3X24B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 120 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
molecule tags Lyase
source organism Rhodococcus erythropolis
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x24B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x24B02
2ZPIB 3X25B 2QDYB 2DPPB 2WSFE 2ZCFB 3WVEB 4ZGEB 3QYGB 3LW5E 2ZZDA 1PSEA 3X26B 2ZZDB 2CZ0B 2O01E 2PVGB 2PVDB 4KT0E 1PSFA 4FM4B 4Y28E 2PU9B 2ZPFB 3VYHB 3A8GB 1DJ7B 4XK8E 4ZGJB 4ZGDB 3HHTB 2DXCA 1QP3A 1UGPB 3A8HB 1JB0E 3X20B 3WVDB 3VYGB 2CZ1B 2PVOB 2ZPBB 2D0QB 2DXBA 4OB1B 2DXCB 1UGSB 2DD5B 3QYHB 3A8MB 3X28B 2PUKB 2AHJB 2CYZB 1UGQB 3A8OB 2DXBB 1IREB 2DD5A 4OB2B 3A8LB 2CZ7B 2DD4A 1UGRB 4OB0B 2PUOB 1V29B 2DD4B 2ZPEB 3QXEB 3VYGA 1AHJB 4RKUE 4OB3B 2WSEE 2WSCE 3QZ5B 1GXIE 2ZPHB 4L6V5 3X24B 5L8RE 2ZPGB 3QZ9B 1QP2A 2CZ6B
chains in the Genus database with same CATH superfamily
3G1JA 3UT1A 2QGFB 2WHBB 3BLHB 4FSXA 1FINB 2X4XA 1YWOA 1W98B 3PO3S 5KH6A 1LOJA 5AT1B 3OA6A 4KRTA 1PWTA 5GMKh 2AT1B 5LJ5e 1N9RA 5LJ3j 4XU2A 1U1SA 3G33B 1OGUB 3I55Q 4FX3B 1VQLT 1D09B 1D3BA 3TEEA 1OKWB 1PCXA 4DQ2A 2NWMA 1MMGA 4QW2A 4HNVA 2RQRA 1H28B 3HFOA 3PVLA 4C5IA 2NUTA 1KD1R 2ROLA 3M4GA 4P5NA 4D8DA 2P4TA 2DLPA 1W1FA 1M2OA 5D6XA 4ELYC 4KULA 5KYYB 3U23A 1M1KR 4N4IA 2QEXA 5GAOr 4ZN3A 4JJNK 1UB4A 3VYHB 4AG1C 1C6VX 1WHGA 2QTVA 3OW2P 3JB9G 4DOVA 4R55A 3I9QA 1M90R 2EGAA 1NLOC 1WJQA 2KSSA 2DMEA 1X27A 2JUFA 4OMLA 3RBBB 1OI9B 3I56Q 2H3JA 4CC7A 1IGUA 2RQTA 1SG5A 2L3RA 4OMPA 3JB9I 3A8MB 2PUKB 2O88A 5LJ5h 2DETA 3QHWB 2L3QA 1JJ2S 3J80E 4MDXA 3SD4A 2BZYA 4IUVA 3HKSA 3SEMA 3TNWB 1YWPA 1UGRB 2OAUA 1B07A 1KK7A 2NUPB 2V1QA 1ABOA 2PUOB 4BB7A 4F7JB 4M7DF 4RMOA 3S6WA 2DEQA 2P0QA 1W6XA 4ELZC 2RQUA 5BNJB 5IHIA 2L0AA 3EG1A 1M3BA 4PFPA 3CCSQ 4M78G 2EUFA 3WXMB 4YOZA 3OMGA 4LN2A 1KG1A 1FXXA 2EQJA 4F7NB 2LZ6B 5CO7A 3MPUB 1VOLA 4LOCA 1FYNA 2AZSA 1FVVB 5HNBB 3VS5A 2NUTB 2G9XB 1TWBA 3X25B 3CCET 3EHRA 4J6WA 2WSFE 1C1AA 2O31A 2C0OA 4J9DA 2DAQA 1N8RU 2KY9A 2PTKA 1JO8A 4JX4A 1G8XA 4MZMA 4ANJA 4M75F 2MI6A 4F6UB 3G6EQ 5DLQE 4II5B 2XIDA 1ZP2A 4QT7A 3CC2A 3R6NA 2QQAA 4CRIA 3OYEA 3CC2Q 1M1GA 3G4SA 4E2FB 1SEMA 4Q5WA 2LJ0A 2RQWA 5HCKA 2HKQB 1PKDB 3FC3A 2RJEA 1M3CA 1E6HA 3KUFA 2PU9B 3HP9A 3EFOA 1RL2A 2I53A 5J39A 1WXTA 2E3HA 1K9MR 1QVPA 4PJJA 1M27C 1VIEA 5CEIB 2PMIB 5CK9A 1K8AU 4A4KA 3NPFA 2UZBB 3QWXX 5M9OA 1YFNA 5GMKl 3WVDB 2KR3A 2L89A 3GBQA 1SSFA 3E1SA 1QVFP 4D8KA 4CC4B 4M75E 1FMWA 2YWWA 1RABB 4CFXB 4J8OA 1N8RR 2LQKA 1UE9A 2FZKB 1YIJT 3OYDA 2J6KA 3MCAB 1ZLMA 4JZ3A 1YITA 5DM7R 1NEBA 4IKFA 3JB9J 3C4SA 4C5HA 5KYNA 2CUBA 4A4FA 3L2RA 2RI3A 3CXCS 1EZZB 2CREA 2LCCA 2O4XB 3H41A 4HXJA 4M78B 1VQPT 3L2WA 4A4EA 3VU3C 1VQ8T 4AKHA 6AT1B 3JCMV 4PLIA 1ENWA 1H8KA 2YUNA 4RKUE 1RACB 3CCLQ 4JS5A 3P8BB 2VUBA 1TH7A 2XDBA 2F69A 4BDYA 4C8QB 4BCQD 2LNHB 3CBOA 4PL6A 3JCMb 1W2BA 3MP1A 2QQBA 3TU4K 3RR6A 2C0IA 2LQ8A 3L42A 2EYQA 4PJOA 2XU8A 1NYGA 3DB4A 4DEXA 4HT9A 3EFOB 2HDAA 1UNGD 1PD0A 3LH0A 4B6MA 4KUIA 1WI7A 5LJ5g 1I5OB 2COZA 2K6DA 5I21A 2ROTA 3JCMc 1VQLQ 2MAMA 2L2PA 4WF2A 2K3YA 1H1QB 2O01E 2DRMA 1GFCA 1K73R 3I5SA 3M03A 3MEUA 3EFRA 2DILA 2QK0A 2DL3A 1HYOA 2C5XB 1IZ6A 2MWPA 1AZEA 4Y28E 4WTOB 1M8VA 1TD6A 1WLPB 4N0AC 3OW2S 1NE8A 3EOCB 1GL5A 3RKXA 2QGGA 2LCSA 3CD6A 1QMZB 1WA7A 3D7SB 1VQOT 3A5ZB 4C92D 1M8MA 3INZA 4M7DB 2CH4A 3OYGA 2FPFA 3CPFA 1G3WA 2DXBA 4J9GA 2QF7A 1KC8U 3RNJA 3CCJQ 3X28B 3CMAA 2ESWA 3C12A 4R0KA 1FMVA 3GLXA 4EMHA 1AWJA 3RMSA 1GRIA 1WHLA 3ASKA 3QJYA 1KFZA 4OB0B 1BB9A 1WXBA 2DTHA 2YUQA 1X75C 3DLLA 1OX8A 4M4ZA 5GAOn 3OY9A 4OMFB 4NL3A 3CCVQ 3CC4A 3JRZA 1HSQA 2HD0A 2LX9A 4C0DC 3BHUB 3EG3A 3CCLT 1OZ2A 2OJ2A 4C92F 1S72T 4Y72B 4G6LB 3NMZC 1RAEB 2K5IA 3PGGA 2XICA 5GANh 3QHSA 3JB9H 4AFZC 1VQ9T 2OTLQ 2YDLA 5AYFA 1JQQA 4J6XA 4F7UE 1P5EB 4FCYA 1ZSGA 1VA7A 4XQ3A 4QVZA 4Y92A 1PD1A 2QFZA 4EOPB 1I0CA 1IHVA 2DA9A 1NZ9A 3EGDB 1WGSA 4PJOE 5CVIA 1UFFA 1WHHA 3PTAA 3HO8A 4BBRM 4E7JA 1TTHB 3QKJA 1SPKA 1PNJA 2X4JA 4YOOA 2JTFA 2WACA 1M9SA 3VS1A 2P0PA 4E7KA 3AHUA 1OV3A 3VS2A 3PVQA 2IPOB 4RTWA 5CR2A 1Q86U 3CCQQ 5FU6C 4D6WA 3CCQA 5GMKm 3PIOA 1QVGP 4EPCA 4EMGA 1JJ2A 5FRNA 5IHYA 1UHFA 1QMCA 3VUBA 1NPPA 3QSUA 3ME9A 5GAN4 1WIEA 3G71A 3CC7Q 5FWCA 5LL6S 1VQOA 1VQ7Q 2BZ8A 2EYYA 1YNZA 3H9NA 3MI9B 1SRMA 2EQMA 2FEIA 3M59A 2UZDB 2E5KA 2D8JA 2HQEA 4HLQA 4L5GA 4C0FA 4Z89A 1KIKA 2YRCA 2PK2A 4M7AE 1B34B 3S3OA 2E41A 5ECAA 4C8QF 3SWNB 5KYUB 4NOYA 3O0GD 2GCXA 4XTZA 4M75C 4TVRA 1GBRA 3C95A 3CCUT 2Y90A 1Q81C 4QQGA 4NL2A 5I11A 3JCMJ 1QQJA 3DL1A 1OL1B 3PIPA 1MV0B 3L2ZA 4ELJA 2F2VA 2RI5A 5LJ3e 1BYMA 3DOGB 3NDQA 2CT3A 1OULA 2XMFA 2DXTA 2QEXT 4MMKA 1X6OA 2CKKA 1AWXA 2HNIA 1RI9A 2Y4YA 3URGA 2EQIA 2M9UA 1Q86R 1ZUUA 1BIAA 3UF4A 3OYAA 1OPKA 5LJ5f 1AWWA 2X1NB 2K2VA 4DBRA 4EOQB 4M78E 3HZJA 3I56T 3NFCA 1MV3A 3CMAQ 1UHCA 1RLQC 2ZZDA 4RCCA 3NTKA 3ZFJA 5GAMf 3FIFA 1Q7YC 4PJMA 5CQXA 4M7DC 2W9FA 5IXFA 4JRQA 3X26B 1X69A 1Y7XA 2V8KA 1B7TA 4A4GA 4RTUA 1ZBXA 2VB6A 4FIBA 1CKAA 2KI7A 2V1RA 1R77A 2ZAEA 1S72A 2RH2A 3LWHA 4M77E 3VUZA 2VYTA 5CKBA 4FM4B 3QO3A 2FRWA 5I22A 2FPEA 1KJWA 1VQ5A 4JS4A 1YJ9Q 2RJCA 2VKNA 1FX7A 1QVGA 3CCQT 1K9MC 3BG3A 2DF6A 2DBMA 1KQ1A 3CXCA 2JN0A 4OMMA 2RPNA 1H4LD 5HK0A 2NUZA 3EG0A 1IHWA 1BCMA 1ZUKA 2CP5A 4F16A 4M7DD 1M2VB 1D0ZA 5GAMj 2M16A 3VJPA 1VQNA 5CYIB 4LDVA 5J3BA 2XKOC 4QVCA 1B34A 3H8ZA 4M6VA 4CXAB 4CFVB 3EG9A 4XTUA 5CKDA 1VQ8Q 5FRMA 1R8OB 3HSBA 2IW8B 5HVYB 2GTJA 3CCUA 1XQHA 3T9NA 3C0CA 1OI1A 4QSHA 4Z8AA 1ABQA 1BCOA 2BS4A 2QG9B 1YI2T 1GFDA 1D3BB 5GANj 4YOSA 3EAEA 1JXOA 2W0ZA 1KC8R 4E7LA 4CI0C 2IIMA 2M0OA 2OTLT 3CBPA 3JCMP 1VQ9Q 2QI2A 3LWIA 4XU0A 4BE0A 3QPHA 2C0TA 5HBEB 3OYBA 3M0PA 3TCJA 1Y96B 3M0RA 2HSPA 1G83A 4J7FA 1YIJQ 2L3PA 3VRYA 4BCPB 5IH2A 4M77G 3OW2A 1D1CA 3CQTA 1K0XA 4FT4A 5FLXE 1VINA 1UNHD 2G6FX 4JJBA 5LJ3g 1K4US 1GBQA 5GANe 2I0NA 4M77A 4BCQB 1BI1A 5IF1B 