD9A 1RRCA 1ESMA 1S9HA 1ZJ6A 1G8YA 5B2ZA 1W49A 3DO6A 4US2R 3PJRA 3C5CA 4RZUA 4BRWA 1TF2A 2P0EA 2JLUA 1MABB 4LYFA 2EYUA 3GP8A 3QVVA 1AZTA 2O0JA 2D62A 3LO5A 2IS1A 5LD2C 2R44A 2GXQA 5G41A 2QTHA 1NVVQ 2FWRA 2E9SA 4FMDF 3GCGA 4HATA 1QHIA 4JJKA 5JJLA 5HE8A 2YWHA 2ZS8A 5CIWA 1AM4D 2BBTA 4HZUA 1E9EA 4D25A 1U0HC 3HU1A 1P73A 3ETLA 4DLYA 5BYKA 4IEIA 4WZ6A 2O8FA 1T0HB 2RMKA 3P4YA 2R65A 4US0R 4LC0A 4NYIR 4A8JA 1KDPA 4MUBA 4C2UA 1IOZA 3I5XA 5AUPB 3THXB 4NL4H 3RWOA 1D5CA 2VF7A 4D4MA 1CULC 1XB2A 2JEOA 4YQFA 5EXTA 1FP7A 2QAJA 1P2TA 1CTQA 2OHFA 3KFXA 4TLDA 2ZJYA 4OQFA 5B64A 4NP6A 4MRPA 3ZVLA 5LDDC 4GZMA 5EQTA 1UFQA 2R6DA 4PZLA 4JZKA 1ZNZA 1E1RA 1N0WA 3M6AA 4C0LA 1G7SA 2JJ1A 3BH6A 5L3QB 2UKDA 4C7OB 1UKYA 1SVWA 4LRWA 3OEEA 4UNPA 3AVPA 2GK6A 1FUUA 2C78A 2IYTA 3MD0A 2CL6X 4W9MC 2IXFA 4BFXA 1KO1A 3P1JA 3CO5A 3TUJC 2AFIE 1WA5A 1XZPA 4P0TA 2DWQA 2QE7A 4KCGA 2WJHA 4LC1A 5AJZA 4DUGD 5A4JA 1NBME 4GRAA 1Z6XA 5HTKA 3P32A 1NMXA 1DTSA 2FH5B 3GFPA 5DI3B 1XJQA 1NKSA 1NVXQ 3Q3JB 2AD1A 5JHGB 3DKPA 4B44A 3AP2A 5JRJA 1NRJB 1XP8A 4XH9B 2G0NA 2WWFA 4TMZA 1NLZA 2YKGA 4XOIA 4A2WA 4TMKA 5FTJA 1F6BA 3DZ8A 4DCSA 3DPUA 2GJ9A 2FPMA 5E7MA 5EE5B 2ZJZA 1G5TA 3L43A 1QF9A 3DM9B 4NMMA 3D6TB 4JYCA 1T9HA 4FCWA 5KDLA 3U3MA 1TTTA 1KHTA 2I4IA 2BOVA 3U5ZB 4TL9A 2LKDA 2FFHA 1KO7A 2P65A 3EA5A 3GJ6A 3EG5A 2BJVA 4AKEA 3HU2A 2ZREA 1R0WA 1N6IA 1DG3A 1R8SA 2IXEA 1W4BA 4KLZA 4NTZA 3T12A 2WAXA 5EXPA 2BJWA 2IYQA 2YC4C 4DDWA 1YKSA 4B3BA 3IPYA 4E22A 3EPLA 2GAAA 2XX3A 3U7HB 4HLUA 1RRFA 3WNCA 1E2NA 3ZLJA 4Q4JB 1PJRA 1GRRA 5FTNA 3CH4B 3Q5DA 4XWOA 3VHLB 3CRRA 4DIDA 2E87A 4YDSA 2B8TA 1FL9A 4OQNA 1TUEA 1NMZA 4TYWA 3AEZA 2AD5A 2QMOA 1COWD 3EARA 3X1DA 3MWJA 2GA8A 3QPVA 2PL3A 4PPFA 2VP0A 4TMTA 3CWQA 1KI2A 3IILA 2OM2A 2VTKA 3I3SR 2FFAA 1BKDR 1YZGA 4FINA 2G9NA 1ZU4A 4LY6A 1V5WA 3QKRA 3PEUA 1FTSA 3M0EA 2QQ0A 2CHQA 5KSPA 2ATVA 2NG1A 2X2FA 4MUAA 1OXSC 2ZRAA 5JI3E 5EE3A 5DLQC 4I1UA 3VKGA 3K0CC 3GLHE 3MCAA 1W4RA 3TMKA 3CPHA 3U6KA 3K0SA 3UPUA 3C15C 4JBYA 1Z0IA 2XSZA 5DYGA 1L4UA 2ZJOA 2VYFA 3H84A 2QSZA 4GMXA 4O3MA 4TLCA 1TAGA 3FHTA 2XNDD 4Q4HB 3C16C 4HAUA 1E2IA 2O0HA 2PBRA 2EU8A 3EIEA 2O8EA 1CRPA 3EXAA 1E2QA 1VIYA 1JR6A 1U90A 3OAAA 1E0SA 3PFIA 1TQ6A 1KGDA 2VQSA 4V03A 1ANKA 1RRPA 5FTKA 1M2OB 3CF0A 2FGJA 1SULA 1B0UA 1N0UA 4Q18A 1G4UR 2FEMA 4ESVA 5FI1B 1XEFA 2BKEA 2CNWA 3KTAB 2PX3A 1NN5A 1W2HA 1E98A 4KBFA 4LOAA 1YR6A 3PUYA 1VCOA 2FV8A 4PPNA 4WW0A 5DGXA 1FQJA 4TZ0A 1ODFA 1DAKA 3FWYA 3QNUA 4B6EA 4OKSA 2NMVA 2CL7X 2W6IA 4NBSA 1S3GA 3BRWD 3ZQ6A 4C0QC 3WYFA 1E2MA 4M22A 2AX4A 4QOSA 3AF0A 4WZAE 4DRZA 2IYYA 1ZNYA 2CCJA 1X3SA 2QPAA 4LGMA 4CT4B 1R5OA 3WP1B 1E2DA 3ICQB 1MT0A 1YZNA 4IOMA 5L3VA 1KO5A 4MRSA 2XB2A 1II8A 4GNKA 4JL8A 1KY2A 3T34A 3L8ZA 4QC2A 3OFND 2RB4A 1TL7C 3QXHA 1U8AA 5HCIA 3SS8A 1OYWA 3I32A 2ZXUA 1S8FA 4IDQA 1P9NA 1ONBA 3LQQA 1AGRA 1I4TD 2ODBA 1KSGA 2OFOA 4NH0A 5JS7A 4Q1EA 3T1TA 1Q57A 1XD2B 4TL7A 3ONWA 1G6OA 4QGGA 4G3XA 2QA5A 4O25A 4ZI3A 2FF7A 1I2MA 2AHOA 3WMFA 3ADBA 2WKQA 4JLDA 4EIWA 2WOOA 2YINC 5FBVB 4M9XA 1W4CA 4TWZA 5KPJA 2ZSAA 4QM6A 3K0FA 3TAUA 3KQKA 3IIMA 3U7FB 4PXAA 3RLFA 1NLYA 2VIIA 4IDHA 3AM1A 3OEED 1NKTA 4GOKA 3SBEA 3TW8B 1LFDB 4Q7LA 4ZCIA 4XWKA 1W5SA 4PSVA 1BOFA 2WSMA 4JVSB 4M1YA 1F2UA 1IY1A 4Q01A 3TSZA 3E5HA 1N6RA 2ZJ5A 3K0EA 1Z2CA 2HCBA 5BN3A 1OW3B 1QRAA 3ZS8A 4PFSA 4ARZB 4GL2A 2ZYWX 3KB1A 3K0AA 3NC0C 4WBSA 5FPTA 1NNEA 1ELOA 4Q4LA 2VA8A 3AGPA 2OESA 1KJZA 2WJIA 1JR3A 4KXFB 4B32A 3O8BA 2DFKB 2BC9A 3T1VA 4MH0R 1U99A 3THWA 3AF3A 3BC1A 1E0KA 1N6PA 4GMDA 4C0BA 2Q9CA 4P4SA 4M4SA 5FBQB 4FCVA 4LX0A 4TQ9A 4ABYA 5JLJA 3V4FA 2H92A 1KKLA 3ADKA 5JEDA 1G20E 3IKJA 1A82A 3DVLA 3SJBA 1NN1A 2A7QA 2OLKA 3CNOA 1IXSB 2ZROA 4M9SA 2G1JA 1UBCA 2QBYA 4HAVA 3DDCA 3TR0A 4NCIA 4RD1A 1IJEA 4BFWA 5CLLA 3L0OA 4PANA 3I61A 5E4FA 1EFCA 1TUIA 1F60A 1NVUQ 1GL6A 4EAQA 4R2HA 5EUMA 1OF1A 3I62A 2FN4A 3UWKA 4DJTA 2OXCA 5SZHB 3JVUA 1VYVA 4RFVA 3A36A 1U8ZA 2X77A 4URWR 1OFHA 2O52A 3JZMA 1D9ZA 2FGKA 4MQBA 2Q3HA 1VG9B 2J0UB 3C7KA 4LDJA 2H18A 5H68A 2GZHA 3SYLA 2Z83A 4FMCB 1NIJA 3K8YA 2P5TB 5K8IA 2YWEA 3PCRB 4C0HA 2ZRBA 3D31A 2ODWA 3WYAA 3KQHA 4AYXA 2GWHA 3CW2A 1KI6B 2C03A 1CU1A 4TYQA 1U0JA 5DH9A 1E96A 2XSZD 4JKIA 1TQ4A 2LWIA 2VP6A 1TF5A 2ZVPX 3LW7A 2GBLC 1LTQA 3KZ1E 5BQ5A 4C3ZA 2HEIA 3S1AB 1XXHB 4BWYA 4PC2A 3CR7A 1CP2A 2BCGY 1LB1B 2A5JA 4TT3A 3BK7A 4LV8B 4OK5A 4X8MA 4NCJA 1JXOA 1AQYA 2KSQA 2RGDA 4C0JA 4F4JA 4OL0A 4FMCF 1VCNA 2A5YB 1ZM7A 3MSXA 3C8UA 4FWTA 5KU1A 4I1SA 4W5WA 4JYBA 1FMLA 1GILA 2CNWD 2NO9A 3CB4A 4PPGA 2ZUDA 2FJUA 1N6LA 3M4YA 1LF0A 3X1WA 1CRQA 1KO8A 3ZGXA 4ZIRA 4QBIA 3PG5A 2GCPA 4LJYA 1N0VC 2XJ4A 2JLVA 1NBMA 3O8DA 2DFNA 2QM7A 2W6ID 4Q00A 1XPOA 4I4LA 2QL6A 4RFSB 3REFA 4P33A 2D7DA 1EWQA 1NLFA 5FPSA 1VHLA 2OEPA 3ZIAD 2JAQA 1E2LA 1OIXA 2ZYVX 1TU3A 2V6IA 5BWMA 2AFHE 2WJGA 5EE1A 3QPWA 2B7CA 5D3MB 1VCMA 4RZXA 