3X1XA

Ras-related protein rap1b with gppnhp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
166
Chain Sequence
b'MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1b
publication title The structure and conformational switching of Rap1B
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 59
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x1xA00
1GOTA 3VR4A 5CDFA 1W5TA 1E9SA 2VIIA 1AKYA 3IO3A 3HU1A 4TL9A 3WMFA 4PPFA 3U44B 4PHGA 1H8HA 2HT6A 4MKGA 4Q7LA 1UADA 2B7CA 2G77B 2WM9B 3ND9A 4LBZA 5D3QA 2WTUA 3T1VA 1Z0FA 2P2LA 3ECCA 4P31A 3U61B 4CVNA 2DCUA 1IN6A 4TSFD 2ONKA 1SKYE 2NOAA 3HWSA 3DKPA 4I1UA 2IW3A 4MGIR 1G4AE 5B2ZA 1G7SA 2VF8A 2G0NA 2VF7A 2HLDA 3HDTA 4PC6A 4TLBA 4XOIA 1E9AA 2GEDA 4V0LA 2UVQA 3U4QB 1I2MA 2ZUCA 1IN8A 4ZO4A 3NG1A 1TQ4A 3A37A 1IM2A 2RKOA 3NC0C 2FEMA 4DRZA 2ZRJA 2A5GA 2P65A 2HCBA 1OFUX 3ZGXA 4H1UA 1RRGA 4L5BA 4RD0A 2PJRA 3Q5EA 5L3QB 2QMHA 1MO3A 2GF9A 4IHQA 1U0HC 3CF0A 1N5JA 3DPUA 3W5JA 1Z0JA 3CRRA 1ZNXA 4TLDA 4KVGA 2CL7X 4OI4A 4JYBA 1N0WA 4TMZA 5JZVA 3OAAD 1G21E 2J7KA 2VYFA 3HJNA 3OHMA 3Q85A 3VR2A 5KDLA 2CBZA 3PEVA 3ZJYA 4EAQA 4ZCIA 3SJCA 3WBJA 2XITA 1II8A 1GKIA 1O3YA 521PA 1BYUA 1RPZA 1JBKA 2QAJA 2F1IA 2DB3A 1Z0KA 2QG6A 3X1WA 4MA4A 1I4LD 2O52A 5CYOA 2W58A 4TTQA 2GK7A 1JAIA 2QTFA 4Z8XA 1UAAA 1DVRA 2GBLA 1XDBA 2F9MA 2P5SA 3KTAB 4Q1AA 3PEYA 1G19A 1RYHA 2D74A 3GEEA 1S9DA 2WZQA 1CKEA 3OIYA 4I81A 3EASA 4BLTA 4F4CA 1VTKA 1S9HA 4IVPA 4KI0A 4F4IA 2ZUBA 1WA5A 1YE8A 2F7SA 2H57A 3DEFA 1G6HA 1M1YE 4BPBA 3PUWA 4O0MA 3I1FA 4PO1A 3C15C 2ZETA 2AWOA 2ZRAA 2A5JA 1XCPA 2WHXA 4Q4LA 1KGDA 1XTKA 3FWYA 3RABA 1KKMA 1QHIA 5HZKA 4RZ3A 2KE5A 2ORIA 4ZIRA 1CIPA 3CR7A 3QKSA 3EIQA 1WCV1 2LWIA 3NXSA 3RS7A 5BN4A 3AVOA 1W0JD 2OO7A 1TTTA 2QAGC 4LJAA 3PUVA 5TMPA 1Z8FA 1AK2A 1GDDA 1XXHA 4AG6A 4UJ3A 2QUZA 4LHWA 1ODFA 5FPTA 4DZZA 3G5UA 5FTKA 1UPTA 1Z6YA 1VG8A 3DKVA 1NI3A 4DCUA 3KL4A 5DI3B 3CPHA 4AURA 1GUAA 3KFXA 4V0MA 3ZZTA 2VSOA 1UBGA 3OEEA 4WA7A 2QPAA 2BBTA 3MMPA 2ECKA 3OEHD 3QQ5A 3W6NA 5AUPB 4GP6A 2WBLC 4GNKA 3S1AA 5EJEA 3U3KA 4GT1A 1D6JA 5C1BA 2CL0X 4LSGA 3HYTA 1KI4A 5J5CA 1CRPA 2ZXUA 3A6PC 2OFOA 2PEZA 3Q7QA 3EZFA 5D3MA 4JBXA 5FBVB 4LYHA 2O8DB 4FCVA 4EJSA 1R10A 4KVAA 4QGAA 2C5LA 3AGQA 3WP1B 4Q48A 1YZKA 4MYCA 2WKPA 1Q1EA 4DHEA 1OYYA 2FNAA 2J5XA 2IXEA 3WYAA 2FSHA 4XJXA 2AD5A 1W36C 3ZS8A 4OHYA 4PPQA 1CR0A 3K53A 4XTRA 3WHKA 4U7DA 1W7AA 4FD2A 3NVAA 1ZIPA 2REOA 1P2VA 1ZJ6A 2HXSA 1IBRA 4F93B 2ZYVX 3THWB 3GLIB 4GZMA 4TLAA 2QQEA 4JLJA 5GVRA 1IN4A 4TL8A 721PA 4HAVA 2JJ8A 4RZUA 2IUUA 1E2PA 1LV7A 1IAQA 4WW0A 4PQFA 2CHQA 2YINC 3RVBA 5IRCD 1GIAA 4RSGA 3QBTA 2IUTA 1GNQA 4P3YA 1FUUA 4LYJA 1T3HA 2V6JA 5KSOA 1VYVA 1N6HA 1JR3D 2H8KA 5CJ2A 5EXXA 3W34A 5CIQA 4RKFA 3KJIA 4P4SB 3AUYA 1VYUA 2BMJA 2ZSFA 2QPOA 3AB3A 5LPNA 4QNRA 5C46F 1BMFA 4K81B 3ND8A 3SBDA 2CNWD 1TUEA 3ZVMA 4AKIA 5JI3E 3IIJA 3OE7A 3OZXA 3E70C 4AWXA 2O5VA 4DCTA 2FWRA 4MITA 3TQFA 2HEIA 3FMOB 1Q57A 4ESHA 3NEYA 1YZUA 2GXUA 2YWFA 1DOAA 1EFHA 2B7BA 4KLZA 2SHKA 4US1R 3SE0A 2X2FA 2FZ4A 3MRSA 4ITRC 4V0KA 3SS8A 3ZH9B 1W36B 5GADl 1BYIA 4CDGA 1ELOA 1OV4A 4EFNA 4B34A 1N6RA 1AA9A 1N6NA 4UJ5A 3SJZA 3KJGA 5CITA 4TT3D 2OT3B 4PZYA 1XEWX 2J87A 1OXUA 1GFIA 2BEJA 3EA5A 2PZEA 3R7WB 3A4MA 4N3NA 5LBIA 1BOFA 4XWOA 1XTJA 4C0KA 2IYZA 2GEVA 5JBQA 3AVYA 3TQCA 5J4LA 1E79D 4DUGD 5E95A 3BORA 3UKDA 4DDUA 2GJAA 2OILA 3C14C 1JPNA 5C4GB 4PAQA 5K8IA 1QBKC 5J4VA 2ZAOA 3O8CA 4E09A 1K6MA 1FP7A 4D4KA 1P2TA 1JJ7A 4R9UC 3CX6A 2FV8A 1E1QA 1W46A 2OSBA 2C9OA 2YC4C 3QI2A 4E03A 4YMSA 4LWZA 1JI0A 4FWIB 1EFRA 1L4YA 4WOPA 3THXA 2XJ9A 2OBMA 1S2MA 2G83A 4LBVA 4L8GA 4NP6A 4R2HA 3FHCB 3TW4A 1EFCA 2EU8A 3DL0A 4XWAA 5FBQB 3B85A 5HR5A 1AIPA 1KSFX 3CWZA 2GVZC 3R8CA 2O8BA 2P5TB 1KAGA 1Z47A 2VRWA 2FG5A 4RVCA 5FL7D 1TF7A 3R9IA 2A9KA 4A8JB 1K5DA 1Z3IX 2QENA 3QVUA 1GNPA 4DLSA 3CUEF 5E3HA 2DBYA 1AS2A 2GCOB 3DOFA 3SOPA 4KSBA 4I4LA 1OJLA 1GG2A 2OEPA 1EGAA 1KO8A 2K5UA 4RD6A 5TB5A 3I3SR 1DS6A 4BLPA 1A4RA 1G3MA 1CJTC 1XTQA 2JLRA 2Z83A 1TX4B 2FSFA 1U98A 3LY5A 1MO5A 5FPSA 2GXAA 4U02A 1JR6A 4CF7A 1V43A 1WBBA 1VIAA 5JCZA 2IYXA 2BMEA 1G1MA 1NP6A 5GJCA 2QMEA 4ON9A 3HU3A 5KU1A 1AS3A 4C2TA 4OBEA 3GJ3A 2V7QD 4WXPA 5TVKA 4B73A 3B5JA 3B2EA 4QGHA 1KK1A 2WWXA 3W6PA 5JRJA 2AKYA 4CGZA 2ZR9A 2DR3A 2Z4SA 3GLHA 3PITA 4HYYA 1PV4A 1P5ZB 1A2KC 4A82A 1NSFA 3UG7A 5BYJA 1Z6GA 5CJPA 1GZSA 3AF1A 4AC9A 4B2IA 2ZE8A 2LKCA 1MO4A 2ZS7A 3F8TA 2PT7A 4B75A 1E94E 1FP6A 2IA5A 2EWWA 3QVVA 4B43A 1QVRA 1T5IA 2CJWA 2I4IA 2XGJA 3PEWA 1Q3TA 1XEXA 3BGWA 4JL6A 2E1RA 4QJ5A 3OFND 4D2IA 4X8HA 1XD2B 3CPJB 4WIAA 1EX7A 3T1TA 2BMDA 3U5ZB 3KKOA 5L3SB 2ZRLA 1NN1A 3D3QA 3DMDA 1RIFA 2JJ1D 3BD9A 4EPRA 2O8FA 1OKKA 3C16C 3DVLA 4BZPA 3ZQ6A 3DM5A 5FH9A 2OCYC 1E96A 5EZ6B 5KNBA 3ADDA 1U81A 3U2QA 1QVAA 2RGBA 4M21A 3CBQA 3H0KA 4B3CA 5JWRA 1T6NA 1LTQA 1RJ9A 3A1TA 2R6AA 1TEVA 1C9KA 4QRHA 3W8RA 1DO0A 4DDVA 2RGXA 4KO8A 1YJ5A 3HR7A 2X1VA 4CW7A 4BFWA 2PCLA 1NLFA 2ZAMA 4F38A 4Z1MD 4QHYA 4HDCA 4NMMA 4HB2A 4BLSA 1HY3A 4LC1A 421PA 1ZCBA 2C99A 3BOSA 2ZSAA 1TAGA 2IYQA 2C96A 3OIUA 2OCAA 2NG1A 2WIAA 4Y0AA 5GJVC 2YWHA 