3X1XA

Ras-related protein rap1b with gppnhp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
166
Chain Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1b
publication title The structure and conformational switching of Rap1B
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 59
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x1xA00
2JJ1D 3AKEA 4BLRA 4KBFA 2OEPA 2HT6A 4XSGA 3C8UA 4NZYA 2QT1A 4KI0A 1RRPA 4XJXA 5LB4A 1TQ4A 4TLCA 3TUJC 3X1DA 1GKUB 4PC3A 3GFOA 5FPKA 5BXQC 1PLKA 4EFMA 2OAQ1 2D2FA 4M0LA 3AGQA 1EG7A 1F3OA 3ICEA 4KFRA 4XD7D 1LS1A 1P60A 1NN5A 4M8NE 4CF7A 1KYIA 1OXXK 1WP9A 1NMXA 5F2EA 2X8AA 5JWOA 3K0AB 5KDDA 5JSZB 2FZLA 3MFYA 4BRWA 2QU8A 3C5CA 2VIIA 4TMZA 4JS0A 2NMVA 1CJTC 1U98A 3C14C 4NDZA 1G9XA 1VIYA 2GA8A 2RGNA 3RS3A 3SE0A 3SNHA 2UZIR 1MO6A 1YZLA 2OBLA 2VHQA 2QMUA 1S8FA 2AFHE 2RB4A 1EX6A 1Z63A 1S96A 2R44A 1NLYA 2W6ID 3A37A 2QNRA 3UWKA 5C4GB 4EIWA 2W58A 1ZNZA 2BKUA 3B1VA 5EXXA 1GG2A 4IOKA 4DEXA 1M7HA 5J47A 1AGRA 2B6HA 4NBSA 1EGAA 3GFPA 1ZC3A 3NBYC 4JKYA 4D82A 1US8A 3EG5A 1ZM9A 1II0A 3CX7A 4Q9LA 4ZCLA 1KJWA 4DSOA 2ZE7A 4DSNA 2PX0A 1RFLA 1ZBDA 2IUUA 5CITA 2QQ0A 5CM8B 3T1TA 4JJZA 1GDDA 1EFCA 3FMFA 1W4CA 1Z06A 2ANCA 4M9QA 3WYAA 2I4IA 4QM6A 5L3VA 1YHNA 1JXOA 2BOVA 1UEIA 1XDBA 1G3UA 2F1HA 1XJ0A 4ZCMA 4C0SA 1CTQA 3SR0A 2IYYA 2PL3A 3TNFA 4F92B 4X8LA 2KWIA 5IK2D 4QNMA 1XEXB 4AG5A 1XTIA 3VX4A 1GRQA 1G5PA 4V0KA 2C98A 1G4AE 2A30A 3T35A 2ZJ8A 3MSXA 5SZKB 4UXHA 3NBFA 2FPKA 2P5TB 3PITA 2BCGY 3IEVA 2V4ZA 1JECA 5KOYA 4JLDA 5B2ZA 4OI0A 4K46A 1CLUA 3PJRA 2XNSA 2IT1A 5FTLA 3T12A 3OEED 3TAHA 3GJ3A 3VTKA 2OCYC 5JWRA 821PA 3SZRA 5KNCA 1KI6A 2YC4C 3AKCA 2J0UA 1QHSA 1G7CA 1CR2A 2GJ9A 3IPYA 4LK2A 1E9RA 1G41A 4B73A 3G0HA 3DPUA 5TVKA 1PLJA 1QHHA 4PHGA 4KU4A 3ZYCA 1JB1A 3LFUA 5FL3A 5JBQA 1G291 3TR5A 2QY9A 1DADA 1I4DD 3X2SA 2VL7A 2XSZA 1U8AA 4P31A 1COWD 1DPFA 1ZM2A 4RCYA 2WSMA 1YE8A 4Q4HA 5EUMA 3CF2A 2C8VA 1BO6A 2WAYA 2G77B 2DFKB 3TIFA 4BEJA 3LNCA 5DI9A 2QTHA 2GILA 2D06A 2ZRGA 1P4SA 1CXZA 2FX3A 4R98A 1C4OA 3KL4A 2CL7X 4RZXA 4IVPA 3U4QB 3CW2A 2EFCB 3RRNA 4FN5A 3D8BA 3NG1A 3R7WB 1OIXA 3VU9A 1E9FA 1CBUA 2GAAA 3ZVMA 4IJMA 2VF7A 4DCVA 4C0AC 5DLQC 5B57C 5CK4A 4HLCA 4O0MA 3U6BA 4PPNA 4PO1A 2WSSA 1T5LA 2OBMA 2F3TA 2NTYC 4WVFA 3HYRA 1H8HD 1F2TA 1VHTA 2O0JA 4G5GA 4F91B 4XWOA 4QGFA 2E87A 4M53A 3AVXA 2WPDD 3MG9A 1ZU5A 2F1RA 2N42A 2QE7D 2RGCA 2E9SA 1PV4A 1GRRA 2CHVA 2FFBA 3B6EA 3CNOA 4MYHA 4Q4LA 5TB5A 2OILA 4PPGA 1NVWQ 1MKYA 3K0SA 2GESA 3A8TA 3HPQA 3LY5A 4LJYA 2FEOA 1PVOA 4JL8A 4B3DA 2OHFA 1OB5A 4ACAA 2WKPA 3ZD7A 2XZOA 2FJUA 4RFVA 2DFNA 2AK3A 4TYWA 4Q1FA 3LBIA 3U3RA 4RKEA 3K9HA 3LBHA 5DGXA 1W2GA 3VKWA 5IHPA 1E9EA 3RWMB 5LBIA 3IBGA 1R8QA 3NVAA 2Q9AA 2WV9A 4I1SA 3Q9LA 3CZPA 5JS7A 4QHSA 2VYFA 2WICA 1P2UA 4MA4A 1S4QA 3CPEA 4LC0A 5DSZA 1R0WA 1LV7A 3BB1A 4PSKA 1E94E 2ZI9A 4DDTA 3A4MA 4PO9A 2IL1A 4KAXA 2X19A 4PAQA 4ZDKA 2IYTA 2ZAOA 3D6TB 3ZS8A 2Z6VA 2WWGA 2OFXA 1X8JA 4FCWA 3GMTA 4CIDA 3FB4A 2CCJA 5K8IA 4HLUC 5BYJA 5CM9C 2OE2A 1V43A 4RY2A 3AM1A 1ESMA 4WZBE 2V9PA 5FPSA 1JR6A 3BOSA 1XCMA 1LY1A 3T15A 1N5IA 1N6LA 2ZJYA 3QF4A 1N3BA 3H1TA 1VTKA 3RC8A 1G17A 4MKIA 1T5IA 2BJWA 5IF9A 4IFEA 4D81A 3L0PA 3AKYA 2O8BA 3BAFA 3QVUA 4Y0VA 3VFDA 1FX0A 221PA 4C2UA 1CEEA 4QBFA 1XEWX 1YU9A 3E1SA 4OQFA 5GJCA 1XD2A 4YMTA 4CEHA 2BMFA 1JPJA 1ZRHA 3LV8A 3SBEA 3CH5A 2JLWA 1VG0B 2Q3FA 3LWNA 2OT3B 4K8OA 4DDUA 1TMKA 4OHVA 3P4YA 5GJVC 4R9UC 1O87A 4Q1CA 2IC5A 3I72A 3K0FB 4EPTA 3TVDA 3EWSA 3MWLA 2BCJQ 5H1YA 4G3XA 5KUTA 2J7PA 3Q85A 1QVAA 5BWMA 1W0KD 2TMKA 2W6JA 4RD6A 2BEKA 3WNBA 1W4RA 4ERNA 5TXGA 1D9XA 1BKDR 4TMTA 5GVRA 5TDHA 5F9HA 5HCNA 4AG6A 1PUIA 1W2HA 2PJZA 1W36B 2QG6A 3THYA 4QC2A 1DG3A 1IN6A 2F1IA 2J0SA 5FTJA 4C7OA 4DB4A 4GP7A 3W34A 2WJIA 3NBZC 5AJZA 3QKSB 1S3GA 2W2XA 4MUAA 4CW7A 4PTLA 1M2OB 4DIDA 1KZGB 2IYUA 3VNUA 2FWRA 1N6IA 1II8B 1OIWA 1D6JA 2WJHA 3T34A 1KHTA 3QPVA 4BFTA 2CE2X 3JVUA 3N5CA 2QUZA 2IYRA 4IKEA 2HT1A 2VP9A 3EIHA 2WWYA 4ESHA 2IK8A 2N46A 5JLJA 5C18A 1ODFA 2VQSA 1O3YA 2WTUA 2BBOA 5P21A 4LYHA 2CCKA 1RC8A 4HAXA 2FA9A 1VECA 1NL3A 1GM5A 5FOWA 1XCPA 1MABA 5KPJA 1W5SA 3B9QA 3SHFA 4IEIA 1K5DA 2RCNA 5EQTA 1SQ5A 3LO5A 3CH4B 3FMPB 4DDVA 1RRFA 1MH1A 2C99A 4DZZA 2P0EA 3GJ8A 1ZM7A 4ZI2A 2RGXA 4MDFA 4B2PA 4BZPA 3OFNA 2HXYA 4GZMA 5GJBA 1K8RA 5D3QA 3AVPA 2WSSD 1TUIA 4LOAA 2JAQA 2VHJA 1ZNYA 3AP2A 2CL0X 4LSGA 3VMFA 4LPSA 1TEVA 2CVHA 1X8LA 3K0CC 2BC9A 4B35A 3T06B 2XX3A 4IHQA 3GLHB 4Q4JB 2AFIE 4XIGS 3FKSD 2J1LA 4DLTA 1I2DA 1QHXA 2VP0A 4F4CA 4MKFA 1I2MA 2DB3A 1N25A 1JQJC 3KUCA 4HI0E 4NCJA 3T1QA 1LS6A 3W6OA 2QM7A 4IXNA 3SYKA 1JR3D 3TGPA 4NPHA 1K5GA 4WXRA 1ZU4A 3ZIAA 5H70A 1XTRA 4GPTA 4MQBA 3FMOB 4EQ6A 4DCSA 1PJRA 2ZRDA 4HSEA 3KQUA 1E1QA 4NCKA 1TQ6A 1AS3A 3I61A 4JIMA 4A15A 4GFDA 3RABA 4IW3B 1R4AA 3OEHA 3CF0A 4NU0A 3LLMA 2VH5R 2KSQA 2JLVA 1XTSA 5DHAA 1OXVA 4Z1MA 1P62B 1E2MA 1SXJC 2B8TA 2P2LA 2BM0A 2QENA 4YMSA 2IXFA 1A82A 1Z2CA 1OH8A 1ZAKA 3W6PA 1XZPA 3FWYA 4Q9JA 2RGGA 1E9DA 1NN1A 1XMSA 2XZLA 1F2UA 2Z0MA 5J4YA 4PQRA 4PSAA 1ZM4A 2IYSA 1KTVA 3OAAD 4M1MA 4BGDA 1M6NA 3CNLA 1DAFA 