3O5ZA 2DTOA 2J6FA 3MEWA 1JKWA 2QQ8A 1BK2A 1K73C 4VUBA 2L8DA 1QCFA 5HY6A 3RKWA 2OX7A 2QDLA 4C8QG 1B3QA 1NLPC 1YBYA 1I81A 4BE2A 4FW1A 2JS2A 3OYMA 4M7DA 3P8DA 4EMKA 3LX7A 3CD6Q 4C92B 4HL4A 3BFMA 2YLBA 4M78C 1X01A 2W10A 1PKTA 1PHTA 4F04B 3ZBDA 3VYGB 3CMET 4M7DG 1PG5B 2K3BA 4C92E 3GOXA 1QWFA 2LNVA 2RQVA 2EGCA 3PFSA 2B86A 5KCOA 2YRVA 2DIQA 3V8KA 1G3NC 3M58A 1T0JA 4NSTB 3N5BB 4F7SB 2BIVA 2KE9A 4OB2B 3O8VA 3THKA 5LJ3d 2COYA 5J26A 2KT8A 1VQNT 2ZPEB 4EOKB 1H26B 2I40B 2LX7A 3OBWA 4DBHA 1QCNA 1U06A 3BE3A 3BDUA 4XU3A 1KSWA 1K9MU 1VQ5Q 2VWFA 4TTHA 3CD6T 4M77D 2KK4A 4B9WA 4PLLA 1JJ2P 1TFBA 5HBJB 1PSEA 1QP2A 2YSQA 2MOXA 4HVWA 2EJGA 3CMEQ 3E9FA 3WVEB 5EFQB 2F5KA 9ATCB 3UA6A 2AKKA 2SRCA 4EOOB 2VVKA 1LCKA 3QYGB 2DKGA 2FL7A 1Q95G 2X51A 3QYBA 3CPWS 3RIRA 1NBEB 4EDUA 3L2VA 2M02A 3M57A 5L2WB 2MCNA 3PMTA 3HBLA 5L23A 1JU5C 4PK4A 3J7AF 2JTEA 4M7AF 3R6OA 1VQ6T 4M7DE 4XAXB 3V7CA 5IDPB 1VUBA 1K73U 2V8JA 2HCKA 3OYFA 4JDSA 4AKIA 1GUXB 2VXFA 1UECA 1QWEA 1KQ2A 4CFMB 2WEVB 3OYHA 1YN8A 4M77C 1JB0E 4JX5A 3MP8A 2RHZA 2CZ1B 4XTVA 2ZPBB 2EYXA 4JX6A 3C94A 4ROCA 3UWNA 3QYHB 2EAYA 4C0ZA 2A36A 1F5QB 5KYXB 4AKGA 3RMQA 4EOSB 3I55A 1UGQB 1BI3A 2IW6B 4JLIA 3RKYA 1M1KU 4GLMA 3A8LB 2CGHA 2DERA 3OMCA 1Y71A 4AFQC 2RN8A 2DJQA 4E7ZA 2ED0A 2C06A 2M1HA 2IW9B 4JRPA 3M4YA 4V2SA 1R0CB 2RK2A 1Q81R 5HKCA 1NJIR 2GGRA 5A0DA 2RK1A 2K9GA 4X34A 1V76A 3HPWA 2Z0WA 1URCB 1W4SA 2PJQA 4A53A 5GAN3 1WX6A 3FB9A 2LCLA 2EYWA 2F2WA 4ZGEB 1PRMC 2FYKA 2HL3A 1Q86C 2H3EB 3H0IA 1Q7YU 7AT1B 3MHXA 2W2HA 1YJNT 5GAN6 1YJWA 5KE3A 4N4GA 3JCMd 2ZGWA 1C0MA 2F5TX 2BS2A 1KHCA 2JMAA 1VQ4A 3VKGA 3EJ1B 4AMCA 2CZ0B 1Q7YR 3G7ZA 4J9HA 2R58A 5DQVA 4MZPA 2K7AA 4J6YA 4FYYB 2EKHA 4IIOA 1UEBA 4II1A 3JB9F 2C5VB 3CCUQ 2LP5A 1PM3A 1MMAA 4LDXA 2KVQG 1D0YA 3V7SA 4FYWB 2WIPB 3V8LA 4QKUA 1Y57A 5KYWA 2FG0A 3A8HB 5FROA 3OQ5A 1BI0A 3BHVB 2LJ1A 3MJXA 3GTMS 1ZBJA 1JEGA 5GAN2 5GANf 4OB1B 3EIDB 3REAB 2OTJQ 2C4GB 3MEAA 4FSSA 3BDLA 2UUEB 1UG1A 2NLUA 4BI3A 1UTIA 4LDWA 4XU1A 2F2XA 2WXVB 4OMOA 5IDNB 2DD4A 4F7UF 5GAMh 1QCOA 1VQPA 3OB9A 2DEUA 4BBSM 4L59A 1WYXA 4DEYA 5LJ5j 1ZA2B 1ZQ1A 3BG9A 2E6NA 3QG1A 5FWBA 2EBPA 1N5ZA 1RUWA 2ZPHB 3LLRA 1H1SB 2X3WD 4JUVA 5L8RE 2B9RA 4PJLA 2O9VA 2QDYB 3S3NA 1RADB 1KC8C 3QJ6A 3MIAB 2A28A 4JLGA 2KYBA 1HD3A 1NYFA 4BCGB 3VV0A 2LT1A 5IHKA 2FB7A 3M56A 1O75A 4M77B 1VQ4Q 2E1HA 2CDTA 1F1BB 2DIGA 4YTLA 1VQKQ 2E64A 4BACA 4HT8A 3EGDA 5A2QE 2XDPA 4F17A 1VOMA 1VQ4T 2D0NA 2X4WA 3RGFB 3JCMQ 1H1PB 3OYIA 3EGXA 3QDFA 2QXFA 5CKFA 2M51A 2HBPA 1ZX6A 4PJOG 1VYUA 8ATCB 2KGTA 1XOVA 2E10A 2JXBA 4M75G 2RHXA 4C8QD 1M1FA 4HKEA 2ZPFB 2WJ9A 2W99A 3DB3A 2RB6A 2BUDA 2EWNA 1LVKA 1JXMA 1RLPC 2GFUA 4F6WB 3FRNA 3QWYA 3RESA 1YJNA 4RG2A 1UGPB 3P8HA 1OQKA 2RHUA 3GP8A 1NJIU 3JCMe 1Y07A 4ME7A 3FLGA 3AT1B 3QUIA 1SSHA 1WDXA 4J7IA 4PKCC 3JCMW 1QVFS 1YHQQ 2D9TA 1RAFB 5IXBA 4CFNB 3KFVA 3TNIB 4BE1A 3FJ5A 5GMKe 1OX9A 1M4ZA 2K57A 2K3XA 3OYNA 2EGEA 2CZ7B 1VQMA 2XDDA 1FKMA 4CFUD 1H3ZA 1TUCA 4LD9K 3CEYA 2VGMA 2RO0A 1X6BA 2CSQA 2HBWA 1KQSS 2DD4B 2E12A 4J83A 3VYGA 4BY6C 3CC4T 3PE0A 3JB9D 1QLYA 4X9DA 2HQHA 1E9HB 3MO8A 1GY3B 2LRQA 3QZ5B 2KAFA 4RUGA 1GXIE 4MIMA 2RHIA 1VQ9A 4ZN1A 2A3LA 1Y0MA 2QGSA 4OR5B 2E5QA 1YHQT 1H92A 4HVUA 5GAMe 1VYVA 2L3SA 2P0KA 1SRLA 4EOJB 2E4HA 2Y4XA 2J7IA 1Z9QA 3OS5A 2JVVA 1C9BA 3NHNA 3SDZA 1IRXA 2RI2A 2W96A 2ED1A 2JT4A 4BCKB 3HRTA 1WZOA 1H25B 4QQ6A 1MNEA 2RA2A 4DBQA 2ZZDB 4BI4A 3LGFA 2FVUA 2YUPA 3TW7A 4M78D 5LJ3f 4EONB 5GAMg 4AT1B 1LNXA 1OEBA 3EH2A 2AZVA 1OU8A 4BCMD 2PVDB 4PJOB 1JOWA 1G3TA 1ZUYA 1VYWB 4M75B 1OIUB 2MIOA 2NYSA 5ACBA 3EGXB 4C0DB 4RTYA 2RD1A 4E7SA 1MGQA 1SKUB 2NUPA 4AFSC 4KH1B 2EJ9A 5DLOA 2A37A 4M75D 3ULRB 3X20B 3CCEQ 5IAYA 2EFIA 3EG9B 5KYXA 1YJ9T 3E19A 3M0SA 4IIMA 1OPLA 2D0QB 3TW6A 4LUEA 2OTJT 2LC4A 1AWOA 3JCMX 1IXDA 3MKDA 2EJFA 1BU1A 2K5LA 4DOWA 4M7AD 1IB8A 3OYCA 4BCFB 3A8OB 1U5SA 1SHFA 2JTMA 2QDJA 1VQMQ 4JPBW 1IREB 1VQKA 4C0GA 1QVGS 2V8IA 4PJOC 4BUGA 2JJ9A 1CKBA 1K8AC 1HJDA 5IN1A 2CP6A 3UDCA 2GNCA 1RAHB 3B57A 2R57A 1WXUA 1E6GA 2MK5A 2DVJA 3CCMA 2HMAA 1VQ6A 3M5AA 3SFMA 4OGCA 5FW9A 3VS4A 1K76A 1T3SA 4EIKA 1PRLC 4C5GA 1ZSZB 4M77F 4UC4A 2F2CA 1IGQA 3JV3A 4HNTA 1NJIC 2OAWA 1N6AA 1YJNQ 2EKOA 5CKEA 5IT9E 2EVRA 2HL5C 4OGRB 4KRDB 1YHQA 1VQMT 2FHDA 4CFWB 4FYVB 1Q82C 2HAXA 2DL8A 4AG2C 2C6TB 1AVZC 2HKNA 4R56A 3SB2A 1WHKA 1H641 2EQKA 2RF0A 3I55T 3HFNA 4FYXB 1NEGA 1SF9A 1WHMA 2F1LA 2PZ1A 3REBB 2IN3A 3MEVA 4ESRA 2EPDA 1D0XA 1H3HA 2RHYA 3CPWP 2HZYA 3GF5A 3UPUA 1U3OA 2G3RA 1H1RB 1PSFA 1RI0A 3DTOA 2DYIA 3ZEHA 4C92G 2D6FA 4HCZA 1PKSA 4MFDA 2GF7A 2MWOA 1TS9A 2BPMB 4M7AG 4DA4A 2GQIA 1M30A 2DXCA 2O4XA 4LDYA 5D6WA 5GAN7 4BI8B 4BY7X 3JCMg 1WQ7A 4EMKB 2CCHB 4OVAA 2FZGB 1G3YA 2CSIA 1N27A 3CCJA 2COWA 4EOMB 1UGSB 2DD5B 2PHGA 4JRKA 4LDUA 1QW1A 3TSZA 2AIRB 3VS6A 1YJWT 2W9ZA 1G3SA 1OL2B 2WPAB 4BCOB 4XTWA 3HTRA 5CAIA 1JBMA 4GBQA 2CT4A 2CH4W 1T3LA 3MY1B 1XJWB 4IURA 3QHRB 3M9QA 1Z9ZA 4A63B 1VQ6Q 4BXXX 4O5VA 4M78A 2VGNA 3LQ5B 4LUDA 2G77A 3HL8A 3OS0A 1YJ9A 5I5ZB 2WSCE 2ENMA 1MHNA 2KMTA 3DDQB 2IVXA 4EMKC 3L2UA 4KGXB 2KNBB 3CCMT 3FEOA 2ABLA 3A98A 5KYUA 3SWNA 2OTLA 3NGPA 2KRNA 2ZPIB 2CUDA 2YT6A 2DM1A 2XHCA 3HB9A 2DVEA 5GANd 4XTYA 5GAOl 3BLQB 3BHTB 1RAIB 3H0FA 2CP2A 2AK5A 2KRSA 3F70A 3V7RA 1M90U 1U1TA 1VQNQ 4PJOF 2QA4Q 5EC7A 2PQWA 2WMAB 2R7GA 4X9CA 2PVGB 4EC9B 4BY1X 4J9CA 4I3ZB 2KDSA 3TNHB 1CSKA 1EFNA 4ATOA 5CKHA 5GJVB 1QVFA 3GIBA 1UUEA 3CPWA 4MZTA 2XK0A 2CJMB 5C0MA 3ER0A 1KHIA 2J05A 5EG2A 1K1ZA 3M0TA 1TUDA 4NC6A 2HEQA 5A0GA 4EORB 1KXUA 3TQ7P 3UATA 4E7IA 3CMEA 4ROEA 2P4RA 5LQFB 4K11A 2X35A 2LJ3A 2J06A 2DXCB 2ECZA 1XO2A 4IUTA 2KXDA 3OBYA 3JCMf 2DZCA 2K4YA 2JM8A 2DXBB 4JRIA 1FWZA 2GBQA 1YITT 3RDVA 2KEAA 2VC8A 1V1CA 2ATCB 3VKHA 3LGLA 2CP7A 4E7HA 2MPXC 1V29B 3S3MA 4BD3A 3CC4Q 1D3UB 1AHJB 1H27B 1VQ8A 2CCIB 1H24B 4AI6A 2P84A 1Q81U 4KUDK 4EC8B 1WFWA 2WSEE 2IVWA 2D8HA 