4TMKA 3GFOA 1NBMA 2WSSA 5GVSA 4UNRA 1TL7C 2ZSEA 4BUJA 5BXQC 1OH5A 2NQ2C 3EXAA 4EQ6A 2W6JA 5FUWA 3U6BA 4H1VA 3EX7C 4WVFA 1ESNA 1N2CE 1S3GA 2VHCA 1XD9A 3GEHA 1S4QA 3AVPA 3OESA 4IOJA 3BFXA 1GL9B 3I92A 1WMSA 1E2MA 3E2IA 2QP3A 2BDTA 1NVXQ 1G7TA 3AEZA 1WQ1R 4BEBA 1ZU5A 1IY1A 3QOFA 1Z6XA 2ZI5A 4B6EA 1ZNZA 3KKPA 3T35A 5L3VA 4QC2A 3MJHA 5EXPA 3M1IA 4GBMA 5CDFE 3B1VA 3WY9A 3OIVA 1H8HD 2G1JA 3E1SA 3SFZA 2HYDA 1Z0AA 2NPIA 4DEYA 3F5FA 3ZD6A 2WJVA 3LQRA 1XCGB 4JIMA 4TYPA 4WZ6A 4US2R 4B2LA 4G5RA 2ZRHA 4YLGA 1X8JA 2PMKA 1ZUIA 2R44A 2GKSA 2ONJA 3ZIAA 2VA8A 3ZD7A 4LZZA 2J1LA 2OZEA 3THYA 2O8CB 1SXJA 4C0QC 1X86B 1LF0A 1LS1A 3BJIC 4OK6A 5FPKA 2HLDD 2ZYUX 3UPUA 2DWOA 3IHLA 4PPNA 5K8UA 1HUQA 2ATVA 2CEAA 5DHAA 1W4BA 1E4YA 2XB4A 2IBMA 4D26A 3LO5A 5E7IA 3K0FB 1SKYB 5JCPA 2ZI7A 1KJZA 3KX2A 4ESVA 1OB2A 4C7OA 4Z51A 3B78A 1G3QA 3QNUA 2VH5R 4DLUA 1NY5A 3ETLA 3LNCA 4PC3A 3QXCA 2C9YA 3FDIA 1JEEA 1OPXA 3GLFE 2W2VA 4LDJA 1KO7A 4QKQA 2VP5A 2QL6A 2BCGY 2VTKA 4LJ8A 4LX0A 2X2EA 2R6FA 2ZROA 3SEAA 4HB4A 4QBGB 4TLEA 2C8VA 4L4UA 1KK3A 4D25A 4Q4HB 1IHUA 2ZJ8A 3H1TA 5CM9C 4G5QA 1P75A 2XZPA 3V4RA 2RGDA 3KB1A 4QFMA 3NDPA 4P4UA 4DDTA 3OF5A 2ZR0A 5EE3A 5JLJA 3FTQA 2GF0A 2LKDA 1J8MF 2VP9A 3M4YA 4PXAA 4B3DA 1DAEA 3NDBB 4X8LA 4B3BA 1UKZA 1R7RA 1E2NA 4A9AA 2C98A 3FHOA 3W90A 1P72A 2AD1A 2KJQA 1G64A 2ZREA 1D5CA 4Z54A 4FMDF 1Z83A 4UXHA 2WIBA 1W0KA 2XNDA 2YHSA 4DDWA 4GPTA 4JLOA 2GDJA 3EIHA 1KOFA 3CW2A 5FTJA 2F3RA 3PR1A 3KJEA 2ANCA 3GJXC 2XSZD 1EFUA 2BBOA 2R65A 4LK2A 5FFMA 1PVOA 1FX0B 1TUIA 1E2EA 1R5NA 2IEZA 2CVHA 3JZMA 1R0ZA 5J4KA 5KYKA 5F3WB 2ZM5A 3N2EA 4DSTA 4GFDA 5AUQA 3AVXA 4RZXA 2Z0MA 1E0JA 3A8TA 4KU4A 1YRAA 1XXHE 4XVRA 3H84A 3C8UA 1XJ0A 1TU4A 1UEIA 1OFTA 5AK0A 4BEJA 4DLWA 4JLAA 1KDRA 1VECA 1AN0A 2WVJA 1L2TA 1ZRHA 1F6BA 1E3MA 3BB4A 4QGGA 2GZAA 1TNDA 1HTWA 5DN6A 2XEXA 5EP2A 4NYJQ 2PBRA 4V0ME 5TDHA 2C03A 2H18A 3ADKA 4L9WA 3P20A 4J0QA 3KKNA 3WNBA 4EPYA 1G41A 2OAP1 3K70C 1A5TA 1E0KA 1U90A 5FOSA 2W2XA 1F48A 2BEKA 2QMUA 2AHOA 2IWRA 2O0KA 2Z43A 4BLQA 1OYWA 3GCGA 4IOLA 1RRFA 1HQCA 2BIFA 2ZRIA 3TW8B 4JSTA 3RNLA 1N25A 2QT1A 4PSVA 4IXMA 2EYUA 3Q8XB 4Q01A 4HB0A 4Q7KA 2QE7A 2FPLA 2RCNA 4KXFB 4PZLA 5CLLA 1VCIA 1YR6A 4B32A 4JKIA 4BFXA 1BO6A 1RE0A 4ZI2A 1QRAA 2GCPA 4JKYA 1S8FA 1SQ5A 3CNOA 3IUYA 1U9IC 2J7PA 1KI8A 4F7WA 3O8BA 4BFZA 3DZ8A 3I73A 1VDZA 2Q3MA 4MUBA 4DSNA 4NYMQ 3RWMB 2HV8A 4L15A 2KSQA 4CEJB 4N0EA 3H2YA 2CLSA 1TQDA 2ODWA 4FI3C 1E2FA 1P7CA 3ZZUA 2VL7A 3FKSA 3RWOA 5KPDA 1KY3A 4W7SA 3LA6A 1KI9A 4QG7A 5JRZA 1MOZA 4HI0E 3UWKA 4OHZA 4ARZB 4HAUA 3D7MA 1G17A 2CLDX 5A0FA 2DY1A 4XWKA 2IX3A 3K70B 3EZ2A 4ACBA 5CM8B 5BWMA 1DPFA 1BMFD 3CB4A 2BBSA 2GZDA 4FMDB 3CH5A 2FE4A 3BK7A 5HCNA 3OE7D 1NLZA 1X8KA 3Q72A 1M34E 2XXAB 3R9WA 1KMHB 5HE8A 3UXMA 2WMNB 3X2SA 2VO1A 2CK3A 1G9XA 2IF0A 4GMXA 1N5KA 3THWA 2QAGA 3F0TA 2HF8A 3GLIA 3PEUA 2W6IA 4TTPA 4RFSB 4US0R 3FOZA 4NCJA 3LLUA 3R20A 1U2RA 5DO9A 3GEIA 3LLMA 1Z28A 3AKYA 1N6KA 4JL8A 2QBYB 4FINA 1NMZA 4S35A 4NPHA 2V1XA 2FFAA 3AQ4A 3VR5A 4PR0A 1II9A 4UNQA 4D80A 4A6PA 1KKLA 2GAAA 4IDQA 4KJZA 1Z29A 4BZXA 4CEIA 5H70A 4XIGS 1GL7A 3A36A 3MG9A 3QKUA 1PJRA 4AK9A 3LRPA 3QF4A 4LI0A 4R2IA 4ERNA 4P4SA 2ZJ2A 3EAQA 1R4AA 2CCGA 2GHIA 3VHXA 2QZ4A 2F43B 3W8NA 1P62B 3BB1A 1XMJA 3GFTA 2GETA 3HYRA 2D2FA 1AZTA 2ZIAA 4NYIR 3X1XA 3VX4A 4DCVA 3BB3A 3TGPA 3D8BA 3E5HA 1BIFA 3EIEA 3PUYA 3IO5A 2OE2A 3BE4A 1E1QD 5DI9A 1AQUA 1JNYA 1EFRD 4PQYA 3DHWC 5JEEA 4O3MA 3VX3A 3RSLA 4POAA 3U3OA 5F2EA 5FR2A 4BECA 3TLXA 1XBTA 1JALA 3GLFA 2BBWA 2PX0A 2QGNA 3DM9B 2ZJBA 3L0PA 1UKYA 5BQ5A 4BRUA 4TZ6A 2A5FA 2C78A 1XPUA 3LX8A 2CHGA 1HT2E 2P6UA 2RMKA 2CE7A 3ZVRA 3SJAA 1X6VA 1E2IA 4Q47A 5DISB 3T5GA 5TY0A 4YONB 4B35A 4C0LA 5A5GA 5HZHA 1F2TA 4F91B 1DAKA 1KZGB 1W2GA 3HPRA 3QENA 2O8EA 1CULC 3CF6R 3CF2A 4BE7B 4JBYA 4B3GA 5EXTA 2VHJA 4JLKA 5B58C 4BFVA 3GPLA 1CP2A 1NMYA 1TF5A 2FFBA 4R71A 3IEUA 1E9DA 4NTZA 2AK3A 1KHTA 4PHTA 4G5SA 1R8QA 4FMCB 2YWGA 4JL5A 1P60A 4LCBA 1N6OA 2F1JA 3I61A 3PJRA 4OHWA 1YZGA 4IVRA 2XZOA 1D9XA 3A1VA 1OIVA 2E87A 3I5XA 5LB4A 4OQFA 4ZDKA 1G3IA 2GTPA 3GLHE 2CXXA 3A1UA 2BKUA 1VHLA 3TH5A 1II0A 3KQNA 3I8XA 2R2AA 1P2SA 1XZPA 3T34A 4LV5B 3W5IA 4CEHA 2JLSA 4Q00A 4QL3A 2OLJA 2CMKA 3QJYA 5EZ5A 1HEIA 2V55B 1KI6A 1R2QA 1QHYA 4CYMA 4PHHA 2J0UB 2MMCA 3NH9A 3CNNA 2GXQA 5DHFA 4LGMA 5AUOB 4TL6A 4GL2A 1NF3A 3BS4A 1E9EA 3DMNA 1Z0IA 3LV8A 1ZNYA 1DAHA 1J2JA 1FL9A 2BVNA 1FZQA 2OUKA 2XTNA 5AJXA 3N5CA 1JQLB 1OIWA 1OKKD 4GOJA 3RS4A 2QSYA 5FI1B 1VCOA 2V54A 3GJ7A 3VU9B 4I99A 1VPLA 4MGYR 1OH7A 2CCKA 4OQXA 1TMKA 2CHVA 2ZU6A 4E07A 4AG5A 4TL7A 2J46A 2YVUA 1JECA 4GRAA 1LY1A 4M4SA 2C04A 3PVSA 3T61A 4JVNA 1L7VC 4TTRA 4XH9B 1M8PA 1ZMXA 4PFSA 3LW8A 2QM7A 2Q9AA 1CR1A 2H7VA 4QBFA 3LBIA 3K0AB 1DG3A 1JJVA 4GMDA 1T4GA 3DDCA 2PL3A 3GJ8A 3RANA 3BC1A 4PTLA 4S2EA 5EP3A 3N70A 4BGDA 1CR4A 2D7CA 1KSJA 3KQKA 3MLEA 4TN1A 4DLZA 3IQXA 3T5DA 1XD2A 4M0LA 3SJBA 5C18A 3DO6A 1E9BA 1NBME 1AGPA 1NBMD 3PG5A 5GJBA 3AH8A 2WSSD 4BFTA 3LAWA 3RRZA 3CIOA 2W6JD 4Q1BA 4EPWA 1TQ6A 2ZE5A 1NVUQ 2W83A 3L0OA 2DFLA 5G40A 5IK2A 4DCSA 2QNRA 2WJGA 3NTUA 2IEYA 