4DLSA 1KI3A 1XXHB 4L15A 3BRWD 5E3HA 4UXJA 2YOFA 4A4DA 2GJSA 5SZHB 4JZKA 1GKIA 5HCIA 3NC1C 1NI3A 1WDTA 3AVOA 1TNDA 4C9BA 2R6DA 4TYNA 5DN6D 3RSOA 4DEYA 4RKFA 4U7DA 4YXWA 3MMPA 3QXJA 4DSUA 2GEDA 3ZGXA 1XU4A 4TQAA 2QQEA 4A8JA 5HE9A 1NIPA 3B8HA 2C78A 2IXGA 2D62A 3L0SA 2NO7A 2EFDB 2VA8A 3I5YA 1TL7C 2X77A 1IN4A 5C4MA 4HAZA 4JLBA 4CEJB 2W00A 2O0KA 4DUGD 3M1IA 4KV9A 1JEEA 4KFUA 4W7SA 4GBMA 1G8FA 1KO1A 5FBLB 1CIPA 4URUR 4Q1EA 3WHKA 4V0MA 3QENA 3ONWA 1KZ7B 4AKIA 3D7MA 2P67A 3RNLA 5J4KA 4AC9A 2ZVPX 2QGZA 1ZIOA 2R8RA 4RD4A 1E4VA 3ZS9A 1AKEA 2WOJA 3W3AA 4HDCA 1XZQA 1KKLA 2CLSA 3BFVA 4C30A 1G3QA 2OV2A 3C41J 4MRRA 2J7PD 3MGCA 2ONJA 1GL6A 1MT0A 4EJSC 3TE6A 5AJWA 1T0HB 3WP1B 1M34E 3LVQE 4M1TA 1AN0A 3KKQA 1KI1A 3IDQA 1VG9B 2H92A 1R10A 4G5QA 4DB2A 4D25A 3O8RA 2WVJA 1MABB 5G3YA 1FQKA 3EZ9A 4V02A 1HTWA 2JIZD 3K09A 3HJNA 3EW9A 2IA5A 2WWIA 1KDRA 3A1TA 1EFRA 2IXEA 4ASUD 2YKGA 3K0AA 4OK6A 1WA5A 4MYUA 5JSZA 1DAMA 1KI9A 1IBRA 4QM7A 4B76A 4D6PA 4WXPA 2V1XA 1T0JB 2REBA 2RH5A 2W83A 5HZKA 2V3CC 3EZ6A 4IRUB 2QBYB 4TZ0A 3QJYA 4PAMA 1YRAA 2C9CA 4LV8B 5KSOA 1XEWY 2R6GA 2G88A 2AK2A 4Q00A 4YQFA 2QMEA 3I73A 3MJHA 3RS5A 3U2QA 2HJGA 1XPUA 1E79D 4N3NA 2XAUA 1J90A 2H18A 5AR1A 2QTFA 4TSFA 5EP1A 3QI2A 3L82B 3Q7QA 4OYHA 4LCBA 6Q21A 1OLOA 5E95A 2GBLA 1M7BA 4YDHB 3OHMA 4M1WA 2W0SA 4OI4A 1Q44A 4LJ5A 1XTJA 3FVQA 5BN4A 4LHVA 121PA 3LLUA 4US2R 3KXIA 3N2IA 4LY6A 4YMUA 1VYTA 2ZREA 3OZXA 2GJKA 2ZVQX 2NO1A 2BVNA 1V5WA 4ON9A 1NKTA 3SDZA 4W5JA 1Z08A 4NKRA 5EXTA 1HH4A 5JRJA 4NP6A 4BLSA 3KB1A 4LJ8A 2JJ2D 2VLIA 2B92A 3M4YA 4MGKR 3W5IA 5JCZA 1QG4A 2OBNA 3GJ6A 5JI3E 1XEXA 4NL4H 4TLAA 4AYTA 3QBVA 1R0YA 4TMWA 5CJPA 2GXUA 3WMGA 1RYHA 3QKRB 3QNUA 3FOZA 1C1YA 3FHCB 2ZJOA 2RMKA 2GJ8A 3BJIC 3SS8A 2GEUA 1MRSA 3PQCA 1GL9B 1G8YA 1NY5A 1Z8FA 4CGZA 2XEXA 4GP6A 1NBME 1D8TA 3QXCA 1ZC4A 1S2MA 4FCVA 1SKYB 4LJ4A 1OHHD 1TPZA 3L0IB 1ONBA 3RSLA 1E1QD 5K8TA 1OFHA 1M74A 3FKQA 2WAXA 2HF9A 3MUFA 5C46F 4RD1A 1XPRA 2ODWA 1N5LA 4Q03A 4RCZA 5L3SB 3GJXC 2PX3A 1T91A 1WMSA 1GKYA 4NYMQ 1G5TA 5AUPB 1DBSA 4HZUB 2WM9B 5DI3B 2XNDA 3PV0A 1XJCA 1QHGA 4KSCA 4P0TA 5FL7A 3WY9A 4L4UA 2B8WA 4B3FX 3B9PA 4AWXA 3V4RA 3H84A 1HQYE 3KZ1E 1JAIA 5J40A 3WRYC 4BZQA 4PFSA 1QG2A 2ZJZA 3OE7D 4LWZA 1NJFA 3QKUA 4C0LA 2JLRA 3U4QA 2P6RA 1RJ9B 3KJGA 3R7WA 2D2EA 3MWYW 4URVR 4Z8XA 2QGNA 3WNCA 1OXSC 2VHCA 1HYQA 4OI2A 2AXNA 5C2JB 1QDEA 2ZETA 3U7FB 1E98A 3IBYA 4CT5A 2FU5C 4B71A 2ZM5A 1FZQA 4L9WA 2FSHA 1ETUA 2H8KA 4V0LA 1E1RD 1KK2A 4HB0A 2A9KA 4MDEA 4NE2A 4GT1A 4XWAA 2VHTA 2GVDC 1R7RA 3QVVA 4PQFA 4C0QC 1R6BX 2ZSBA 3GEIA 4RD0A 3E70C 1P73A 2VEDA 5TV2A 2BMDA 3UG7A 1Q1BA 1TQ2A 2NPIA 4BFWA 4E22A 3TVTA 1AIPA 3VR3A 2UVQA 3LRPA 2HLDD 2WOOA 2ZRBA 1P6XA 4GZLA 3IHWA 3EPHA 2XB4A 4PXAA 1XMIA 2V7QA 5JEEA 5JEDA 4QOSA 3U3JA 3TRFA 4KVAA 2NIPA 3CNNA 4B74A 1IY1A 3PUZA 1VCMA 3HR7A 2VP4A 1OKKA 1A1VA 3B1XA 1RYFA 3BBPA 1GTVA 1E9AA 4LUCA 5EE1A 3B5JA 3IILA 2G6BA 3G5UA 4UNQA 5FI1B 1BIFA 2CK3A 3DOFA 1TU4A 3SEAA 4FMCF 5F9FA 3LXRA 1Z0KA 1CR4A 3SOPA 2QAGB 4Q02A 4R7ZA 2REOA 1W0JA 3WYGA 4EKDA 4A6XA 3BH6A 1DAGA 2OSBA 2YWEA 3ZQJA 2IS4A 2WMOB 1Z28A 4CEIB 1W4BA 1QRAA 3CO5A 1IM2A 1LF5A 1CRQA 4TMXA 1GITA 2IW3A 1DVRA 5FPYA 2E1RA 4F4JA 4Q9HA 1VCOA 3RRZA 4Z51A 2GWHA 3KKNA 3RHFA 4UKDA 1BYUA 3DZ8A 1KSJA 5DE3A 1UBEA 1SZPA 4WZAE 4DLYA 3UMSA 2F6RA 2VPPA 1FP6A 4FIDA 4Q47A 4B3CA 2YVUA 2VP6A 2ZYTX 4GMXA 4HATA 3GLGE 4N1AA 2LKCA 3B1ZA 2ZSFA 2MSEB 3A4LA 521PA 2OLKA 2MSDB 4QHYA 4JLAA 3LQQA 3WMEA 2YV5A 1P5ZB 2PCJA 3FE2A 1E2GA 3HP1A 2ORIA 4LX0A 1FTNA 2B7BA 4Q9IA 1LNZA 1M1YE 1Q57A 4QGGA 3VKHA 5EE9A 3THXB 4RD3A 4Q7MB 1XF9A 5JJLA 1D5CA 4A2WA 2EWWA 2PZFA 4FMCB 1ZW6A 1NF3A 1R5OA 1OJLA 2V54A 3N70A 4GNKA 3U3OA 5HTKA 3EC1A 5A0FA 1AQYA 1XRJA 2P6NA 5E4FA 4URZR 1L7VC 4A1FA 3QEOA 3K0FA 4HAYA 4Q4AB 3IIJA 1VDZA 5FOUA 3KKPA 4IEEA 1MO4A 4OQNA 4UNPA 2FDCA 3ICQB 3F8TA 3TQCA 3A1VA 3T5DA 2FNAA 1GWNA 2HDNB 3A58B 3FDIA 2ZU6A 5SZIA 3UANA 1UM8A 2PZGA 3GLFB 5HPYB 3GJ7A 3AQ4A 4I99A 2J0VA 4GSYA 3SI7A 3VHLB 2A5GA 1E32A 1TADA 5CDFE 4JVLA 2JASA 4ESVA 3L2OB 4PR0A 4TL8A 1GVNB 1UKVY 2O8CB 4NCNA 1P2VA 4ACBA 2QAGC 2YWHA 2Y8EA 5LDDC 1X1RA 3BFKA 2XTMA 5KSYA 3O47A 1WF3A 3I32A 1NJGA 1XD8A 3QKSA 1W44A 3SN6A 4OL0A 4AK9A 5LD2C 4Q21A 5IRCD 4QBGB 3A36A 1Z0JA 5FTKA 4LI0A 4HB4A 1II8A 3B82A 3TKLA 3DMDA 4ZO4A 3EZFA 4I1OA 1SXJE 3VAAA 3B2EA 4AD8A 4O3MA 4P3YA 4OK3A 2XNDD 4TQ9A 1W49A 1RRGA 5FL7D 3TLXA 1UBGA 2AHOA 1G8PA 3TSWA 3K53A 3QPUA 3K70D 3R9XA 5D3MB 2G0TA 4HLDA 4NYJQ 3I3SR 2O8EB 2DCUA 4Q66C 3WMFA 4TMKA 4B44A 4PZLA 3AV0B 4JSYA 4BFUA 3U60B 1VHLA 2BMJA 1BS1A 2VHUA 1WCV1 1G20E 3AEZA 4FWTA 4NYIR 5L3QB 2JLYA 3L8YA 5FFMA 3SQXA 3A1WA 3CB4A 3RANA 5ANRB 2P65A 4MRPA 1IXRC 2ZUCA 4MYCA 4CYMA 1CJKC 2DBYA 2ZS9A 1KO5A 4DIEA 1IXZA 5TY0A 4E09A 2AD1A 1SVLA 3IPXA 1FOEB 2ZRPA 1IAQA 1VKJA 3NC0C 3GLHE 5JI2E 4BPBA 4YDSA 2J41A 1YKSA 3CX6A 3GLHA 4FCTA 4Q4JA 4BECA 4DXAA 2ZS8A 1T4GA 3T1OA 2CVFA 3D3QA 1KAGA 1IN5A 4OQMA 1T3LA 5KO2A 4KXFB 4URWR 3QEJA 3NH6A 2ERYA 2PLFA 4ZPXA 3WBKA 1WE2A 4DWJA 3RWOA 1HE8B 1W48A 1CJVC 4JLMA 3AVTA 3TSZA 4B48A 4C3ZA 5CLQA 1KNQA 1NLZA 4D80A 