3QIIA 1LPLA 5IHNA 3JAME 5GMKi 2X3XD 1O9KB 2KR6A 2LT4A 1Y96A 3PT9A 1M2VA 2CZ6B 3TSWA 1QLBA 3J81E 1UJYA 3VKIA 1WHJA 1YCYA 4Z02A 1X2KA 2BE9B 2GFAA 1N9SA 4N4HA 3F5XB 1KD1U 3VS3A 4YC3B 2X4YA 5CQYA 2H8HA 3E9GA 4IUQA 2FRYA 2DL7A 3G6ET 1MMDA 1G5VA 1VYTA 4NS5A 5DY9A 4BY6B 4QQDA 4HA8A 3G4SQ 1RAAB 3GPLA 3Q1JA 5CIUA 3KBGA 2LMJA 2YXYA 1QKWA 5GMKj 3HRUA 2UZEB 5GAOq 4FL6A 1I1JA 3M54A 1DJ7B 2JW4A 3EGUA 2K2MA 4PFZA 4HCBA 3I5RA 2J6OA 1TSFA 4FW2A 4M7AA 1TXQA 2K5FA 1AT1B 3ZL7C 1GH6B 2C5NB 1N4MA 4OMNA 2HQXA 3H0HA 3OYLA 1JSTB 3BG5A 1A0NB 4J9IA 4M75A 4Y91A 1YJWQ 1VQLA 2A7YA 3VS0A 2YLCA 1YITQ 1EX4A 1O9KA 2E70A 3M0UA 5CCAA 4C92A 4C8QC 1ZSZC 1J3TA 2XI9A 4J9EA 4PFOA 3DJBA 1ZSZA 2RMOA 1SHGA 1BU2A 3DKMA 5C6SA 2RNAA 4C8QA 1K8AR 4OB3B 1MUZA 3RUXA 3RERA 2YUOA 3OSSC 3H4CA 2KYMA 4MDWA 8AT1B 1KQSP 2O2OA 3QZ9B 1UDLA 2MYSA 2MMPA 2DPPB 2DXUA 4BDZA 2EYZA 3CCRT 1OKVB 2R5MA 4JJCA 4M7AC 4PNOA 2DL5A 4RTTA 1I5LA 2OTJA 2JZ2A 1MNDA 3LH5A 1AD6A 2XG8D 1KD1C 1Q82R 4J5YA 5I2SA 4HCKA 3OS2A 1PC0A 2MF2A 2KT1A 2QAZA 2WIHB 2CP3A 1M1KC 3BW1A 4LXCA 5GAOp 1OU9A 1AISB 3VS7A 2JGZB 1YCSB 3EFSA 1W2BP 2DMOA 2GTOA 2BKZB 4KT0E 3TREA 2K79A 4MFEA 2KBTA 1M90C 5GAN8 1QKXA 4ZTJA 2UZLB 1X43A 2DL4A 3OYYA 3QBYA 1X6GA 3HRSA 3CCRQ 3FJPA 4ZGDB 4BCIB 3CCEA 1QP3A 1NPRA 2XD0A 3G71T 3GNGA 2FPDA 1GCQA 2PVOB 2PNIA 3BY7A 3OYKA 1UGVA 5FU7B 5GAOm 2V22B 2LW4A 4IMYB 1D1BA 2V26A 4QVDA 2KROA 2AHJB 5HQ0B 5LJ3h 5A0LA 2B8AA 2DNUA 3EHQA 2LTOA 2BE7D 1WJSA 3H6ZA 2KMGA 5FU7C 3CCVT 2HSEB 2JNGA 3A1PA 1ARKA 1I4K1 4CRLB 4IUUA 4RCBA 1WJRA 4E47A 3META 2L5QA 1OIYB 1M5Q1 1S72Q 1ACMB 3QXEB 1AZGB 1BI2A 4WCIA 1E7PA 5GANg 3UA7A 2RJFA 4RODA 3DLMA 3MP6A 2QEXQ 1AD5A 1RAGB 1OOTA 2E3IA 4M78F 1LJOA 2ZPGB 3QWLA 1I8FA 2VV5A 4N0AA 1KQSA 4EOIB 1UJ0A 3G71Q 2ZCFB 5EJCA 2BZXA 1VQOQ 1VQ7A 2DRKA 2WFYB 1YIJA 1M3AA 3I56A 4PJOD 3CCJT 3LW5E 3KXTA 1XTDA 3L2QA 2GQVA 2OI3A 4IUPA 1WQWA 1NM7A 2DJZA 2KXCA 3I35A 4C8QE 4E6RA 1GCQC 4BCHB 2BKDN 1TUGB 2R5AA 2QA4A 1UNLD 2KRMA 4OGEA 4OMQA 3IQLA 1O9SA 2DYBA 1T0HA 4FT2A 2DBKA 3M53A 4HNUA 3SHWA 2D1XA 4F14A 2LQWA 3CXCP 2FO0A 4RG8A 3CCSA 2YRDA 3A8GB 2EIFA 4MMLA 5I2MA 4XK8E 1VQ5T 3KHIA 2LDMA 2JMCA 3M55A 3CCRA 1YP5A 2RJDA 3OSVA 4F70B 4ZGJB 4BCND 5GAN5 4CFUB 2QQ9A 4J9BA 2VASA 1OYXA 1N8RC 1BKBA 4ORZA 4LNPA 3OS1A 4F7UA 5LMKB 2WMBB 4A54A 5HK3A 3CC7A 1IO6A 3NTIA 2QYZA 4DBFA 3GNFB 5HBHB 2QTXA 2CYZB 3SWNC 5KCHA 1E7OA 4CC2A 3EG2A 1R0BG 1VIFA 1I07A 3JSCA 2AKLA 3PNWC 1X2QA 4CC3A 2X9HA 4B9XA 3NTHA 4ELLA 1Q82U 4OF1A 1TOVA 5KYWB 3CCVA 5DQWA 2DFUA 2E6ZA 1HXDA 3CCMQ 1WNLA 1XNIA 2EQUA 4RTZA 2BTTA 2FZCB 1YI2A 4BCNB 2A0FB 1FMKA 1S1NA 5D6YA 4L6V5 3QDRB 1JRIA 4HCCA 4Z6YA 3CBMA 4LE9A 1G2BA 3M0QA 4RTXA 3JCMh 4UN0A 4C92C 1BIBA 4RTVA 1ZHIA 4KGVB 2QQRA 3CMAT 4O6JA 3V8JA 3QYEA 4Z88A 4EOLB 5ICPB 2C5OB 1MMNA 2CS7A 4JJDA 2PK9B 3MY5B 4BCMB 3PMIA 1W2BS 4KBMB 5KE2A 4C5EA 5KYYA 2VXEA 2M0YA 4F7UB 4F7LB 5FU6B 2LVMA 4BCJB 2BS3A 2DK3A 5D7UA 1AOJA 3VRZA 3CCLA 4KGZB 3BLRB 2DTIA 4M7AB 2RM4A 4ZNXA 1U8RA 3LYIA 1VQ7T 1TU0B 2JM9A 2LQNA 2O9SA 3E2UA 4JZ4A 4HVVA 3TVTA 3HHTB 2E65A 1ZA1B 5LJ5d 4F6SB 3L1AA 1GUXA 1BBZA 2CP0A 5GJWB 2KQWA 5FGKB 1EIFA 3OYJA 3POMA 2QA4T 1JSUB 4ZTFA 1HK9A 2A08A 3CC7T 5GAMd 2DO3A 4J9FA 2QASA 1WPYA 2QQSA 1VQKT 4KH0B 2DD5A 2DE0X 2DX1A 3TN8B 2YHTA 4OP0A 3G6EA 1K0SA 4KRCB 4FU6A 4X1VA 4GLKA 1P92A 3CCST 2IG0A 2JS0A 2EW3A 1W70A 1VQPQ 3K7AM 3FDRA 4F7UG 4LD6A 1NG2A 4GY5A 3CC2T 3DDPB 2JOYA 4PJNA 1OZ3A 4XTXA 2SEMA 2I2LA 3G4ST 1TG0A 1GCPA 1YI2Q 1AEYA 1K9AA 2DZ9A 1D1AA 4AFUC 3X24B 4A4HA 3EH1A
chains in the Genus database with same CATH topology
3UT1A 5LJ5f 3J81E 2QDYB 2K2VA 4FSXA 3VKIA 3S3NA 1YCYA 4M78E 4Z02A 1KC8C 3HZJA 2X4XA 3QJ6A 3I56T 3NFCA 4JLGA 5KH6A 1LOJA 2GFAA 3OA6A 1N9SA 2ZZDA 4N4HA 3NTKA 4RCCA 3ZFJA 5GMKh 3VV0A 3FIFA 5GAMf 2LT1A 1Q7YC 1KD1U 2FB7A 3M56A 1O75A 4M77B 1N9RA 5CQXA 2E1HA 1U1SA 2X4YA 4XU2A 5CQYA 2DIGA 4YTLA 5LJ3j 4M7DC 3E9GA 4IUQA 3G6ET 1VQLT 4JRQA 1D3BA 3TEEA 3X26B 2E64A 4DQ2A 4BACA 4HT8A 1G5VA 1Y7XA 2V8KA 4A4GA 4QW2A 4HNVA 5A2QE 1ZBXA 2XDPA 4NS5A 4FIBA 3HFOA 4C5IA 1VQ4T 5DY9A 2X4WA 4BY6B 4QQDA 3JCMQ 3M4GA 4P5NA 1S72A 4HA8A 2P4TA 3GPLA 2RH2A 3Q1JA 5CIUA 3OYIA 5D6XA 2QXFA 3KBGA 4M77E 5CKFA 3VUZA 4KULA 4ELYC 3LWHA 2VYTA 5CKBA 2HBPA 4FM4B 4PJOG 5GMKj 3HRUA 1XOVA 3QO3A 4N4IA 2E10A 5GAOq 4FL6A 4M75G 4ZN3A 2RHXA 4C8QD 1M1FA 2QEXA 4JJNK 5GAOr 4HKEA 2ZPFB 1UB4A 3VYHB 1VQ5A 3M54A 1DJ7B 2WJ9A 4JS4A 3DB3A 2RB6A 2BUDA 2EWNA 2RJCA 3JB9G 4HCBA 2GFUA 4DOVA 4R55A 1FX7A 3FRNA 3RESA 3CCQT 1YJNA 4RG2A 1QVGA 1WJQA 2KSSA 4M7AA 1K9MC 1UGPB 3P8HA 2K5FA 3BG3A 2RHUA 3GP8A 1KQ1A 1NJIU 2JUFA 3JCMe 1Y07A 3CXCA 2JN0A 4ME7A 3FLGA 3QUIA 4J7IA 2H3JA 4PKCC 3JCMW 2HQXA 1QVFS 3OYLA 2L3RA 3JB9I 3A8MB 3BG5A 2PUKB 2D9TA 5HK0A 4M75A 5LJ5h 4Y91A 4BE1A 5GMKe 3J80E 1JJ2S 1VQLA 4MDXA 2A7YA 3SD4A 4IUVA 1M4ZA 2K57A 2K3XA 2YLCA 3HKSA 3OYNA 4M7DD 1VQMA 2CZ7B 2E70A 2OAUA 1UGRB 2XDDA 5GAMj 1FKMA 2M16A 3VJPA 4BB7A 5CCAA 2PUOB 4LD9K 1VQNA 4C92A 4LDVA 5J3BA 2XKOC 3CEYA 4C8QC 4QVCA 2VGMA 1B34A 4RMOA 4M7DF 3S6WA 2DEQA 2P0QA 2RO0A 3H8ZA 4M6VA 4ELZC 1KQSS 2XI9A 4XTUA 5FRMA 5CKDA 2DD4B 1R8OB 2E12A 4J83A 3VYGA 4BY6C 3CC4T 3HSBA 3CCUA 3DKMA 5C6SA 3JB9D 4C8QA 1XQHA 3T9NA 4OB3B 4M78G 3RUXA 3RERA 3WXMB 3OMGA 4X9DA 1OI1A 1KG1A 1FXXA 2EQJA 3OSSC 4QSHA 3MO8A 3H4CA 2BS4A 1YI2T 5CO7A 4MDWA 1D3BB 2LRQA 3QZ5B 2KAFA 5GANj 1GXIE 4LOCA 3EAEA 4MIMA 2RHIA 4E7LA 1VQ9A 4CI0C 4ZN1A 2OTLT 2A3LA 2M0OA 3CBPA 3JCMP 1W2BA 2E5QA 3QZ9B 2QI2A 1YHQT 3LWIA 2MMPA 4XU0A 3X25B 3CCET 2DPPB 2DXUA 4J6WA 5GAMe 4BE0A 2P0KA 3QPHA 4BDZA 2WSFE 3OYBA 3TCJA 3CCRT 2Y4XA 1Y96B 2R5MA 2DAQA 4M7AC 1N8RU 2KY9A 4J7FA 3OS5A 4PNOA 2JVVA 3SDZA 1I5LA 2OTJA 2JZ2A 2RI2A 4M77G 3OW2A 4JX4A 3HRTA 4MZMA 4FT4A 2XG8D 5FLXE 4M75F 4J5YA 2MI6A 5I2SA 1KD1C 5DLQE 3OS2A 2XIDA 4QQ6A 2RA2A 5LJ3g 2ZZDB 4BI4A 3LGFA 2FVUA 2MF2A 5GANe 3CC2A 3TW7A 2QQAA 4M78D 