4DT1A 2KBFA 3NC1C 1ZINA 2PT5A 3AVYA 1NSTA 2C9YA 2DFTA 2OBNA 2IHYA 2PMKA 3LWNA 5TY0A 3AP3A 3QOFA 3R9IA 1F5NA 2JLYA 3W5JA 2AWNA 2AK3A 4JSTA 2EFEB 2JIZA 4ZPXA 2O8CA 3TUIC 2BMJA 2ZE5A 3GJ8A 4JLVA 1P5ZB 3ZYCA 1VIAA 3GEHA 3Q7PA 2HDNB 4Z51A 1ZM9A 5FUYA 5DYIA 3CZQA 3KQNA 1Z08A 1Z0DA 4JL6A 1SQ5A 4HB0A 1N5IA 2HLDD 4HDOB 1IQPA 1Q44A 3NDBB 1YRBA 4G1UC 4QXAA 4A0FA 1OH8A 2MSEB 2QAGB 1U0LA 3LVRE 2BDTA 1Q12A 1GG2A 3MUFA 3R8CA 5BYJA 3CH5A 3LV8A 4QJ4A 5J4LA 3VU9A 1EFUA 3P20A 3RYTC 2V9PA 1RW4A 1JNYA 1Z47A 2MMCA 1D2MA 1T91A 4BLSA 4PO9A 2VHCA 3U44A 1ZD9A 4UXIA 4XD7A 3U7GA 2PMDA 4Q4AB 2QORA 4Q9JA 5F3WB 2F43B 3A4MA 3SC3A 1MRSA 4LBVA 2FSGA 1F2TA 4V0OA 1VG0B 4HUTA 4D82A 3FFAA 3AV0B 1VMAA 2BBWA 2I1VB 2IUSA 1E9FA 4BZXA 4F91B 5HZHA 4CEJA 2MMGA 3GMTA 2FNAA 1ZIOA 2D74A 3GLHA 3SE0A 4OI0A 3LLUA 2PH1A 2I1QA 5AUNB 1G8GA 2H57A 1UDWA 3P27A 4TL6A 5GJCA 3W8NA 2QUZA 1W4AA 1E0JA 2CCGA 1FX0A 5JWOA 3QKUA 2ZRJA 2JLSA 1T8TA 1XU4A 2CLSA 1W36B 1AKYA 1FPMA 2CLDX 2BM0A 3EIHA 4YC7A 1WBDA 3B78A 4QJ5A 1KI1A 2BKUA 5J4VA 3AP1A 3QF4B 221PA 2EFGA 5DNYB 4AD8A 2QY9A 2OCYC 3L0PA 1VDZA 3KXLA 3MWYW 3QBVA 4QHTA 5G40A 3IEVA 1LS1A 1YJ5A 2YWFA 4NONA 4A1FA 4B74A 4C0AC 1EWRA 3KL4A 4X8LA 1LVGA 4RY2A 5FL7D 2NGRA 4G5RA 3OIWA 1G5PA 3V9PA 4OJQA 3DOFA 4MKIA 1X6VA 1YU9A 2HUPA 4L16A 1CXZA 1E99A 1P72A 4OHWA 4Z8XA 4AIIA 1EGAA 2ZI5A 2IXGA 4C30A 1FMJA 2ZUBA 1KO4A 2KBEA 1UM8A 3DHWC 2E1RA 3FYHA 3QKSB 4GZLA 3MJRA 4B3FX 1TADA 2QN6A 1US8B 1KAGA 1G64A 2XXAB 4L5BA 4V0KA 1PLJA 1W1WA 3IIKA 3FGNA 2IF2A 3W6OA 1XEXA 2V8OA 1EXMA 3NHAA 3UMFA 1Z6GA 4URUR 3KKNA 5EE0A 4Q9KA 3WHKA 3SZRA 1JEEA 1RJ9A 4BQSA 3BAFA 3HYRA 5IF9A 3NBZC 4G5QA 2R2AA 2QNRA 2H7VA 4G01B 4DLWA 4Q1FA 4JS0A 4ON9A 3B6EA 5CM8B 2ZRIA 1MO5A 2GBLA 3CBQA 3X2SA 4LI0A 2AN9A 4M8NE 1COWA 1Z22A 1AK2A 2EYQA 2XTNA 3PENA 5KDOA 4DB2A 1R6BX 1SHZA 2YOFA 3U2QA 5B57C 1DAIA 1FW6A 4QBHA 2RGGA 2Q0HA 2ASEA 4M1OA 2ZSEA 3MG9A 2C99A 1GKYA 1AZSC 3LBHA 2QTVB 2F6RA 3A1WA 2F1HA 1CJUC 1P3JA 4JMPA 3BS4A 4AI6A 3OESA 4F93B 2FPLA 1L8QA 2A5DA 5P21A 1FOEB 1ZCBA 1DAMA 2GEVA 3B9QA 3W6NA 1MABA 4BFTA 2QSYA 3DL0A 4YMVA 1N5LA 3PITA 2J46A 3NDPA 4DXAA 3BOSA 3IUYA 3K1JA 3HP1A 1DAFA 4Z8YA 4EPWA 3TK1A 3LXRA 2IHBA 2ZSBA 4QGFA 1IHUA 1XRJA 3EASA 2V1UA 2ZI6A 2R6FA 2JIZD 2X2EA 4EFLA 2HF9A 1DELA 3AVXA 2K5UA 5EP4A 3SJAA 2OAQ1 3THXA 2HV8A 3EZ7A 1JQLB 4TQAA 2PZEA 4MGKR 3AF4A 2WZQA 3FMOB 4V0ME 2FEOA 1XXHE 4HAWA 1DVRA 1M74A 1UPTA 4AKIA 4PHGA 1SZPA 1XCGB 2B8WA 4HB2A 1H8EA 5C4GB 5FI0B 4R98A 2WJJA 4DIEA 3CRVA 5GJWC 5CB6A 1SVKA 4D81A 4FWIB 4CT5A 5L3QA 3AGQA 1XCPA 3QEOA 1XPRA 1V43A 5DN6A 4C7OA 3CONA 2ZRDA 4DUGA 4BASA 1W36D 4GPTA 4BLRA 3OFNA 5HE9A 4XD7D 1OLOA 3GJ5A 1Z0JA 121PA 3QI2A 3KKQA 3R7WB 4URVR 1CJMA 2ZYTX 3GFTA 3C4JA 1HY3A 3LFUA 4QGHA 4PR0A 3V4RA 3RVBA 2R9VA 5IT5A 3L0IB 3RAPR 4HZIA 3A6PC 4HLQB 3GEIA 1OB2A 4DDTA 2W2VA 1KTVA 1GITA 5DI3A 1TMKA 1ESNA 1G17A 1KSHA 3D7MA 1XTSA 1ETUA 1IY2A 2NIPA 3AKEA 2CHGA 1TQDA 2C9CA 1ZCAA 3Q9LA 621PA 2VF8A 1Z2AA 2B92A 3UG7A 1X86B 2GEDA 4GT1A 1XMIA 1CJVC 1F48A 2R6AA 1ZUIA 2XEXA 3K09C 4R2IA 3HYTA 4KYUA 1NVVR 3BWDD 4KFSA 3AB3A 5TXGA 3B82A 1X1SA 5DSZA 1FNNA 1UAAA 4NDZA 5TARA 5JWHA 2G0TA 3OIVA 4PPQA 3MAAC 4KVAA 1GFIA 4U00A 5JECA 2D2FA 1G16A 1QVAA 4I99A 4P31A 1PLKA 1Q3TA 4KV9A 4NYMQ 1JB1A 2G6BA 4I1VA 2J5XA 1N3BA 2QU8A 1E2FA 2IF0A 1N25A 2VP2A 5CM9C 3W8RA 5IK2D 4Q4JA 4EPXA 2BEKA 4TYYA 2JDID 2IYWA 3O47A 4CF7A 3SHFA 3SYKA 1ZNXA 2QRZA 3QKTA 3SQWA 1PZNA 4O2LA 1Q1ZA 4LV6A 4RZ2A 4TLBA 4CEIB 3IHWA 2N1BA 4N0EA 3VNVA 3VTKA 4Q1AA 4LJ5A 4RKFA 2HYIC 4F38A 5LB4A 2DBYA 3SN6A 2DHRA 3BH0A 1K6MA 4Z54A 1GVNB 2JLWA 4TLAA 3I72A 2A3RA 1XJ0A 2GK7A 2GNOA 1QHXA 1MH1A 2HXSA 4KBGA 4AURA 2YNMA 5JS8A 2QROA 1ZM4A 4CRWB 3HJNA 5M04A 2UZIR 3FKSD 3LNCA 4H9GA 3KJIA 1XF9A 2GZAA 4B71A 5EP2A 1LNZA 3CNNA 2J87A 3W3ZB 4B34A 3C41J 4Q4HA 1GL7A 3FHOA 3HWSA 4QRHA 3RRNA 1U81A 5E95A 4ZDKA 5TB5A 4A82A 4DB4A 4E03A 4AKGA 2VSFA 3IBYA 2OILA 4UJ3A 2DWPA 3TNFA 1IM2A 1ZVQA 1S2MA 2J1LA 4JLAA 4CDGA 4KITB 2LCFA 2WWYA 3A1TA 2MSCB 5JEEA 5GJVC 2ODEA 2KB0A 3TIFA 3KTAA 3HPRA 1MOZA 4Q66C 4CYMA 2IBMA 1A2KC 1TX4B 3BB3A 4PHHA 2JJ2A 1IN5A 4TYPA 3GPLA 1AKEA 5DIFA 1N6KA 2ZRLA 2CCKA 3C5HA 5GVRA 1R5NA 2FOLA 1YZLA 4IFEA 2CK3D 1P60A 4KLNA 4OI4A 4DEYA 1YZTA 2AXPA 3B13B 4D0GA 2H17A 4EUNA 4ASUD 1Z0FA 1GRNA 3QIAA 3REGA 2QRNA 1GM5A 2IUTA 4LZZA 2EVWX 1OKKD 1KNXA 2H1LA 3BBPA 2X1VA 3FE2A 5ANRB 2IC5A 4B47A 4IJMA 3SU8A 2BBOA 3B1XA 3NEYA 1G21E 4W5HA 5JCZA 3Q8XB 2A30A 3TH5A 3FDIA 4UQOA 2WWWA 3AUXA 2NTYC 2QAGC 2ATXA 2ZSFA 3RS7A 5FTMA 3MGCA 2QPOA 4LBWA 1OT3A 2WSSD 1XD2A 1NF3A 3VKWA 2ZSDA 4M1TA 1ZRHA 4KFRA 1H65A 4LPKA 1U9IA 4JVLA 4LHVA 1NJGA 2MSDB 3W34A 1H8ED 3ZIAA 1XFAA 2OBMA 3AH8A 3NBFA 4TYNA 4DEXA 3CPJB 5FUWA 2BCJQ 3QPUA 5DO9A 2VHTA 1DO2A 1E2EA 4JBWA 3UANA 4BEJA 2FDCA 1WXQA 4C0KA 1CLUA 5DN6D 1HTWA 3X1YA 1JI0A 3EW9A 1AQUA 4F92B 3R9WA 2YV5A 