4Z8YA 2F1JA 3PFIA 4QKQA 2VSXA 4G5SA 4JLJA 1U9IA 2ZPTX 4KSBA 4NCIA 3T1VA 4BQSA 4URYR 2GRJA 4B43A 3BH0A 2CK3D 3GLGB 4IDQA 3L43A 1ANKA 1R2QA 3AF4A 3VQTA 2ASEA 2GCOB 4H1UA 1IHUA 4ZKDA 3RDPA 3CPJB 3WRXC 2QM8A 3K70C 1SHZA 2GTPA 4LJ7A 5FPTA 2AD5A 1YR7A 3CIOA 2GZDA 2ZRFA 5DH9A 4Q48A 1P9NA 4TL6A 4EPVA 1KSHA 4XVQA 4A0HA 3LXXA 3J81k 2I1QA 1DEKA 1NN0A 1XXHE 2ZUDA 4B33A 5EE5B 1OIVA 2G3YA 4HZIA 4TLDA 1XXHA 4YLGA 2XOKA 3B13B 2WJJA 1J2JA 4IDPA 1PLLA 1JXMA 4HAUA 4PPFA 5DO9A 1NLFA 3ADCA 3IHLA 5AJYA 3NDPA 4WAUA 3QKTA 3WYFA 3MWKA 4G5RA 4TL7A 4WZ6A 1T9HA 3I5XA 2ZRCA 1LTQA 4LC1A 3K9GA 3CZQA 4PAOA 2ODEA 1P72A 2Q3HA 4TYQA 4A0RA 1ELOA 1H8EA 2CDNA 4CEJA 3IIMA 3IUYA 1UKEA 1DE0A 721PA 3CRMA 2H5EA 4EDHA 4RFSB 2QEQA 1WQ1R 2IYZA 4PQYA 2W2TA 2EYUA 2C04A 2BKEA 1OFUX 3TJZA 2C2HA 2ZSEA 4HAWA 2RGDA 4JBWA 4TT3A 5A4JA 1YZKA 4DT1B 1CS4C 3LDAA 4MGIR 3GFTA 4EFNA 4O2RA 1XPOA 1UF9A 1QHNA 4HUQB 4G5OA 4LHZA 4JL5A 4UNSA 3ZDQA 2F7SA 2XSZD 1SXJB 4L16A 4XSHA 2BBSA 4C0BA 1GNPA 1N6OA 2ATVA 2JLSA 1IQPA 1Q12A 4B3BA 1SVOA 1Z47A 2CMKA 4MUBA 1KK0A 2J5XA 4W9MC 3T61A 5L8VA 1T3SA 3U44B 1XCGB 2IYXA 3AUXA 2R2AA 2AKAB 2EFHB 2XTNA 3MAAC 3PEYA 5CIWA 1NRJB 3EPKA 4TN1A 1VPLA 3B78A 4DLZA 4WOPA 4QJ3A 2GDJA 5AUOB 1EESA 5EXSA 2HUPA 3GJ0A 2XXAB 3JVVA 4EPWA 2BMEA 1LF0A 1Q21A 4UJ3A 3V00A 3U7HB 2V6IA 1JAHA 3FHTA 4XH9B 3UATA 1Z6XA 4L9SA 4YC7A 3KQKA 2A7QA 1L4YA 3R9WA 3QPWA 4LRWA 3SBDA 2X2FA 1XNJA 3PIRA 2XJ4A 2ZQ5A 3KDSE 5GJWC 5SZJA 2ZYUX 5LPNA 1T3HA 2I1VB 2IWRA 3QXSA 5JMTA 2YINC 1S1MA 1OXUA 4KHZA 4DHEA 1RKBA 1DAEA 2Q21A 1W4AA 1L4UA 1N2CE 4B6FA 2N1BA 2P6UA 2WKRA 2ONKA 4OKSA 1Z83A 4NYMR 4TLEA 5E7MA 1X86B 2J9RA 4LBWA 4EPXA 2FH5B 1HURA 5KSPA 4JBYA 2PEZA 1E0AA 1NP6A 3Q5DA 4EJSB 3ASZA 5EXPA 4IXMA 3HU2A 2ZR0A 1KY2A 1BH2A 1KOFA 2RHDA 2JDIA 3QQ5A 4BFVA 2V55B 4Z54A 5AUNB 1KMHB 4LZZA 1IOZA 4PC6A 1NVVQ 4MGYR 5C1BA 1Z6AA 3LD9A 4UNRA 4NYIQ 4QL3A 4B2IA 5KNDA 1N0UA 2BIFA 2H17A 2BWJA 2PMKA 3K8YA 3QKRA 3TW8B 4DC9A 2W2VA 3RS7A 4XVUA 1E9CA 2QMOA 3KX2A 1ESNA 1ZJ6A 1AS0A 2DWPA 1KJYA 3THWB 2EW1A 2ZRNA 2GK6A 1IY2A 2BV3A 2XTZA 1ZUHA 1KNXA 4M9SA 3KQLA 2IHYA 1BYIA 1SKYE 1E96A 2AX4A 1P9WA 1EFUA 4HEJA 2H57A 2WJYA 2ZRMA 1N6RA 2X1VA 3C7KA 4POAA 5J5CA 4BLTA 2VRWA 2H7VA 3F0TA 4I81A 1MRNA 1Q1ZA 2IEZA 3EARA 1KKMA 4XTCS 5IT5A 3BGWA 5L3SA 4AY2A 2C95A 3MCAA 1YR6A 2ZUBA 2F55A 4ZV4A 4DLRA 4OJKA 4BWYA 4D0LB 3CRRA 4HZUA 3CF6R 5DYGA 1ZNXA 3E5HA 4G01B 5DI3A 3NWJA 3EZ7A 2NPFA 2IF0A 2CHGA 1Z0FA 2KI5A 2ZSAA 4JL6A 3GPLA 3BE4A 2OESA 1Q1EA 3SC3A 1UPTA 1T6NA 2WWWA 1JJVA 3IQXA 4KLNA 2FGJA 1NNEA 4JT2A 1JALA 2JJ1A 2LCFA 3BORA 2KJQA 4BEBA 2QMHA 2HF8A 1KI7A 2ZU0C 1RJ9A 4QJ4A 3W6NA 1A2KC 4LHWA 2CEAA 4HLQB 3P32A 2XOKD 1HA3A 1XP8A 3VR6A 3PVSA 3I92A 2AN9A 1B0UA 3RRYA 3TAUA 4YMVA 4M1SA 4QFMA 4XOIA 2G0NA 4P4SB 1HQCA 2FFAA 2W6JD 4ZDJA 2UKDA 2JLUA 1TTTA 1VG8A 3H4MA 3QOFA 4XD7A 4BZXA 4C0KA 4U00A 4BFYA 1YZNA 4OQLA 1GILA 1FPMA 2XGJA 1DAIA 2PZEA 2QPTA 3M0EA 2GCPA 3IGFA 4QJ5A 4TMVA 4TTQA 1W47A 5CYPA 1HEIA 4LGMA 5EP3A 3C15C 4KITB 3Q72A 4B2LA 2ZE6A 1HT1E 4X8MA 3X1ZA 1SVMA 3OIVA 2OCBA 3IO3A 4IVQA 1Z3IX 5G40A 1A4RA 4M22A 3DL0A 1S0UA 1XD9A 2OZEA 5B64A 3O8CA 5JHHB 4KO8A 1G1MA 4TT3D 1ZVQA 4QG7A 4DSTA 1N5KA 2VF8A 3P4XA 1NSTA 4M9ZA 3UIEA 1E9BA 3ZJYA 4JT4A 1TUEA 1IN8A 1JJ7A 2QAJA 4H1VA 1UAAA 1E0KA 2NOAA 1YJ5A 5K8LA 3SJZA 3VHXA 5FPHA 2Q9CA 4BFXA 2WJGA 1K6MA 3AF3A 5FTNA 1Z6TA 2IYWA 1Z0IA 5KDLA 4AYWA 2QAGA 1HE1C 1YZGA 4IOJA 1Z6GA 1AZTA 1KIMA 4JKIA 3PXGA 3OF5A 4RVCA 421PA 2IYLD 3RC3A 1XMVA 4F93B 3VR2A 1RRCA 2HCJB 1KAOA 3QUSA 4CEIA 4UQOA 1UJ2A 3KTAB 1EWQA 2QPOA 2FSIA 1G64A 3MJRA 1FFHA 2ZYVX 1E2LA 4QGAA 4WBSA 1XTKA 3QXHA 5EP4A 3OFND 1I4LD 1KDPA 1A7JA 1JEDA 4I1VA 5GVSA 1G7RA 3V9PA 2ATXA 1E0JA 2WKQA 3CRVA 3GJ5A 4MKGA 3BWDD 2CXXA 4N0EA 4R71A 4Q19A 5KSZA 4A82A 2A78A 3ZLJA 2DWOA 4ZKEA 3CBQA 1GAJA 4NHOA 2NG1A 3HDTA 4TYYA 2BM1A 3ADBA 1UDWA 2PH1A 1P9RA 3KJIA 3O8DA 4D0GA 5JRZA 3THXA 4W5HA 5DISB 3FMIA 4R2IA 2RHMA 3ZIAD 2A5DA 3BIFA 4J0QA 2F43A 4RZ2A 4QNRA 3UWOA 1AJEA 3P27A 4GRAA 4I4LA 4DLVA 4II7A 1NBMA 2BDTA 2EWVA 4Q4AA 2GK7A 1J8MF 1COWA 2GCNA 4PZYA 3HR8A 4OQXA 2FPMA 4KYIB 2A5YB 4DJTA 4U02A 1EXMA 3GLFE 1VYUA 4NYJR 1UEJA 1OFIA 3N2EA 4US1R 2FFHA 4FW9A 3GLFA 3W90A 4D4LA 5HKKA 3OEHD 4C2TA 1OV4A 1ZD9A 5M04A 3TUIC 4O2LA 2JLQA 1T8TA 1AS2A 4Z1MD 5EUQB 3RRMA 4NTZA 2QP4A 2O8CA 2ZE8A 4TZ6A 2BEJA 1NN3A 5JHGB 1VCNA 1NG9A 5AK0A 1P7CA 2ORVA 3KQNA 3DDCA 1JBKA 4HLUA 4B75A 2DWQA 3ND9A 4A92A 1KSFX 5CB8A 1A2BA 3FHOA 1H8HA 3IIKA 4URXR 2IS6A 2JATA 3D31A 4P33A 2GXSA 3EIQA 1ZINA 3C16C 1A5TA 3DEFA 4ITRC 2X2EA 4JLNA 2WPDA 1E69A 1HY3A 2GKSA 2QE7A 4GI7A 1UDXA 4YXWD 3GP8A 4DKXA 3PUVA 2FGKA 2ZRIA 3NTUA 2ZI5A 5IDVA 5FBWB 4MRNA 3BERA 3LQRA 4M2LA 1XMJA 1KDOA 3QSYA 2A2ZA 2FG5A 2D4HA 1XB2A 1U90A 3RLFA 4Q1DA 4YMWA 3U7EB 2JEOA 5F98A 1QHYA 4JYCA 3NHAA 5D3MA 3EZ2A 4PX9A 2GZHA 4EFLA 2O8EA 5UKDA 2AXPA 2OXRA 4JLKA 4A2PA 3HYTA 1CR0A 3CONA 1CKEA 2ZI6A 3BK7A 1G4UR 3GCGA 5AJVB 2ECKA 3DKPA 5EP2A 2IS2A 2Z83A 3CPHA 2CHQA 4LHYA 2Z5FA 1E6CA 2A3RA 5L3QA 2EFEB 4LDJA 3WP0A 4US0R 4B3GA 1FQJA 4KBGA 1FP7A 2OFOA 3BC1A 2FF7A 4Q18A 