5H8WA 4Q03A 1N5LA 1B0UA 2AX4A 1KO5A 4MKHA 5AWFC 1LVGA 5EE9A 3GLGB 3V9PA 3EARA 1QDEA 4ASUA 5DYIA 1FW6A 4XSGA 3D31A 1KZ7B 5HE9A 3TAUA 4PZZA 3FFBA 4M9SA 2Q3HA 3WYFA 3B9QA 4Q5IA 4DBLC 3AF3A 1G5RA 4BZQA 1F2UB 3TNFA 1SVSA 3L82B 1QHSA 1P9NA 4AKGA 3ZIAD 1QHHA 5HPYB 3U3RA 4A0HA 3LH5A 4Y0VA 2XNSA 3FGNA 1Y3AA 1GKUB 1SXJE 3A1SA 3X1ZA 2Q3FA 3VFDA 2OXRA 4H9GA 1MRNA 2EFDB 3V4FA 1ZM7A 1UDXA 4A8JC 2CLCX 1ZUNB 2FU5C 1XU4A 3IGFA 3IPYA 1VG9B 1S1CA 2ZRBA 3L0IB 2KBFA 1KO4A 2HXYA 1AKEA 3EG5A 4NH0A 1QF9A 2YJTD 2IYTA 2VSXA 1YR9A 3LXRA 1VCNA 4F92B 1KMQA 2KBEA 2ZU0C 5EUQB 3TUJC 5HTKA 3EPJA 1CXZA 4ZV4A 1L8QA 1OXVA 4M53A 5JJIA 1YU9A 4A0FA 1BH2A 1PZNA 5H68A 3ICEA 1GVNB 3T1OA 1UM8A 4B2PA 5DYGA 2RGNC 5EP4A 3QEJA 3U6KA 3FE2A 3AKCA 1Z06A 3MUFA 1E1RA 5JWHA 3X1DA 2WKRA 4MDFA 2HJGA 4EFLA 3L43A 4DLVA 3FMPB 3WNCA 4FXPA 4A36A 3KKMA 3VTKA 4DIDA 4CIDA 4M9ZA 5AJWA 1E9CA 5JECA 2J0QA 1GILA 1E9FA 3TSWA 2GAOA 2FA9A 4D6PA 3K0FA 1EWRA 5IDVA 1N5IA 1II8B 5KNCA 1KDTA 4HDQB 2IS4A 2OG2A 1E2DA 4YDSA 2C95A 2OXCA 1D9ZA 2OBNA 2IXGA 2R6DA 1TEXA 1ZD1A 1J8YF 3A58B 2H16A 2C9CA 4CT4B 1W0KD 1XP8A 1IXZA 2B8WA 4HUQB 2IYWA 4OI2A 4TMWA 3TUZC 1KI2A 1OHHA 3KFVA 2JJ2A 3RS0A 4HLCA 4DWJA 4KODA 4C0HA 4FWTA 3EPHA 2QY9A 3TMKA 3TR5A 3B8HA 3LD9A 4HDOB 4YMWA 1P2UA 4PSKA 3JZAA 2J9RA 1TQ2A 2QSZA 3QXSA 4IDPA 2QP9X 5C4MA 1ONBA 2NIPA 2Q9BA 4P0TA 4Q1FA 1GRNA 2GJKA 3NIBA 4DVGA 3WYGA 5BYKA 1SVOA 2IXFA 1Q0UA 2IYYA 1YR7A 4ZIRB 3SYKA 1XX6A 1ZUHA 3QKSB 4Q4AA 5FTLA 2WKQA 1LF5A 1LFDB 1MABB 3UK6A 3QG5A 3QKRA 2AXPA 2P6NA 2PLRA 2ZI6A 2ZRDA 1ZNWA 5JHGB 4HLQB 1D2NA 5J47A 4GSYA 5DN6D 1N0VC 3EPLA 5FUVA 1XXHB 4AKEA 3A1WA 1Z63A 2AL7A 1X1RA 3BBPA 1SKQA 1PLKA 4BLOA 1OE0A 1P6XA 3KJHA 5LDDC 4A2WA 1MRSA 4HZUA 3RDPA 4NKRA 5C2JB 4JLBA 4E5UA 4EUNA 5B64A 2ANBA 3QXHA 3CM0A 4V0NA 3TK1A 3CRMA 4TYNA 1KO1A 4LYFA 1G5PA 3REFA 1E9RA 5DGXA 5DSZA 2QMOA 1KDOA 1Z2CA 2G3YA 5M04A 1CJKC 4G1UC 1WP9A 3TSOA 1EXMA 1W1WA 1SVIA 1WBDA 2QE7D 1VG1A 1I4DD 4EDHA 2JEOA 2IYSA 4EKDA 3AVWA 2C77A 3AM1A 2VPPA 1OFIA 4MKFA 2GWHA 4OJKA 4EPXA 2EQBA 4OI0A 1E6CA 5J40A 2J7PD 4EJSB 5KO2A 1HA3A 2ZI9A 1Z07A 2QT0A 4OKSA 4D0LB 1G291 2ZRMA 4C0SA 2V6IA 3LX5A 4D4LA 5JJLA 3ADBA 1FMLA 2O0HA 4JBWA 1ZU4A 1Z6AA 4DB2A 1TADA 1GL6A 1E69A 2HYIC 2X77A 3QY0A 1E99A 3I72A 3FKSD 2IL1A 3K9GA 1S0UA 2QROA 3AF0A 4M1KA 1DE0A 2HCJB 3REGA 3V00A 5FOUA 1RFLA 4DSOA 4DT1B 5KOYA 3LBHA 3IIKA 4RD3A 3T1QA 3LDAA 1HE1C 1ZC3A 1K5GA 3SZRA 1IQPA 2JIZA 4D81A 4CRWB 4M1TA 1DBSA 2H92A 3B13B 1GRRA 1DTSA 5JSZA 1FOEB 4TQ9A 4Q02A 4IJMA 1KAOA 2VQSA 5AJYA 3NHAA 3K9NA 2CK3D 1M7HA 2PX3A 3GLIE 2EW1A 1YQTA 1I4TD 2W6ID 2E9SA 2JDIA 4Q4JA 1CJUC 3Q5DA 4BFSA 3O47A 4MYHA 5CK4A 4QOSA 5SZKB 2ZVQX 4IOMA 5JMTA 1R0XA 1X1SA 4RD4A 5FI0B 1M7BA 1XFAA 1JEDA 1CF4A 3RRNA 1NNEA 2V3CC 3THOA 1GRQA 3PFIA 3VR1A 4N1AA 2UZIR 1M6NA 2HF9A 4P32A 2W00A 5FUYA 2BM1A 3Q7PA 1G20E 3AVTA 3TVDA 1E2JA 2ERYA 3SC3A 4A1FA 2REXB 4PC2A 1Q12A 2QQ0A 4NONA 3JVVA 4RD1A 2ZJZA 4RCZA 4XD7A 3K8YA 3LQQA 2WOJA 3B9PA 2OM2A 4QHTA 3PIRA 1OH6A 2IS1A 2XXAA 3ZVNA 1E2KA 4MKIA 3K09C 3RSOA 2OFWA 2ZE6A 1T0JB 1WF3A 3P4XA 3ASZA 4MRPA 5TXGA 2WMOB 5EXSA 3CZQA 4EPTA 2F6RA 5EUMA 5EP1A 1ANKA 2QBYA 4IRUB 3IKJA 3BAFA 4KYUA 2KI5A 4KSCA 4M9QA 3U60B 1U9IA 1P4SA 4Q1EA 2BHRA 2EYQA 4AYTA 3U44A 2YOGA 4IXNA 2EWVA 4ZCLA 2GNOA 2H1LA 3FYHA 4KV9A 4HB3A 4WXRA 4PQRA 4AYXA 1L4UA 1W5SA 2VHUA 3FVQA 4DSUA 5KUTA 4JYCA 1JXMA 4TYWA 4DCNA 5E7JA 3ZQJA 4IKEA 2P67A 3CRQA 3W3ZB 1ZYUA 2QN6A 4HUTA 2ZRPA 2BMFA 1XD8A 4G5OA 4JT4A 4B3XA 2G0TA 2CDNA 1QG2A 4M2LA 1OXXK 4JJKA 1UJ2A 1C4OA 3SYNA 3FB4A 2MSCB 4XVQA 1Z5ZA 3U4QA 1UFQA 3QG1A 2A30A 3EWSA 3VHLB 2Q6TA 4WZBE 1OSNA 4PAMA 5AJVB 1ESMA 1U8YA 2A3RA 1F60A 1VKJA 5AUNB 1LNZA 2BWJA 1Z2AA 2R8RA 5LB2A 3I8SA 1M2OB 1NLYA 5L3QA 4UXJA 1Z22A 1X3SA 2XJ4A 4M1SA 2NTYC 3U7EB 4Q1DA 2G6BA 2FEOA 2QP4A 1ZM4A 1T3LA 3A4NA 3LBNA 4OHXA 3CZPA 4LHYA 2RGAA 3NBYC 4LHVA 1UKVY 2RGEA 1QG4A 3B6EA 1VIYA 2ZRCA 1VG0B 4FCWA 4AYWA 1SHKA 4Z8YA 1AS0A 5G53C 2OLKA 3U7HB 2EFCB 3NWJA 2NO6A 1KNXA 1R0WA 3ZDQA 1KJWA 3J81k 2JCSA 1W49A 4QGFA 4A0GA 2A5DA 1WRBA 3AVVA 3GLHB 4ZDIA 3QKTA 5G41A 2FGKA 3WP0A 3DZDA 3KTAA 3KB2A 4YDHB 2PMDA 3L8ZA 2PLFA 4OQLA 1H8EA 3SFVA 1NN3A 4A4DA 1NVVQ 2DFKB 2VP0A 3OEED 3KUCA 2CJWB 2JASA 3IBGA 1MO6A 3K9HA 4PSAA 8OHMA 3KQUA 2OCBA 1G6OA 2D06A 4ABYA 4C3ZA 1GSIA 1XEXB 3KDSE 1FNMA 2WJIA 3O8DA 1D2EA 3HP1A 1VMAA 3KUDA 2J3EA 2WJJA 1C1YA 4LJ4A 4U5XA 5FOXA 2A7QA 2V8OA 2WV9A 3RS2A 1MKYA 3WMGA 4QBIA 4DXAA 4TLCA 1XTRA 1AQYA 4JT2A 2O8FB 2ODBA 1R5OA 1KI1A 3CH4B 5FBRB 1U8AA 5E4FA 2ZANA 2F1RA 5EE5B 4D4JA 4JSYA 5L8VA 121PA 3IQWA 3I4LA 1H65A 3N2IA 2J0UA 4IDHA 4NYIQ 5AR1A 2RB4A 3HPQA 3LW7A 2WPDA 3MD0A 5KNDA 3TR0A 4PO8A 3RC8A 1EG7A 3QBVA 3A4LA 1RJ9B 5DI3A 2WOOA 4LHXA 3UWOA 1CRQA 4NCNA 2IT1A 2MSEB 2A2ZA 1N0UA 1OH8A 4MYTA 2H5EA 3KXLA 1N6PA 1RYFA 4X8MA 4GP7A 3W6OA 2GRJA 3MGCA 4OJQA 1X8LA 4O2RA 2F55A 1AM4D 3SU8A 5IK2D 4AY2A 4JLPA 1UKEA 2FSGA 2ZYTX 4TMXA 4DC9A 3C41J 3Q9LA 1JPJA 1IJFA 4ASUD 3R9XA 2O8DA 4EQ6B 4DLTA 3AUXA 4MRVA 3AP3A 4QXAA 1NKTA 2RAPA 3GD7A 1RRPA 2F9LA 2J41A 2GVDC 5J4HA 4DLYA 4FMCF 3HU2A 4URZR 2WWHA 