5LJ3f 4M77A 4CRIA 3OYEA 1M1GA 5GAMg 3BW1A 3G4SA 1M1KC 1LNXA 5GAOp 1BI1A 4Q5WA 3EFSA 2DTOA 2PVDB 3MEWA 3FC3A 4PJOB 2RJEA 1G3TA 4KT0E 3KUFA 2QQ8A 4M75B 1K73C 4VUBA 3TREA 2L8DA 2PU9B 3HP9A 3RKWA 5HY6A 4C8QG 4MFEA 1RL2A 1M90C 5J39A 1YBYA 1I81A 5GAN8 4BE2A 4ZTJA 4C0DB 2RD1A 3OYYA 1QVPA 3OYMA 4M7DA 3P8DA 3QBYA 1MGQA 3HRSA 4EMKA 3LX7A 1VIEA 5CK9A 4C92B 4HL4A 3FJPA 1K8AU 3BFMA 4ZGDB 2EJ9A 4A4KA 5DLOA 2YLBA 4M78C 3CCEA 1X01A 5M9OA 1QP3A 4M75D 3X20B 5IAYA 2EFIA 3WVDB 5GMKl 1NPRA 2L89A 2XD0A 3ZBDA 1YJ9T 3VYGB 1SSFA 3E19A 3E1SA 3GNGA 3G71T 3CMET 4M7DG 2PVOB 4M75E 3BY7A 3OYKA 2D0QB 5FU7B 3TW6A 5GAOm 4C92E 3GOXA 2LNVA 4J8OA 2OTJT 2LC4A 3PFSA 5KCOA 4QVDA 2YRVA 2DIQA 3JCMX 2LQKA 3V8KA 1YIJT 2AHJB 3OYDA 5LJ3h 2EJFA 2K5LA 2B8AA 4DOWA 3MCAB 5A0LA 3OYCA 3M58A 4M7AD 3N5BB 2LTOA 3A8OB 1YITA 2BIVA 5DM7R 2JTMA 2QDJA 1WJSA 3H6ZA 4IKFA 1IREB 4OB2B 3JB9J 1VQKA 2KMGA 3C4SA 3O8VA 4C0GA 1QVGS 5FU7C 3CCVT 2V8IA 4C5HA 2JNGA 4PJOC 4BUGA 5LJ3d 1I4K1 4IUUA 4A4FA 1K8AC 4RCBA 2RI3A 1WJRA 5IN1A 5J26A 2LCCA 2O4XB 3UDCA 4E47A 3META 3CXCS 2L5QA 2R57A 4M78B 1VQPT 3L2WA 1M5Q1 3VU3C 4A4EA 1VQ8T 1VQNT 2ZPEB 3QXEB 4AKHA 1BI2A 3JCMV 1E7PA 5GANg 4PLIA 2RJFA 3OBWA 3CCMA 4RKUE 4JS5A 3DLMA 1VQ6A 3BDUA 3M5AA 3P8BB 3MP6A 4OGCA 3SFMA 4XU3A 4C5GA 2VUBA 1TH7A 1K9MU 2XDBA 4M77F 2F69A 4BDYA 4M78F 4C8QB 4UC4A 1LJOA 3CD6T 3CBOA 4M77D 4PL6A 3JCMb 2KK4A 4HNTA 2ZPGB 3MP1A 4PLLA 1QP2A 1PSEA 3QWLA 2QQBA 1I8FA 4B9WA 1N6AA 3TU4K 2VV5A 4N0AA 1KQSA 2EKOA 5CKEA 2LQ8A 3L42A 2EYQA 5IT9E 4PJOA 2EJGA 2XU8A 3E9FA 2ZCFB 3WVEB 3DB4A 5EJCA 2F5KA 1VQ7A 4HT9A 1YHQA 1VQMT 2FHDA 1YIJA 3I56A 1Q82C 2HAXA 3LH0A 4PJOD 4KUIA 3QYGB 2DKGA 4R56A 3LW5E 3KXTA 3CCJT 3SB2A 1XTDA 3L2QA 2FL7A 2GQVA 4IUPA 5LJ5g 3QYBA 1H641 1WQWA 3CPWS 2DJZA 3RIRA 2EQKA 5I21A 3JCMc 3I55T 2MAMA 3HFNA 4C8QE 4EDUA 3L2VA 3M57A 2BKDN 2K3YA 4WF2A 3PMTA 2O01E 2R5AA 2QA4A 3HBLA 3MEUA 4OGEA 3MEVA 3EFRA 3J7AF 1O9SA 2RHYA 4FT2A 3GF5A 3UPUA 3M53A 2G3RA 4HNUA 4M7AF 1IZ6A 2MWPA 1PSFA 1RI0A 4Y28E 3R6OA 1VQ6T 1M8VA 4M7DE 3OW2S 4N0AC 4XAXB 3V7CA 1NE8A 1VUBA 4RG8A 3ZEHA 3CCSA 1K73U 2V8JA 3RKXA 4C92G 3A8GB 2EIFA 4MMLA 5I2MA 2D6FA 4HCZA 4XK8E 3OYFA 1VQ5T 4JDSA 4MFDA 3CD6A 4AKIA 3KHIA 2GF7A 2MWOA 2VXFA 2LDMA 3M55A 3CCRA 2RJDA 3OSVA 4ZGJB 1VQOT 1KQ2A 4M7AG 3A5ZB 4C92D 4DA4A 5GAN5 2O4XA 2DXCA 4LDYA 2QQ9A 5D6WA 5GAN7 4BI8B 4M77C 1JB0E 3OYHA 4JX5A 1OYXA 3INZA 1BKBA 2RHZA 3MP8A 1WQ7A 3JCMg 1N8RC 4M7DB 4EMKB 3OYGA 3OS1A 4F7UA 2CZ1B 3CPFA 2ZPBB 1G3WA 4OVAA 4XTVA 1G3YA 4A54A 5HK3A 3CC7A 3NTIA 4JX6A 2DXBA 1N27A 3C94A 3CCJA 3GNFB 2QF7A 3UWNA 1KC8U 1UGSB 2DD5B 3QYHB 2EAYA 4C0ZA 3X28B 3CMAA 4AKGA 2QTXA 2CYZB 4JRKA 4LDUA 3RMQA 3C12A 3SWNC 1QW1A 3GLXA 5KCHA 3I55A 4EMHA 1UGQB 1BI3A 1YJWT 3RMSA 4JLIA 3RKYA 1M1KU 1VIFA 3JSCA 1G3SA 3ASKA 3PNWC 3A8LB 3QJYA 2CGHA 4B9XA 4OB0B 3OMCA 1Y71A 2DTHA 3NTHA 4XTWA 1Q82U 4OF1A 2C06A 2M1HA 1X75C 5LJ5e 3DLLA 5CAIA 1JBMA 3CCVA 5GAOn 3M4YA 4JRPA 3OY9A 4OMFB 4NL3A 4V2SA 4IURA 2E6ZA 1HXDA 3CC4A 3JRZA 3M9QA 2HD0A 2LX9A 2RK2A 1WNLA 4C0DC 4O5VA 5HKCA 3CCLT 1OZ2A 1XNIA 2EQUA 2VGNA 4M78A 2G77A 3HL8A 3OS0A 1YJ9A 4C92F 5A0DA 1S72T 2KMTA 1MHNA 2RK1A 2WSCE 1YI2A 4EMKC 3CCMT 3L2UA 2K5IA 3PGGA 4X34A 3FEOA 5D6YA 2XICA 5GANh 4L6V5 3QDRB 1JRIA 3QHSA 3SWNA 2OTLA 3JB9H 1VQ9T 3HPWA 4HCCA 4Z6YA 3CBMA 1W4SA 4A53A 5AYFA 3JCMh 4C92C 2ZPIB 3FB9A 4J6XA 4F7UE 5GAN3 1BIBA 2LCLA 3OYAA 2FYKA 4ZGEB 1Q86C 2XHCA 1ZHIA 3HB9A 2DVEA 2QQRA 5GANd 4XQ3A 3CMAT 4O6JA 4QVZA 4XTYA 1Q7YU 5GAOl 3V8JA 3MHXA 2QFZA 1YJNT 3QYEA 5GAN6 1YJWA 5KE3A 1NZ9A 4N4GA 2ZGWA 3JCMd 1WGSA 2F5TX 3F70A 4PJOE 2BS2A 3V7RA 5CVIA 1M90U 1KHCA 3PTAA 2CS7A 1VQ4A 1U1TA 3HO8A 4BBRM 3VKGA 4E7JA 3PMIA 3QKJA 4PJOF 1W2BS 4KBMB 5KE2A 4C5EA 2CZ0B 3G7ZA 2VXEA 2PQWA 2X4JA 4F7UB 4X9CA 2PVGB 2R58A 5FU6B 2JTFA 2WACA 2LVMA 1M9SA 4MZPA 2P0PA 2BS3A 4E7KA 3AHUA 2DK3A 4J6YA 2KDSA 1UEBA 4II1A 3CCLA 3JB9F 4ATOA 5CR2A 1Q86U 5CKHA 1QVFA 3GIBA 3L2RA 3CPWA 4MZTA 5FU6C 4D6WA 2XK0A 2DTIA 4M7AB 5GMKm 3PIOA 3CCQA 2RM4A 5C0MA 4LDXA 2KVQG 3ER0A 4EPCA 1U8RA 3V7SA 4EMGA 1JJ2A 1KHIA 5EG2A 5FRNA 3LYIA 1VQ7T 3VUBA 1NPPA 3QSUA 4NC6A 5A0GA 3V8LA 3HHTB 2E65A 3A8HB 4E7IA 5FROA 5LJ5d 3ME9A 5GAN4 3L1AA 3OQ5A 3G71A 1BI0A 3CMEA 5LL6S 1VQOA 5GAN2 2KQWA 2X35A 5GANf 1EIFA 2EQMA 4OB1B 3M59A 2DXCB 3OYJA 2QA4T 2HQEA 3MEAA 4IUTA 4ZTFA 3OBYA 4HLQA 3BDLA 1HK9A 4L5GA 3JCMf 3CC7T 2DZCA 5GAMd 2K4YA 2DO3A 2NLUA 4C0FA 4BI3A 4M7AE 1B34B 2DXBB 4LDWA 4JRIA 1FWZA 1WPYA 2E41A 2QQSA 4XU1A 3SWNB 4C8QF 3S3OA 2DD5A 1YITT 1VQKT 4NOYA 2VC8A 2GCXA 2DD4A 4F7UF 2YHTA 4OP0A 3G6EA 4FU6A 4XTZA 1NJIC 3VKHA 3LGLA 4M75C 4TVRA 4GLKA 1P92A 5GAMh 3C95A 3CCST 3CCUT 2Y90A 4E7HA 1Q81C 4QQGA 4NL2A 1VQPA 2IG0A 3JCMJ 3DL1A 1Y96A 3OB9A 3PIPA 4BBSM 1V29B 4L59A 3S3MA 4BD3A 1AHJB 3FDRA 3L2ZA 1VQ8A 4ELJA 4F7UG 4AI6A 2RI5A 4GY5A 4LD6A 1ZQ1A 3BG9A 2E6NA 5LJ3e 3QG1A 2JOYA 1Q81U 3CC2T 1OZ3A 4KUDK 1BYMA 4XTXA 2DXTA 2I2LA 3G4ST 2QEXT 2WSEE 4MMKA 1X6OA 2IVWA 2CKKA 3QIIA 2HNIA 1H3ZA 2Y4YA 2ZPHB 3URGA 2DZ9A 3LLRA 2M9UA 3JAME 5GMKi 4JUVA 1BIAA 2KR6A 3X24B 2LT4A 3PT9A 5L8RE 4A4HA 5LJ5j 2CZ6B 1QLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPI B;  3X25 B;  2QDY B;  2DPP B;  2WSF E;  2ZCF B;  3WVE B;  4ZGE B;  3QYG B;  3LW5 E;  2ZZD A;  1PSE A;  3X26 B;  2ZZD B;  2CZ0 B;  2O01 E;  2PVG B;  2PVD B;  4KT0 E;  1PSF A;  4FM4 B;  4Y28 E;  2PU9 B;  2ZPF B;  3VYH B;  3A8G B;  1DJ7 B;  4XK8 E;  4ZGJ B;  4ZGD B;  3HHT B;  2DXC A;  1QP3 A;  1UGP B;  3A8H B;  1JB0 E;  3X20 B;  3WVD B;  3VYG B;  2CZ1 B;  2PVO B;  2ZPB B;  2D0Q B;  2DXB A;  4OB1 B;  2DXC B;  1UGS B;  2DD5 B;  3QYH B;  3A8M B;  3X28 B;  2PUK B;  2AHJ B;  2CYZ B;  1UGQ B;  3A8O B;  2DXB B;  1IRE B;  2DD5 A;  4OB2 B;  3A8L B;  2CZ7 B;  2DD4 A;  1UGR B;  4OB0 B;  2PUO B;  1V29 B;  2DD4 B;  2ZPE B;  3QXE B;  3VYG A;  1AHJ B;  4RKU E;  4OB3 B;  2WSE E;  2WSC E;  3QZ5 B;  1GXI E;  2ZPH B;  4L6V 5;  3X24 B;  5L8R E;  2ZPG B;  3QZ9 B;  1QP2 A;  2CZ6 B; 