4B34A 3UPUA 3E2IA 4IOMA 3AVVA 4FMDF 4PHHA 3O8BA 4IDNA 1EWRA 3AKDA 3DVLA 2GF0A 3LH5A 2YC2C 3ADDA 1KY3A 1DO0A 1KJZA 2QRZA 3CLVA 4B47A 1NG1A 1G21E 4QHTA 2VP2A 3OIYA 3SYNA 4HAVA 3GLIB 4CRWB 4JSTA 4D4JA 3ZZUA 5LD2B 4JMPA 1EFRD 1P2SA 5FUYA 2AKYA 1KDTA 3UKDA 4RJLA 4M9XA 4F38A 1R5NA 4JLOA 1ZNWA 2GETA 4PC2A 5F3WB 1NSFA 2O52A 1SGWA 1TX4B 4AIIA 3EAQA 3GD7A 4Q5IA 1FNMA 3OIUA 3NH9A 1CJUC 2F9MA 3SFVA 4A8JC 1RIFA 2XITA 3TMKA 3DM5A 3DM9B 2O8DB 3P20A 1E2PA 1N6KA 1E9SA 1OXTA 3KB2A 3CX8A 3I4LA 4Q7JB 1Z2AA 4TSFD 2NQ2C 1P3JA 1G7SA 3S1AB 3GLGA 3U3MA 2GCOA 2WJVA 2CJWB 4UXIA 2FE4A 4ABYA 1DO2A 1PUJA 5J4LA 1Q22A 5KU1A 4TTRA 4TLBA 1XTQA 4FMDB 2ZRLA 3I8XA 4KCGA 1SKQA 4U5XA 1TF2A 2C9OA 3ZVLA 3PUYA 3EPJA 1YR8A 3DMNA 4X8HA 1VCIA 1DG1G 2GVZC 3TR0A 4P4UA 2F43B 3TSOA 1UKZA 2ZAMA 1W0KA 2QT0A 4DBLC 1W1WA 2NO6A 1XWIA 3ECCA 4Q9KA 1HV8A 3K0CA 2ZRKA 1GOTA 3AUYA 5CYOA 2Q3MA 2ZROA 4HB3A 4EUNA 2ZEJA 3MRSA 1OE0A 4TTPA 4ZIRB 5CK5A 4JJKA 1Z22A 4CDGA 4Y0AA 3KKOA 5FUVA 3CRQA 3I62A 3QY0A 5CDFA 3K09C 1R5BA 1OYWA 4QXAA 4XVRA 2GEVA 1I4TD 3ASYA 2QL6A 1DS6A 5KDOA 5BW8A 2BJVA 4RFSA 2HEIA 3B85A 4M1KA 3AP3A 3X1XA 5DYIA 4DLXA 2L0XA 1XBTA 3EC2A 1MR3F 1FMJA 3LW7A 1NBMD 3DKVA 1WRBA 4M1YA 2R6AA 1FW6A 3ND8A 5G53C 4DT1A 4FD2A 4QBIA 3UK6A 3NBXX 1YVDA 1E2QA 4IOLA 3LAWA 4L8GA 2JLXA 1L2TA 2OM2A 3BB4A 4RZUA 4HUQA 5KPDA 1NVXQ 3C5HA 4AKGA 4BLOA 2NGRA 3CR7A 4IDHA 5HKKD 3K70B 1NY6A 1SXJA 2CLCX 3ZH9B 3IO5A 4UNNA 2OXCA 2GBLC 4GOXA 1Q3TA 3C4JA 3W5JA 3W9YA 4F4IA 1CULC 2KBFA 5AWFC 1WBDA 5G3ZA 2NZJA 4LJ9A 4A2QA 2PJRA 2Q0HA 3QXXA 1EX7A 3U44A 2A5JA 3M6AA 5EJEA 4OHYA 4I1UA 2ODBA 2GNOA 3W8RA 1ZD1A 4AKEA 4GDFA 1J7KA 2ZJ5A 1YZTA 2WIAA 3ZQ6A 4KFSA 1Z29A 4CVNA 2PT5A 2CL6X 4C0HA 2ORWA 1NVVR 4G0NA 3KFXA 4EPRA 2VSOA 2XXAA 4XTRA 2QORA 2G1KA 4CT4B 1NVUQ 3B1YA 4LYAA 3KKMA 2Q6TA 1OF1A 1KI8A 1LVGA 1E99A 3FKSA 3NIBA 3Q3JB 2GF9A 4LBZA 1XJQA 1F48A 2J87A 1NIJA 4GL2A 2QPAA 1WBBA 4IDOA 3CR8A 1JR3E 1G19A 1R8SA 1JR3A 2QP3A 5JCPA 1AQUA 1G8HA 3P26A 1YRBA 1UBCA 1Z07A 3NDBB 4M4SA 4HUTA 1Y63A 2IHBA 4GOJA 4JVMA 3TW4A 1JNYA 2GXQA 4PO8A 3TQFA 3RS2A 3QE0A 1Z6YA 3ETLA 2IX3A 3X1WA 2YNMA 5JFGA 1WXQA 5DIFA 4DDWA 1JI0A 2BBTA 1G5RA 2FOLA 2V7QD 2WWFA 3K9LA 2LWIA 4BFZA 1KMQA 3Q7PA 3RS4A 4EJSA 2EQBA 1CP2A 1OKKD 5JWHA 3R8CA 2JA1A 1H65A 1G6OA 2ERXA 1EK0A 4AYXA 2IYVA 1QF9A 1US8B 2PEYA 2B21A 2DHRA 5KTYA 3LX5A 4LBVA 1X3SA 1SVKA 4D4MA 1KMHA 2QP9X 4KVGA 4XWKA 4A6PA 1P2TA 3L8ZA 1F6BA 1OSNA 2R6CA 2NZ8A 3IQWA 1W0JD 3AVYA 3OAAA 1VIAA 5BN5A 2QBYA 3ADKA 3OIWA 4B32A 3AB3A 2YOHA 621PA 1U0HC 4LHXA 4BASA 2NO9A 2J7KA 1CJMA 4MITA 3THWA 1E4YA 1ZCAA 5FOSA 3NKVA 3VR1A 2MMGA 3BB3A 5DN6A 2HYIC 3PCRB 1GL7A 5L3RA 4C0JA 3BFXA 1X8KA 3WNDA 3TK1A 1E2FA 2CBZA 1EFHA 1OH7A 1DELA 2XB2A 1U81A 1TQDA 4E5UA 3AVWA 5HE8A 2FPLA 1E2IA 3A6PC 1U99A 3B1WA 4M1OA 4RD2A 4ZDIA 2VO1A 2Q9BA 2RAPA 3UMFA 1TF7A 4NH0A 4DUGA 3PUXA 4OK5A 5JECA 3RS0A 1Q20A 2FN4A 4EAQA 5A5GA 2KBEA 5KHOC 4FI3C 3I1FA 4WA7A 4ARZA 1KK3A 1KI6B 3CWQA 2CLDX 3A1UA 4D0NA 3QF7A 3WXMA 1UFQA 2J0UB 2D3WA 2XJ9A 2WIBA 1UADA 2ZRHA 1YZQA 2B7CA 4O25A 1R0XA 1XEFA 1G8GA 1QHHB 3HU3A 4DCTA 2GAOA 3IEUA 5EE0A 1KO4A 2KB0A 2RGNC 2C77A 3AH8A 2YJTD 3BS4A 1W7AA 1N0VC 3UXMA 1P61B 4Q4HB 4DLUA 5JZVA 1G16A 2D74A 2K5UA 1DAKA 2ZI7A 3HPRA 2RGEA 3A4NA 3Q5EA 1WB9A 3WHLA 3KFVA 4A9AA 1U2RA 4P4SA 1IONA 4WIAA 1DOAA 3SFZA 1E0SA 3FGNA 4K81B 1QVRA 2JIZA 1J99A 3AVQA 5JJIA 3SU8A 1GFIA 3QG5A 2OFWA 1FL9A 4G1UC 3CM0A 3SJAA 3TUZC 4ASUA 2YOGA 4NONA 1IJEA 5EZ6B 3VU9B 2HV8A 1D2NA 3Q8XB 1W36D 4B6EA 4HDQB 4D2IA 2DR3A 2GXAA 2R6FA 1S3SA 4P32A 4TYPA 2DFTA 1RVDA 2IF2A 2JJ8A 2PBRA 5CB6A 2WZQA 4LJAA 3TBKA 5J4HA 4KLZA 4PHTA 3V4FA 1F2TB 1TF5A 2ZS7A 3EX7C 1GNRA 1N6PA 1E79A 1MO3A 2FEMA 4WW0A 2PMDA 3AF2A 1OH6A 1ZUIA 5CLLA 2ZSDA 3FPAA 4FXPA 4PPQA 4D26A 2NO0A 3X1YA 2Z4RA 3MD0A 1MOZA 3LX8A 4M21A 4A0FA 1VMAA 5FI0B 2V6JA 1SXJD 1GP2A 5KNBA 5EZ5A 1CR1A 2OAP1 3JZMA 1XFAA 1SVSA 3H0KA 5TMPA 3ZVNA 1AK2A 1E2HA 2H1LA 4DVGA 1OH5A 3JZAA 3U3KA 2C5LA 2OCAA 5FTMA 1CRPA 2FV8A 3VX3A 1FNNA 1E2NA 2HJVA 3U7GA 4GMDA 3KTAA 1J70A 2ZRAA 3PG5A 3NEJA 5DHFA 2PT7A 1U8ZA 2JJ2A 2WMNB 3TH5A 5BN3A 2RKOA 3EXAA 5FR1A 3W8NA 4OBEA 2V8OA 4OHZA 1RE0A 2ZANA 3H2YA 3UMRA 4AI6A 2IYQA 1TEXA 4D4KA 2CNWA 2OUKA 3SYLA 2PLRA 1M7GA 2YWGA 4TL9A 2JCSA 3AF1A 4YONB 4KODA 2HXSA 2QRNA 3AVUA 4LV6A 1IY0A 4KFTA 3R8FA 3MWJA 5FUWA 3BXZA 2C96A 1W36C 2ANBA 4LJ6A 3REGA 4BLPA 2A5FA 4LV5B 1F5NA 1SVIA 2F3RA 1GSIA 4LBYA 1NMZA 4IVRA 1OHHA 2FMXA 2FZ4A 2I3BA 1G7TA 1ZD8A 2EVWX 2CCGA 2C9YA 4E03A 1SULA 1SVWA 2ZJBA 4C4PA 5B30A 1GRNA 3CRW1 2F9LA 3QF4B 4LYFA 1W5TA 5DNYB 2YWFA 5H68A 2O8FA 3HWSA 2R62A 4ZDWA 4A0GA 3GJ4A 4QRHA 3PR1A 2OG2A 3OESA 4JVSB 2O0HA 3QIAA 2IUTA 1S9DA 1AA9A 2J45A 2O8BB 2VP5A 2W0MA 3K0EA 4GOKA 5FBRB 1G3RA 2QZ4A 1OPXA 5H8WA 4LYJA 1FX0B 3ZD6A 1IXSB 1P75A 2FFQA 5FUXA 2LKDA 2REXB 3EPLA 4CEHB 1XD2B 1NKSA 3DZDA 3VR5A 1YQTA 4MH0R 4MYTA 2ZIAA 1ZYUA 4IFBA 3OE7A 1CF4A 4V03A 2QSZA 4ARZB 3FYHA 4JVNA 4FWIB 5FBQB 1X1SA 3ZZTA 1BMFA 1MV5A 3LVRE 4ILEA 4DLWA 3CKLA 1KI4A 2QROA 4OHWA 1N6NA 4OHXA 3VR4A 2R9VA 2Z4SA 5K8UA 2YYZA 3T5GA 5B58C 2IEYA 