2A78A 2D7DA 1NMXA 2WJHA 3P4YA 2RGGA 1KTVA 1RZ3A 1UBEA 3UIEA 1HYQA 4Q9HA 4Q7MB 3VKHA 1YZTA 1IJEA 2CVFA 1Y63A 5F9HA 1OLOA 1E98A 4Q9KA 4NDZA 5HCIA 1US8B 2VHTA 3K0CC 4LJ7A 4LV8B 2IWHA 2L0XA 2VP6A 3TSZA 4LY6A 4YQFA 2P3SA 2PZGA 5KPJA 4OQNA 2RHDA 2ZSBA 1ZM2A 3NHBA 1Q44A 2NO9A 2XAUA 1W47A 3THYB 3SQWA 5CIWA 5F98A 3QXXA 3GLGA 221PA 3WBKA 1Q1BA 3GQBA 3IIMA 2R62A 2OFXA 2WWFA 4M22A 4Q18A 6Q21A 2QU8A 2WSMA 4R7ZA 2WWGA 1CLUA 4RY2A 1Z08A 5FOTA 4KAXA 4D4MA 4C7OB 3BWDD 3MWJA 4NYJR 2EFEB 1F2UA 4RFVA 1EESA 1CJMA 1OB5A 2QORA 3LXXA 3FPAA 3SYLA 3CR8A 2UZ3A 3VMFA 3CNLA 4DLXA 4HLDA 1E1RD 1XZQA 4HLUC 2R9VA 3GJ4A 3I32A 4IDNA 2IS6A 4ZKDA 4Q9JA 1F5NA 3TVTA 3QSYA 2ZQ5A 5BW8A 4OK5A 5H1YA 1O87A 1XTSA 2B6HA 2YC2C 5KDOA 1UF9A 2HJVA 4M8NE 2ZEJA 3GJ0A 3SQXA 2FFQA 2JA1A 1U99A 3ZZ0A 2NPFA 2IF2A 5AJZA 2FJUA 3R7WA 5FOVA 2HDNB 1AZSC 2NGRA 2NZ8A 4IVQA 3KKQA 5CB6A 3PENA 3LVRE 1YZLA 2ASEA 2DFTA 1D2MA 2FN4A 1XMVA 1G4UR 2IYUA 1OHHD 2N42A 2R6CA 3PCRB 4NYMR 2ZTSA 4W5JA 4A6XA 2JJ2D 4HSEA 2DYKA 2CE2X 3MJRA 2I1QA 2WAYA 5FTMA 1P9WA 2YKGA 3SNHA 2AFHE 2GESA 4QJ4A 2FSIA 3GJ6A 3MWKA 4P33A 4A0RA 3NBFA 4A2QA 4EPVA 2JLUA 4K46A 4EIWA 2ZS8A 4QJ3A 2QGZA 3PV0A 1CTQA 4GOKA 2IHBA 1AGRA 2Z4RA 2ZI3A 4LHZA 4RZ2A 5HKKA 5FUXA 3B7GA 2ATXA 1JQJC 3K0EA 3NH6A 4B74A 4KITB 3ICQB 2OAQ1 3RRMA 1G16A 2XOKA 2YWEA 5FTNA 5P21A 4KFSA 3PQCA 3TAHA 3TIFA 2IYRA 3AF4A 3O8RA 2JAQA 1XPOA 4IOKA 4A8JA 1GNRA 1YR8A 3QXJA 4HUQA 3KZ1E 1T9HA 1FTNA 4HZIA 2GCOA 2F1HA 2I1VB 2JLVA 1P73A 4BQSA 1KSGA 4ZCMA 1XMSA 4ZPXA 2G1KA 1U0LA 2BJWA 2CL6X 3UANA 3FFAA 1VYTA 3ADCA 1ZC4A 2GILA 2WWIA 1HURA 3G82C 4B71A 4BFUA 2MMGA 4NE2A 5KTYA 2ZRGA 1JAHA 2ERXA 2XSZA 2R6GA 1COWA 4KFTA 4Q21A 1KSHA 1E0AA 1MABA 3QPWA 2RGNA 1GKYA 4AI6A 1RC8A 2YZ2A 4JJZA 1T8TA 2C2HA 5CYPA 3SHFA 1EWQA 4M1MA 3M6AA 2ZRKA 4CZ2A 2QTVB 4QM6A 1S96A 4IW3B 4RCYA 2J0SA 3SDZA 2HT1A 3CWQA 3ZYCA 1U0JA 4UXIA 3AGPA 3BRWD 3IILA 3VQTA 2EFGA 621PA 4RJLA 2GK6A 1EX6A 2ZRNA 4YXWA 4G3XA 2WICA 2XB2A 2Q9CA 1Q3HA 4UNNA 1KIMA 3L2OB 5E7MA 3U7FB 3AP1A 5LD2C 1ZCAA 3IBYA 1G5TA 1WE2A 3L0SA 2QTHA 1FUKA 4FW9A 2JIZD 1OT3A 1KK2A 4FN5A 3B1XA 5CK5A 3EPKA 4NZYA 5TARA 3KXKA 3FKQA 5L3SA 3JVUA 4LC0A 3C4JA 5DH9A 2O0JA 1KNQA 1XCMA 3G0HA 5K8LA 3MAAC 4TYYA 4KCGA 3T06B 2JATA 1UBFA 4Q7JB 1U94A 2VP4A 2FGJA 3VR3A 3SR0A 2JDID 2QA5A 5IF9A 2UKDA 2JLYA 1XNJA 2GA8A 1E2QA 2KWIA 1XTIA 1FQKA 1ZD9A 3HR8A 5EQTA 2D62A 1A2BA 2QAGB 4C0JA 2QI9C 4I1VA 1MV5A 3C5CA 5JI2E 5FPHA 4JVSB 3CKLA 1NJGA 1Z0DA 3CLVA 4HAXA 4C2UA 1QHXA 2ORVA 4KBFA 1J70A 4I1OA 2AN9A 3K70D 4DT1A 1E2HA 1PUJA 1PUIA 5KHOC 4XD7D 1NJFA 4XTCS 1G8PA 4CEIB 4OL0A 1IOZA 1XEWY 1JB1A 4D0GA 1SXJD 1XWIA 3QPUA 2FMXA 1KYIA 4DLRA 3QF4B 3K1JA 1JR3E 2RHMA 1XPRA 3PUZA 1SVLA 4D82A 4U00A 3SHWA 5EE1A 2GBLC 4FMBB 4TMVA 5LD2B 1N3BA 1RVDA 1NIPA 3LVQE 1IN7A 1KY2A 2XZLA 1LW7A 4GOXA 2OHFA 2NO0A 1NL3A 1VCMA 1E32A 1E2LA 1NIJA 1P61B 1P9RA 1R5BA 1DEKA 3MFYA 4Q9IA 4G5GA 4GZLA 3VR6A 3UMFA 3NBXX 3NBZC 2YNMA 4JLNA 3UATA 2X8AA 4MRRA 1Z6TA 1KJYA 1YKSA 1TU3A 4HATA 1XB2A 2AK2A 4OYHA 3BH0A 4PANA 2IHYA 5JS8A 1CBUA 1DAMA 2DFNA 2N46A 2O8CA 2FZLA 2CCJA 4LJYA 2G88A 3EC1A 3F3YA 3OIWA 3GLFB 1LS6A 4URWR 2BOVA 2ZR7A 3ONWA 1VHTA 3P32A 3RYTC 2ZPTX 4HAZA 1GP2A 4NCHA 3P26A 1XMIA 3AKEA 4TSFA 3SI7A 3WXMA 4IDOA 4PAOA 1LB1B 2V4ZA 4B3FX 4KYIB 2W0SA 3VAAA 1T3SA 1F2TB 1DAIA 2AWNA 4LBYA 1KI7A 3BERA 3Q3JB 2O8EB 2N1BA 1NKSA 1IN5A 2G9NA 3EA0A 3AKDA 3B1WA 2A5YB 4JS0A 1OFHA 3NC1C 1R6BX 2XNDD 4UNPA 5EE0A 1GTVA 2NMVA 1KDPA 1S3SA 4MRSA 3B1ZA 1CJVC 1MT0A 2PCJA 2ZVPX 2AKAB 1T8UA 4LPSA 3RRYA 1ZM3A 4Q4HA 3ZVLA 4ZKEA 2JGNA 2NO7A 4EJSC 4JMPA 1FTSA 4A92A 3OAAA 1NRJB 2ZJAA 1SGWA 1XJQA 2OBLA 4IEEA 3IEVA 1Q21A 2QRZA 4ZI3A 4IFBA 2IYLD 2W0MA 4EFMA 3UMSA 1GWNA 2ZUDA 4KFRA 1AJEA 1IXRC 1NN0A 3U3MA 5JEDA 2F3TA 4C9BA 4CEHB 4O2LA 1H8ED 1SVWA 3RLFA 1KI6B 3TUIC 2IC5A 2J59A 2XTMA 3K09A 1UBCA 2Z6VA 2QEQA 1OW3B 1SHZA 2X19A 4M9XA 3VKGA 1ETUA 1HV8A 3EZ6A 3AVUA 4NBSA 4QHSA 4KLNA 4PC7A 1FX0A 1FPMA 4JLMA 1QHGA 3AV0B 3S1AB 5DNYB 2VEDA 3T15A 2NO1A 4AD8A 3KQHA 4Q9LA 4AKHA 2GJ9A 2XTZA 4Q66C 4TYQA 2PZFA 4LYAA 2V1UA 3C7KA 4MGKR 2VP2A 2REBA 1HH4A 2WPDD 4GI7A 5FOWA 4B48A 3CO5A 3ASYA 2IUSA 2YYZA 1E4VA 2WAXA 3QPVA 5D3MB 1W0JA 2B92A 3CONA 3AF2A 2AR7A 4DEXA 4HAYA 1YHNA 3EW9A 4JLVA 4FCTA 4YMVA 3QE0A 4D0NA 4V0OA 5ELXA 2B8TA 4DJTA 1G3RA 4MQBA 3MWLA 3CRW1 4LJ5A 1J7KA 1ZVQA 4M1YA 1GAJA 3SN6A 4B44A 5CB8A 4WAUA 3RS5A 4B76A 2VBCA 1S1MA 4OK3A 3OEHA 5BN3A 3CRVA 1M74A 2IK8A 2YV5A 3UG6A 3ZLJA 1DG1G 2IS2A 4X8OA 2ORWA 1NY6A 4IFEA 4PHFA 3K0SA 3NKVA 1V5WA 5JJKA 2DWPA 1OXSC 5CLQA 2ZI4A 1A7JA 1IY0A 3VNUA 4HAWA 1T0HB 2XX3A 1W48A 4NCKA 5IHPA 4CT5A 1RKBA 4DB4A 3PUXA 1Q22A 1G7RA 4CEJA 4ZDWA 1QZXA 4F4JA 3BFVA 2EVWX 1E2GA 1QHNA 4BWYA 1YVDA 2ZITA 2YOFA 1D8TA 1QHHB 2FH5B 1G8GA 4DIEA 1W4CA 1NN5A 1K8RA 3FMFA 2KB0A 4QBHA 1EK0A 2Z5FA 1ZM9A 3CX8A 4ARZA 3GLGE 3WMEA 1RW4A 5FBLB 3LWNA 1ZP6A 4RD2A 4MRNA 3DOEA 3W9YA 4I1SA 1UEJA 1PLJA 4WBSA 5J4YA 1N6IA 1U8ZA 5DLQC 1ZINA 2FX3A 2NZJA 5SZIA 4MDEA 3MCAA 3AVQA 1KMHA 4LPKA 1JR3A 4LUCA 4B33A 4NU0A 4YC7A 3GFPA 3RC3A 3TKLA 2D3WA 1XJCA 4UQOA 2D4HA 