3ZZ0A 3FMFA 1E69A 1MV5A 2P3SA 1SVSA 3A1VA 2IYRA 4S35A 2C9OA 4LV5B 2VL7A 2XAUA 4OQLA 2B7BA 5EE9A 1TU4A 1E9BA 3F5FA 421PA 4D80A 2OFWA 1A5TA 5DHFA 4A2PA 2GXAA 4P3YA 4ARZA 3KQLA 2WIAA 5BXQC 4OJKA 1Z28A 2HLDA 3SBDA 4A0RA 4NPHA 3QEJA 2AWOA 2EFCB 5DISB 5KYKA 1M6NA 4Q5IA 1ZUNB 2WTUA 4D4KA 4ZCLA 4DC9A 4PAMA 4DCNA 1FFHA 1XTRA 1W36C 2GEUA 3B60A 1II9A 2QMEA 3IGFA 1R5BA 5H1YA 2GJSA 2J0VA 1Z5ZA 2CE2X 5JFGA 3LRPA 4DLRA 4KU4A 1S0UA 5HZKA 1FTNA 3AVTA 5FBWB 1OH6A 3CWZA 1QHNA 4EJSB 4N3NA 5SZKB 4QKQA 3OHMA 1AIPA 2BMFA 4LCBA 4G0NA 2REBA 2N46A 1G8PA 1JALA 1BYUA 3MWLA 1NY6A 3TAHA 4BUJA 1JJVA 4B2LA 1WRBA 4ACAA 1Z83A 3T1OA 3C14C 2VH5R 4P4TA 3VNUA 3FPAA 5C18A 5FPHA 3UMRA 2YC2C 2ZR0A 2ZRNA 1XTQA 2BVNA 2FSIA 3SFVA 4A9AA 2G88A 1J90A 3GLIB 3TJZA 2XTZA 3ZDQA 1R8QA 1KYIA 2OBLA 2V55B 3QJYA 4HYYA 4POAA 4RD3A 5BW8A 2GETA 2Y8EA 2ECKA 3A8TA 5FFMA 2J0UA 1AS2A 4CIDA 4IEEA 2YZ2A 3NEJA 3Q7QA 4DLXA 3SQXA 3RS4A 3LA6A 5CIQA 5JZVA 2YOGA 2BEJA 2J41A 3NTUA 5JMTA 3ICEA 2G3YA 5CJ2A 3WBJA 3K53A 4XVRA 3DMDA 3ZD7A 1ZD1A 1VKJA 3I1FA 1KDTA 4R9UC 1KI6A 2WOJA 3BERA 4KVGA 4CW7A 1T3SA 1RIFA 1RKBA 3RSLA 2ZR9A 3S1AA 1TPZA 3ECCA 4V0MA 2REXB 2CEAA 3VAAA 1XXHA 5FL7A 2WVJA 3CUEF 5JWRA 2WWHA 1EFTA 4NYJQ 3QY0A 3B9PA 1D8TA 2WKPA 4OI2A 4PC6A 2PZFA 3SNHA 1E1QD 1M34E 2BV3A 3QXXA 4YMTA 3BXZA 3UK6A 4NHOA 2AXNA 4URYR 4WOPA 1HUQA 4URZR 1DO0A 4M53A 1P61B 3SYNA 5E3HA 3EPKA 4BLPA 3UATA 1R2QA 3FB4A 3H86A 4CEHB 4DDVA 2OZEA 5FOVA 1RYHA 1SVIA 1VECA 2GTPA 1GNPA 1RC8A 4FW9A 2HT6A 4Q19A 3SEAA 4M9QA 4RD4A 1KSFX 2JGNA 4DLZA 4Q7KA 2HCJB 2JJ2D 2RGCA 3BIFA 2F1RA 4XJXA 5AJXA 1UKEA 2GESA 2D06A 2AKAB 3NVAA 2V7QD 2ZE6A 3WMEA 1YHNA 3K9NA 3ZH9B 5FPKA 3E1SA 4HEJA 3AF2A 1S1CA 2GCNA 3GD7A 3K0CA 4RFSA 5AJYA 4TMXA 3J81k 1WBBA 4PHFA 4GOJA 1T6NA 2G1KA 4L9SA 4BFZA 5D3MA 1BIFA 1QG4A 2DR3A 3KUDA 3ND9A 4NYJR 2ERYA 4OHVA 1LS6A 1XZQA 4C0SA 3GFOA 3SOPA 4BFUA 1DS6A 3KQUA 3RRYA 4LHWA 4OYHA 5KSOA 1J99A 4NZYA 2PT7A 3OZXA 4PC3A 4YXWA 1J7KA 2Z0MA 4Q47A 4AYWA 2L0XA 1KI9A 3Q72A 4DCVA 2BIFA 4JVMA 1IBRA 2PCJA 1Z07A 2HJVA 1Z29A 1IN6A 5LB2A 2REOA 721PA 4PSKA 5CDFE 1VHTA 1RPZA 3EC2A 4D4LA 1KOFA 2QAGA 4TSFD 2C98A 1MO3A 3GLFB 4P32A 4Q9HA 5EXSA 1ZC3A 4L9WA 2ZRMA 5A0FA 4GDFA 1P7CA 3QF7A 5TDHA 2BWJA 1SKQA 2Q9BA 1IY0A 4MKFA 1YZKA 1G8HA 2ZITA 2OXRA 1J70A 4O0MA 3UXMA 3GJXC 1ZD8A 4UNSA 3PUWA 3PEVA 2GDJA 4Q4AA 1ZYUA 4DLTA 3PEWA 1KZGB 2F43A 2JLQA 3GEEA 3OIYA 1MRNA 2ZUCA 4ILEA 3ZJYA 4MKHA 4ZDIA 1OXTA 1VCIA 1K5DA 1FP6A 3PXGA 1II0A 4TTRA 2W58A 2ZRCA 1E9SA 1EK0A 1UBGA 1CR1A 2WJYA 3K70B 2O8DB 5KSZA 4NKRA 4AYTA 1S3SA 1ZC4A 1FZQA 1F3OA 4BLOA 1OSNA 2GCOB 3AUYA 4PO8A 4HAYA 2IK8A 2ORWA 3A1SA 5IDVA 4ZCMA 3TGPA 2IYXA 3B1YA 4DKXA 5K8LA 5KO2A 3VR6A 2OSBA 1RE0A 3VKHA 1SXJB 3IQXA 2J7PD 1LV7A 2ZU0C 4F4IA 1E79A 2CVHA 1R0YA 1T4GA 4V02A 2FG5A 2PLRA 2OO7A 5KUTA 3PVSA 5H8WA 5FOTA 1CS4C 1XD8A 3MRSA 5F98A 2EQBA 2F3TA 4IDNA 1Q1BA 3P4XA 4KO8A 1RFLA 4MDFA 2ZI7A 3QXSA 2J0QA 3QVUA 4F4CA 3RS5A 1OXXK 4JL5A 5EP3A 3U4QB 2ZRPA 3QF4A 1N5KA 2XZLA 3THYB 3BB4A 2IW3A 3LBIA 5K8UA 3CX8A 5AUQA 4Q9IA 4CVNA 2XGJA 4MYUA 2OUKA 3VR4A 1OIVA 2WWXA 4W7SA 1ZIPA 4GOXA 4B33A 1G3IA 1M8PA 4EPRA 1A7JA 4MGIR 2W0MA 2AKYA 3W3AA 2CJWB 3TQCA 4E07A 1T3HA 3EZFA 1G3RA 2OFXA 4KHZA 4PAQA 5B30A 5JSZB 1PV4A 2JJ8A 1P2SA 3AKDA 3L2OB 3LH5A 4HUQB 4RVCA 5EP1A 5TV2A 4EQ6B 4AY2A 4DDUA 3SDZA 1DBSA 1HURA 3QKSA 4AK9A 3QSYA 2IWHA 3EPHA 2CBZA 1US8A 4JSYA 4M9ZA 2XXAA 3KKPA 3LXXA 2FMXA 1WB9A 2IEZA 1ZU5A 4WA7A 1HT1E 5FOWA 3BE4A 4GP6A 5CK5A 4A6XA 821PA 5IK2A 3ZVRA 2V3CC 2F55A 2W2TA 1N6OA 2W00A 3IPXA 2H5EA 5CLQA 2JDIA 3MMPA 2AR7A 3O8RA 3IHLA 4PQFA 3B1VA 5CYOA 3PV0A 4A6PA 4XTCS 1C9KA 2CE7A 2P2LA 4ZDJA 1DARA 1FUKA 5FR1A 2A2ZA 1HEIA 5FOUA 3LX5A 3CNLA 2GAOA 1SKYB 3VQTA 2YYZA 2ZI9A 2D2EA 1P62B 2OE2A 1QHHB 5KNBA 2WHXA 3QG1A 2GJAA 4MA4A 4U5XA 1Z8FA 3SI7A 1WF3A 2CMKA 1E9AA 2Z6VA 4WXRA 2PJRA 4B35A 2IYSA 4AG5A 3FKQA 2FZLA 1IN4A 2OCPA 2QEQA 2IYZA 1CF4A 1KMHB 1GAJA 2BMDA 2PZGA 2G77B 3LVQE 1C1YA 5EUQB 1CEEA 1M7BA 3N70A 2V6JA 1HQYE 1IJFA 1I2DA 4PAOA 5L8VA 2NO6A 2GXSA 4IRUB 3Q5EA 1W7AA 1E4YA 4QGAA 3ZVMA 3FKSA 1AA9A 1XEWY 3AVWA 1ZW6A 2B6HA 1E32A 1NN0A 3LLMA 4W5JA 1EG7A 3OEHD 5JJKA 1E94E 2OT3B 3GLIE 4H1UA 4L4UA 1KNQA 2IT1A 3P26A 4LBYA 5FR2A 3LBNA 2VPPA 2ZS9A 1OFUX 2WBLC 4HSEA 4LJAA 4O2RA 4V0LA 4AC9A 5E7JA 2A5GA 1RZ3A 2CXXA 1K5GA 1VPLA 3K9HA 4S2EA 2IX3A 1XDBA 4M0LA 3PIRA 2RGBA 4R71A 1R4AA 3NIBA 4H1VA 1G7CA 1P4SA 4G5OA 2Q9AA 1G291 3FTQA 3B2EA 4WXPA 2JLRA 4B3XA 4MKGA 3AKYA 3G0HA 4YXWD 4JIMA 1A2BA 1WMSA 4HLCA 1OFIA 3I8SA 3QENA 1DAHA 3IBGA 1NIPA 3B85A 3T15A 2EFHB 3K70D 4C2TA 1LY1A 4RD0A 3G5UA 1KJWA 1NVWQ 3GLGB 2TMKA 1UDXA 2CK3A 2ZRHA 3WNDA 4XSHA 3ADDA 4Q03A 3OE7D 4HB4A 1SXJD 1GZSA 4RD6A 4ASUA 1VG1A 1W0JA 1KK2A 3TSOA 1X8LA 1OKKA 4GBMA 5A5GA 1OE0A 3EZ9A 3I5YA 1D2NA 1H8HD 1ZM2A 2QP4A 4KSCA 4LJ6A 4GP7A 2FZ4A 3H0KA 3T5GA 1O87A 2NZ8A 