2BBWA 3G82C 4BRUA 1QBKC 5E7IA 1E3MA 3VNVA 1KI2A 1E1RA 3RAPR 1YR9A 2IUSA 1JPNA 1S1CA 1LB1B 3AP1A 1FMLA 4JYBA 3K9NA 1KK1A 2R65A 3THYB 4HB2A 1Z5ZA 2ZI3A 3KXLA 4E07A 2P5SA 4V0ME 5FH9A 1IJFA 4C7OB 2PCLA 4OJQA 4A36A 2DPXA 3QG1A 4AKHA 3NXSA 3SHWA 1AKYA 1E2KA 1EFTA 1W46A 2HLDA 3FFAA 1H8ED 2J59A 2GHIA 3GEEA 3IKJA 3LBNA 4TQUS 2RGAA 4V0OA 3P1JA 1M8PA 2J3EA 1X6VA 4V0NA 1OYYA 4PZZA 1AGPA 2ZR7A 4BFSA 5HR5A 5HZHA 2QN6A 1NMYA 5G41A 3MLEA 1IN7A 1VG1A 2AL7A 3FTQA 3K1JA 2C03A 2WWXA 3B7GA 4PC7A 1TU3A 2AWOA 2J46A 2W6IA 3GQBA 1U9IC 2FSGA 2QA5A 5FOTA 2EFGA 4Q1AA 4Q01A 4S35A 2FSFA 4NCHA 2G9NA 4NMMA 4PANA 2ZJAA 4F7WA 2H16A 4PHFA 4OI1A 4S2EA 4MGZR 1J8YF 2HYDA 3THOA 2IS1A 1AM4D 1DTSA 1KGDA 5FR2A 2MMCA 1JQLB 1E2JA 1RPZA 1ZUNB 3U6KA 2EYQA 3ZZ0A 1G3MA 2QI9C 2ZR9A 2ZITA 3EA0A 1Y3AA 3FFBA 3HU1A 2P3SA 1Z0DA 3QBTA 4FINA 5LB2A 4B3XA 1VYVA 1ZP6A 5BQ5A 4ZI3A 3GLIE 2MSCB 2EU8A 3KUDA 4RZ3A 3GLIA 2ZRJA 1YZUA 1DARA 2QTVB 5AJXA 4CZ2A 5JS8A 2DYKA 1OB2A 5GADl 4MRVA 2DY1A 4TWZA 5E7JA 1GZSA 1N0WA 1BOFA 1UKYA 1F60A 3CUEF 3LA6A 4FMBB 4X8OA 5JJKA 2G1JA 1HUQA 1HT2E 3EA5A 4ZCIA 2WWHA 1OFTA 2RGBA 5IK2A 3DO6A 1Q0UA 2ZE5A 4EPYA 1GNQA 3SJBA 1II9A 5FOVA 1OW3B 1D9ZA 4KJZA 8OHMA 4HDOB 1QZXA 1OT3A 1UBFA 3DHWC 3ZVRA 1ZM3A 1D2EA 1CU1A 1ZMXA 2VBCA 1GUAA 2YHSA 3GEHA 3I8SA 3RVBA 2O8DA 3PUWA 1KO7A 2ZXUA 3F3YA 3L0OA 2JLZA 4MKHA 3S1AA 1DAHA 3U61B 4QGHA 2D7CA 2CJWA 3OEEA 3PENA 1FTSA 3H86A 4JBXA 3KQHA 4EQ6B 1U0JA 2CE7A 3NHBA 1T8UA 2KE5A 3AGPA 2OLJA 2V1UA 1L8QA 2ZJ2A 1KO8A 1N6HA 3PEWA 3BD9A 4MRSA 1E2DA 4Q7KA 3R9IA 4BUJA 2VTKA 3REFA 2O8FB 1E2EA 2ZTSA 3BH7A 2D7DA 3WBJA 2AWNA 3SQWA 2CNWD 3PEVA 3W3ZB 4DCUA 4DRZA 5TARA 1AZSC 4PC1A 2VSFA 2O5VA 3DOEA 2JDID 1PZNA 1U8YA 1S9HA 4BLQA 4JLVA 1Z0AA 5FOXA 5AUQA 1G18A 3U5ZB 4ZIRA 3EWAA 5BYKA 1F2UB 2G83A 1Q3HA 2BHRA 3NEYA 1RW4A 3PEUA 1GIAA 4UJ5A 4LPKA 3RYTC 1N5JA 2DFLA 2QSYA 4QBHA 1R0ZA 3EIEA 2OO7A 5EE3A 2J0QA 2IBMA 4BE7B 2Z43A 4JLPA 1KSGA 3UG6A 4DCNA 2UZ3A 4R2HA 1D2MA 3KJEA 1G6HA 1LFDB 4A8JB 4P4TA 4RSGA 2IWHA 2XZPA 4KYUA 3KXKA 3SJCA 1B23P 2GZAA 1QHIA 3VKGA 3A1SA 2SHKA 1Q1QA 2AR7A 2WBLC 2ZYWX 5FBVB 1RZ3A 2GJAA 1ZIPA 2JGNA 3B60A 3LW8A 4W5WA 3EASA 5KYKA 1FUUA 1C9KA 1LW7A 1SHKA 4Q1BA 1XX6A 4PSVA 1ZCBA 1FUKA 3CWZA 4L5BA 1G3IA 2YZ2A 4H9GA 2OCPA 2ODNA 2HCBA 4Q7LA 4HYYA 3KJHA 4N0DA 1BMFD 1U94A 1U0LA 5CIQA 2ZI4A 1TAGA 1MO5A 3AF0A 3F5FA 5CJ2A 4AURA 5J4VA 3R20A 5ELXA 2WHXA
chains in the Genus database with same CATH superfamily
1XNGA 1XZNA 5AXCA 5C81A 1EXWA 3FUUA 4DUYB 4ZMSA 2HT6A 4XSGA 2QU7A 2BFDB 3C8UA 4XUCA 2CVPA 1SHJA 3NU1A 4NZYA 3W2HA 1EUQA 4MR7A 3O3MB 2GPYA 5EUBA 4C7KA 1M2HA 1U1IA 3QLUC 4ZU6X 4TLCA 5E38A 1PF7E 3TUJC 3V32A 3X1DA 5D8DA 1KP9A 4AROA 4CKCB 4YJGA 5FPKA 1ZR4A 2WHPA 3NVMB 4C0WA 2GZRA 1GKKA 4MAAA 1EG7A 1F3OA 3BVPA 3T3OA 1BZYA 5E1BA 1FUEA 1OZGA 4L1KA 5AHWA 2I8AA 1VLQA 2PSHA 4LX8A 4CF7A 1KYIA 4RBNA 1WP9A 1CQIA 2X8AA 5I45A 4UEOA 2XLBA 4EKIA 5JSZB 4J8PA 2HO4A 4JS0A 1IXKA 3D8HA 1I8TA 3C14C 2GA8A 4P53A 4L5YA 3SNHA 5IT5A 2D1QA 3K9BA 4FUTA 5HWSA 2I0FA 1K9VF 1YZLA 4A5OA 3EC7A 4NY1A 4YAGA 2RB4A 1CDEA 2HSEA 1DUVG 3JALA 1ZVJA 3H9JA 3JWHA 4PLVA 5JD4A 4UD2A 1ZJ4A 1Z63A 4N65A 1S96A 3OJOA 3PNQA 4N8SA 4CCYA 3A37A 1AHIA 1BN7A 1PJAA 2QNRA 4KDRA 2W58A 4YTEA 5IAEA 4ZAXA 1NRWA 4D96A 3FJYA 5K45A 3P0JA 3IDSA 1GG2A 3DW3X 3OZRA 2I6FA 2GUGA 3H4TA 1HDIA 1M7HA 4ZV9A 1AGRA 5J47A 3TZ6A 3GFPA 3AF5A 4L4ZA 3NIDB 5U4QA 4FS8A 4AZSA 4K6KA 3NUQA 3QJ5A 4ERXA 1GCGA 3UJDA 2I03A 2QS9A 4YYEA 5I7WA 5LN1A 9MHTA 4IQ8A 1T4CB 2VHWA 2K87A 2PX0A 3GFFA 4UOEA 5EIBD 5C4IA 3G2HA 2IUUA 3IP5A 3ZW9A 1WCYA 4JJZA 1P4AA 1GU1A 4B4WA 3C97A 5TEVA 3D7KA 3GYGA 5LQAA 3B9BA 2GEBA 2GSDA 4QM6A 3VR2D 3FYUC 1YHNA 2OZLB 4ZGGA 1OLUA 3G59A 4RHTA 2J0EA 3E81A 3OOSA 4CG1A 3OQIB 3RAEC 1NWHA 1G2OA 1YDFA 2CHEA 2FR1A 2V6BA 3EXHC 3KYCB 4R2LA 1ZZGA 4YFVA 5J58A 5K09A 2B98A 1T1SA 3ZHVA 3ZDYB 1M5TA 2WA2A 7MDHA 4YEDA 5KOJA 2GEKA 2KWIA 3N39C 4DNOA 1WD7A 3RUDA 3BULA 1J5EB 4G0VA 2WYOA 1Z3CA 4GF5A 4GGOA 4FGSA 1E61A 3TLAA 5JANA 4N0MA 2FFRA 5SZKB 2ISCA 2RONA 5DYTA 1OJ7A 1G55A 3ESAA 4R7GA 4F5YA 3JQ8A 3KLBA 4Z0TA 2G8NA 1C0LA 3DO5A 2V4ZA 4JLDA 2WJWA 4OI0A 4K46A 1CLUA 2ISSD 2IT1A 3ZXYA 4EJMA 3ZD9A 1GUZA 4QUAA 3DTVA 3TAHA 4BO4A 4KBYA 1T3GA 3ITNA 3RJMA 2XDQB 4FBLA 1VPDA 3MOGA 3SZRA 4EB3A 4DW8A 4LYGA 3K32A 1FTYA 3TIVA 4PXYA 1CR2A 3PRHA 4F5ZA 5HX7A 1TD1A 3LZDA 1M2NA 2EW2A 3EVFA 4E7OA 1TJNA 3G0HA 1NHGA 3LHFA 2F67A 3Q1KA 3RUAA 3T3PB 1AXEA 1Y1PA 1GNVA 3ZTYA 4R83A 5LKRA 3HJGA 2H1SA 4XJTA 1I4DD 4BNGA 2BFWA 5BWNA 1P2BA 5AI8A 1C1XB 4UREA 1L5KA 3L4JA 3CEMA 3RIYA 2I6SA 1EHIA 1O77A 2WSMA 3C87A 3HDJA 4Q4HA 4UM5A 1K8ZB 5EUMA 1DKQA 1VE5A 2B5VA 1ZD2P 3BZUA 4YAJA 1N3IA 5GAJA 2DFKB 3UK1A 2QZPA 3LNCA 5EIBC 1UJNA 2GILA 2QTHA 4PG8A 5IJAA 5AVSA 1P4SA 1CXZA 3E3OA 4P82A 1PGPA 1C4OA 2DBVO 2D4AA 3KL4A 4P22A 4R98A 4BU0A 2CL7X 4EGAA 4DV6B 4B6RA 1EFKA 1TRHA 3UOGA 2PXXA 2N3ZA 3DL7A 4KXQA 4FN5A 1UWCA 3AHGA 1UIRA 2POQX 2Y6UA 4H17A 3I45A 4RZSA 5D86A 2XCUA 1GRVA 2VF7A 3QTTA 4IJMA 2OYCA 3DNMA 4ZANA 3ULKA 1E18A 1D4FA 3LHDA 5BUZA 4PQGA 5CK4A 1CETA 4PPNA 3T7RA 1TCAA 4UW9A 3ET4A 