#chains in the Genus database with same CATH topology
 3G1J A;  3UT1 A;  2QGF B;  2WHB B;  3BLH B;  4FSX A;  1FIN B;  2X4X A;  1YWO A;  1W98 B;  3PO3 S;  5KH6 A;  1LOJ A;  5AT1 B;  3OA6 A;  4KRT A;  1PWT A;  5GMK h;  2AT1 B;  5LJ5 e;  1N9R A;  5LJ3 j;  4XU2 A;  1U1S A;  3G33 B;  1OGU B;  3I55 Q;  4FX3 B;  1VQL T;  1D09 B;  1D3B A;  3TEE A;  1OKW B;  1PCX A;  4DQ2 A;  2NWM A;  1MMG A;  4QW2 A;  4HNV A;  2RQR A;  1H28 B;  3HFO A;  3PVL A;  4C5I A;  2NUT A;  1KD1 R;  2ROL A;  3M4G A;  4P5N A;  4D8D A;  2P4T A;  2DLP A;  1W1F A;  1M2O A;  5D6X A;  4ELY C;  4KUL A;  5KYY B;  3U23 A;  1M1K R;  4N4I A;  2QEX A;  5GAO r;  4ZN3 A;  4JJN K;  1UB4 A;  3VYH B;  4AG1 C;  1C6V X;  1WHG A;  2QTV A;  3OW2 P;  3JB9 G;  4DOV A;  4R55 A;  3I9Q A;  1M90 R;  2EGA A;  1NLO C;  1WJQ A;  2KSS A;  2DME A;  1X27 A;  2JUF A;  4OML A;  3RBB B;  1OI9 B;  3I56 Q;  2H3J A;  4CC7 A;  1IGU A;  2RQT A;  1SG5 A;  2L3R A;  4OMP A;  3JB9 I;  3A8M B;  2PUK B;  2O88 A;  5LJ5 h;  2DET A;  3QHW B;  2L3Q A;  1JJ2 S;  3J80 E;  4MDX A;  3SD4 A;  2BZY A;  4IUV A;  3HKS A;  3SEM A;  3TNW B;  1YWP A;  1UGR B;  2OAU A;  1B07 A;  1KK7 A;  2NUP B;  2V1Q A;  1ABO A;  2PUO B;  4BB7 A;  4F7J B;  4M7D F;  4RMO A;  3S6W A;  2DEQ A;  2P0Q A;  1W6X A;  4ELZ C;  2RQU A;  5BNJ B;  5IHI A;  2L0A A;  3EG1 A;  1M3B A;  4PFP A;  3CCS Q;  4M78 G;  2EUF A;  3WXM B;  4YOZ A;  3OMG A;  4LN2 A;  1KG1 A;  1FXX A;  2EQJ A;  4F7N B;  2LZ6 B;  5CO7 A;  3MPU B;  1VOL A;  4LOC A;  1FYN A;  2AZS A;  1FVV B;  5HNB B;  3VS5 A;  2NUT B;  2G9X B;  1TWB A;  3X25 B;  3CCE T;  3EHR A;  4J6W A;  2WSF E;  1C1A A;  2O31 A;  2C0O A;  4J9D A;  2DAQ A;  1N8R U;  2KY9 A;  2PTK A;  1JO8 A;  4JX4 A;  1G8X A;  4MZM A;  4ANJ A;  4M75 F;  2MI6 A;  4F6U B;  3G6E Q;  5DLQ E;  4II5 B;  2XID A;  1ZP2 A;  4QT7 A;  3CC2 A;  3R6N A;  2QQA A;  4CRI A;  3OYE A;  3CC2 Q;  1M1G A;  3G4S A;  4E2F B;  1SEM A;  4Q5W A;  2LJ0 A;  2RQW A;  5HCK A;  2HKQ B;  1PKD B;  3FC3 A;  2RJE A;  1M3C A;  1E6H A;  3KUF A;  2PU9 B;  3HP9 A;  3EFO A;  1RL2 A;  2I53 A;  5J39 A;  1WXT A;  2E3H A;  1K9M R;  1QVP A;  4PJJ A;  1M27 C;  1VIE A;  5CEI B;  2PMI B;  5CK9 A;  1K8A U;  4A4K A;  3NPF A;  2UZB B;  3QWX X;  5M9O A;  1YFN A;  5GMK l;  3WVD B;  2KR3 A;  2L89 A;  3GBQ A;  1SSF A;  3E1S A;  1QVF P;  4D8K A;  4CC4 B;  4M75 E;  1FMW A;  2YWW A;  1RAB B;  4CFX B;  4J8O A;  1N8R R;  2LQK A;  1UE9 A;  2FZK B;  1YIJ T;  3OYD A;  2J6K A;  3MCA B;  1ZLM A;  4JZ3 A;  1YIT A;  5DM7 R;  1NEB A;  4IKF A;  3JB9 J;  3C4S A;  4C5H A;  5KYN A;  2CUB A;  4A4F A;  3L2R A;  2RI3 A;  3CXC S;  1EZZ B;  2CRE A;  2LCC A;  2O4X B;  3H41 A;  4HXJ A;  4M78 B;  1VQP T;  3L2W A;  4A4E A;  3VU3 C;  1VQ8 T;  4AKH A;  6AT1 B;  3JCM V;  4PLI A;  1ENW A;  1H8K A;  2YUN A;  4RKU E;  1RAC B;  3CCL Q;  4JS5 A;  3P8B B;  2VUB A;  1TH7 A;  2XDB A;  2F69 A;  4BDY A;  4C8Q B;  4BCQ D;  2LNH B;  3CBO A;  4PL6 A;  3JCM b;  1W2B A;  3MP1 A;  2QQB A;  3TU4 K;  3RR6 A;  2C0I A;  2LQ8 A;  3L42 A;  2EYQ A;  4PJO A;  2XU8 A;  1NYG A;  3DB4 A;  4DEX A;  4HT9 A;  3EFO B;  2HDA A;  1UNG D;  1PD0 A;  3LH0 A;  4B6M A;  4KUI A;  1WI7 A;  5LJ5 g;  1I5O B;  2COZ A;  2K6D A;  5I21 A;  2ROT A;  3JCM c;  1VQL Q;  2MAM A;  2L2P A;  4WF2 A;  2K3Y A;  1H1Q B;  2O01 E;  2DRM A;  1GFC A;  1K73 R;  3I5S A;  3M03 A;  3MEU A;  3EFR A;  2DIL A;  2QK0 A;  2DL3 A;  1HYO A;  2C5X B;  1IZ6 A;  2MWP A;  1AZE A;  4Y28 E;  4WTO B;  1M8V A;  1TD6 A;  1WLP B;  4N0A C;  3OW2 S;  1NE8 A;  3EOC B;  1GL5 A;  3RKX A;  2QGG A;  2LCS A;  3CD6 A;  1QMZ B;  1WA7 A;  3D7S B;  1VQO T;  3A5Z B;  4C92 D;  1M8M A;  3INZ A;  4M7D B;  2CH4 A;  3OYG A;  2FPF A;  3CPF A;  1G3W A;  2DXB A;  4J9G A;  2QF7 A;  1KC8 U;  3RNJ A;  3CCJ Q;  3X28 B;  3CMA A;  2ESW A;  3C12 A;  4R0K A;  1FMV A;  3GLX A;  4EMH A;  1AWJ A;  3RMS A;  1GRI A;  1WHL A;  3ASK A;  3QJY A;  1KFZ A;  4OB0 B;  1BB9 A;  1WXB A;  2DTH A;  2YUQ A;  1X75 C;  3DLL A;  1OX8 A;  4M4Z A;  5GAO n;  3OY9 A;  4OMF B;  4NL3 A;  3CCV Q;  3CC4 A;  3JRZ A;  1HSQ A;  2HD0 A;  2LX9 A;  4C0D C;  3BHU B;  3EG3 A;  3CCL T;  1OZ2 A;  2OJ2 A;  4C92 F;  1S72 T;  4Y72 B;  4G6L B;  3NMZ C;  1RAE B;  2K5I A;  3PGG A;  2XIC A;  5GAN h;  3QHS A;  3JB9 H;  4AFZ C;  1VQ9 T;  2OTL Q;  2YDL A;  5AYF A;  1JQQ A;  4J6X A;  4F7U E;  1P5E B;  4FCY A;  1ZSG A;  1VA7 A;  4XQ3 A;  4QVZ A;  4Y92 A;  1PD1 A;  2QFZ A;  4EOP B;  1I0C A;  1IHV A;  2DA9 A;  1NZ9 A;  3EGD B;  1WGS A;  4PJO E;  5CVI A;  1UFF A;  1WHH A;  3PTA A;  3HO8 A;  4BBR M;  4E7J A;  1TTH B;  3QKJ A;  1SPK A;  1PNJ A;  2X4J A;  4YOO A;  2JTF A;  2WAC A;  1M9S A;  3VS1 A;  2P0P A;  4E7K A;  3AHU A;  1OV3 A;  3VS2 A;  3PVQ A;  2IPO B;  4RTW A;  5CR2 A;  1Q86 U;  3CCQ Q;  5FU6 C;  4D6W A;  3CCQ A;  5GMK m;  3PIO A;  1QVG P;  4EPC A;  4EMG A;  1JJ2 A;  5FRN A;  5IHY A;  1UHF A;  1QMC A;  3VUB A;  1NPP A;  3QSU A;  3ME9 A;  5GAN 4;  1WIE A;  3G71 A;  3CC7 Q;  5FWC A;  5LL6 S;  1VQO A;  1VQ7 Q;  2BZ8 A;  2EYY A;  1YNZ A;  3H9N A;  3MI9 B;  1SRM A;  2EQM A;  2FEI A;  3M59 A;  2UZD B;  2E5K A;  2D8J A;  2HQE A;  4HLQ A;  4L5G A;  4C0F A;  4Z89 A;  1KIK A;  2YRC A;  2PK2 A;  4M7A E;  1B34 B;  3S3O A;  2E41 A;  5ECA A;  4C8Q F;  3SWN B;  5KYU B;  4NOY A;  3O0G D;  2GCX A;  4XTZ A;  4M75 C;  4TVR A;  1GBR A;  3C95 A;  3CCU T;  2Y90 A;  1Q81 C;  4QQG A;  4NL2 A;  5I11 A;  3JCM J;  1QQJ A;  3DL1 A;  1OL1 B;  3PIP A;  1MV0 B;  3L2Z A;  4ELJ A;  2F2V A;  2RI5 A;  5LJ3 e;  1BYM A;  3DOG B;  3NDQ A;  2CT3 A;  1OUL A;  2XMF A;  2DXT A;  2QEX T;  4MMK A;  1X6O A;  2CKK A;  1AWX A;  2HNI A;  1RI9 A;  2Y4Y A;  3URG A;  2EQI A;  2M9U A;  1Q86 R;  1ZUU A;  1BIA