3R7WA 3B8HA 4DBLC 2WJVA 2D3WA 1KK3A 2ZETA 3NH9A 1JPNA 2WPDD 3PQCA 4X8HA 4A0GA 2DB3A 1WCV1 2PCLA 2ZPTX 1OH7A 3T35A 2W0SA 4LHYA 3X1ZA 2I3BA 1P2VA 2WWIA 4IXMA 1Z6TA 3F8TA 1J8YF 1W0KD 2VRWA 4Z1MD 2XOKD 4ZV4A 4ESHA 2WSSA 3WMGA 4ZKDA 1HE8B 5DE3A 5CB8A 2CVFA 2HJGA 3ASZA 2YJTD 1Q20A 5EZ6B 3TW4A 4TL8A 4EPTA 1D6JA 1KDOA 1QG2A 3B1ZA 3HDTA 1E3MA 4IDPA 5C46F 3I73A 4JT4A 3U3RA 4NYIQ 1P6XA 1XMVA 1DEKA 1E79D 1GSIA 3L82B 3QBTA 4OHXA 3VR2A 2QI9C 3CRMA 2QGNA 3IIJA 4EJSC 5UKDA 4QBGB 2ONKA 4IFBA 2G83A 4PTLA 3BFKA 1EESA 5EJEA 1OPXA 1JBKA 1X1RA 3FOZA 4MRVA 2W6JD 4A0HA 1Z3IX 1IAQA 2ZJ2A 2ZANA 4DHEA 1KI8A 5AK0A 5C1BA 4NE2A 2FFBA 4RJLA 1YR7A 2W83A 521PA 4YMWA 2QZ4A 4BLQA 2DCUA 3UIEA 3GLFE 1ZUHA 4LSGA 3UG6A 2IS2A 2ZS7A 1KKMA 1NSFA 3A4LA 3U6BA 3F3YA 1WQ1R 2QG6A 1BMFD 4IVQA 4R7ZA 1E9RA 2XB4A 1Z63A 5BN4A 1WE2A 2XZOA 4CEIA 5KSYA 1G9XA 1R7RA 4WZBE 1Z06A 2P6RA 2V4ZA 4IW3B 5IHPA 3LD9A 4Q7JB 3TR5A 3TLXA 3MFYA 2NZJA 2J7KA 2WKRA 2XJ9A 1ZAKA 4KSBA 3LY5A 4HI0E 1EFHA 2P6UA 3CKLA 4WIAA 3O8CA 3CF6R 1W48A 1BYIA 5IRCD 1R0ZA 1FQKA 4IOLA 1U2RA 2VHUA 4PQRA 5E7IA 1NJFA 4X8OA 2WV9A 2DFLA 2Z4SA 2NO7A 3ZZUA 4EDHA 2KE5A 1SXJE 5CDFA 5FBRB 3VHXA 1RVDA 4TN1A 3VFDA 5J4KA 4MDEA 4DSOA 4HZUB 5JJIA 4RCZA 4IXNA 1UEJA 4JT2A 2VHQA 1N2CE 1UADA 1T3LA 2O0KA 2Q21A 3DZDA 5KNCA 2O8FB 1P9WA 1E2HA 2QQEA 5G3YA 4B3GA 2VP9A 1PVOA 3T1QA 4A8JB 3AVOA 3TBKA 2IYVA 4M1SA 1CR0A 1VTKA 2FSHA 1TF7A 1Q3HA 4Q1CA 1BS1A 2FA9A 4J0QA 3W6PA 3R8FA 4B75A 2IS6A 1E4VA 3B7GA 1HH4A 5HCNA 1CIPA 4XSGA 4HDQB 1U98A 4QNMA 3X1XA 4XVQA 2X8AA 4NYMR 3A1UA 3KB2A 3IO3A 4M2LA 4JKYA 1Q1EA 1R10A 2P67A 3PR1A 4TQUS 4BFVA 3CX6A 2GXUA 1GKUB 4DLVA 3WHLA 3W5IA 3DM5A 4TLEA 1E9DA 3KJHA 1GL9B 2NQ2C 3TVTA 4KYIB 2QT0A 2PEYA 3KXKA 4NCKA 1J8MF 4OBEA 4GI7A 2Q3FA 3UMSA 1E1QA 1KI7A 2WICA 1X8KA 1YVDA 4OK3A 1C4OA 1DPFA 4HAZA 2BM1A 2C8VA 4MYCA 1LW7A 1E2GA 1S1MA 4PC1A 2BBSA 4LJ4A 4B3DA 1HE1C 5HKKA 1M7HA 2PLFA 4XTRA 3TVDA 4PC7A 1IONA 2J3EA 2YOHA 2F1JA 2IA5A 2QTFA 3KUCA 2R8RA 2XZPA 4WAUA 3HR7A 1XMSA 4KAXA 4C9BA 2V7QA 4M21A 1GNRA 1SKYE 1XNJA 1JEDA 1QDEA 2KWIA 2QPTA 3GJ0A 2QENA 3ZVNA 3HU3A 4US1R 1KMQA 4BEBA 1XPUA 4DSTA 1ZNWA 4DCTA 1AGPA 3U3KA 3IEUA 4ZKEA 1W0JD 3KX2A 2ZVQX 1OB5A 1T5IA 1BO6A 2ODNA 1G3MA 2VO1A 3NBYC 5H70A 4KI0A 5CK4A 1K8RA 1P9RA 3LQRA 3LX8A 4BZQA 3D8BA 4ZDWA 3A58B 4DZZA 4Q7MB 4QG7A 3AKCA 4E5UA 3K70C 2H16A 2VSOA 4A2QA 4B73A 1G3QA 4EPVA 2IWRA 5C2JB 1Q0UA 2O5VA 3W90A 2PJZA 4JBXA 5FH9A 2N42A 2D7CA 3L8YA 2C04A 4NU0A 1YRAA 5L3RA 3QXCA 3BFXA 2J59A 4TSFA 5KPDA 1SXJC 5AJVB 3ADCA 3MJHA 2P6NA 2IYUA 4B2IA 5J4YA 2ONJA 4WVFA 4JLMA 4HB3A 1G7TA 1CJTC 2F1IA 1OV4A 1EFRA 3ND8A 3QKRB 1OXVA 2XTMA 2ZJ8A 2ERXA 2XITA 4JLKA 1LF5A 1Q1QA 1JAIA 5B58C 2ZTSA 2UZ3A 5FL3A 1DG1G 3F0TA 5AR1A 1VYTA 4LHXA 4FXPA 4EJSA 1W2GA 1OIWA 2XNSA 4IOKA 3CR8A 4PSAA 4D2IA 1XTJA 2DWOA 5AWFC 3THOA 4KFTA 3H1TA 3QQ5A 2FFQA 3AQ4A 1L4YA 2Z43A 2RGAA 3CF2A 4LPSA 2O8EB 3RC3A 3GLGE 1YR8A 4PX9A 3RWMB 1G3UA 1NY5A 2EFDB 4HLDA 2OG2A 3U60B 4UNNA 1NG1A 4BPBA 4LUCA 4JJZA 4IDOA 3IQWA 2IYLD 1UF9A 2SHKA 4EPYA 1N6NA 3NXSA 2Z4RA 4M1KA 1W44A 2R6GA 4UXHA 3GLIA 2J7PA 1NG9A 1I4LD 1KSJA 3TQFA 1Z6YA 1PUJA 3HPQA 3TKLA 2HF8A 1UKZA 4LJ8A 2C5LA 4OI1A 4URXR 2YHSA 4PHTA 2ZAOA 1UKVY 2ZRFA 3K09A 1Y63A 1DAGA 1T8UA 4F7WA 4QNRA 1R0XA 1N6HA 3BORA 1OHHA 3B1WA 3VX4A 1JJ7A 4LJ7A 3Q85A 5F2EA 1E1RD 3ZS9A 1L2TA 3RABA 3GJ7A 3WXMA 1IN8A 3VMFA 1Z0KA 2JJ1D 2WWGA 4K81B 3RHFA 1D9XA 3RS2A 4A92A 4AKHA 2A5FA 2ZE8A 4OHZA 2EWVA 4II7A 4HAXA 5CITA 1A4RA 1II8B 3WRYC 5G3ZA 5LD2B 2GVZC 3EIQA 1W46A 3R20A 2B21A 1KZ7B 1ZP6A 3H2YA 1KK1A 1IXZA 1GNQA 2WMOB 2GJ8A 4NCNA 3AVUA 3BH7A 4B2PA 4DVGA 3TUZC 1OJLA 3KXIA 3SHWA 4OHYA 1VG8A 2QE7D 2Q6TA 3BGWA 3T06B 2V1XA 2ZYUX 2FSFA 4LYJA 4DLSA 2ORIA 3VR5A 4CEHA 2LKCA 2GF9A 3QG5A 1CKEA 4OQXA 4JLBA 1SVLA 2JATA 3H4MA 1OXUA 4DLUA 5FBLB 2OV2A 5J40A 1HQCA 5K8TA 1G8FA 5EZ5A 3ASYA 3U61B 1OYYA 1QVRA 1UEIA 4JLOA 3FMIA 4BFYA 1QBKC 2RHDA 4KODA 3K0FB 2R62A 1AS3A 4FN5A 1HA3A 3CRW1 1ZBDA 5KDDA 1GP2A 4UNRA 1XJCA 4QM7A 1FNMA 4D6PA 4Y0AA 3EA0A 3N5CA 1MO6A 2DY1A 5G53C 1F2UB 1PUIA 1NN3A 2DYKA 4GFDA 5SZJA 4EFMA 2JASA 1GIAA 2QMHA 4Q1DA 2Z5FA 1HT2E 1GWNA 3WRXC 1GKIA 2RH5A 3K0AB 4ZO4A 5HKKD 4TTQA 1SGWA 2ANCA 2RGNC 1AJEA 2GJKA 2CDNA 5C4MA 1AS0A 3RSOA 1QHYA 2ZJAA 5TMPA 3N2IA 2RGXA 2A78A 4TZ6A 3THWB 5DHAA 3CIOA 3JZAA 3RANA 1WDTA 4QJ3A 2RHMA 5GJBA 1DOAA 4OK6A 4P4SB 2KI5A 3OEHA 1N5JA 2GILA 1HV8A 2NOAA 4KJZA 3SFZA 3GLFA 5FUVA 5ELXA 4BGDA 5GADl 1QHSA 4ACBA 4D0NA 3IO5A 1XCMA 4Q48A 1GDDA 2ZQ5A 2NO1A 1G6HA 4U02A 2P5SA 1KK0A 2QBYB 1P2UA 3CZPA 1TEXA 2F3RA 3EZ2A 4FMBB 4M1MA 3RDPA 3RNLA 2AK2A 2V54A 3NBXX 1YE8A 3NKVA 3PUXA 3EWAA 1G4AE 3R9XA 2DPXA 4LJ9A 1AN0A 3I92A 3E2IA 1Z0AA 2O8DA 2C2HA 1T5LA 5JHHB 3OAAD 1I4DD 3QUSA 4QFMA 3GQBA 2GCOA 4XIGS 5CJPA 2IL1A 4B6FA 4DWJA 4TMWA 1KI3A 4QBFA 2CHVA 1EFRD 3OE7A 1L7VC 1SXJA 2D4HA 3G82C 