3CX7A 4C0BA 4QM7A 4MUAA 3M0EA 2QPTA 1G7CA 1SVKA 1US8A 2AFIE 3K9LA 4RFSA 1J99A 4N0DA 3RAPR 2CNWA 4ACAA 821PA 1FFHA 1HT1E 4B47A 4G01B 1I2DA 1W36D 2QRNA 1KK0A 2ZJYA 3LFUA 2VSFA 2GJSA 5B30A 1NG9A 3B1YA 1ZD8A 4PO9A 4E22A 3QIAA 5FPYA 3VKWA 5FL3A 1T5LA 3ZS9A 4URVR 2ODEA 3RS3A 4TZ0A 1B23P 3THXB 1SULA 1BS1A 1ZW6A 3H4MA 5GJWC 1WDTA 5JS7A 5KSPA 2DPXA 2V9PA 5DE3A 2F43A 3D6TB 4ILEA 5F9FA 3B82A 3TBKA 1OIXA 1DO2A 5SZJA 3VNVA 2FFHA 3C5HA 4V02A 5DIFA 2P0EA 2RGCA 4V03A 2O8BB 4TT3A 4A2PA 1IY2A 1XEFA 4B6FA 2BJVA 3MWYW 5L3RA 1GM5A 4OHVA 3KXIA 4TWZA 2P6RA 4URUR 1G3UA 3IHWA 1E79A 4DUGA 1SVMA 3GP8A 5HKKD 1R0YA 1CR2A 1W4RA 2ZYWX 5JWOA 1BKDR 3QUSA 4C30A 2ZSDA 4L16A 4W5HA 2J0VA 4O25A 5K8TA 2XOKD 3QEOA 1Q20A 2PJZA 4TQUS 3RHFA 4LOAA 1WXQA 4BRWA 4QNMA 1ZBDA 3EWAA 1HE8B 3WRXC 4NCIA 3K0CA 5TV2A 3BH7A 2IYVA 2BCJQ 1NVWQ 3QF7A 4Q4AB 4FIDA 3WHLA 3X1YA 3BIFA 4LJ9A 2RH5A 3QKRB 1G8YA 4TQAA 4P4TA 4IEIA 2VHQA 3P1JA 2ZE7A 4HEJA 4II7A 4LV6A 4MYUA 4R98A 3EC2A 1DELA 3EZ7A 3GJ5A 5FL7A 3EZ9A 4LBWA 4ZDJA 2B21A 4A15A 1F3OA 1Q1ZA 3FHTA 5A4JA 2DHRA 4UKDA 4HZUB 3AP2A 2ODNA 3IPXA 2MSDB 1DAFA 4Q1CA 1G18A 2WWWA 1YRBA 4TMTA 5SZHB 1COWD 2TMKA 1NG1A 2PEYA 5ANRB 1MR3F 5IT5A 1KI3A 3B60A 4BASA 2OV2A 4YMUA 1PLLA 2JLXA 2ZJ5A 4MH0R 2WWYA 4URYR 4BLRA 1CU1A 4K8OA 4HLUA 4YMTA 2ZS9A 4DKXA 1R8SA 5JHHB 1ZIOA 1W4AA 2Q0HA 2EFHB 4RKEA 1J90A 3I5YA 5KDDA 2V7QA 4XVUA 3U7GA 3TRFA 3BFKA 5JFGA 4JLDA 2I3BA 4KBGA 4GDFA 2GJ8A 1FNNA 3WRYC 4W9MC 4YXWD 1HQYE 2W2TA 3BXZA 4JZKA 4PPGA 1XRJA 2BKEA 2VLIA 2PT5A 1TF2A 1RRCA 3NEJA 3W3AA 3R8FA 4L9SA 1SXJC 1W2HA 2JLQA 2DWQA 2GCNA 2D2EA 1DARA 2PH1A 3P27A 3KQLA 3TJZA 2AXNA 4C4PA 1A82A 4URXR 1TPZA 3BH6A 4BFYA 4G0NA 3SBEA 4Q19A 1IXSB 2FOLA 4MGZR 3VU9A 3OFNA 1DADA 4KFUA 4NL4H 4OQMA 5KSYA 4JVMA 2GZHA 3TE6A 1GITA 1YZQA 3L8YA 3PXGA 5JSZB 1P3JA 1G8HA 2ZRFA 2JJ1A 3UMRA 3MSXA 2H17A 2Y8EA 5FR1A 1MH1A 5G3ZA 5G3YA 3T12A 1Q1QA 4M1WA 4PC1A 3K0AA 1SZPA 2FDCA 2HUPA 2FPKA 4UNSA 5KSZA 5FBWB 1OF1A 5BN5A 4Q4JB 4C0AC 1WB9A 2YOHA 3H86A 5UKDA 4KHZA 1JXOA 2FPMA 4PX9A 1XF9A 4WZAE 4OI1A 2BC9A 1EFTA 2GXSA 4XSHA 3GMTA 3U3JA 2JLWA 2FF7A 1YZNA 1UDWA 1CS4C 1CEEA 1FMJA 2OCPA 4Z1MA 4AIIA 1A1VA 1N6LA 1DAGA 2BM0A 4W5WA 3FMIA 2WJYA 2LCFA 2OESA 1SXJB 2J45A 1FQJA 4LRWA 1G8FA 1IONA 1M7GA 4JVLA 2BV3A 3WNDA 2ZJOA 1W44A 1OXTA 2QM8A 5B57C 1NSTA 4NHOA 1E0SA 1T91A 4M1OA 3I62A 2Q21A 3CPEA 2JLZA 1NVVR 1ZAKA 3IDQA 2GEUA 4LJ6A
chains in the Genus database with same CATH superfamily
1CUJA 1JR2A 2REQA 5JNLA 3G0GA 2P2NA 1M75A 3WDSA 1W5TA 2IU6A 2Q1SA 4MAMA 3BWCA 3WMFA 3HU1A 3HN2A 3JR3A 3OJOA 4K0RA 4PHGA 3U44B 2HT6A 2H3HA 3F67A 4MKGA 4CL2A 4DC0A 3HGMA 1OZ0A 3BMCB 4KQHA 4Q7LA 3ZE9A 3OJWA 3WI7A 5C37A 4PY2A 3WGQA 1C3EA 3BXGA 3ND9A 5LWHA 2WTUA 1XR3A 2WD7B 4RK1A 3CLTD 5GONA 1GU0A 3BD7A 4CVNA 4QYWA 4MW5A 1EQUA 1Z4LA 4U63A 2Q50A 1ZQ1A 4TSFD 1FXWA 3VDMA 4FLEA 2FX2A 4BNMA 3ROQA 5B2ZA 1PGQA 3GPBA 1Y80A 2G0NA 3OM8A 4XOIA 2BFAA 4NS1A 2P4HX 2GEDA 4GGOA 2CHFA 3A14A 4AO8A 4RQBA 4V0LA 2FW1A 3KYDA 1EZ4A 4FHGA 2OB1A 3FPKA 4ZU1X 4LZNA 4ZO4A 4CI9A 4X65B 3U4QB 1FUIA 4HDMA 1NYRA 2IHTA 3A37A 3JVIA 4WI1A 1VOTA 1XDSA 1K9SA 2Z8YM 2ZRJA 4GSLA 4DSZA 3L1IA 1U1FA 4GQBA 2O8NA 2BDEA 3FRHA 2CXNA 2P4UA 4HXEB 3SSNA 5L3QB 3MRXA 2QMHA 2G4LA 3ICWA 3DJYA 4UM7A 4EMTA 4HKTA 4JI5B 2UUCB 3WLTA 1SBZA 2CL7X 2EKLA 1J39A 1SC6A 2ZGVA 3R7BA 5ICGA 2WQ6A 3VVCA 2DPMA 2SICE 3EXHC 3OAAD 5CDTA 5F2NA 4QU8A 5IEJA 3Q5GA 3SWWA 3HKDA 4BQPA 1G21E 3ZLBA 3TXXA 2BGWA 3Q85A 4J8PA 1NC3A 4WINA 1ID8A 3PEVA 4EAQA 2IXDA 1KY5A 3SJCA 1BFUA 4Q6BA 2XT6A 4F3KA 3W5VA 3DC2A 4CIXA 3N28A 3WGUA 3EGOA 4IUYA 1RPZA 2CVOA 1EP2B 1WXIA 1JKIA 2F1IA 1M3SA 1UEXC 5DLYA 5E2BA 5F73A 3N75A 2DB3A 1YF3A 5AVUA 2W58A 3UUEA 4TSRA 3NV9A 3VOAA 3R7DA 1TZBA 3NPAA 4AIRA 1DRJA 1KOJA 4XYEA 1UAAA 3RBZA 1QJ4A 4YB8A 2P69A 5FWNA 1RYHA 3V8EA 2PPLA 4C7MA 4ZYLA 2GR9A 2WZQA 1QYRA 3AW8A 3R40A 3ZLTA 4BLTA 3QGMA 1S9HA 1UINA 2DM6A 4IVPA 4KI0A 1EX1A 1ODCA 4LRUA 4NQZA 3TSAA 5DLPA 1JHZA 4I6JA 4L07A 3TYXA 3VSAA 1G6HA 1LDMA 3PUWA 3H4TA 1QIIA 4GM1A 4PO1A 4Q4LA 2A5JA 1BHO1 2C9DA 2UYOA 2VNJA 3ABSB 3FWYA 4P4NA 1KKMA 3N2NA 4I55B 5CLFA 1LFAA 3UJBA 3A31A 3IBTA 1T24A 3IDSA 1CIPA 3KDAA 2E4AA 3CR7A 3QKSA 1XV5A 2AB0A 4FNAA 3UCFA 1HR0B 3G9XA 3WLQA 1ATZA 4EJFA 4NF2A 2O57A 5IEBA 1KMNA 1MGPA 3AVOA 5B2FA 1NT4A 4OGFA 2AEFA 2Q28A 2RHHA 2WF9A 2C3PA 3JPWA 2I3DA 3LL7A 3N39C 2DBQA 4LJAA 4EDFA 1GDDA 2O3UA 3LY8A 4ER5A 4U9HS 4YRAA 2XCUA 1XXHA 4AG6A 1GAEO 3C3AA 4UJ3A 1XVIA 2YL2A 4LHWA 5FPTA 2JG3A 1FQWA 2EZ8A 1Z6YA 4HCJA 2LRHA 1PDVA 4DCUA 2O23A 4MEAA 3RIXA 5IKXA 4P92A 4ARCA 4AURA 4QSHA 1GUAA 1R50A 2ETVA 2ZIXB 3KFXA 1QPGA 1UBGA 3OEEA 4GUDA 2QPAA 3U37A 1QS0B 2EF1A 2C9ZA 3A1EA 3W6NA 5EJEA 4MRMA 3S1AA 4DEVA 1OBVA 1TZCA 3AHFA 1UMBB 2AA3A 4PX5A 4F3TA 5JSFA 2YVKA 4CLRB 4LSGA 4E13A 1VKNA 5CFRA 4BGVA 1KI4A 2B9EA 3H8JA 1NF9A 3WK6A 1YTUA 2G7ZA 3VV2A 3KUUA 3A6PC 2PEZA 4RV4A 2WAAA 4BWFB 1V45E 4JBXA 3JQ7B 3TGWA 4FCVA 4Y6LA 5E1DA 3DJFA 5ENZA 4EJSA 1Q7GA 2XR1A 1ZMBA 3AGQA 3LC0A 5CB4A 3SICE 2ZIEA 4ZT5A 3PNBA 1U3UA 4DHEA 4Z53A 4YUVA 2IXEA 2RCYA 4G07A 3TDKA 5CEFA 3UHOA 1ZVKA 