A;  3UF4 A;  3OYA A;  1OPK A;  5LJ5 f;  1AWW A;  2X1N B;  2K2V A;  4DBR A;  4EOQ B;  4M78 E;  3HZJ A;  3I56 T;  3NFC A;  1MV3 A;  3CMA Q;  1UHC A;  1RLQ C;  2ZZD A;  4RCC A;  3NTK A;  3ZFJ A;  5GAM f;  3FIF A;  1Q7Y C;  4PJM A;  5CQX A;  4M7D C;  2W9F A;  5IXF A;  4JRQ A;  3X26 B;  1X69 A;  1Y7X A;  2V8K A;  1B7T A;  4A4G A;  4RTU A;  1ZBX A;  2VB6 A;  4FIB A;  1CKA A;  2KI7 A;  2V1R A;  1R77 A;  2ZAE A;  1S72 A;  2RH2 A;  3LWH A;  4M77 E;  3VUZ A;  2VYT A;  5CKB A;  4FM4 B;  3QO3 A;  2FRW A;  5I22 A;  2FPE A;  1KJW A;  1VQ5 A;  4JS4 A;  1YJ9 Q;  2RJC A;  2VKN A;  1FX7 A;  1QVG A;  3CCQ T;  1K9M C;  3BG3 A;  2DF6 A;  2DBM A;  1KQ1 A;  3CXC A;  2JN0 A;  4OMM A;  2RPN A;  1H4L D;  5HK0 A;  2NUZ A;  3EG0 A;  1IHW A;  1BCM A;  1ZUK A;  2CP5 A;  4F16 A;  4M7D D;  1M2V B;  1D0Z A;  5GAM j;  2M16 A;  3VJP A;  1VQN A;  5CYI B;  4LDV A;  5J3B A;  2XKO C;  4QVC A;  1B34 A;  3H8Z A;  4M6V A;  4CXA B;  4CFV B;  3EG9 A;  4XTU A;  5CKD A;  1VQ8 Q;  5FRM A;  1R8O B;  3HSB A;  2IW8 B;  5HVY B;  2GTJ A;  3CCU A;  1XQH A;  3T9N A;  3C0C A;  1OI1 A;  4QSH A;  4Z8A A;  1ABQ A;  1BCO A;  2BS4 A;  2QG9 B;  1YI2 T;  1GFD A;  1D3B B;  5GAN j;  4YOS A;  3EAE A;  1JXO A;  2W0Z A;  1KC8 R;  4E7L A;  4CI0 C;  2IIM A;  2M0O A;  2OTL T;  3CBP A;  3JCM P;  1VQ9 Q;  2QI2 A;  3LWI A;  4XU0 A;  4BE0 A;  3QPH A;  2C0T A;  5HBE B;  3OYB A;  3M0P A;  3TCJ A;  1Y96 B;  3M0R A;  2HSP A;  1G83 A;  4J7F A;  1YIJ Q;  2L3P A;  3VRY A;  4BCP B;  5IH2 A;  4M77 G;  3OW2 A;  1D1C A;  3CQT A;  1K0X A;  4FT4 A;  5FLX E;  1VIN A;  1UNH D;  2G6F X;  4JJB A;  5LJ3 g;  1K4U S;  1GBQ A;  5GAN e;  2I0N A;  4M77 A;  4BCQ B;  1BI1 A;  5IF1 B;  3O5Z A;  2DTO A;  2J6F A;  3MEW A;  1JKW A;  2QQ8 A;  1BK2 A;  1K73 C;  4VUB A;  2L8D A;  1QCF A;  5HY6 A;  3RKW A;  2OX7 A;  2QDL A;  4C8Q G;  1B3Q A;  1NLP C;  1YBY A;  1I81 A;  4BE2 A;  4FW1 A;  2JS2 A;  3OYM A;  4M7D A;  3P8D A;  4EMK A;  3LX7 A;  3CD6 Q;  4C92 B;  4HL4 A;  3BFM A;  2YLB A;  4M78 C;  1X01 A;  2W10 A;  1PKT A;  1PHT A;  4F04 B;  3ZBD A;  3VYG B;  3CME T;  4M7D G;  1PG5 B;  2K3B A;  4C92 E;  3GOX A;  1QWF A;  2LNV A;  2RQV A;  2EGC A;  3PFS A;  2B86 A;  5KCO A;  2YRV A;  2DIQ A;  3V8K A;  1G3N C;  3M58 A;  1T0J A;  4NST B;  3N5B B;  4F7S B;  2BIV A;  2KE9 A;  4OB2 B;  3O8V A;  3THK A;  5LJ3 d;  2COY A;  5J26 A;  2KT8 A;  1VQN T;  2ZPE B;  4EOK B;  1H26 B;  2I40 B;  2LX7 A;  3OBW A;  4DBH A;  1QCN A;  1U06 A;  3BE3 A;  3BDU A;  4XU3 A;  1KSW A;  1K9M U;  1VQ5 Q;  2VWF A;  4TTH A;  3CD6 T;  4M77 D;  2KK4 A;  4B9W A;  4PLL A;  1JJ2 P;  1TFB A;  5HBJ B;  1PSE A;  1QP2 A;  2YSQ A;  2MOX A;  4HVW A;  2EJG A;  3CME Q;  3E9F A;  3WVE B;  5EFQ B;  2F5K A;  9ATC B;  3UA6 A;  2AKK A;  2SRC A;  4EOO B;  2VVK A;  1LCK A;  3QYG B;  2DKG A;  2FL7 A;  1Q95 G;  2X51 A;  3QYB A;  3CPW S;  3RIR A;  1NBE B;  4EDU A;  3L2V A;  2M02 A;  3M57 A;  5L2W B;  2MCN A;  3PMT A;  3HBL A;  5L23 A;  1JU5 C;  4PK4 A;  3J7A F;  2JTE A;  4M7A F;  3R6O A;  1VQ6 T;  4M7D E;  4XAX B;  3V7C A;  5IDP B;  1VUB A;  1K73 U;  2V8J A;  2HCK A;  3OYF A;  4JDS A;  4AKI A;  1GUX B;  2VXF A;  1UEC A;  1QWE A;  1KQ2 A;  4CFM B;  2WEV B;  3OYH A;  1YN8 A;  4M77 C;  1JB0 E;  4JX5 A;  3MP8 A;  2RHZ A;  2CZ1 B;  4XTV A;  2ZPB B;  2EYX A;  4JX6 A;  3C94 A;  4ROC A;  3UWN A;  3QYH B;  2EAY A;  4C0Z A;  2A36 A;  1F5Q B;  5KYX B;  4AKG A;  3RMQ A;  4EOS B;  3I55 A;  1UGQ B;  1BI3 A;  2IW6 B;  4JLI A;  3RKY A;  1M1K U;  4GLM A;  3A8L B;  2CGH A;  2DER A;  3OMC A;  1Y71 A;  4AFQ C;  2RN8 A;  2DJQ A;  4E7Z A;  2ED0 A;  2C06 A;  2M1H A;  2IW9 B;  4JRP A;  3M4Y A;  4V2S A;  1R0C B;  2RK2 A;  1Q81 R;  5HKC A;  1NJI R;  2GGR A;  5A0D A;  2RK1 A;  2K9G A;  4X34 A;  1V76 A;  3HPW A;  2Z0W A;  1URC B;  1W4S A;  2PJQ A;  4A53 A;  5GAN 3;  1WX6 A;  3FB9 A;  2LCL A;  2EYW A;  2F2W A;  4ZGE B;  1PRM C;  2FYK A;  2HL3 A;  1Q86 C;  2H3E B;  3H0I A;  1Q7Y U;  7AT1 B;  3MHX A;  2W2H A;  1YJN T;  5GAN 6;  1YJW A;  5KE3 A;  4N4G A;  3JCM d;  2ZGW A;  1C0M A;  2F5T X;  2BS2 A;  1KHC A;  2JMA A;  1VQ4 A;  3VKG A;  3EJ1 B;  4AMC A;  2CZ0 B;  1Q7Y R;  3G7Z A;  4J9H A;  2R58 A;  5DQV A;  4MZP A;  2K7A A;  4J6Y A;  4FYY B;  2EKH A;  4IIO A;  1UEB A;  4II1 A;  3JB9 F;  2C5V B;  3CCU Q;  2LP5 A;  1PM3 A;  1MMA A;  4LDX A;  2KVQ G;  1D0Y A;  3V7S A;  4FYW B;  2WIP B;  3V8L A;  4QKU A;  1Y57 A;  5KYW A;  2FG0 A;  3A8H B;  5FRO A;  3OQ5 A;  1BI0 A;  3BHV B;  2LJ1 A;  3MJX A;  3GTM S;  1ZBJ A;  1JEG A;  5GAN 2;  5GAN f;  4OB1 B;  3EID B;  3REA B;  2OTJ Q;  2C4G B;  3MEA A;  4FSS A;  3BDL A;  2UUE B;  1UG1 A;  2NLU A;  4BI3 A;  1UTI A;  4LDW A;  4XU1 A;  2F2X A;  2WXV B;  4OMO A;  5IDN B;  2DD4 A;  4F7U F;  5GAM h;  1QCO A;  1VQP A;  3OB9 A;  2DEU A;  4BBS M;  4L59 A;  1WYX A;  4DEY A;  5LJ5 j;  1ZA2 B;  1ZQ1 A;  3BG9 A;  2E6N A;  3QG1 A;  5FWB A;  2EBP A;  1N5Z A;  1RUW A;  2ZPH B;  3LLR A;  1H1S B;  2X3W D;  4JUV A;  5L8R E;  2B9R A;  4PJL A;  2O9V A;  2QDY B;  3S3N A;  1RAD B;  1KC8 C;  3QJ6 A;  3MIA B;  2A28 A;  4JLG A;  2KYB A;  1HD3 A;  1NYF A;  4BCG B;  3VV0 A;  2LT1 A;  5IHK A;  2FB7 A;  3M56 A;  1O75 A;  4M77 B;  1VQ4 Q;  2E1H A;  2CDT A;  1F1B B;  2DIG A;  4YTL A;  1VQK Q;  2E64 A;  4BAC A;  4HT8 A;  3EGD A;  5A2Q E;  2XDP A;  4F17 A;  1VOM A;  1VQ4 T;  2D0N A;  2X4W A;  3RGF B;  3JCM Q;  1H1P B;  3OYI A;  3EGX A;  3QDF A;  2QXF A;  5CKF A;  2M51 A;  2HBP A;  1ZX6 A;  4PJO G;  1VYU A;  8ATC B;  2KGT A;  1XOV A;  2E10 A;  2JXB A;  4M75 G;  2RHX A;  4C8Q D;  1M1F A;  4HKE A;  2ZPF B;  2WJ9 A;  2W99 A;  3DB3 A;  2RB6 A;  2BUD A;  2EWN A;  1LVK A;  1JXM A;  1RLP C;  2GFU A;  4F6W B;  3FRN A;  3QWY A;  3RES A;  1YJN A;  4RG2 A;  1UGP B;  3P8H A;  1OQK A;  2RHU A;  3GP8 A;  1NJI U;  3JCM e;  1Y07 A;  