1KY3A 3CM0A 1XEWX 2WM9B 3WNBA 2WMNB 1ZMXA 3OIUA 4JLPA 5CYPA 2ZR7A 1O3YA 4A15A 1H8HA 1S9DA 2QT1A 3DEFA 1ZM3A 4Q02A 4RSGA 3TE6A 4BLTA 5BN5A 2IS4A 5LBIA 1E2PA 2WAYA 2VP5A 2PEZA 1T0JB 3U3JA 4D0LB 1QHGA 2WPDA 2RCNA 2F9LA 4KFUA 5AJWA 3UWOA 3W9YA 3U4QA 4MYTA 4CZ2A 2X19A 3NH6A 5HPYB 3THYA 2J0SA 1NP6A 2J9RA 4CGZA 5FUXA 1OH5A 1W0KA 4Z1MA 4P4UA 2XOKA 1SVMA 4IOJA 2ZEJA 2QMUA 1JXMA 1KAOA 1HYQA 2VLIA 1DADA 3GJ3A 4ITRC 4ZI2A 4YLGA 1BH2A 1M7GA 2F7SA 2JA1A 4JLNA 5FOSA 2CJWA 1NL3A 2ORVA 5F9HA 4A36A 3BD9A 2HYDA 4LWZA 2F9MA 3ZQJA 3VR1A 3DOEA 3FHCB 5JSZA 4IVRA 1Y3AA 2OCBA 4HUQA 4DCUA 4EQ6A 5JBQA 2FPKA 3IDQA 3MWKA 2OLJA 2ZIAA 4ZIRB 4YMSA 4Q21A 4Q9LA 4U7DA 1JQJC 1MO4A 4B43A 1KDRA 2GKSA 2W6JA 3KJGA 4I81A 4QHSA 4MRRA 3T5DA 1OHHD 2AL7A 4FI3C 1IN7A 4PZZA 4XWAA 1E6CA 2EW1A 5J5CA 5LPNA 2PX0A 4N0DA 3MLEA 4DSUA 4NCHA 5AUOB 1KIMA 2GVDC 4K46A 2ZI3A 1SVOA 4RCYA 4DT1B 3EC1A 3WYGA 5KOYA 3I8XA 5L3SA 1PLLA 2HXYA 4B3CA 5GVSA 3AVVA 4A8JC 1BMFA 1VYUA 1EX7A 1QHHA 1QZXA 3B5JA 3KJEA 3PUZA 4JVNA 2O8CB 1E2JA 1DAEA 2GZDA 4IKEA 2W2XA 4IHQA 4D4JA 3PEYA 1YR9A 2ANBA 5SZIA 5TVKA 5FOXA 1KMHA 4RKEA 2FE4A 2ZI4A 3N2EA 1XMJA 1MKYA 2ZRGA 2VBCA 1JR3D 4BZPA 5KHOC 4HDCA 3JVVA 1XTKA 2OCAA 3RS0A 2BMEA 3FMPB 4I1OA 3VU9B 3NWJA 3A37A 2IEYA 2C96A 2GF0A 4LBZA 3OF5A 4TMVA 5EXXA 4IVPA 5L3SB 1Q21A 4XVUA 1E9CA 4EFNA 4PQYA 4AG6A 5J4HA 3U44B 3K9LA 5JI2E 4LK2A 1TNDA 1IXRC 3NG1A 2ZE7A 2NO0A 3SJZA 4D26A 1G18A 1CR4A 2RAPA 3L0SA 1F2TB 1UBEA
chains in the Genus database with same CATH superfamily
4XYLA 4ZTZB 1YONA 4BQIA 4HDNA 4B76A 4Y1FA 5K0CA 1D2EA 5CMLA 3UFXA 5FTLA 3AL3A 1S96A 3RT9A 4ZI7F 4LHZA 1GTVA 1TQ2A 3QY9A 3A2LA 1NXSA 4L15A 5H9VA 1JPJA 1S4MA 2VPZA 4MR9B 3T5MA 3A05A 4KKXB 6REQA 3A4NA 2EKBA 1AQLA 1VGRA 2NTJA 2OCIA 2ZU6A 2JLBA 4LCJA 3S55A 2XRZA 1V39A 4OXYA 4AWAA 3TRFA 2H2HA 4HTFA 3LHSA 3BCHA 4V0NA 2QM8A 4MTLA 1Z74A 2Q3MA 2YHIA 3D59A 3LWZA 5HFJA 3SY8A 5IG2A 3RC8A 3OFVA 3N2NA 2B8EA 1EVJA 2RGEA 3RRZA 4PG8A 2IOQA 1D04A 2JRCA 2J0EA 2WAMA 2WF8A 3Q5GA 4BV8A 5HKBA 5JE8A 1SAYA 3TEMA 5K9ZA 1YA8A 4I50A 5IKMA 3RRMA 3KQMA 3RTGA 5J47A 1CY0A 3KSMA 1S4QA 1MX5A 1UBFA 3V1MA 4C07A 3AIMA 3EXFA 3DTNA 2G80A 4CF4A 3S5JA 4DXDA 4GKKB 3Q8LA 1TPYA 1M54A 5AI4A 2F59A 3BB1A 3D5EA 3H5WA 1PG5A 4MYHA 4ERNA 4ZT3A 3AM4A 1W47A 5AVYA 3JYPA 1O03A 2OK8A 1YI8A 3C3DA 1OFTA 1GGFA 1KERA 3KYBA 1GOTA 3LUGA 1W88A 1BFUA 2O2EA 1RXWA 4C3OB 1WP9A 3VISA 2IZ5A 1E0AA 2UVQA 4NJEA 5LQKA 1NDUA 3FGPA 2D00A 4XW2A 4HPXB 5IC5A 3WL3A 4BAZA 4EELA 2BSQA 3M1IA 2R6CA 3HZZA 3E9NA 2JFFA 1AGNA 4UPVA 3V1TC 1JAHA 2FUG6 3FA2A 2NPIA 4FCTA 4G5SA 3KKOA 4DANA 1RRVA 1GA4A 3NEPX 2EJUA 4KQHA 1KJYA 2COUA 1G7RA 4N6OA 4AICA 3BTOA 1CNMA 3GJ4A 1WZ2A 4TTPA 3FH0A 1F0PA 3V4LA 2YWGA 2HRBA 3CKMA 5TC4A 1TEHA 4F3TA 1YZQA 1JR3E 2A4KA 2QMQA 1FU4A 3MILA 1RJ9B 2EG5A 1BHSA 1NBMD 3PUVA 4JBIA 4KXMA 4L9RA 2H4FA 3AFHA 3D6AA 3EAQA 3AF1A 4INZA 3I04M 2HT1A 2HO5A 5IDXA 3O4GA 4L3VA 4J03A 2IHJA 3HH8A 5JCPA 2WQ7A 1V2GA 3OCYA 1TC2A 2BE9A 1JLMA 3BE5A 5FPYA 5A4MS 4N1AA 1SRQA 4IHJF 1J07A 3WWOA 1B23P 5TVGA 1GU7A 1W6RA 1WSAA 1ZA2A 3O91A 4IZIA 4FMDB 4GLLA 5C3UA 4EKDA 3QXJA 4UKDA 5AK4A 4MTCA 3EE6A 2LCIA 5K3SA 3BIJA 5CYFA 1NOJA 3WP0A 2Z09A 2GHIA 4CWAA 3E70C 4DQVA 2IOYA 2AN3A 2JI9A 4CQNA 2B98A 3LAWA 1MCZA 3K2BA 1QIHA 1XLWA 2ZKIA 4KO3S 5GGXA 5F9FA 3IE1A 4KMMA 1U8CB 3O83A 3KTFA 1IEQA 3RS3A 3VI3B 1XD9A 2OUIA 2ZTHA 4QTYA 5B2ZA 1ZJ6A 3VOAA 2UYOA 1P44A 4IRXA 3DO6A 2RHJA 4K9LA 4EGSA 5CRIA 3C8MA 3NT2A 1T4MA 1Y9AA 1Z5PA 3DV0A 3QJ5A 3JTEA 1CFJA 2JLUA 2DUUA 1X7ZB 3GRFA 1YA4A 3UC5A 4Y2TA 5ED0A 1AHNA 1CUZA 2C1EA 2D62A 2IITA 3E8SA 1D4ZA 5J1TB 5LD2C 4W9NA 4XUCA 1BA2A 2PSEA 3K5WA 1K1EA 1QE0A 4GR5A 1RBYA 5EYPB 4P98A 5ESRA 1DL5A 1OOEA 2R47A 2YWHA 4Z4FA 5EJ7A 5IT4A 1BWRA 2X15A 3DVRX 3COZA 3ZHOA 3U40A 4E5KA 2NZWA 4ENVA 4O2AB 1XVVA 3ES9A 5BYKA 1ACMA 4IEIA 2AI3A 2XKJE 3MTQA 4JDUA 4IQFA 4US0R 2R65A 4FT2A 4WUTA 3RVRA 4YAKA 3NFRA 5B4TA 1G20B 4NYIR 4EA9A 2Q4TA 4D9GA 2ZBEA 4WNAA 2G5CA 1T2CA 3RWOA 1D5CA 1BX3A 3J81A 2WNIA 4HNVA 4ENQA 3GCDA 3PQ3A 2GN8A 3QLEA 1LKZA 1PK7A 2QR5A 1CQJB 3O82A 5EUBA 5TQVA 1P2TA 1CTQA 3VO1A 1BX0A 3NU1A 4NWIA 2ZJYA 4E21A 2VPQA 1XTVA 1N1DA 4NP6A 3FPFA 5EQTA 1CIVA 4PZLA 5T8KA 1PV1A 4K9PA 1QCCA 4TUYF 4WDQA 1BDMA 3MT7A 1N0WA 4JUFA 4FGKA 4KUEA 1JHUA 4IHKA 4KQGA 1JWLA 1EYZA 3KV1A 4LKRA 5ALZA 1V8DA 3R5XA 4YROA 4CUKA 1Y5IA 3QLJA 3TDKA 5JISA 4GI2A 4LRWA 3B51X 5GQSA 1LLFA 2P11A 3KQTA 1OGIA 3HBAA 4ZU6X 3K9CA 2HSEA 3NTRA 2YZKA 4H18A 1RRCA 4G63A 2XB9A 4WFJA 3UAWA 3N76A 4GU5A 2XIJA 1QGED 2P9TA 4WOKA 4W6ZA 4P0TA 2Q0XA 3QIVA 2IVFA 3M82A 1NBME 1ZKMA 3SIWA 1OGJA 1A2QA 1NMXA 3GFPA 1XJQA 2XUZA 1NKSA 1COZA 4DUPA 5LU9A 3DKPA 3CLUD 4AMUA 1V5FA 2BRUC 4EMBA 1PZMA 3X0DA 3OZGA 3M6UA 4Q4DA 5EVJA 3PQ7A 5HXAA 5JROA 2VJMA 1XRNA 1G1AA 4DCSA 3QHQA 2PZBA 2Q5EA 5CA0A 1XNGA 3THRA 2ZUSA 3C5VA 3L43A 4DNXA 4FHFA 3DM9B 3KTDA 