4LQ4A 5LNK1 4ZHSA 5K20A 4OHYA 2HMWA 3HACA 3E9DA 4RK4A 3KQSA 2FOIA 3BSSA 3BF8A 4CN9A 4O4HA 4KQMA 4FR2A 2FI1A 4E12A 2REOA 4EHDA 4ZYYA 1Y48E 1ZJ6A 1P1IA 2Y0PA 3ANLA 1OROA 3STVA 1P5FA 3GLIB 3WE7A 4TLAA 3FTCA 3ZY6A 2NTVA 1QJCA 2HHCA 1Z0SA 4LE0A 5EAIA 1APBA 1L4NA 2JJ8A 3PDIA 1QCCA 4YRZA 1E2PA 1JH8A 1FNBA 1G5QA 1LV7A 2HJSA 2M98A 3MJ4A 4JQCA 4NZ9A 5EJ8A 2CHQA 2YINC 5IRCD 2MU1A 3EW7A 4JHXA 5LFAA 4RSGA 2OWEA 1J20A 3MWDA 4LHSA 4R69A 4DDHA 4E70A 5AP9A 4CL8A 2HXGA 3AV3A 3O2SB 3EXFB 1HSOA 2PMBA 4F3RA 5IJWA 3O31A 1EB9A 1N6HA 1JR3D 3GQBB 1FXUA 3SC4A 3W34A 5A9SB 1A77A 4RKFA 1N4DA 2XBMA 1LSUA 4BXOA 2BMJA 2VR1A 1LBQA 5LPNA 1UL1X 1BMFA 1RLIA 3NR2A 4GI5A 2W2PA 4K81B 4OY3A 2JIDA 4I8DA 4O6VA 3SBDA 3F74A 3PUIA 3VA7A 1E4OA 2H1WA 4N47A 3SZUA 3VRHA 3WB2A 2BGMA 4PLGA 1XGKA 1ZITA 4CV1A 4DCTA 1N8KA 1A1SA 2B94A 1MG0A 3RIYA 4HTFB 1OFGA 4I9FA 1Q57A 4ESHA 1YZUA 2GXUA 1EFHA 1FP1D 4Y2QA 4Z2AA 2XH8A 1Z0ZA 2QR5A 2E37A 2X2FA 4JC0A 2FZ4A 3MRSA 4YO8A 1YV9A 3SSAA 5A06A 2VAMA 3DTVA 3PXEA 1QB7A 1MNAA 3BD6A 4N40A 3N87A 3U4DA 3F1LA 1LPMA 4AMZA 2B61A 3OCUA 4CQMA 3K30A 4OB7A 3O1HB 1HDGO 1AA9A 3AF6A 1CS0B 5CITA 4NOLA 4TT3D 3DEKA 5SY9A 1FVHA 1XEWX 4PZYA 4WOKA 1ADYA 3DSRA 1GFIA 2BEJA 3ZGYA 1VSUA 1FDUA 4CCYA 4ESOA 2UYYA 4MVYA 1NPDA 3GBPA 1USVA 4E21A 4C0KA 3OX2A 2FRXA 4L51A 3R0XA 5H3LA 3DMHA 1E79D 3Q7TA 3KSBC 1CG6A 1F51E 1VPEA 3BORA 1VMIA 3EGDB 4DUGD 5K0EA 5JS2A 2GJAA 1E1MA 3G2OA 1SUCA 3MWEB 1Y1SA 3HCEA 3HB5X 3OJ0A 5J4VA 2ENWA 2X0IA 3O8CA 3PL1A 1QH8A 1WM1A 2FW7A 2WP0A 3ORQA 5HBRA 3JATB 3RF6A 1E1QA 1RP7A 3NHYA 4MPPA 1BS9A 1LLCA 2FSSA 3WX0A 3M83A 3PPYA 3PXAA 4IGAA 2J9FB 4MQMA 3S27A 3FDZA 1TM4E 2GARA 4U7TB 3THXA 3W5SA 2XJ9A 3VKVA 4IF4A 3DVRX 3D5EA 3NJ4A 1PNTA 5KX5B 1BGVA 2PX4A 4XWAA 5FBQB 1VJDA 1AIPA 1KSFX 2BF7A 2O8BA 4LCEA 1KAGA 1W93A 2BI7A 5EEGA 3ZV5A 4DRYA 1TF7A 4ABTA 1JNXX 2A9KA 2C3YA 2J5KA 5DDIP 3TPZA 3HRIA 3KSMA 3UICA 1C9DB 3PC8A 1JVNA 1DV2A 2R84A 1I7DA 3CUEF 3F73A 1PX0A 1TRHA 2XUKA 2YHIA 2GCOB 2EZ4A 1KR2A 5CH5A 3OZGA 3SOPA 3VDXA 1W8DA 4OLHA 1Q0RA 2OEPA 1L3IA 1N1DA 2UVPB 4QSMA 4CKEA 3I3SR 4JP1A 3A4IA 3DP7A 3BJMA 2ENUA 4YCJA 4CQJA 3KETA 1DC5A 1XTQA 1Z56C 2JLRA 3IIIA 1GO2A 5AHXA 5B1IA 1MO5A 2QY6A 4BNDA 3BXFA 2GXAA 1V43A 2DGDA 3SDSA 1E0DA 1EVQA 1VIAA 1FRFS 2UXCB 2IYXA 3L7AA 3QX8A 3S28A 4JEIA 1TTHA 5GJCA 1X1TA 5U1PA 3Q6IA 3RIEA 2E4ZA 1RP1A 2H63A 3RYIA 3ZU5A 4C2TA 3GJ3A 2V7QD 1ZISA 3NUGA 5DXAA 5I47A 1XZBA 3EQ6A 4QPNA 2HMUA 3N2GB 5EIEA 1TCCA 2RDMA 2YW2A 1KWGA 3V1KA 2XMDA 3LQ1A 5GY7A 2DR3A 4J16A 4D9CA 3TLMA 3GLHA 2P3LA 1P5ZB 3LHKA 3Q3IA 1A2KC 1WL8A 3D43A 3OQBA 3U4AA 5MDHA 4RV9A 1HI9A 1P17A 3IAM6 3R9XB 4JD5A 5TRTA 1GZSA 4AC9A 4QXMA 1MO4A 3F8TA 3GUYA 1E94E 1GQYA 6NULA 4J91A 4M99A 3HKCA 1OREA 1SOMA 2EWWA 3SF8A 5D6OA 3O4IA 4H4CA 4B43A 2CJWA 5EWMB 4AF6A 1Y6RA 1NQWA 4L50A 4HRYA 3ROTA 4LECA 2W11A 3G5LA 3PEWA 2CXUA 1XEXA 4NBVA 4WJZA 4V3CA 3BGWA 3FJ1A 5CJJA 4JL6A 2E1RA 3PNPA 3CC8A 3QBEA 4I3GA 3SD7A 4H7EA 3UJAA 3T7DA 4Q05A 2PS1A 5BQFA 4WIAA 2G25A 2ID9A 4W5NA 3CE6A 4O8CA 1ONNA 3OQOA 3PB3A 1OKKA 1V0JA 3DVLA 3W77A 3DCJA 5D84A 3DM5A 1JR4A 1JKJA 1UBRS 4G0YA 1Y37A 4ZOLA 3D6AA 3ADDA 1MRZA 1U81A 4H16A 1P9OA 2IZ7A 3LJKA 4RGYA 3ZK7A 1BRTA 3BKWA 2R8BA 2YTZA 3E3NA 3R3JA 2HLHA 4XQ9A 3S99A 1E7QA 4WN9B 1K86A 2WYUA 1GCOA 5E4YA 4OOFA 5EQFA 2QD2A 4TV8B 1T6NA 5IBRA 4UAJA 3UGKA 3QUBA 3ZDZB 4B6GA 5IXSA 1I3CA 5DXFA 3W2TA 3BRWA 4BX3A 1ACMA 1M10A 2I62A 4HQKA 3WLLA 1WS6A 2V7TA 3HR7A 3KPJA 3N7AA 4UUPA 3S1SA 2D00A 2X1VA 4F38A 1OCEA 1G8KA 2FVXA 2QUJA 3OPYB 4TOIA 2JHGA 1OA0A 4ZK2A 3D3KA 2C54A 2FSVC 2O7QA 4W9NC 2WYIA 3LKBA 3RE1A 3S40A 2C99A 3TPFA 2IYQA 4S0XA 2WFAA 2A88A 4MMYB 2OCAA 2NG1A 1NYLA 4QO8A 1B7GO 2LV8A 3DE7X 5AICA 3ONEA 1R88A 2WSSA 3ZLVA 5KINB 1Z0UA 1YXMA 1DC3A 4GPEA 2VN8A 3EXAA 4HG2A 3TNDA 1H6DA 1T0UA 3PT5A 4PLHA 4AZWA 1ESNA 1OBFO 2CEKA 3JQFA 4K03A 5JAQA 5A4AA 3AVPA 5FBKA 4RA9B 3RO7A 4WFKA 3UYLA 3I92A 1JAXA 3PT9A 4L5CA 1E2MA 2QP3A 2I55A 2BDTA 3AEZA 3PTLA 1U7UA 3H5OA 3KJZA 5ELMA 3IBSA 4PN7A 4B6EA 3QOFA 5L3VA 4LY3A 2WUGA 3KKPA 1EVZA 3BCUA 3E9YA 3M1IA 4FS8A 2HQOA 3ENWA 4L8LA 3WY9A 1NBOA 3PF8A 1H8HD 1SUFA 3SFZA 1NU6A 2Q0SA 5FFNA 3AXSA 2YXDA 3F5FA 5CNIA 3S4YA 2F2TA 1XCGB 4HH4A 3P0FA 1SCBA 4JIMA 4TYPA 3EOAI 1DAOA 4YLGA 1DZIA 3JQ8B 1X8JA 3DLIA 1ZUIA 3W78A 1T5HX 1E59A 1E1DA 3MYYA 3O73A 5B6JA 1J6UA 2V98A 4DJAA 1L7EA 2K6GA 2R48A 3UB4A 4LZZA 3R7SA 2CV1A 1BD3A 1KYZA 1LGYA 5ETJA 3UMGA 2O8CB 3ZGOA 1LS1A 3SPXA 2HLDD 1VQ1A 4S2UA 1MFZA 4XX1A 5BMVB 3IHLA 5LQCA 4NDNE 1OWNA 4GR5A 5FUBA 1GCIA 1FQOA 3FVWA 1JIJA 2IBMA 4D26A 1G55A 4XARA 2ZI7A 4RL6A 1AB5A 1C4XA 3NLLA 5A62A 2WG0A 4Z51A 4COOA 3B78A 3QMPA 3H9EO 1SWWA 2WSLA 2UZAA 2VH5R 5GIOE 1H94A 4H3SA 3HDGA 3V1YA 4D9IA 4WUVA 2YRWA 5CX4A 3V7YA 3WJ7A 4CTKA 5IT0A 4J1SA 2QW1A 3OCCA 2CXOA 3OA2A 3OM0A 3AY7A 3OURA 3PRJA 1P9LA 4PICA 4XB6B 3K3PA 4RLFA 2VP5A 4BB6A 2VK1A 4LJ8A 4QKQA 1SXPA 4EYGA 3KTFA 2IV7A 2X2EA 5LKRA 3SEAA 4QBGB 1E2UA 4EW6A 1LDGA 1GPUA 1XA4A 4L4UA 3WBFA 4IWYA 2FQQA 3WJ1A 1E3EA 1SHUX 1K2VN 2PJDA 2VCEA 1X7HA 4G5QA 4UVGA 1E8DA 2QHXA 3ANMA 3EXEB 3TVYA 2VHVA 1TD9A 