4ME7 A;  3FLG A;  3AT1 B;  3QUI A;  1SSH A;  1WDX A;  4J7I A;  4PKC C;  3JCM W;  1QVF S;  1YHQ Q;  2D9T A;  1RAF B;  5IXB A;  4CFN B;  3KFV A;  3TNI B;  4BE1 A;  3FJ5 A;  5GMK e;  1OX9 A;  1M4Z A;  2K57 A;  2K3X A;  3OYN A;  2EGE A;  2CZ7 B;  1VQM A;  2XDD A;  1FKM A;  4CFU D;  1H3Z A;  1TUC A;  4LD9 K;  3CEY A;  2VGM A;  2RO0 A;  1X6B A;  2CSQ A;  2HBW A;  1KQS S;  2DD4 B;  2E12 A;  4J83 A;  3VYG A;  4BY6 C;  3CC4 T;  3PE0 A;  3JB9 D;  1QLY A;  4X9D A;  2HQH A;  1E9H B;  3MO8 A;  1GY3 B;  2LRQ A;  3QZ5 B;  2KAF A;  4RUG A;  1GXI E;  4MIM A;  2RHI A;  1VQ9 A;  4ZN1 A;  2A3L A;  1Y0M A;  2QGS A;  4OR5 B;  2E5Q A;  1YHQ T;  1H92 A;  4HVU A;  5GAM e;  1VYV A;  2L3S A;  2P0K A;  1SRL A;  4EOJ B;  2E4H A;  2Y4X A;  2J7I A;  1Z9Q A;  3OS5 A;  2JVV A;  1C9B A;  3NHN A;  3SDZ A;  1IRX A;  2RI2 A;  2W96 A;  2ED1 A;  2JT4 A;  4BCK B;  3HRT A;  1WZO A;  1H25 B;  4QQ6 A;  1MNE A;  2RA2 A;  4DBQ A;  2ZZD B;  4BI4 A;  3LGF A;  2FVU A;  2YUP A;  3TW7 A;  4M78 D;  5LJ3 f;  4EON B;  5GAM g;  4AT1 B;  1LNX A;  1OEB A;  3EH2 A;  2AZV A;  1OU8 A;  4BCM D;  2PVD B;  4PJO B;  1JOW A;  1G3T A;  1ZUY A;  1VYW B;  4M75 B;  1OIU B;  2MIO A;  2NYS A;  5ACB A;  3EGX B;  4C0D B;  4RTY A;  2RD1 A;  4E7S A;  1MGQ A;  1SKU B;  2NUP A;  4AFS C;  4KH1 B;  2EJ9 A;  5DLO A;  2A37 A;  4M75 D;  3ULR B;  3X20 B;  3CCE Q;  5IAY A;  2EFI A;  3EG9 B;  5KYX A;  1YJ9 T;  3E19 A;  3M0S A;  4IIM A;  1OPL A;  2D0Q B;  3TW6 A;  4LUE A;  2OTJ T;  2LC4 A;  1AWO A;  3JCM X;  1IXD A;  3MKD A;  2EJF A;  1BU1 A;  2K5L A;  4DOW A;  4M7A D;  1IB8 A;  3OYC A;  4BCF B;  3A8O B;  1U5S A;  1SHF A;  2JTM A;  2QDJ A;  1VQM Q;  4JPB W;  1IRE B;  1VQK A;  4C0G A;  1QVG S;  2V8I A;  4PJO C;  4BUG A;  2JJ9 A;  1CKB A;  1K8A C;  1HJD A;  5IN1 A;  2CP6 A;  3UDC A;  2GNC A;  1RAH B;  3B57 A;  2R57 A;  1WXU A;  1E6G A;  2MK5 A;  2DVJ A;  3CCM A;  2HMA A;  1VQ6 A;  3M5A A;  3SFM A;  4OGC A;  5FW9 A;  3VS4 A;  1K76 A;  1T3S A;  4EIK A;  1PRL C;  4C5G A;  1ZSZ B;  4M77 F;  4UC4 A;  2F2C A;  1IGQ A;  3JV3 A;  4HNT A;  1NJI C;  2OAW A;  1N6A A;  1YJN Q;  2EKO A;  5CKE A;  5IT9 E;  2EVR A;  2HL5 C;  4OGR B;  4KRD B;  1YHQ A;  1VQM T;  2FHD A;  4CFW B;  4FYV B;  1Q82 C;  2HAX A;  2DL8 A;  4AG2 C;  2C6T B;  1AVZ C;  2HKN A;  4R56 A;  3SB2 A;  1WHK A;  1H64 1;  2EQK A;  2RF0 A;  3I55 T;  3HFN A;  4FYX B;  1NEG A;  1SF9 A;  1WHM A;  2F1L A;  2PZ1 A;  3REB B;  2IN3 A;  3MEV A;  4ESR A;  2EPD A;  1D0X A;  1H3H A;  2RHY A;  3CPW P;  2HZY A;  3GF5 A;  3UPU A;  1U3O A;  2G3R A;  1H1R B;  1PSF A;  1RI0 A;  3DTO A;  2DYI A;  3ZEH A;  4C92 G;  2D6F A;  4HCZ A;  1PKS A;  4MFD A;  2GF7 A;  2MWO A;  1TS9 A;  2BPM B;  4M7A G;  4DA4 A;  2GQI A;  1M30 A;  2DXC A;  2O4X A;  4LDY A;  5D6W A;  5GAN 7;  4BI8 B;  4BY7 X;  3JCM g;  1WQ7 A;  4EMK B;  2CCH B;  4OVA A;  2FZG B;  1G3Y A;  2CSI A;  1N27 A;  3CCJ A;  2COW A;  4EOM B;  1UGS B;  2DD5 B;  2PHG A;  4JRK A;  4LDU A;  1QW1 A;  3TSZ A;  2AIR B;  3VS6 A;  1YJW T;  2W9Z A;  1G3S A;  1OL2 B;  2WPA B;  4BCO B;  4XTW A;  3HTR A;  5CAI A;  1JBM A;  4GBQ A;  2CT4 A;  2CH4 W;  1T3L A;  3MY1 B;  1XJW B;  4IUR A;  3QHR B;  3M9Q A;  1Z9Z A;  4A63 B;  1VQ6 Q;  4BXX X;  4O5V A;  4M78 A;  2VGN A;  3LQ5 B;  4LUD A;  2G77 A;  3HL8 A;  3OS0 A;  1YJ9 A;  5I5Z B;  2WSC E;  2ENM A;  1MHN A;  2KMT A;  3DDQ B;  2IVX A;  4EMK C;  3L2U A;  4KGX B;  2KNB B;  3CCM T;  3FEO A;  2ABL A;  3A98 A;  5KYU A;  3SWN A;  2OTL A;  3NGP A;  2KRN A;  2ZPI B;  2CUD A;  2YT6 A;  2DM1 A;  2XHC A;  3HB9 A;  2DVE A;  5GAN d;  4XTY A;  5GAO l;  3BLQ B;  3BHT B;  1RAI B;  3H0F A;  2CP2 A;  2AK5 A;  2KRS A;  3F70 A;  3V7R A;  1M90 U;  1U1T A;  1VQN Q;  4PJO F;  2QA4 Q;  5EC7 A;  2PQW A;  2WMA B;  2R7G A;  4X9C A;  2PVG B;  4EC9 B;  4BY1 X;  4J9C A;  4I3Z B;  2KDS A;  3TNH B;  1CSK A;  1EFN A;  4ATO A;  5CKH A;  5GJV B;  1QVF A;  3GIB A;  1UUE A;  3CPW A;  4MZT A;  2XK0 A;  2CJM B;  5C0M A;  3ER0 A;  1KHI A;  2J05 A;  5EG2 A;  1K1Z A;  3M0T A;  1TUD A;  4NC6 A;  2HEQ A;  5A0G A;  4EOR B;  1KXU A;  3TQ7 P;  3UAT A;  4E7I A;  3CME A;  4ROE A;  2P4R A;  5LQF B;  4K11 A;  2X35 A;  2LJ3 A;  2J06 A;  2DXC B;  2ECZ A;  1XO2 A;  4IUT A;  2KXD A;  3OBY A;  3JCM f;  2DZC A;  2K4Y A;  2JM8 A;  2DXB B;  4JRI A;  1FWZ A;  2GBQ A;  1YIT T;  3RDV A;  2KEA A;  2VC8 A;  1V1C A;  2ATC B;  3VKH A;  3LGL A;  2CP7 A;  4E7H A;  2MPX C;  1V29 B;  3S3M A;  4BD3 A;  3CC4 Q;  1D3U B;  1AHJ B;  1H27 B;  1VQ8 A;  2CCI B;  1H24 B;  4AI6 A;  2P84 A;  1Q81 U;  4KUD K;  4EC8 B;  1WFW A;  2WSE E;  2IVW A;  2D8H A;  3QII A;  1LPL A;  5IHN A;  3JAM E;  5GMK i;  2X3X D;  1O9K B;  2KR6 A;  2LT4 A;  1Y96 A;  3PT9 A;  1M2V A;  2CZ6 B;  3TSW A;  1QLB A;  3J81 E;  1UJY A;  3VKI A;  1WHJ A;  1YCY A;  4Z02 A;  1X2K A;  2BE9 B;  2GFA A;  1N9S A;  4N4H A;  3F5X B;  1KD1 U;  3VS3 A;  4YC3 B;  2X4Y A;  5CQY A;  2H8H A;  3E9G A;  4IUQ A;  2FRY A;  2DL7 A;  3G6E T;  1MMD A;  1G5V A;  1VYT A;  4NS5 A;  5DY9 A;  4BY6 B;  4QQD A;  4HA8 A;  3G4S Q;  1RAA B;  3GPL A;  3Q1J A;  5CIU A;  3KBG A;  2LMJ A;  2YXY A;  1QKW A;  5GMK j;  3HRU A;  2UZE B;  5GAO q;  4FL6 A;  1I1J A;  3M54 A;  1DJ7 B;  2JW4 A;  3EGU A;  2K2M A;  4PFZ A;  4HCB A;  3I5R A;  2J6O A;  1TSF A;  4FW2 A;  4M7A A;  1TXQ A;  2K5F A;  1AT1 B;  3ZL7 C;  1GH6 B;  2C5N B;  1N4M A;  4OMN A;  2HQX A;  3H0H A;  3OYL A;  1JST B;  3BG5 A;  1A0N B;  4J9I A;  4M75 A;  4Y91 A;  1YJW Q;  1VQL A;  2A7Y A;  3VS0 A;  2YLC A;  1YIT Q;  1EX4 A;  1O9K A;  2E70 A;  3M0U A;  5CCA A;  4C92 A;  4C8Q C;  1ZSZ C;  1J3T A;  2XI9 A;  4J9E A;  4PFO A;  3DJB A;  1ZSZ A;  2RMO A;  1SHG A;  1BU2 A;  3DKM A;  5C6S A;  2RNA A;  4C8Q A;  1K8A R;  4OB3 B;  1MUZ A;  3RUX A;  3RER A;  2YUO A;  3OSS C;  3H4C A;  2KYM A;  4MDW A;  