5KDLA 2I4IA 3DULA 4L8FA 4TL9A 2F62A 2EX0A 4XJTA 4KK4A 3UMJA 1KDZA 4BE9A 5LU8A 1ODCA 2BJVA 1V7CA 2H4WA 3IMFA 3KT6A 4GECA 4OQZA 1JDPA 4ROTA 4N01A 5F64A 2HRRA 4NU8X 1FMTA 1CT9A 1A8UA 4X20A 1DG3A 2IXEA 1W4BA 4KLZA 4H7FA 3T12A 2IYQA 1CYDA 1DBQA 2CXQA 4G0PA 4B3BA 3FOFC 4E22A 2SBTA 3LDHA 2GAAA 1TAQA 1GZ3A 1U3WA 2HWUA 1UAYA 1L1EA 2HK9A 2IPAB 4Y2JA 4HWRA 3CSDA 4IWXA 3TEFA 2Y67A 3OPMA 2A67A 3GR6A 5FTNA 4AJHA 3CH4B 3Q5DA 5B3KA 6AT1A 3PTZA 1SUIA 4IJQA 4XWOA 3BZWA 3U7IA 2IXTA 3MWEB 2NSDA 4CDMA 2RC6A 2INGX 3EGEA 1FL9A 1ENZA 1OTXA 5BPFA 4FYMA 1P3Y1 1P80A 3K32A 4A8HA 5C8DA 1SWWA 4QE3A 2FXIA 1RJEA 2GZ1A 3MWJA 4HSGA 1TCCA 1YWGO 2RJNA 4PPFA 2VP0A 4OMUA 1KI2A 4DADA 2ZW9A 4I66A 1XAJA 4YRQA 2FPUA 2W37A 3JARB 4JROA 4QDKA 1BKDR 1DJNA 1YZGA 5HF9A 5TMBA 4CQMA 1ZU4A 1BXGB 1MGPA 1R27A 2YY5A 4AO7A 4CKBB 3BWMA 1FTSA 5JBIA 1X39A 2X9LA 4UEKA 5A04A 3UENA 4B7CA 1FRVA 1OXSC 5JI3E 3VKGA 2BFBA 2MJLA 1M8JA 3CLTC 1O95D 4IH4A 5DNVA 3GVXA 1KPGA 4BVHA 4DMFA 1GRCA 2Z2XA 3C15C 1Z0IA 3CHYA 4KXVA 5DYGA 6PFKA 4HDAA 2XZDA 2ZJOA 3QUTA 4FKZA 3ZXYA 5IM4F 2QSZA 1DTWB 2J5BA 2IQ5A 3DDWA 3QUQA 4TLCA 1L8XA 2FPIA 3A9UA 4EJMA 1TAGA 1Z5NA 4Z7OB 3Q8MA 1QHFA 1G8JA 3DV9A 4EYEA 1JDNA 3DE2X 4HAUA 2O0HA 3EIEA 3HFJA 4K1LA 3WGMA 1CRPA 2JD0A 3EXAA 1E2QA 1JEYB 1MAHA 1U90A 4TV8B 5BN1A 3E8XA 1E0SA 5I9IA 5AKGA 1TQ6A 2IIPA 3AETB 4H7HA 2VQSA 2XVYA 4L2IA 2CXOA 2Q27A 1NATA 3AYXB 1ZQ9A 4FOTA 1EX9A 4KQFA 3RU2A 5FTKA 1IJBA 2HRZA 3P45A 4CR6A 1WQ4A 1ND5A 4EF6A 5BOSA 3CF0A 1EHIA 1B0UA 3WFJA 4Q18A 1G4UR 5DASA 4KI7A 5FI1B 4ESVA 3WNQA 4Q93A 4H4EA 1E7MA 1XEFA 4RH0A 5HIJA 2BKAA 3LP5A 1NN5A 3RKSA 1UWCA 3ND6A 4P8RA 2P9QA 2QTBA 4LOAA 3I9FA 5EZQA 5C8ZA 2C57A 4URHA 5IF3A 2UXDB 2NP6A 1O7JA 1PJQA 1UAGA 3D6MA 3IUNA 3QNUA 5E6RB 3IKVA 4EDFA 2NMVA 3GT4A 4J3NA 5DW3A 1S3GA 3PZRA 4C0QC 1WMEA 3S70A 4KWIA 2Z5GA 5IWAB 3M6MD 5L95A 2OO3A 2NZ2A 1FLNA 1RYYA 3ZNOA 3ZKAA 2IGTA 2Y1DA 1BGVA 4J1NA 1X3SA 4K9SA 3R7NA 4D9CA 1REQA 1EFAA 4OXKA 1VA5A 1FXUA 1P4JA 4CM9D 5L3VA 3C6BA 4R8MA 5J1SB 4GNKA 5L45A 3KT3A 1KY2A 3L8ZA 4QC2A 2CMFA 5I9TA 3OFND 2PUAA 4BGEA 1TL7C 3QXHA 4X90A 3IH5A 3NP7A 2X5KO 3W7VA 1T1EA 3L77A 4D4GA 3QV2A 4XPIB 8AT1A 4ME6A 1YB5A 4CHGA 2QSUA 1BS9A 4P3KA 5D1NA 1AMNA 3K1TA 4BXOB 1EA7A 5JS7A 2WE7A 1ID1A 5EI5A 2VYQA 2FPPA 1SQ0A 1CW2B 5AXAA 2HSGA 1TIPA 3WWZA 3T1TA 3ZHZA 2ILVA 3C3MA 3MK31 1FX1A 2R6ZA 4C6TB 4E32A 1CQWA 4RIIA 4ZAXA 1JS1X 4BNTA 4QGGA 4E14A 1OREA 4BVBA 3W06A 4ZI3A 1VGQA 3U0BA 3ADBA 2EQAA 4P38A 3H3JA 3T3GA 5JADA 2YINC 2OM6A 5F1YA 2IEAA 3PPIA 5FBVB 2AC7A 2ZSAA 4HGZA 1EZZA 4FGLA 4OA5A 5FT9A 4PXAA 1U7TA 1FE8A 3IKMB 3C3YA 3AM1A 2QL7A 3DQQA 1H3EA 1GLVA 1NKTA 4GOKA 3TW8B 1LFDB 3RVJA 1V5GA 2GEBA 1R4NA 3UMBA 1ISHA 1NM5A 4BB6A 1W5SA 1LDGA 2IDMA 2WSMA 2HRDA 4JJIA 4JVSB 2CKMA 2ZTMA 4M1YA 4TTAA 4NQRA 3LCRA 3TSZA 1B76A 1GJRA 2C9MA 3DCIA 2H3EA 3P9YA 4UZSA 5F5LA 4RF4A 2XCOA 2M9MA 4QQFA 4XARA 2X5JO 3NTOA 4Y98A 4BLUA 3SDBA 3ZS8A 4B3SB 1J2RA 1UXGA 3OOHA 3U5TA 5AIAA 3VPDA 1FPQA 4GL2A 3WMRA 2E4XA 1NNEA 1VMKA 4ALNA 3M2PA 4LE0A 3AGPA 3HY6A 4Z49A 2RHHA 2OESA 2XDQA 1V11B 1JR3A 4R8SA 3VOBA 2C59A 5CGQB 4B32A 4Z2AA 4XQ9A 3G6KA 2G04A 3OURA 5FLEX 1U99A 4RK1A 2O14A 5AHOA 4ISCA 4B6PA 2QL9A 1PSDA 4M4SA 4AJ2A 5FBQB 2JD2A 4E5SA 4AIRA 2UDPA 2QGFA 4JHLA 3UKOA 5I8WA 5DNUA 2ZGVA 1A82A 1T24A 3DVLA 1QZ3A 4IDGA 2IY8A 2HA2A 1RXCA 1XTZA 2A7QA 2NV2B 2OLKA 3S99A 3QYAA 1E1DA 2H48A 4R1LA 1IXSB 2ZROA 2D6FA 4M9SA 3PGMA 1UBCA 1YKFA 1LSSA 5AOVA 1ZK4A 2QBYA 1AHIA 4JN6B 4PX3A 1SJ9A 1Q2UA 4NLLA 3NB0A 4Q3OA 4RD1A 1IJEA 5AVKA 4BFWA 2VOJA 1H2BA 3KPWA 4R16A 1PNQA 5E4YA 5CLLA 1Q7EA 2B1GA 1EE9A 3YASA 5C1OA 5BVHA 3IXQA 1A8SA 1TUIA 1S2GA 2O23A 1SBZA 4JBNA 1NVUQ 4WLFA 3ORSA 4ZQFA 1W0CA 4PG5A 2Z5VA 3I62A 4W7HA 4RGVA 3A6EA 4ZA2A 4DJTA 3L01A 4F2GA 1JRLA 4Q3KA 2OXCA 5SZHB 1VYVA 1VE1A 2Q6KA 2YZNA 2Z58A 3L04A 2F3SA 1OFHA 2HWWA 3WL6A 4LA4A 4O4JF 4G4JA 1DJQA 3I6ZA 3JZMA 4MQBA 4X7PA 2PQMA 2GB4A 2J0UB 3C7KA 3FVRA 1XRMA 3KIPA 4JWKA 4LDJA 4AMYA 2GZHA 4WUVA 4YJKA 3SYLA 1WZUA 4G1BA 4KVFA 4ZCRA 2O5EA 3G5TA 3K8YA 2BHSA 2WKSA 1J7JA 1LW6E 3R75A 3CC8A 1GQOA 5FD8A 2R7LA 3OZRA 3WYAA 2JGRA 1SC9A 4IXTA 3ZE2B 4JJEA 4FXOA 2XSZD 4OUDA 4JEUA 2K7FA 3PC6A 3W6UA 4FYHA 4DJEC 5EJMA 5EIFA 4A03A 2XUJA 4CETA 1QYWA 2CFTA 4I5IA 2HEIA 1I1HA 4AUKA 1KQFA 4BX8A 1FDVA 1SUCA 3KM0A 5A62A 4P34A 1EJ6A 1KA9H 4RKQA 1CP2A 1XKTA 2C20A 3NVKI 1YVRA 5D5HA 1YHYA 1HXHA 2A5JA 5G4LA 3H8JA 3S2ZA 2HMVA 1U0GA 3GUCA 1UANA 3OU7A 1N5DA 2Y2UA 3CF4G 4IKPA 3UPDA 4N48A 4FLMA 2OHOA 1JXOA 1AQYA 2KSQA 2XUGA 3ACCA 3EVBA 4OL0A 4FMCF 1VCNA 3MSXA 5C8YA 1ZWLA 4PCVA 1I14A 3D7LA 1KFCB 4RQBA 4UPEA 1JZSA 5C5DA 4P83A 4J9UE 4Q3EA 4XOUA 5AKXA 4K8RB 3SVTA 5JH7A 1KMCA 4RMHA 1GILA 1F4VA 1NBIA 4PPGA 5JG7A 1UBRS 3N2KB 5AI9A 1EE2A 2GAIA 3ESRA 1KO8A 1Y8AA 1JL3A 4ZIRA 1O4WA 2FLVA 3GRZA 4LJYA 3WBFA 2XV1A 4LDZA 5ALTA 2I54A 3PFKA 1U0SY 