4J2TA 4LQCA 3USZA 2FX2A 2XB8A 1FJHA 4IEFB 3HYRA 1F2TA 16PKA 2JJQA 2O0JA 4G5GA 1FTQA 4NK4A 4WCFC 1WDLA 4XWOA 2E87A 4EECA 2O48X 4MYSA 4RX1A 2YQ5A 3H2JA 2YRFA 1ZK3A 2FRDC 3MG9A 1QYWA 2QVZX 2QE7D 4RZQA 4Q4LA 1M2VB 3UA4A 3I9KA 3TKYA 5JJ5A 1NVWQ 3D6JA 3WLFA 3KT6A 2V3WA 3OKFA 1U8UA 2HK9A 3HPQA 1WMBA 3A1FA 2FEOA 1PVOA 3EIXA 3NJ4A 4JL8A 4UU0A 3CT4A 2WZBA 4PX5A 4DCGA 5C5CA 2FJUA 3N75A 1RLOA 3KOYA 2DAPA 4FR5A 4RFVA 2HIMA 3SLKA 1O6ZA 3D4LA 3VPFA 5E1OA 5KNCH 2RGRA 1UWVA 2V3VA 1GNLA 2NNWB 4EG1A 4KHPB 1YJXA 2V59A 3D4NA 3PHHA 3K9HA 1WUHS 5TGDA 3U3RA 3JAKA 5IHPA 3RWMB 3GGJA 4MQFB 1FJ2A 2D3TA 2FEPA 2WU0A 3NVAA 3T3DA 1LBEA 1WKBA 1JQEA 1W0CA 4I1SA 3ZPXA 2Y1EA 3AKZA 4E1BA 4RV5A 3IT2A 3UT5B 3ZJ4A 3GN2A 5K3AA 2BFPA 2PUJA 2WICA 1K5PA 4MA4A 2Y1FA 1AKNA 3O7WA 4FEYA 1R0WA 3BB1A 1K7FB 4PSKA 5TPZD 3LC1O 1AB5A 2ZI9A 3G8AA 4DDTA 3DVQX 4PO9A 2IL1A 1VLJA 4PAQA 4EY3A 4ZDKA 2IYTA 2DPGA 1UAYA 2FQQA 4MTCA 4OMDA 1W5FA 4LG1A 4FCWA 3ADPA 1N57A 5REQA 1VLMA 1JP7A 2O06A 1HT0A 2WF8A 2QY6A 5BYJA 1RHMA 4HFMA 4PYKA 2XNJA 1ZOLA 3F6BX 3HN6A 1R3UA 3NV7A 2A92A 4RY2A 4WZBE 5BNWA 1C7IA 1TMGE 1JR6A 2Q5LA 4F3YA 5HJ7A 2I67A 4R1PA 1XCMA 4CKCA 3T15A 3HN7A 4KH1A 5EZQA 1N6LA 2ZJYA 5JR3A 3QF4A 1T25A 3H1TA 4ZJYA 3DUWA 2CXRA 2HH9A 3RC8A 2Z8YM 3I2JA 2BM8A 4PLCA 2YHAA 5KYXA 1RAEA 5IF9A 4IFEA 1KQGA 3BAFA 1VHDA 5DBHX 1CV2A 3ZLVA 1NMEA 1FX0A 1NNI1 1VPWA 5FHQA 1YU9A 1Y80A 4DL9A 1XD2A 1FMCA 1FRZA 2BMFA 5L95A 4PG7A 4S1NA 1A69A 1J1ZA 4NG5A 4GPIB 4REQA 1X39A 3LV8A 5D1HA 5G0UA 5TSDA 4NNOA 5DCLA 1PEYA 2HMUA 1FYEA 3LWNA 4Z9FA 1NUQA 4DDUA 2CSXA 3HFJA 1RE1A 3LKVA 1O87A 2LR0A 2IC5A 2LW7A 5GJVC 4QPNA 2HHLA 3I72A 4K6CA 2XD9A 3UBMA 4EPTA 3LKDA 5H1YA 3ZBPA 2SCUA 2HRZA 2NYAA 2D5AA 2VCHA 3SSOA 1V11B 1XJ5A 2BP7B 3QELB 5KUTA 2J5QA 1AV6A 1Z8DA 4RGYA 4OXQA 5BWMA 3TZLA 4BXOB 2GJ4A 3NTLA 1EBFA 2TMKA 4RD6A 3KLPX 3W2GA 4KQCA 1XDGA 2Q7OE 4DFDA 5HGJA 4LVCA 1NQTA 1Y5NA 4C7JA 2SICE 4IX1A 5F9HA 2EP5A 3GEMA 3HA7A 4UU7A 2FMFA 5LLSA 3UYLA 3BXXA 3AHIA 2Q99A 1WEHA 1B6GA 5LBUA 2GRAA 2DULA 1N5RA 5FBKA 3RVNA 5EJIA 4I50A 3W5UA 5DGDA 3NBZC 1QV7A 1SQSA 3NJ8A 1KZ4A 5IBPA 3NIGB 3C6MA 1J2YA 3T7EA 4I4CA 3UAZA 4MUAA 1KS9A 4O5OA 4ZVTA 4DIDA 4RVHA 2PZKA 2XUKA 1GLGA 5AJTA 1II8B 1UKCA 3HL4A 4N54A 2A0KA 1ZCZA 2V4MA 3QPVA 4BFTA 4ESOA 2CE2X 3JVUA 2QUZA 2HT1A 4UHHA 2VP9A 3OP4A 1I33A 4BO7A 4ESHA 4YRGA 4HQ0A 5JLJA 3EGIA 2HZ7A 5C18A 1ODFA 3GPDG 3E2PA 2H2HA 2CCKA 3N74A 3R0JA 3AIMA 4WFJA 3WSVA 1H22A 1NL3A 1LCIA 1VECA 4U7FA 1DWPA 2C92A 2HCFA 3H4IA 1W5SA 3B9QA 4YACA 3WMRA 3VKVA 1U6IA 1TPYA 1VBFA 2R1VB 3LO5A 4DDVA 3H0CA 1MH1A 2WLTA 2C99A 1WXFA 5FA6A 1UH5A 4LRSB 2RIRA 1GGKA 3JD2A 3O9VA 1U2PA 1LPNA 4IIFA 4BZPA 5F21A 3HKBB 1G38A 1XG5A 4GZMA 3DBIA 3NHUA 3OG9A 4DWVA 3RSFA 1TUIA 2AC7A 2JAQA 1JU3A 1AVTA 4BO9A 1DEHA 3RYIB 4YV1A 4Y2TA 2Z6QA 1YQEA 1LLCA 4TKUA 3UHFA 4N8DA 1OREA 3DMTA 3L1UA 2XX3A 3BQNB 1L5NA 2JGDB 4C43A 4Q4JB 5B55A 1LH0A 2CC2A 3FKSD 3S2FA 3DTYA 5JYBA 8ATCA 1J25A 1URPA 1N4AA 4Y1GA 3E18A 2L82A 4X97A 1A7AA 5BYBA 2P9CA 3ZN2A 3U5TA 1HFEL 5AVRA 5K2OA 3KKKA 1D1TA 1HXHA 3MQ4A 3SNKA 1Y6QA 4U7TB 5T5QA 1O9HA 1D2HA 1I2BA 3I6QA 1K5GA 4WXRA 1ZU4A 4B7UA 3C3WA 1K1EA 1Q6YA 1XTRA 1YCHA 3H1AA 4KWIA 4L28A 5H70A 4NDAA 4D9EA 4DCSA 3S1SA 3CSDA 3F4BA 2ZRDA 2NUPB 1Y3BE 2QSJA 2W4MA 1TQ6A 3DP9A 2YNMD 5BQOA 2XODA 1DZ3A 3Q40A 2FQ1A 4BN5A 4IIUA 3ZLUA 3NVDA 4PWZA 4QEDA 2OKCA 3I05A 3EXG1 1T2NA 4PLHA 2IZ0A 4QXQA 2VH5R 3FBTA 3I6MA 1T2CA 1ULSA 4XUGB 4YRPA 5DHAA 1CNFA 2ON6A 1PGOA 5FV7A 4Z1MA 1WM1A 4HO1X 1SXJC 3H6HA 2A0WA 3N0WA 3PLRA 2OD9A 2P2LA 2QENA 2BKVA 2IXFA 3BXGA 4AIRA 1JFRA 3FIJA 4HNSA 4I8XA 3UB4A 1ZAKA 3W6PA 1OH8A 1XZPA 1TZBA 5FLEX 3WV4A 4PRKA 2R1ZA 2RGGA 4Q9JA 4DANA 1E9DA 2XZLA 2IH5A 1K7EB 1Y1SA 1IK4A 3PYLA 4HX9A 3TE7A 3RGGA 3E4DA 3GNTA 4IH4A 4ND7A 3IAAA 1M54A 2IYSA 1U2QA 4M1MA 1IMJA 3WZLA 1E6MA 4DLSA 1UK6A 2PYZA 3KT3A 4CM1A 4CQJA 4HDAA 1JKIA 4GI5A 2YOFA 4IV5A 5SZHB 2H7CA 4A4DA 2JAPA 3CNEA 5HCIA 4C9BA 5ED4A 1WDTA 4YO8A 1TNDA 2BT4A 2P2ZA 1XLVA 4DEYA 2VCYA 2ZTUA 3FOCA 3R3SA 4UZEA 4YXWA 1XU4A 4TQAA 5FKJA 4GKJB 4EG5A 4ENWA 3O26A 4PWYA 1B6SA 3L0SA 3OCXA 1A50B 3DB1A 2CB0A 2EFDB 2VA8A 1XKQA 1NLUA 1TL7C 2X77A 2YQZA 3FX2A 3G1TA 4WZZA 2OXIA 4HAZA 5DXFA 3M4NA 4UHDA 4CEJB 3GAMA 1SBZA 3IKMB 2OAGA 3K92A 5L40A 3I9OA 4W7SA 1HSOA 1G8FA 4PCLA 5AM0A 1KO1A 3RVRA 2O20A 1ZLYA 3GDWA 3WHKA 4YDRA 2MR5A 3OLCX 2EQ5A 3QENA 3VO2A 3EDOA 1Z7EA 2NPOA 3BRSA 3D7MA 1MIOB 2AMFA 4D3XA 3HA3A 4QAQA 3RYFB 3JVDA 2R8RA 4RD4A 5AVOA 1NYLA 2YNMC 2G9RA 2JEZA 4QOFA 4MPJA 3PWTA 1KDZA 2OV2A 3ORRA 1MAHA 2XYQA 3FDZA 3MGCA 3O75A 4JEUA 3ZXUB 1MHTA 4QPCA 3TE6A 3GUHA 1EUDB 5AJWA 4ZC1A 1UODA 1TIBA 5DFAA 2VDWA 2JL1A 4DCJA 4NBRA 4FNMA 1EGVB 1PYOA 4Z3KA 2EL7A 2VJYA 2DHCA 3QLJA 4FX5A 3T7TA 1EE9A 2C8LA 1KI1A 3O8QA 1R10A 4DB2A 4DV5B 2ECPA 4FYYA 1IB0A 3ACCA 4A6DA 2PMFA 1FQKA 2W6OA 1SCIA 4KQKA 3K09A 2Y1LA 3HJNA 5FI5A 4MSUA 4BU1A 2IA5A 1DRJA 4C06A 2YKGA 1ZLXA 4MS3B 1B42A 3K0AA 3KOUA 3N58A 4UVIA 4RY0A 5CLJA 1H2RS 1JJFA 5CLIA 4QM7A 4WXPA 3TJRA 5JD3A 2RH5A 3GA0A 3EZ6A 4IRUB 4QJBA 2XKKA 1R27A 3U3ZA 4QATA 1YRAA 2C9CA 5KSOA 