3MQ2A 3FTQA 3L8CA 2X6TA 2GF0A 2J6IA 1G6KA 2LKDA 1MIOB 2MR6A 3FCOA 1J8MF 2VP9A 4R1PA 4YRKA 1DJOA 4B3DA 1QF6A 1B6SA 3I6BA 5TJ9A 5BW4A 2Q5QA 1ODTC 3SF0A 3U81A 3D64A 2FZGA 2ZYHA 1X2BA 4LWPA 4XQ0A 4CKBA 2X7XA 3QLUA 1CR6A 1LI5A 4G5XA 2HWYA 3ZCUA 5TPZD 3FHOA 4QDJA 3W90A 5IDXA 3UTDA 5JISA 4EKGA 3ZHCA 3BTVA 2ORED 2JFBA 4WRRA 2XUGA 4DIMA 1BZYA 3CXUA 2TSYB 5L9AA 5KTRA 3OQMA 1EYZA 4FMDF 4MUFA 1Z83A 2HMTA 2WIBA 2XNDA 1BXZA 2YHSA 4GPTA 4I4TB 3FJYA 4K3UA 1C1DA 3A26A 5FTJA 2F3RA 3PR1A 4ZO9A 5K4AA 3INNA 5JTTA 3TXYA 4RJTA 1Y89A 3TF5A 1GLVA 2CVHA 2FUNB 3JZMA 1R0ZA 2I2FA 1XIVA 2IHKA 3PTZA 1C2YA 1V39A 2QU7A 2P2YA 3W8FA 1LPPA 2I4OA 3N2EA 4MV5A 1Q3KA 4DABA 4BKQA 3VZRA 1E0JA 3A8TA 3P2IA 1WBJB 4XVRA 4BRZA 3GAZA 3H84A 5AK0A 2O0LA 1KDRA 1XRQA 2FUEA 2IY7A 2YHAA 4D8XA 2WVJA 1F8YA 2BGKA 4O2BB 4V0QA 4QUEA 3ET5A 3W7BA 3H2HA 3FGZA 3PR2B 4K0KB 5DN6A 3ZHXA 2XEXA 4X9XA 2NTJA 3HWWA 5CXQA 3ETDA 3ZXSA 1MAUA 1ZGBA 4LX8A 4RGVA 4BB9A 4WK2B 1I80A 3FRIA 3WGGA 1DXOA 3ZV4A 3K70C 5LJIA 1XZJA 5JR3A 4J2OA 1RHKA 1WSAA 3KQTA 2BEKA 2DR0A 2AHOA 2P8JA 2D6FA 2J3IA 3U49A 1H0SA 2VYVA 3GCGA 2O0MA 1ORIA 3F6BX 4I50B 4IOLA 4XEUA 4YRGA 1HQCA 2GD0A 2BIFA 1JL3A 1YFLA 2XRMA 4E31A 3UMYA 1PO7A 5ITVA 4PSVA 4IXMA 3QW2A 4WCFC 4AXXA 4EEXA 1QFXA 2QX9A 4HB0A 4Q7KA 4EMBA 5CLLA 2WRZA 1U80A 2ONYA 4B32A 4HV4A 3A32A 3HSSA 1IULA 4BFXA 1V8OA 1RE0A 5FWDA 2YZ7A 2AMJA 2GCPA 3ETJA 1AHPA 1WUYA 3NNDA 3CNOA 2DC1A 4TPKA 2H4WA 4PXSA 4C4XA 2J7PA 1KI8A 4F7WA 3KYJB 5KKNB 2HLPA 2ZIXA 1VDZA 4MUBA 4NYMQ 5ALKA 2HV8A 3H7AA 2D1FA 2KSQA 2CLSA 3B48A 2ODWA 1CZUA 1URPA 4KUGA 2VAVA 3KQYA 2PX6A 4KPEC 2B7LA 3R0QA 5ENVA 3FKSA 2GRUA 4JJ6A 3H4VA 5CM2Z 3RW9A 1Z88A 1D0VA 5ALVA 3FTFA 4S12A 1IL0A 3LWBA 3ESAA 4QG7A 2XMSA 4HI0E 3FCSB 3UWKA 4AJIA 3WA7A 5LNK6 3D7MA 4DMGA 3S8EA 1G17A 2X0JA 5FUQA 4HXYA 3WLHA 1Z5PA 5LMCA 5IUNC 1KXJA 3EZ2A 3LPCA 4DCCA 4DJDC 5BWMA 1DPFA 3Q3CA 1CSEE 4W5QA 1B2RA 1K27A 2BBSA 2GZDA 2N0SA 4DREA 4N4AA 5ALDA 3BK7A 1X1BA 2IHUA 5HCNA 1DO8A 1NLZA 4NBNA 5K0JA 2I6XA 3G88A 2QN3A 1P0CA 5HE8A 1PJLA 5ICMA 3JZDA 2PMEA 1NUQA 2VHZA 3PYLA 1QZ3A 4QQRA 2VO1A 3X2SA 2CK3A 4GMXA 2IF0A 4WACA 2DAPA 1U2GA 4G63A 2QAGA 4I55F 3F0TA 4IAOA 5ITZB 3AR2A 3GLIA 3FOZA 4RFSB 4Y2YA 3FPHA 5BV7A 2GEBA 1CB7A 3AX6A 3GEIA 1Z28A 2EP5A 1N6KA 3AKYA 2IHVA 5EJFA 5CCEA 5K8CA 4QD3A 4RL4A 1FP4B 3D7SA 3AQ4A 3PPIA 1WV0A 5AKGA 3DNMA 3HDJA 4G41A 4A6PA 4KJZA 1SKAA 1Z29A 1Y98A 3OLQA 5DZSA 5H70A 4BZXA 4CEIA 4XIGS 1GL7A 4UBNA 2EX0A 3EXFA 4D5EA 1Z74A 3PFCA 4YHHB 1BX1A 3QF4A 4GOLD 3DD5A 1U8FO 3F9IA 4K8RB 4D4HA 4QQ8A 4R2LA 3NHJA 2QS9A 2ZJ2A 3EAQA 2AN3A 5DCYA 1KP3A 4J76A 4C22A 4ZZ0A 4YACA 1JPUA 1R4AA 1T9GS 2XKJE 3G7NA 2QRMA 1R9GA 2GHIA 1R16A 3A3KA 3IRUA 4TUYB 1TT5B 2Y0EA 4FFBB 4PCAA 3WL5A 3BB1A 1BKYA 3UPTA 1P1HA 1OVGA 1XMJA 2F3QA 2GETA 3HYRA 4HH1A 3B53X 3LP6A 5KQRA 5L95A 1AZTA 1EHYA 4YP6A 5FV4A 1KZYC 1V3UA 3LWZA 3VX4A 4HTFA 3BB3A 4XYLA 2MCFA 5K0GA 4CE6A 1TDJA 2C59A 5LMNB 3PUYA 3IO5A 1E9VA 4IY1A 2ZT7A 3BE4A 5IKOA 3BWVA 4O3FA 4F2HA 3V5NA 1C1XA 4FNMA 6LDHA 4QJBA 3BM5A 1FJHA 1EP1B 1YAJA 2RIRA 3E05A 1JNYA 2Z2JA 2UZ0A 3EHEA 4IFIA 4PQYA 4LKOA 5GOZA 2JK0A 4JEUA 1LDNA 1LPOA 2GK4A 2X5NA 3MTGA 4MWCA 3VX3A 4O3MA 4L8YA 4POAA 3U3OA 1AO3A 1W35A 1XRSB 2FRDA 1KEEB 4TLMB 5FR2A 4BDSA 4EA7A 5IUJC 1OZGA 4EHFA 1XBTA 4FZ3A 2FZKA 4RTNA 3DM9B 2HLNA 1VL1A 5BQ5A 5LMZA 3FPFA 4BVFA 1NUSA 2H85A 3BILA 4YCDA 1JJAA 2IPLA 2CHGA 2R7KA 3CVOA 4AB1A 1BQ3A 2J6CA 1HT0A 2RMKA 1OVMA 2JEYA 3Q40A 1SBCA 1U8EA 3ZVRA 4YRQA 4Q47A 3GJTA 1HMPA 5C5CA 3T5AA 3GUUA 4D4GA 1N92A 1HT3A 3QUQA 1JWAB 1UK9A 4B35A 1H23A 3DMFA 3GV0A 4C0LA 1NUAA 2AS0A 1F2TA 4H7JA 2O2CA 1DRWA 1IB0A 2WZBA 1DAKA 1CUYA 4B3XA 3R6DA 2J31A 3QENA 1MZVA 2GN0A 3OFJA 2O8EA 3N8DA 4BE7B 2A92A 3DWIA 4JBYA 2Q6KA 2Y9PB 4XYBA 5E2AA 5M2QA 3O3OB 2VHJA 4V2UA 3AHHA 4AROA 4N65A 3DLBA 5B58C 4BFVA 3BMXA 2HO5A 1E89A 3HWX1 2B2NA 4PF1A 4DY4A 2HWKA 1TF5A 3ETCA 3VSEA 1DKLA 5SYAA 2J9FA 1BA3A 3A2LA 3E9EA 4RADA 3CLUD 2ZCUA 4W8HA 2YWGA 4INPA 5F23A 3HK2A 4JBIA 5TJHA 2CNNA 1UBSB 5IN4A 3JQDA 4JUCA 3STYA 3VPGA 3KLBA 1FYXA 1EHCA 1UWLA 3O03A 4N7BA 1L5LA 3UK1A 1O6GA 1F4LA 1G8MA 2YJ3A 4B87A 5I9LA 1M6HA 4ZU6X 4UCQA 3UGQA 1IPFA 1UXGA 4BVAA 1LWNA 1GPBA 4HAIA 3I5XA 1MLDA 5LB4A 3ICOA 4HRVA 4NICA 4OQFA 3OJXA 4FN4A 3WKCA 4NR0A 4DA6A 1O0CA 4C6HA 3ZD8A 2RHOA 1QLJA 2AHRA 1VHLA 3UT6A 1II0A 3SFTA 1I24A 1R5JA 4S3MA 1XZPA 4Q4CA 4LV5B 3W5IA 5JAOA 3OLXA 3HM9A 2JLSA 1L7RA 4CLDA 2CMKA 4KXUA 3COJA 2ATIA 2R6JA 5EZ5A 2V55B 4HNVA 1R2QA 3I45A 1LLFA 1XHLA 4C7XA 4ZQFA 1PT6A 3NH9A 4MLDA 1YZFA 3F90A 4PFJA 2GXQA 4WBNA 4YUYA 1SK9A 2X1MA 1GA4A 1NFRA 5SICE 1TUBB 1VE5A 1Z0IA 4R84A 5E6UA 2WUFA 1L5FA 2WFLB 4BKMA 4EX6A 5LSAA 1Q16A 2I6FA 2PY6A 4NZNA 1DKMA 4UARA 3C8HA 3TBFA 5JZSA 3UHFA 2FW0A 3MOIA 4CIWA 3B36A 3N5CA 4IQ8A 3D4NA 2ZTUA 4QX6A 1UBHS 1JQLB 1NT2A 3QU7A 4GOJA 2G70A 4I5EA 5CVCA 5FI1B 4XLTA 2X4GA 3N2GA 4MB6A 1P8JA 1Z73A 2OFFA 3VU9B 1O6FA 5FA8A 1SK8A 3NUZA 4E07A 2YZGA 3DE3X 3IMCA 4XIIA 3TJMA 5KQMA 4H6PA 4J0DA 2J46A 4GRAA 1LY1A 4D45A 1PR5A 1WHTB 1XZKA 1VI5A 2X2PA 3AJAA 4M4SA 4JVNA 3TZHA 3OICA 4JFRA 4PFSA 5H3HA 