3GXOA 1AZWA 2F1KA 4LOHA 1NBMA 4EW2A 2JLVA 1UMBA 4Q00A 1Z15A 4ZK6A 1BEZA 2WU0A 3REFA 4RFSB 1SK8A 1V16A 1ADYA 2OHJA 5DIZA 3RODA 1EWQA 1XRRA 1X38A 1Z33A 4Y6GB 1E2LA 1OIXA 3ROTA 2R8BA 2VNKA 2AFHE 5AW5A 5F3RA 2WJGA 4YV7A 5KYWA 4DDHA 5JJBA 1A04A 1RHQA 1JAYA 1TYBE 2GSDA 4Y7DA 2YXBA 5EWLB 3NC1C 4FFVA 3LLVA 1XZBA 2V4UA 2C9YA 5E2BA 1H6AA 2XMBA 1L7EA 3M5DA 1E5TA 5MN6A 4LY9A 3DR5A 4JA0A 4L4ZA 3A1CA 2A94A 3TE7A 4RACA 1QFYA 4BB5A 3CV3A 2PFKA 2HF2A 1GPNA 3TUIC 4UEJA 4HVTA 1MJNA 5F2KA 5DHSA 4QXPA 4YCBA 3Q7PA 1WS6A 2WYWA 4Z4HA 5FUYA 1NVBA 2JFUA 5LC1A 1UXJA 1Z0DA 1I9GA 3L7DA 1SQ5A 4UVIA 2FYTA 4KX5A 1Q44A 3IS3A 1IPEA 1YRBA 2I6GA 1H85A 3G2JA 4G1UC 4WK6A 4ZRMA 3LVRE 2DUMA 3F47A 5ALFA 2BDTA 1PK8A 1GPDG 4NMHA 1NWCA 4Y2PA 1U5BB 4V1CB 1OWOA 5B37A 1W73A 2AR9A 2ST1A 5CIYA 2FE1A 1EFUA 4BMOB 1NQXA 4JP1A 1AKRA 4WKPA 3VSEA 5E8JA 3U7QA 3GLQA 1JNYA 1Z47A 4NHEA 1D2MA 1T25A 2G17A 4HQNA 5HNKA 4F12A 1A7UA 3FVTA 4ZHSA 3AHFA 3GYGA 3QMVA 3ZLTA 1MDFA 4BLSA 3TIIA 1YIDA 1UKCA 1JGTA 4NCBA 2BFDB 1EGHA 2HDOA 4IDDA 4UXIA 3H4IA 2JFXA 5LBTA 8ABPA 2AW5A 3EFOB 2J6HA 4JBLA 3UT5B 3A4MA 1KXZA 1NBWB 1YJAA 2JC3A 3HSSA 4V0OA 4HUTA 2YFQA 5BSFA 1TJYA 4ER5A 1P39A 3WGQA 3R3UA 1EJ2A 5EIOA 1T8PA 3ETEA 4JJ6A 4HMQA 1JFRA 3ZK7A 3GEMA 3PWSA 5HZHA 2MMGA 3GMTA 2FR0A 3SK0A 4FDAA 5DU2A 2D74A 2HK6A 4X60A 5JNSA 2NSLA 2DUWA 3AJAA 4PHCA 1SM4A 4DV1B 3PFHA 2I4TA 1GCIA 1GLNA 3AUKA 3ZJUA 4LRSB 1D2CA 1UOQA 2BR4A 3WTBA 4UDNA 1N75A 4KE6A 4JITA 4ALJA 1BMQA 4CEJA 3L7BA 1P8AA 2G06A 2CCGA 4DCMA 2DVMA 4PWZA 1QGUA 2JHFA 1RCFA 4QT0A 4CM8A 2WZCA 1VSUA 2ZRJA 1LFAA 2E5WA 4EHFA 1M1NB 2CLSA 3OQPA 3C8ZA 3QGMA 5T4FA 3U17A 2D1SA 3AY0A 1FPMA 2LDXA 3BMOA 3AT1A 2JA2A 1J33A 1D03A 3ZG6A 5ICEA 3AP1A 4NV1A 5AW2A 1L5ZA 5EZYB 3VSDA 5J4VA 2YUTA 2EFGA 1RKQA 2P9HA 4GE3A 4JGGA 4BMSA 1TVCA 4INAA 3KXLA 3MWYW 4NFLA 5L7YA 1K0FA 3G3EA 4YJHB 4G0XA 5G40A 3S3TA 4MW0A 5KYNA 4NONA 2YKGA 1N4DA 2HFJA 3MUEA 2VXBA 4QOFA 3ZDXB 4J0JA 3F67A 4G89A 4K6KA 1ZK1A 2V3VA 3FZGA 4NJMB 2NGRA 1LI4A 2PL1A 4Q12A 3V2HA 1NAIA 2NV0A 1FUEA 2QTLA 1K8XB 1BW9A 1LI7A 1CXZA 3OCUA 4RXTA 1E99A 3IUMA 4BNDA 1E1MA 1P72A 1QK4A 2CDRA 3D4NA 4AIIA 1EGAA 2ZB8A 4C30A 3IOCA 4JYMA 4AWBA 1FMJA 1X7WB 1RLTA 1V8OA 3FSRA 4EB8A 2PS0A 3CW8X 1KO4A 2KBEA 4I3FA 2V9ZA 4O4HF 2W2NA 1H0KA 3AQIA 2ZIXA 3GLUA 2M2IA 1US8B 1ESDA 2XXAB 1G64A 3FRIA 4B80A 1B41A 3A11A 1G60A 1QPBA 5F78A 3SS9X 5JV5A 4PN3A 5CH8A 4MRMA 3W6OA 1XEXA 4HDKA 5A3QA 1YJXA 2GBGA 2QWXA 5ECYA 4PYLA 3UMFA 1LPPA 4BKRA 2I67A 2GZMA 1HG1A 1WCXA 3GOHA 3KKNA 3O8OA 4URUR 4IWNA 3MHTA 5IF9A 3GUZA 1CNEA 5LKRA 2NQ8A 1C41A 3CLTD 1Q1NA 4G5QA 2CNNA 4JB8A 2QNRA 2H7VA 1BDJA 3WOHA 2GM5A 2PV7A 1ES9A 3L41A 3AZOA 2O3TA 1A4UA 4MULA 5CM8B 3NYRA 3GA7A 1Q0ZA 1SXHA 1EM8A 3CBQA 5ITZB 1PEDA 4KPYA 5I7OA 5KDOA 4ZAZA 4EI2A 1ONOA 4DB2A 4RK0A 1R6BX 1SHZA 3KYCA 3V33A 4BZWA 2YOFA 3ZWOA 2CC2A 2QMYA 3U2QA 3CCCA 3L6RA 5E1MA 4ENSA 2WSYB 3P9RA 3T7TA 4M87A 4UDOA 2ZIWB 2RGGA 3WGNA 1PWXA 2Q0HA 3PQ8A 3FTNA 4HXFB 3BK2A 1ZY2A 3U48A 4UUPA 5AW8A 2C99A 2YN2A 1FYEA 1F4PA 3UUGA 4EI7A 1AUOA 3A1WA 4I2NA 3NRJA 1NZFA 3NYWA 3NP9A 1HDGO 3WYDA 1C1DB 4JMPA 1H2EA 4XUGB 4J4BA 1G0OA 5B2FA 1L8QA 5GONA 2A5DA 4L22A 5BR1A 2GJ4A 2P69A 2ID8A 5EESA 5P21A 5IXJA 1DAMA 2F90A 1GPH1 2YZ7A 4LSZA 4FVTA 1HTBA 2C5AA 3O31A 3AIOA 3F6PA 4RV9A 3I5UA 4BHTA 1KBZA 5LMNB 3DKRA 3ANNA 4DBVO 1IPFA 3EIXA 3UT0A 5LQAA 3BOSA 3IUYA 3K1JA 4PIVA 3HP1A 3X1KA 3D3EA 3E3AA 4Z8YA 3J7AC 3O3MB 1HDZA 3IJ5A 3IP6A 2QJTA 5AM0A 4OTZA 4EPWA 3TK1A 1M72A 3OQJA 1RWWA 5T41A 3GT7A 4S0XA 4QGFA 4LOLA 4YO7A 4H77A 3UMCA 4ZCSA 4EFLA 3AEKB 2JIZD 2QRHA 1ZLXA 2HF9A 3A26A 4IG4A 2PH5A 4JODA 2G76A 4NI5A 4QSMA 4RPGA 3SJAA 3THXA 1PR2A 3L5KA 1M1XB 2VWQA 4P7BA 4MI6A 5KWJA 4TQAA 1Q74A 1GYQA 3K72B 3AF4A 4DEVA 4V0ME 5SYMA 1L1QA 1FFEA 1XXHE 3W8EA 3ERCA 2B82A 5DB4A 4P86A 1UPTA 3RYHB 4ZRNA 4PHGA 1MVOA 1KQPA 1SZPA 2UZ0A 3D5QA 3H04A 3PHBE 1E5XA 4HB2A 4PXSA 4WE3A 5C4GB 3VNBA 4DV4B 1L7DA 4AECA 3E18A 3KCNA 1MJGA 4DIEA 1EXVA 3E53A 2R8YA 3VHQA 1L0BA 4CN8A 5JXWA 1I1OA 1L8OA 2PPLA 1OTYA 3BWXA 4F3NA 3OLYA 1V43A 3FUUA 4C7OA 5EKDA 2HX1A 2ZRDA 1E3WA 3KQPA 4C01A 4UOEA 3TF5A 2EHDA 3SQNA 4LYDA 3W04A 4RJTA 4TKUB 4BLRA 3OFNA 4ER7A 4DCCA 3CSSA 3T3OA 1ISFA 1N8NA 3EC7A 3GJ5A 3S2UA 2RHLA 2IOFA 3KKQA 4G1CA 1CJMA 2ZYTX 3V4RA 3C4JA 1HY3A 4QGHA 4OH7A 2ZPUA 4Q15A 2IPMA 3L0IB 3QM1A 4OVKA 3ABZA 4ZT5A 5LKAA 2QG4A 5K3BA 2JVKA 4HQLA 1X2BA 4DDTA 3KPVA 1ESNA 1EWVA 1ULBA 4OUKX 4U9IS 1ETUA 1P1CA 1MIHA 1IY2A 2WDPA 3AKEA 1Z26A 3IBFA 3VR4D 3DEHA 3OTQA 1GYRA 1TQDA 2C9CA 3F5DA 4K9DA 5F5NA 5KAPA 1YCFA 3CEHA 1CHDA 4JOCA 3HL0A 4DZRA 621PA 5LBUA 3FOWA 1CRZA 1FFDA 1X86B 4RHXA 3KLPX 4R1TA 2R6AA 1CJVC 1F48A 2DT8A 4N18A 3HJCA 3HYTA 4A0SA 4C6RA 4OLHA 3VVBA 1FVXA 1QPGA 2X6TA 2HIAA 1M34B 2J3MA 1FNNA 1UAAA 2WD8A 1VYHA 3I53A 1EUCB 1GPAA 3I9LA 4QOHA 4Z1OA 5JECA 1G16A 3MRXA 2N3ZA 1OLUB 1TU0A 