3QU4A 1A2OA 1DRWA 1XEWY 5T67A 2NYUA 2G88A 1UFVA 1E7QA 1JHZA 1Q7RA 2OHJA 4TT8A 2QMEA 3EGXA 4YQFA 3I73A 1WZUA 2EZ4A 1Q2UA 1PZGA 1T8WA 2GM5A 2VQ6A 1B43A 2JD1A 2M6SA 1UMCA 3GU3A 2R96A 4N3NA 1J90A 4U6NA 4D9KA 1RHRA 3KG2A 3V34A 4KEAA 1PJBA 1UT6A 1RACA 3V2IA 3W1EA 1R6TA 2Q3JA 2RD2A 5HFJA 2AFIB 4LCBA 3GLSA 1E8MA 1Q2XA 3C6XA 4AMUA 1M7BA 1MC8A 3OHMA 1U0EA 4OI4A 1Q44A 3GZNA 1CRZA 1XTJA 5AM1A 5EC8A 2QVGA 1BEUB 1XYVA 2D8AA 2GGSA 1XRSB 2Q2WA 4KSYA 4J1NA 1RWVA 4P54A 3RKRA 3E7PA 2BGJA 4BWFB 5BV1A 2QMZA 3U1BA 4RTSA 2JFWA 2ZREA 5JQGA 2FPGB 2GJKA 1N2CB 1AKMA 2YUTA 3U26A 1ATZA 1XZAA 2OV4A 3L1KA 2VKQA 3GRYA 5HIMA 2YJ5A 2H4ZA 4CT0A 1JT2A 3L0BA 3DDZX 1NKTA 1QIJA 4RYDA 3SDZA 3L0CA 1OFUA 1XTUA 2XVYA 1T9ZA 4NP6A 2FWPA 3GVCA 1XHLA 3KB1A 1H2WA 2JJ2D 1QGYA 3WE7A 4F3NA 3U49A 2B92A 2FAXA 4MGKR 1UQTA 4J1QA 2IZ5A 4JGIA 4ND4A 5IC4A 3FVWA 5JCZA 3LFHA 1WWKA 2B30A 1XEXA 1H5QA 2QLTA 4OKIA 5COBA 4WNAA 4EHFA 5FWYA 5I7HA 4L22A 5CJPA 1WDMA 3RASA 3OT1B 4Y1FA 1YKGA 4ENTA 5ITSA 2COKA 1RYHA 4OUDA 5DYYA 3DOUA 3QNUA 2PKQO 3GMSA 4HPJB 2IH4A 2ZJOA 4NXMB 3UV3A 2GJ8A 4L8YA 1L5MA 5H4HA 2Z2JA 1NW3A 3QHPA 1SG6A 1EIWA 2P27A 1NX9A 4CGZA 1I5EA 3RC7A 2XEXA 4GP6A 3TW6A 1NBME 1J20A 3W7AA 3NRCA 2AV6A 3QXCA 4YJ2A 4LJ4A 3IVXA 4HOYA 1KRWA 4LF6B 2QR3A 3V97A 1ONBA 2Z9DA 5HFAA 2YMPA 1S8AA 4EZEA 3IP8A 4JXJA 4EZIA 2OMKA 2ODWA 1TECE 5EESA 4WK6A 1L8LA 1T91A 1WMSA 1I4EB 1G5TA 5IVDA 4WBNF 3PQEA 4HH4A 4BV8A 1B8PA 3HKCB 2XNDA 4M7RA 1TYDE 2B8WA 2PSSA 2WJ4A 2R00A 2WJZB 1I3CA 3L49A 3NCTA 1W85A 1EFPA 1TIKA 3DS8A 3PCTA 3HB4X 4V2UA 4AWXA 2ZSJA 3VR5D 3QFSA 4WACA 2CXHA 1CRLA 4R16A 1Z2OX 5J40A 4K9RA 3UZUA 4AMBA 4BZQA 4XUDA 4PFSA 1QG2A 2ORED 1SKMA 2JAUA 4GMHA 4KAFA 4LWZA 1BQ4A 4C0LA 1L7EA 2FI1A 5DTEA 1KTIA 4BQIA 2R68A 3T4UA 3MWYW 1KWKA 4URVR 3H1EA 4FS3A 3S5JA 2VWGA 1FFCA 2VHCA 3G2NA 3JQQA 2Q9UA 2NTNA 4N18A 2AXNA 3WQBA 1QDEA 1QE0A 3I9NA 5DHSA 2YN4A 1E98A 2FPPA 2YYAA 1A27A 1WQ3A 5AXAA 3OP1A 4RXTA 4HRAA 3JQ7B 2AC4A 3VOTA 1U8FO 3KT0A 4V0LA 4X66B 4Q16A 2XBMA 4KXXA 1M0EA 2H1RA 2ONCA 1WAMA 5KINB 5LQDA 3WLRA 5FB3A 2X0FA 4M98A 5AVZA 1BFUA 2P41A 4WNYA 4OX9B 3BMCA 4PQFA 4JB3A 1N3YA 2VXOA 4RJJA 3EAGA 1CZKA 1P73A 1UR5A 3KL2A 4L6IA 4P3XA 5T64A 1TQ2A 5TV2A 3UG7A 2D6FA 2Q7DA 3TVTA 1FZTA 4OQZA 1ZRSA 3V42A 1TAHA 2BZSA 2UVQA 2VAWA 4WBNB 2CSUA 2R6ZA 3MRVA 1D1SA 3QFFA 2VYQA 3HBNA 1O97D 2C2XA 4GZLA 2CXNA 4Q3KA 4L4XA 2J31A 4W5TA 4JLSA 1OLSA 3EPHA 1ND5A 4RDHA 5IP5A 1AMOA 4LVNA 4V1CB 3TRFA 1J7JA 2NIPA 4H4CA 3CNNA 1WXDA 4B74A 2I4LA 2WE7A 2XLCA 3CT6A 5AIBA 4CE6A 3QX3A 1YR3A 3BBPA 1JEAA 2VDVE 2G6BA 4BUCA 3HJHA 5CNIA 3VHXB 3D6VA 3ESQA 4RWEA 1A1SA 2Q8NA 2JIRA 1YB5A 2QE6A 4N82A 1OWNA 4Q39A 3LXRA 5KCZA 1Z0KA 1CR4A 2OFFA 4MI1A 3M1AA 1ZN7A 4R40A 4OAOA 4BUZA 1ZJ5A 1W0JA 1DCTA 3WYGA 1O95C 4MW7A 4BO2A 3PGJA 5ALZA 2OSBA 3ZQJA 5JS6A 1T10A 1UXHA 4DV2B 3ZD7A 3K15A 4FEAA 4DNFA 3G9ZA 5DTIA 3UJ9A 4X3CA 2FEKA 4Y9RA 2D2VA 1IM2A 3AYZB 4ZVKA 1M3SA 1AO3A 4F4DA 1RM4A 2JFQA 1MIHA 1BH6A 4EHIA 3IC5A 3W8EA 4Q9HA 4ADSG 1GARA 5BPFA 5IMBA 1UOOA 2AXQA 2GWHA 3EXEA 3H7AA 4HGNA 4WNCA 1KSJA 4DLYA 4YB8A 4URHA 4CLEA 3U4DA 3K30A 2BFBA 3ESRA 3RGWS 3UUFA 2PAFA 2YVUA 2VP6A 3OCJA 4GMXA 4XDYA 3ROZA 1W9MA 5BR1A 3MLAA 4WERA 4F04A 1XZKA 3LQQA 3E05A 3A4VA 4AFNA 4H6PA 5JUWA 1DDIA 1FK8A 3B48A 1MX5A 3AONB 5ICEA 2WT8A 4Q9IA 3TQHA 1YI0A 2BN4A 3TOVA 1Q57A 3KRTA 3VKHA 2I62A 1CUZA 5KQSA 4E4RA 2XADA 3IJRA 4UDXX 3AYXB 1MD9A 1CC1S 1O97C 4NV0A 3SYTA 1ECLA 4JBIA 1H1LA 5GPBA 1OUMA 1C8BA 1R5OA 3N70A 1P0CA 1A9ZA 4J1TA 5F35A 3U3OA 3NORA 5BW4A 4DM4A 2HMVA 1QQ7A 4KN8A 1AQYA 2P6NA 1U2ZA 4HAYA 3FZNA 4MARA 2VTEA 4OQNA 1YULA 3PPVA 4AP9A 4BBPA 2GO1A 4RGVA 4KOAA 5CG1A 1VLLA 1Z12A 5KYUA 1O5TA 1WL8A 3GFQA 2QWXA 2VZ0A 3BE8A 2XYGA 2ZU6A 3ZQKA 1FRQA 1R0KA 3GJ7A 1IB6A 1PJTA 3GJTA 2DTDA 5CM2Z 2H63A 2R8XA 5JCOC 1NASA 2POCA 3IP9A 4ESVA 3VGPA 1D5WA 4AS1A 5GP1A 5HEKA 2YY7A 1C81A 1BDIA 1ZH6A 1R8JA 3SHTA 1LUAA 2YWHA 4X84A 2Y8EA 3VV2A 4EITA 3BPSA 3SQOA 4GWLA 4IJUA 4AICA 1A9SA 3MRXA 5BOVA 3SC2B 4EG0A 5K7SA 3O47A 4CMKA 1NJGA 1XD8A 2GM9A 3SN6A 2BSAA 3OT5A 1Y4DE 4CQLB 4AK9A 2CWDA 1SFRA 1ZDMA 5FXMA 4CXMA 2H29A 4UC0A 1M2OA 4XB6B 3STHA 5A62A 3IXMA 3OPNA 4HV4A 3A36A 1Z0JA 4XRGA 5CFMA 1L5FA 1PKXA 2ENWA 4GGPA 1Q91A 5KQPA 5KOHB 2NLOA 3AR7A 3FMVA 1VHQA 4R05A 5EJ9A 2JFZA 3SIXA 4TQGA 3ONEA 4CG3A 1YDEA 2CVZA 3VAAA 5DRYA 3AUAA 1B3BA 4OK3A 2XNDD 1P1KA 4TQ9A 3DQQA 3TLXA 2Z3WA 5AK6A 2Y4OA 4LE1A 4WMLA 1TIPA 2GHTA 4YCAA 3EZYA 3TSWA 1JTFA 1N7GA 5LOVF 3NX4A 2G0TA 1AKUA 1NZFA 4B4VA 4WKPA 5A6SA 4Q66C 3WB2A 5JJBA 1T8RA 3KLOA 4TMKA 3HCDA 1SA0B 4J29A 5BQPA 2RAFA 2VPYA 3U60B 2BMJA 2VHUA 1REQA 2YWBA 1G20E 4ES6A 4GBJA 2E5LB 2PX4A 2QZJA 3Q0TA 1FLVA 1XDWA 5G0WA 4KQ1A 1H5UA 5L3QB 4MW4A 2JLYA 2SECE 3A1WA 4O1IA 4O4JA 2V4UA 3P8ZA 2GTHA 2AVDA 2RI0A 2H0RA 1IXRC 4MRPA 3I6BA 4WUVA 1Y6FA 2DBYA 2OB2A 1KO5A 2A0FA 3A14A 1IXZA 2AGVA 2ONZA 1MUUA 1JHMA 3IPXA 3MGKA 3EFEA 3ZWAA 4MRMA 1EDOA 4P3OA 1WHTA 4BPBA 2DECA 2RHJA 1MEJA 3E03A 5LSAA 5MGNA 3GLHA 2FMKA 1W1IA 3L8MA 2UU9B 1PT8A 2OGSA 3RU3A 3ER9A 4DXAA 2ZS8A 3CW9A 2Q62A 2X58A 2CVFA 4PG5A 3STTA 5B7NA 