1UMCB 3I9KA 1MDFA 4KLAA 5DVZA 3WLPA 2H7VA 3TG8A 5HEKA 4QBFA 2WM3A 3K0AB 1DG3A 1VZ3A 1SCAA 1JJVA 4RENA 1EAMA 3OUUA 2Q2VA 3GJ8A 1ZK3A 5EJAA 1QV9A 1XMXA 2BFFA 4Z9YA 3VUFA 4OFWA 5KX5F 4S2EA 3VZSA 2X13A 4MQ4A 1KYVA 3J80A 2D7CA 2BRUA 1V95A 2X5JO 4TN1A 4DLZA 3LIIA 2AJ8A 3D4BA 4F11A 4M0LA 3QUCA 3OTIA 1E9BA 4MVJD 1NBME 2JARA 1F7VA 4MS1A 3AH8A 4HAOA 4CUJA 5T7BA 3IIEA 3A1NA 4L5IA 3CIOA 1TECE 1A8PA 2ZR8A 4Q1BA 1TQ6A 1GHTA 4C3OB 3MJSA 4I6GA 3GNLA 5ECWA 4YT8A 2VT7A 4DTIA 1U2TA 3DB2A 3FUCA 3OY2A 5IK2A 4AZSA 1Y5RA 2WJGA 1I3MA 4RK6A 2IEYA 4DS3A 5H8WA 5BWBA 2AX4A 1KR5A 3ABQB 3GEMA 3L7KA 5AWFC 1PP4A 1D4OA 1ISJA 2JAXA 1M1NB 1FNSA 1J23A 5CLIA 5EE9A 3V9PA 2PBFA 1WVMA 4TV8A 3ZDEA 3CVUA 1EJBA 3DAGA 4QNNA 4MPJA 2ZDGA 3BICA 4XSGA 1H2AS 1PTJC 1R6XA 3E5RA 3S2IA 3FOWA 3GK3A 3DMTA 3T0IA 1X1DA 4FLFA 1U1GA 2O5CA 4UMEA 4OF4A 3S3TA 1BD4A 1QGED 1G5RA 4ISBA 2HU2A 3TNFA 1UJCA 1YZ3A 3NWOA 3SSMA 1P9NA 3ZIAD 1XDUA 4A0HA 4Y0VA 1DOHA 4R2JA 5LP1A 5J5AA 3OVMA 2VC2B 3DZJA 4RPKA 2VNSA 2ZJ6A 1WB6A 5CVEA 2AFIB 3A9TA 2J0EA 4ZV9A 4CWAA 4AN0A 1TVEA 1VJ0A 5LQAA 4IX1A 1CVLA 1IOLA 3JYLA 2I9PA 3I9NA 3W5AA 4PAGA 3RC1A 5BR4A 5KYUA 1BDMA 1FDIA 1XU4A 3IPYA 4EB6A 3ZDDA 3JY6A 4IMPA 3FYUC 1JFFB 2EWMA 3WSWA 4CU2A 3L0IB 1Q5PA 2QN2A 1R8XA 1ILWA 3V1NA 1QF9A 2YJTD 4PXYA 1L7PA 2DUMA 3PDUA 1VCNA 4W5RA 2E0IA 1KMQA 4FFPA 3HFJA 3OD5A 4J2HA 4J1TA 4YEDA 2PSEA 5EUQB 1V1MA 5HTKA 4HX9A 1CXZA 5K51A 1OXVA 3GVCA 4X1YA 4Z4CA 4RTJA 2I7TA 1KP2A 5A04A 3HM2A 2GO7A 4GKKB 1NVKA 2PRJA 3P9SA 5CAEB 2XEDA 1YBMA 1DQZA 4RNDB 2QMQA 4YK7A 7ABPA 4DF3A 4OP1A 1VHWA 1Y9DA 1R4NA 4KGDA 1DLJA 4MDFA 5BMVA 1EUYA 4DLVA 1SC4A 3FMPB 4RHCA 2DT8A 3WNCA 3KKMA 3O92A 1RDFA 1U6KA 2PRSA 1E9CA 2AV6A 3H2GA 4E4YA 5KWVA 2WT8A 1NR1A 1WHSB 3PNMA 3KRTA 3Q0EA 4E11A 1EWRA 4X7PA 1UK8A 5JXGA 1C9YA 1VC2A 3H2ZA 4XOUA 4KZKA 2WHQA 1ZMTA 2C95A 5EIWA 1D9ZA 2OBNA 2V6FA 2A86A 4CI0B 1HFWA 1RMTA 1QIHA 4K3VA 1ZD1A 4X3OA 3P5BA 4CLOB 2C9CA 5LLSA 4KH0A 3K35A 4HUQB 2B8WA 4HQ6A 1UR5A 4OAPA 4TMWA 1VBFA 1KI2A 3IDAA 4CTOA 3DFIA 3L04A 4E5YA 5C1DA 1X2EA 3TUZC 1TKRA 2G06A 3U31A 2ZZMA 3H1AA 1WVIA 1OA1A 2Q3BA 3ANXA 4HLCA 3FZGA 4BP8A 4QUAA 1GTMA 4X41A 4V39A 2A84A 3B8HA 3TR5A 4Q7QA 4HRAA 2AIRA 5M5BA 3KT8A 1QVWA 4PSKA 1GXSA 1L5YA 1WU7A 1H5NA 2J9RA 4LS3A 3EXEA 2XUHA 5BSWA 4GWLA 3IXQA 4GYYA 4Q9AA 3D3NA 2Y0CA 3NIBA 4G9GA 4HDNA 4GOOD 3WNZA 3WYGA 1MIOA 4DGSA 3T3DA 2IYYA 4ZIRB 2CYCA 1ZUHA 1KL7A 1DMSA 3BDVA 3GT4A 1MCZA 2WKQA 2Z3ZA 3IMKA 1LF5A 3ANSA 3W3AH 3PWTA 5LP6B 2AXPA 4PVCA 1LK0A 2IPNA 1P7YA 1ZNWA 2ZRDA 1D2NA 5CA0B 1XN1A 3E0QA 2WU1A 3RD5A 1J49A 5FUVA 5B3JC 4FYWA 5HS6A 4ZAGA 4CMGA 2QZJA 4JGBA 4BMPB 1PNVA 2P9GA 4YRRA 3VPXA 4C3UA 1E7RA 3FCUB 4I4TA 4NKRA 5TGZA 5KCZA 3W2GA 3KT6A 2E21A 4E5UA 3JQ6A 1CIVA 1PR6A 5BQXA 1HX7A 3IAS1 4F9FA 4X85A 3K20A 2OZLB 3G59A 1E9RA 2FUKA 5EIBC 4EA6A 4MUNA 5DGXA 3EGIA 4FFLA 3LX4A 1Z2CA 5DYNA 2QTLA 4AY6A 4RWZA 4P84A 4BUCA 3ECSA 3LMKA 4II2A 1LWOA 1XKXA 4C07A 5C5IA 1WP9A 5JCJD 1EXMA 4CDNA 1VG1A 1I4DD 2KHZA 2PS9A 1IVYA 1ZVVA 3H19A 1DJNA 3RHTA 4EKDA 3AM1A 2GH1A 4AMUA 4TRMA 1BGXT 2WJ4A 4L0CA 4GI1A 1ZIDA 1YGYA 2M1ZA 1JDBB 3MGGA 2VNIA 4LW8A 1HA3A 1LZKA 4YREA 4L3OA 4MI1A 3HDQA 1ACJA 4OKSA 1HOTA 1YZHA 4EY6A 4HOYA 4W5OA 4JYMA 4GKJB 2NYUA 3KKKA 1JSLA 1IYZA 3DV0A 4D02A 3HRHA 2GWRA 3GUCA 3A0UA 2JFGA 4R8VA 3ADBA 2B34A 3DXZA 5EIXA 4JBWA 1BKSB 4BBJA 2L17A 1GL6A 5I9NA 2Q7DA 4BCBA 1H5QA 3ODGA 1FFDA 1PNQA 1SXHA 3K9GA 3N0XA 4JOBA 4AQYB 2QROA 1XMOB 3KQMA 2VF4X 3RVMA 4BATA 3DGEC 3ACCA 3REGA 5B6PA 1LZLA 4ZOAA 2XGSA 1E3JA 3U1TA 5EMMA 3C3XA 2WTBA 5FOUA 2EAUA 4DT1B 4OEHA 2HGZA 5JNWA 2QVGA 4HQOA 5FLEX 3VPBA 8GPBA 3WIDA 3SX0A 3LLVA 4I9NA 1KYWA 1IQPA 3HEAA 5K0BA 1HKUA 1M72A 1RHUA 1SIUA 1DBSA 2QMYA 2NUAB 3DWFA 4EG1A 3HO1A 5JSZA 2OHHA 3CEPB 4JC8A 5HRCA 2VQSA 3U17A 1XRMA 1IQ0A 3K9NA 3G5TA 4YFVA 3B9RA 3ACDA 3AZOA 2EW1A 1YQTA 3USCS 5WRFA 3U9LA 2PH7A 2E9SA 1BJTA 3AR3A 3V2HA 4G0VA 3P2OA 4BFSA 2AT1A 3IT0A 5SZKB 1CUEA 4QOSA 2ZVQX 4IOMA 3DG9A 3GFBA 5CT8A 2Q9UA 4OIFA 4KMOA 3UF0A 2VS1A 4MR9B 4ER7A 5IULC 1CF4A 1NNEA 2VHEA 4PLCA 1ML4A 5FNVB 5EJMA 1E1CB 4AY5A 5K03A 2FXIA 1XTBA 4TWAA 1O8CA 1TW2A 2ZTVA 2BM1A 4QDXA 1G20E 4LXHA 1XZMA 4QE3A 4FTWA 4Y2UA 3ZLUA 2WHRA 3AVTA 4PC2A 3KZXA 2E6KA 2HSEA 1N57A 3F7NA 5TT0A 2PUVA 4GEGA 2ZJZA 3HZRA 1ES9A 5JD5A 3M6VA 4FD3A 2RONA 2Z1NA 3Q2OA 3OPMA 1X1QA 1Z2PX 1NHWA 1N7HA 3PQ5A 4G23A 4DHWA 2PUGA 3RGWS 1W1IA 3RSOA 2HRQA 4UOEA 2ZE6A 4G89A 4XIJA 5TXGA 2ZWOA 4KE7A 4BNYA 5EXSA 2QVZX 3FXAA 4EPTA 3OU6A 2WYVA 1XN4A 2ZDQA 1TIBA 4I50F 3NKLA 3KD2A 4A03A 2F3UA 4IRUB 3FBGA 1KJNA 2XWPA 3BAFA 1R3DA 4KSCA 3FSEA 3U60B 2SBTA 3B5IA 2YCLA 2J9ZB 2W2QA 3R3ZA 4ZEVA 2BHRA 4K9DA 2C2KA 5AFSA 3QEAZ 4YJFB 1BCRA 3PI6A 2E3JA 4KV9A 4WXRA 2CT8A 1TD1A 1L4UA 1W5SA 2O1EA 5TQ0A 2NYVA 3JD4A 4DM3A 6PFKA 5KTPA 4X95A 3VU0A 2CFIA 2HIHA 4M88A 4RHTA 5E7JA 3ZQJA 3W9SA 4Y1RA 2QN6A 5JMOA 2ESRA 4YPOA 2W6CX 4IL5A 4MW0A 4PCUA 4FFBA 4AJKA 2IIQA 5CBPB 3ELUA 3KZCA 2CDNA 3EISA 4ZEMA 3OLZA 3V3TA 4F96A 1FSZA 3G68A 2K7FA 4GX1A 2WDZA 1SCQA 4MX8A 3RV3A 4U7HA 1Z5ZA 3DBHA 4Y9RA 3QG1A 2WTXA 3EDCA 1MF7A 3ETNA 3N8IA