1T5HX 1SPBS 2G6BA 1LPMA 1P17A 3F2VA 4MQEA 2MOKA 3FROA 5CM9C 1D6NA 4Q4JA 5LJIA 2BEKA 4TTVA 1JHRA 1RI5A 3V5NA 4D9BA 2LIPA 4CF7A 4E31A 3WYEA 5E4JA 1ZNXA 2PH3A 1UKAA 2QRZA 5AICA 2PUBA 5CB0A 1PZNA 2GPSA 3DZJA 1OXMA 4X3PA 3TBFA 1U7HA 4KWEA 3CZ4A 4O2LA 4UUMA 1Q1ZA 4RZ2A 3QMWA 3SJ7A 3WGGA 4BNIA 3C3CA 4GX2A 5BN4B 4OHBA 5BT9A 5KNLA 3PPYA 2F64A 4P22A 3WDMA 1PT6A 4FTWA 4B7UA 4RKFA 1B8UA 1KDYA 5AHWA 2I8LA 5J23A 2AFHA 3CRZA 4BVLA 3ILYA 2DHRA 3SN6A 4F9EA 2A9RA 1K6MA 4QEKA 4RM2A 4Z54A 4ZHQF 5B36A 1EWTA 3L18A 4F96A 2F4NA 1H3FA 2ATEA 4TLAA 3ZGOA 2OBFA 4PTYA 1EVLA 1XJ0A 4R1NA 2GNOA 5CA1B 4URFA 3AG6A 4L8YA 3GY0A 2CZGA 1HKHA 1Z2EA 4KIWA 3RM3A 3RVNA 1PZHA 1OWPA 2YHUA 3WGTA 1J0AA 4DM4A 5K5EA 3ND5A 4EYKA 1J6UA 3AY6A 3FSEA 5M04A 2UZIR 3MIIA 5LP6F 5JASA 1QH1B 3FRJA 4NNOA 2BFAA 3JQFA 4B71A 1LNZA 4CLOB 2HJ9A 1V8FA 2O3RA 1H6BA 1PGJA 4O4IA 4AF6A 4CKEA 5BW5A 1BVUA 2BAGA 2OZLA 3JZDA 4B34A 4HQ0A 1CFZA 2QM3A 4MB0A 3UXHA 3VHXB 1B16A 3RUAA 5EJ9A 2X0DA 4V39A 2I2XB 1KJ9A 4QRHA 4ZDKA 1U81A 5TB5A 1NW4A 4CNBA 4AKGA 2HGSA 2XUFA 1R6DA 2R5FA 2WSIA 3FZEA 2VSFA 3H2IA 3M7IA 4KN9S 1O58A 2GYUA 3QJGA 4MJXA 1QV7A 2J9FA 4KRXA 3LJKA 1NUTA 3MTAA 3SHTA 3OCVA 2OP1A 3EQ2A 4GQBA 4L73A 1M2OA 4CDGA 1NDHA 4YJ3F 3JZFA 3QWBA 5JEEA 3UYLA 2NYVA 2ET6A 1AKVA 2BN4A 2PMFA 3EDMA 2GM3A 3G1TA 2IBMA 5FJIA 4EEXA 4EI8A 4LF5B 1TX4B 1FMFA 1Z0UA 3BL6A 4BNNA 3EVGA 1KF0A 3UZUA 5AM4A 4NOKA 3SXUA 5CG2A 2H2WA 1B2RA 2QUJA 5DIFA 2VQEB 3HCPA 2ZRLA 4M7WA 4MS1B 3RSHA 5KJ1A 2B36A 2LZ0A 4I9FA 5GVRA 3ZTWA 3PWTA 2F67A 4LWQA 1P60A 3IXMA 5LXTF 3TIVA 4I14A 1IRXA 3GMSA 5G0TA 2XUDA 3VNQA 3G7SA 4YV2A 1S2NA 3FDZB 3K05A 1GRNA 1SBYA 3QIAA 4RELA 3NBAA 1CUFA 4U8HA 3F4BA 2IUTA 4KQ9A 4L3OA 5I47A 2X58A 1KNXA 3BBPA 4X84A 1WOYA 3OLCX 4PAGA 1XZFA 4PLCA 5C7LO 4ARVA 3R3YA 1G21E 4IYRA 2A57A 4W5HA 5CAEB 4DJDC 5JCZA 5AFSA 3ZLVA 1WXWA 3LWBA 1RDFA 2G7MC 1XROA 1NMSA 3OQHA 4OB6A 1L7PA 2I2WA 3FDIA 4X61A 1RADA 4ZOAA 5AVUA 4WBNA 4PV7A 2NTYC 2QAGC 2ZSFA 4QFDA 4YJGB 2QPOA 3F8WA 1QQTA 1RQGA 1Q50A 4ZV9A 1TCBA 3TTUA 1ZVMA 1HE4A 1XD2A 1WY7A 3AEQB 3RUPA 1G5FA 3SHVA 2FSUA 2NAFA 3DOJA 2ZSDA 5KQPA 5LZ4A 3D2BA 4KDEA 1S8NA 1BD4A 4KEAA 1H65A 1LXCA 1R5JA 3RJTA 2AZTA 4EUFA 1CWUA 1NJGA 3C43A 1K27A 3LT5A 3W34A 5CB4F 2C5FA 2WHPB 1EK5A 4HAOA 2CWWA 4D96A 3S28A 2JARA 3GJRA 1ZGZA 1DO2A 3CZMA 2HO4A 4J0EA 3V8EA 3KAJA 1JHXA 4NU6A 1MH9A 2ZWVA 4ZWNA 4CL8A 3R9WA 3FYDA 1JR2A 5AVOA 2FMIA 4KXNA 3PRKE 2P3SA 1MV5A 1YSCA 2F00A 3WLQA 1F8UA 3TOVA 1QVZA 2MSKA 1CQXA 1KU6A 4LV5B 3EXHC 4XGKA 3SXJA 2B7BA 3FDFA 5ALRA 1AA6A 4LFBB 4XWTA 4BYGA 2OFWA 1IWOA 3KKZA 1EFVB 1LBIA 3H4VA 1N9KA 2ZJFA 3O0TA 3E9RA 3H0CA 4A0RA 3QEJA 5DHTA 1LPSA 1POXA 2B2NA 2EFCB 3EWIA 3EBLA 5KYKA 1EBFA 2O06A 3GPDG 4BTVA 2VXOA 3OQ1A 1BJTA 4Y2XA 4D4KA 4XYMA 3MMXA 1ZIYA 4PYOA 4WXEA 4MUXA 2VNAA 4Z9AA 1U28C 1XLVA 3CJQA 3MZ0A 5ILOA 1KGSA 3GDGA 2G40A 3B60A 3IGFA 2MINB 1R5BA 5H1YA 2GJSA 2J0VA 5H59A 4DLRA 5A5DA 1ZL0A 1S0UA 5HZKA 2VZEA 5IPFA 1FTNA 4LDNA 4G4SP 4CU5A 4JGIA 3WKAA 1PL0A 5C52B 1GQFA 3CWZA 3I3OA 4EUHA 2XTJA 1RWKA 3AL0C 3HXMA 4OGWA 3S44A 5SZKB 1A9ZA 4QKQA 2HMYB 5FUMA 2BMFA 3JYLA 2C7BA 4MUFA 3MAJA 1KP2A 2REBA 3BD6A 3HLYA 1G8PA 2D2IA 1HETA 5T6BA 1MZPA 5ARCA 5SY4A 4M0FA 5DTMA 3A6FA 3COVA 1FXWA 1IG0A 2BFEA 2ZB7A 3W2TA 1IUOA 2PFGA 3IUJA 4BGVA 3OJWA 2CYBA 2FEAA 2QVBA 2IHUA 4Z0HO 5JOQA 3IP1A 1B14A 2NUBA 3T1OA 1NNUA 3FPAA 1ULSA 2J08A 1J24A 3IEMA 2YC2C 5KNBH 4QUBA 3W7AA 3SFVA 4H3SA 2X1HA 3WB1A 4OQPA 2FKAA 4QPCA 3RYCB 2W4IA 2WVGA 4Q37A 3GLIB 3GGJA 3RG2A 4EB0A 5LNK1 3OZUA 2V55B 5JXJA 1P5RA 3BA1A 1YF3A 3A8TA 2VT6A 4RV5A 3EEBA 1PAUA 1OAOA 4N5NA 2P1ZA 4IEEA 4JXKA 1Z38A 3PKIA 2JLAA 3NEJA 2I7XA 1K8QA 1WW2A 3AZPA 4O02B 2BONA 4W7IA 3W5BA 1ZR2A 1R4ZA 1TC1A 3ZHSA 4O08A 5IYZF 3BVPA 3AW9A 2C2ZA 1NVDA 1IIBA 2G3YA 4B4VA 1PU2A 2O57A 3FDXA 4ZDJA 1ZD1A 3BEDA 2QLMA 1GSAA 1KDTA 3I1FA 4P84A 3WV5A 2WOJA 1BA3A 3BERA 4FS3A 1NLUA 1HO3A 1T3SA 4G86A 1VZ2A 4L4YA 1DDIA 4XGIA 1YCGA 5BW6B 3QLVC 1MHPA 2ZR9A 1UP7A 2Y1WA 3S1AA 1GV1A 2RHRA 3T7JA 3WJAA 4V0MA 5LMCA 1RABA 1SHLA 1XXHA 2ZATA 3G59A 3N86A 4JQSA 1SOAA 1DEAA 2XYVA 4R81A 1K8YB 5CXQA 5JWRA 1HF3A 1B73A 1XALA 5TQ0A 1J9ZA 4YV0A 1D8TA 1GA6A 2PZFA 1E1QD 2BV3A 4YMTA 3A3OA 3BXZA 5I7HA 2VZ8A 3GN1A 2D0DA 1IBCA 3I2GA 3EY4A 1VHDA 2R25B 3OPYI 3RIXA 4FQ8A 3ANSA 4UC0A 6YASA 4RTNA 1HNNA 1B7GO 3GG9A 3OLZA 3SLGA 4UTPA 3ENQA 4JJ8A 3FYUA 1CUEA 1VECA 3HCRA 2AF3C 3GPBA 4GI3A 3ZV7A 1RC8A 2ON6A 1U4NA 1VL5A 1JPVA 4HDSB 1KSFX 2AI2A 3ILXA 4J0IA 4FUTA 4DLZA 2OA0A 2H4XA 5C53B 4IGKA 4RH1A 4Q7KA 2HCJB 1NNI1 2G07A 2JJ2D 2RGCA 5AJXA 2FSVA 5AXDA 4D45A 4Z7JA 2ZE6A 2EKDA 2PANA 3L8GA 3IR5A 4WY8A 3ZH9B 2F8LA 3E1SA 5FPKA 1TZBA 2R1ZA 3AF2A 5EWMB 1AGYA 4KGZA 5J2TF 2H59A 4JOBA 1D4OA 1RWXA 3DVAB 4PHFA 3MB5A 1ILEA 1XWWA 3GCWA 4LK3A 4PINA 5B7QA 3DZIA 3HA7A 3RRXA 4NYJR 2ERYA 1WAMA 4HG2A 3LP6A 1XZQA 3SYRA 2IP4A 3SOPA