4LFBB 2B2NA 3PB3A 3BA1A 2EZ8A 1T3LA 2KHZA 2IPNA 1UJ4A 1E1NA 5EIFA 4YCDA 1SO8A 3OX1A 3BT7A 2ERYA 2PLFA 3SS7X 1BKYA 1U0NA 1WE2A 3NANA 4J0FA 3W8FA 4DWJA 1XQXA 5BP7A 1HE8B 1CJVC 3L7BA 3O1LA 1IPEA 4TS4A 1JIVA 4ZICA 1RPNA 2OBYA 5CLQA 1KNQA 3PGMA 2DQKA 4GSLA 4Z8YA 4D80A 4HNVA 3ZWPA 3PFIA 4WE3A 2WTBA 4QKQA 1NV8A 4ZN6A 4XAQA 2RKWA 3JVIA 3ETNA 4MJ3A 2H9IA 4HVTA 2JJMA 1PBTA 3FDJA 4ZFNA 5LOVB 5GIPE 1XALA 2R7KA 4MB0A 4EKEA 4XE5A 2W11A 1DMSA 3ZYZA 4RU1A 4M1ZA 3NAMA 4BQSA 5DW0A 1XRMA 1UZMA 2GRJA 4YECA 3BH0A 4F9GA 1C2YA 1ZGCA 5D1NA 3GLGB 1ZOPA 2I4OA 3P4UA 4IDQA 5G1OA 3R7FA 3VQTA 3LUPA 5J1TB 3EFBA 2NW6A 2ASEA 5B2FA 1UJ6A 4ZKDA 2HJWA 1NQVA 3OJLA 2PLNA 3CPJB 2IHTA 2QM8A 5JASA 1NXWA 1TYAE 1SHZA 2GTPA 3CKKA 4RNCA 5AXDA 4CIXA 1GPJA 3PA6A 3V1LA 4E08A 1YJBA 2WK1A 3MJDA 2GZDA 3NUGA 2R3SA 2HQRA 1ZMBA 3TOZA 3V3TA 3LIPA 1Y8CA 1ATIA 1KSHA 1Y7IA 1ZGAA 4K6HA 3DEIA 1MG5A 3FLEA 3K1AB 3WS7A 1CDZA 3ZX4A 3LXXA 3ONDA 4GL4A 1DEKA 1NF2A 1VMDA 1NPDA 1XXHE 1XZFA 3FNQA 3Q4GA 3WRVA 1XK6A 5EE5B 2G3YA 2PGOA 4HZIA 4Z99A 1SCKA 4LE0A 2ZT8A 1EXNA 4D4IA 2ORYA 2GD0A 1PLLA 2RGUA 5B2EA 1VJRA 4PPFA 3LCRA 4Z5XA 3ZG6A 1DT5A 5J2UA 3IHLA 4IMJB 4HWRA 5AJYA 3KWJA 4WAUA 4H7EA 2VZ8A 2G5GX 1XE3A 2RH9B 3A10A 3PDUA 2JZCA 1L3BA 1M8KA 2X3YA 4WZ6A 4K0KB 5G0SA 2M6LA 4H7PA 4YRKA 2JGKA 3PT9A 3RTEA 4B3HA 1U3FA 4K7JA 3NM5A 1K8YB 3DE7X 4PAOA 2B9EA 1P72A 4M54A 4TYQA 1H8EA 1R4NB 2HSJA 3F2VA 2XW6A 3I9FA 3VPXA 5TJHA 1E66A 2HHAA 3OECA 1WQ1R 3EUFA 4R1OA 2K7FA 5J2TA 2IYZA 3GW8A 3VJKA 2W2TA 3KK0A 2EYUA 3L92A 2BKEA 2WP0A 4RHCA 4S3MA 1N34B 2ZSEA 3PXXA 1NURA 4RLFA 1GXSB 5CPFA 3UFXA 2HBQA 1PFWA 2GMWA 4J03A 4OLFA 4UTPA 2HFJA 4MUXA 4C01A 3PX2A 2F8TA 3ORHA 4AKTA 1P5JA 3RSHA 1VSVA 3ZLBA 3EUAA 3QIVA 2Z2YA 1EWTA 1QHNA 2O23A 4P58A 1CZUA 3ZDQA 5MDHA 4MLCA 1XIVA 2AXEA 4XSHA 2BBSA 4E13A 4C0BA 1U31A 1W5AA 2F1OA 2JLSA 4TVOA 3PKZA 3QX9A 3AETB 1SVOA 1IEQA 1W2WB 1PTKA 1ZIXA 3GOQA 2I5PO 4W9MC 5L8VA 1WMFA 2FQWA 4O4HA 5TT0A 3KZKA 2R2AA 3H5WA 4RHXA 1UMBA 4AO6A 1KWGA 1UPFA 4K5QA 4LVUA 1N1EA 1R4MA 2DF8A 1C3EA 3CB2A 3KJZA 3A26A 3B78A 5CH5A 2FCRA 1ZUD1 4U4AA 5AUOB 1I4WA 5EXSA 1DTEA 2OGWA 4C1BA 3ABSB 4DMKA 2RHOA 1H4SA 3RBXA 4HZGA 1NUAA 5EKDA 1L3IA 5HILA 2SKCA 1CZRA 4XH9B 4X6UA 5EZYF 2CKDA 2A9VA 4L9SA 1M73E 3OX2A 4L3WA 5IYZF 1W75A 4LOIA 4OYLA 4CL2A 3CYFA 4LRWA 1L4KA 3FLMA 4NBUA 4QLBA 2X2FA 1XNJA 3LGAA 3PIRA 2O1SA 2HA2A 1GGNA 3KU1A 2V8BA 5EPOA 4KW7A 3KDSE 4NEQA 1RRVA 1FYWA 1O5OA 5GJWC 4DZTA 5LPNA 3C1UA 3TD2A 1K5HA 1PAUA 2RHBA 3QHQA 4C1NA 1B0PA 2E2WA 2FPRA 1S1MA 3KYBA 1OXUA 3WNVA 1L6RA 1RKBA 1S7CA 4B3IA 1VZ3A 2EJBA 2X6RA 4WLVA 3CVUA 3TMAA 4IJKA 1D4OA 4OKSA 5LWQA 4NECA 2EX0A 2OSVA 5E7MA 3W04A 8GPBA 3H0EA 5DBFA 4G9EA 3CUTA 2ZBUA 2FH5B 4JUDX 4WK0B 4FR2A 4AMGA 5A3JA 4ISCA 3SMVA 1O96B 3ASZA 2V7GA 3KHKA 5EXPA 1MZPA 2A8YA 4PYOA 1KFBB 4HX5A 3HU2A 5HIJA 1HMPA 2BEUA 4IJ5A 5ALMA 3DCIA 3E8XA 1BH2A 1IJKA 2CFCA 2RHDA 5IVKA 3QQ5A 3RFCA 1RXCA 3L84A 4XFDA 4GG1A 4R1UA 4WCVA 4Z0HO 5AUNB 1KMHB 4LZZA 4WTOA 4RAOA 2W2KB 3FPLA 4N7MA 2OYSA 3NFYA 4KPYA 1E1DA 3VVCA 2FLWA 4AW9A 3AW9A 3G0IA 1Y7TA 4V3CA 4QL3A 3ZOZA 4B2IA 1DBIA 4RLSA 1OLXA 4HGRA 5EZYB 1DX4A 5BNFA 4LYYA 3QKRA 2DPLA 4MR9A 2LBPA 4DC9A 5IYZB 1NXVA 2LCIA 2R7NA 3OTWA 2G5PA 1RDFA 4RSRA 1AS0A 4P4NA 2NZWA 3EG9A 2G36A 4IKPA 4MV1A 4TKLA 2X3UA 3DE5X 1UBJS 5C5DA 2AX4A 5MFPA 1P9WA 1EFUA 4IQ4A 1OWMA 1X1CA 4B2YA 3D54D 2C5EA 3T5PA 2DR2A 3GGGA 5FDFA 2H57A 1P1IA 5FFNA 3C7KA 1N6RA 4POAA 4RADA 4BLTA 3PX3A 4LS3A 2WW8A 4NFYA 3IOYA 3RT1A 4CIBA 3GELA 4FSXA 4LZWA 3SBOA 1F8XA 1P2FA 4EG4A 5A6VA 1JIUA 1SD1A 1D2GA 1JA0A 3A2KA 2J8ZA 3I6YA 4DLRA 3NATA 1DKUA 3CRRA 4BEVA 5ITVA 3CF6R 1OBFO 1MB4A 2J5RA 3IDZA 2GOYA 1LX6A 2YQ4A 2ZULA 5IDQA 3EZ7A 2NPFA 4AUEA 1Y82A 3ZU3A 2ZSAA 4JL6A 3ZDFA 1KL7A 3BXHA 4YJDA 2JHGA 3BE4A 3ILHA 3M49A 4P3KA 1UPTA 1T6NA 2WWWA 1JJVA 3ZU2A 2Y0PA 2CB9A 2DHQA 4F21A 1NDHA 2RC6A 4JT2A 1NNEA 1JALA 2JJ1A 2LCFA 2C5BA 2KJQA 1CZOA 2BRUA 1QH8A 1O57A 1LPBB 1NJ1A 2J3KA 3PIDA 3S68A 3ZHQA 3F9CA 3M7IA 4JOSA 1JSZA 4JWKA 3BWYA 2CEAA 2SKEA 2DFDA 4LXHA 5KVSA 1E64A 4GR4A 4M0FA 4UHJA 1UPUA 2W37A 4TRNA 4GE0A 3IKLA 1RC1A 5HRCA 1B0UA 3E48A 3OJWA 1WUTA 1ADJA 3P52A 2FZ5A 3GT0A 2BKXA 2G0NA 3NO4A 5DCWA 2VJPA 4P4SB 2FFAA 3TI9A 2R66A 2UKDA 3DB2A 1RM5A 3FTPA 4NOJA 1MEEA 5IC6A 4XD7A 3VHQA 3UICA 3ZV3A 2WYHA 2FQYA 2DUWA 4R0NA 1FPMA 1TLFA 3EW7A 4BNDB 4EI2A 4JEMA 4MS4B 2DG2A 2GCPA 4TTQA 2IUFA 3O21A 4XEHA 1HEIA 5CYPA 4F11A 1PGQA 1QANA 1A97A 4KITB 1FU8A 1L8AA 4QXRA 4Z53A 3HGQA 2ZE6A 5EEHA 3H6KA 3K1ZA 5DNUA 4DIKA 2HDOA 1BA3A 5DMHA 1PQ4A 3UMYA 1A4RA 2NU8A 3K7EA 1VKRA 1JIXA 5IJ9A 2GO7A 2OZEA 4YJ3F 5B64A 1Z68A 4KO8A 4NAUA 4NESA 2QTRA 5TQ2B 1ZVQA 2WIKA 4QG7A 4DSTA 4MHSA 1N5KA 1YAJA 2VF8A 2O8NA 5BSEA 4OP2A 1KYTA 3NW9A 4EMTA 1TCCA 3AR2A 3GO4A 2BGIA 4MUFA 2PT9A 3OX4A 3I04M 2VRCD 3KR0A 4JT4A 3L8FA 1TUEA 4OHFA 4LDNA 3WLJA 1WXHA 4AS2A 4QT0A 2QAJA 3BSWA 5KAPA 2WA1A 4I9NA 2PS0A 1MJHA 2B1JA 3R0ZA 2I80A 1QC5B 3IQDB 3AF3A 4AWBA 3ZJ5A 1Z6TA 4AB1A 1ODIA 1LK0A 2IYWA 5IKPA 4CKEB 3DTTA 1TO6A 3IB3A 4X64B 1YZGA 2D8MA 1Z6GA 3GT3A 4JKIA 2H5JA 1QMPA 1USVA 3TDMA