8AT1 B;  1KQS P;  2O2O A;  3QZ9 B;  1UDL A;  2MYS A;  2MMP A;  2DPP B;  2DXU A;  4BDZ A;  2EYZ A;  3CCR T;  1OKV B;  2R5M A;  4JJC A;  4M7A C;  4PNO A;  2DL5 A;  4RTT A;  1I5L A;  2OTJ A;  2JZ2 A;  1MND A;  3LH5 A;  1AD6 A;  2XG8 D;  1KD1 C;  1Q82 R;  4J5Y A;  5I2S A;  4HCK A;  3OS2 A;  1PC0 A;  2MF2 A;  2KT1 A;  2QAZ A;  2WIH B;  2CP3 A;  1M1K C;  3BW1 A;  4LXC A;  5GAO p;  1OU9 A;  1AIS B;  3VS7 A;  2JGZ B;  1YCS B;  3EFS A;  1W2B P;  2DMO A;  2GTO A;  2BKZ B;  4KT0 E;  3TRE A;  2K79 A;  4MFE A;  2KBT A;  1M90 C;  5GAN 8;  1QKX A;  4ZTJ A;  2UZL B;  1X43 A;  2DL4 A;  3OYY A;  3QBY A;  1X6G A;  3HRS A;  3CCR Q;  3FJP A;  4ZGD B;  4BCI B;  3CCE A;  1QP3 A;  1NPR A;  2XD0 A;  3G71 T;  3GNG A;  2FPD A;  1GCQ A;  2PVO B;  2PNI A;  3BY7 A;  3OYK A;  1UGV A;  5FU7 B;  5GAO m;  2V22 B;  2LW4 A;  4IMY B;  1D1B A;  2V26 A;  4QVD A;  2KRO A;  2AHJ B;  5HQ0 B;  5LJ3 h;  5A0L A;  2B8A A;  2DNU A;  3EHQ A;  2LTO A;  2BE7 D;  1WJS A;  3H6Z A;  2KMG A;  5FU7 C;  3CCV T;  2HSE B;  2JNG A;  3A1P A;  1ARK A;  1I4K 1;  4CRL B;  4IUU A;  4RCB A;  1WJR A;  4E47 A;  3MET A;  2L5Q A;  1OIY B;  1M5Q 1;  1S72 Q;  1ACM B;  3QXE B;  1AZG B;  1BI2 A;  4WCI A;  1E7P A;  5GAN g;  3UA7 A;  2RJF A;  4ROD A;  3DLM A;  3MP6 A;  2QEX Q;  1AD5 A;  1RAG B;  1OOT A;  2E3I A;  4M78 F;  1LJO A;  2ZPG B;  3QWL A;  1I8F A;  2VV5 A;  4N0A A;  1KQS A;  4EOI B;  1UJ0 A;  3G71 Q;  2ZCF B;  5EJC A;  2BZX A;  1VQO Q;  1VQ7 A;  2DRK A;  2WFY B;  1YIJ A;  1M3A A;  3I56 A;  4PJO D;  3CCJ T;  3LW5 E;  3KXT A;  1XTD A;  3L2Q A;  2GQV A;  2OI3 A;  4IUP A;  1WQW A;  1NM7 A;  2DJZ A;  2KXC A;  3I35 A;  4C8Q E;  4E6R A;  1GCQ C;  4BCH B;  2BKD N;  1TUG B;  2R5A A;  2QA4 A;  1UNL D;  2KRM A;  4OGE A;  4OMQ A;  3IQL A;  1O9S A;  2DYB A;  1T0H A;  4FT2 A;  2DBK A;  3M53 A;  4HNU A;  3SHW A;  2D1X A;  4F14 A;  2LQW A;  3CXC P;  2FO0 A;  4RG8 A;  3CCS A;  2YRD A;  3A8G B;  2EIF A;  4MML A;  5I2M A;  4XK8 E;  1VQ5 T;  3KHI A;  2LDM A;  2JMC A;  3M55 A;  3CCR A;  1YP5 A;  2RJD A;  3OSV A;  4F70 B;  4ZGJ B;  4BCN D;  5GAN 5;  4CFU B;  2QQ9 A;  4J9B A;  2VAS A;  1OYX A;  1N8R C;  1BKB A;  4ORZ A;  4LNP A;  3OS1 A;  4F7U A;  5LMK B;  2WMB B;  4A54 A;  5HK3 A;  3CC7 A;  1IO6 A;  3NTI A;  2QYZ A;  4DBF A;  3GNF B;  5HBH B;  2QTX A;  2CYZ B;  3SWN C;  5KCH A;  1E7O A;  4CC2 A;  3EG2 A;  1R0B G;  1VIF A;  1I07 A;  3JSC A;  2AKL A;  3PNW C;  1X2Q A;  4CC3 A;  2X9H A;  4B9X A;  3NTH A;  4ELL A;  1Q82 U;  4OF1 A;  1TOV A;  5KYW B;  3CCV A;  5DQW A;  2DFU A;  2E6Z A;  1HXD A;  3CCM Q;  1WNL A;  1XNI A;  2EQU A;  4RTZ A;  2BTT A;  2FZC B;  1YI2 A;  4BCN B;  2A0F B;  1FMK A;  1S1N A;  5D6Y A;  4L6V 5;  3QDR B;  1JRI A;  4HCC A;  4Z6Y A;  3CBM A;  4LE9 A;  1G2B A;  3M0Q A;  4RTX A;  3JCM h;  4UN0 A;  4C92 C;  1BIB A;  4RTV A;  1ZHI A;  4KGV B;  2QQR A;  3CMA T;  4O6J A;  3V8J A;  3QYE A;  4Z88 A;  4EOL B;  5ICP B;  2C5O B;  1MMN A;  2CS7 A;  4JJD A;  2PK9 B;  3MY5 B;  4BCM B;  3PMI A;  1W2B S;  4KBM B;  5KE2 A;  4C5E A;  5KYY A;  2VXE A;  2M0Y A;  4F7U B;  4F7L B;  5FU6 B;  2LVM A;  4BCJ B;  2BS3 A;  2DK3 A;  5D7U A;  1AOJ A;  3VRZ A;  3CCL A;  4KGZ B;  3BLR B;  2DTI A;  4M7A B;  2RM4 A;  4ZNX A;  1U8R A;  3LYI A;  1VQ7 T;  1TU0 B;  2JM9 A;  2LQN A;  2O9S A;  3E2U A;  4JZ4 A;  4HVV A;  3TVT A;  3HHT B;  2E65 A;  1ZA1 B;  5LJ5 d;  4F6S B;  3L1A A;  1GUX A;  1BBZ A;  2CP0 A;  5GJW B;  2KQW A;  5FGK B;  1EIF A;  3OYJ A;  3POM A;  2QA4 T;  1JSU B;  4ZTF A;  1HK9 A;  2A08 A;  3CC7 T;  5GAM d;  2DO3 A;  4J9F A;  2QAS A;  1WPY A;  2QQS A;  1VQK T;  4KH0 B;  2DD5 A;  2DE0 X;  2DX1 A;  3TN8 B;  2YHT A;  4OP0 A;  3G6E A;  1K0S A;  4KRC B;  4FU6 A;  4X1V A;  4GLK A;  1P92 A;  3CCS T;  2IG0 A;  2JS0 A;  2EW3 A;  1W70 A;  1VQP Q;  3K7A M;  3FDR A;  4F7U G;  4LD6 A;  1NG2 A;  4GY5 A;  3CC2 T;  3DDP B;  2JOY A;  4PJN A;  1OZ3 A;  4XTX A;  2SEM A;  2I2L A;  3G4S T;  1TG0 A;  1GCP A;  1YI2 Q;  1AEY A;  1K9A A;  2DZ9 A;  1D1A A;  4AFU C;  3X24 B;  4A4H A;  3EH1 A; 
#chains in the Genus database with same CATH homology
 3UT1 A;  5LJ5 f;  3J81 E;  2QDY B;  2K2V A;  4FSX A;  3VKI A;  3S3N A;  1YCY A;  4M78 E;  4Z02 A;  1KC8 C;  3HZJ A;  2X4X A;  3QJ6 A;  3I56 T;  3NFC A;  4JLG A;  5KH6 A;  1LOJ A;  2GFA A;  3OA6 A;  1N9S A;  2ZZD A;  4N4H A;  3NTK A;  4RCC A;  3ZFJ A;  5GMK h;  3VV0 A;  3FIF A;  5GAM f;  2LT1 A;  1Q7Y C;  1KD1 U;  2FB7 A;  3M56 A;  1O75 A;  4M77 B;  1N9R A;  5CQX A;  2E1H A;  1U1S A;  2X4Y A;  4XU2 A;  5CQY A;  2DIG A;  4YTL A;  5LJ3 j;  4M7D C;  3E9G A;  4IUQ A;  3G6E T;  1VQL T;  4JRQ A;  1D3B A;  3TEE A;  3X26 B;  2E64 A;  4DQ2 A;  4BAC A;  4HT8 A;  1G5V A;  1Y7X A;  2V8K A;  4A4G A;  4QW2 A;  4HNV A;  5A2Q E;  1ZBX A;  2XDP A;  4NS5 A;  4FIB A;  3HFO A;  4C5I A;  1VQ4 T;  5DY9 A;  2X4W A;  4BY6 B;  4QQD A;  3JCM Q;  3M4G A;  4P5N A;  1S72 A;  4HA8 A;  2P4T A;  3GPL A;  2RH2 A;  3Q1J A;  5CIU A;  3OYI A;  5D6X A;  2QXF A;  3KBG A;  4M77 E;  5CKF A;  3VUZ A;  4KUL A;  4ELY C;  3LWH A;  2VYT A;  5CKB A;  2HBP A;  4FM4 B;  4PJO G;  5GMK j;  3HRU A;  1XOV A;  3QO3 A;  4N4I A;  2E10 A;  5GAO q;  4FL6 A;  4M75 G;  4ZN3 A;  2RHX A;  4C8Q D;  1M1F A;  2QEX A;  4JJN K;  5GAO r;  4HKE A;  2ZPF B;  1UB4 A;  3VYH B;  1VQ5 A;  3M54 A;  1DJ7 B;  2WJ9 A;  4JS4 A;  3DB3 A;  2RB6 A;  2BUD A;  2EWN A;  2RJC A;  3JB9 G;  4HCB A;  2GFU A;  4DOV A;  4R55 A;  1FX7 A;  3FRN A;  3RES A;  3CCQ T;  1YJN A;  4RG2 A;  1QVG A;  1WJQ A;  2KSS A;  4M7A A;  1K9M C;  1UGP B;  3P8H A;  2K5F A;  3BG3 A;  2RHU A;  3GP8 A;  1KQ1 A;  1NJI U;  2JUF A;  3JCM e;  1Y07 A;  3CXC A;  2JN0 A;  4ME7 A;  3FLG A;  3QUI A;  4J7I A;  2H3J A;  4PKC C;  3JCM W;  2HQX A;  1QVF S;  3OYL A;  2L3R A;  3JB9 I;  3A8M B;  3BG5 A;  2PUK B;  2D9T A;  5HK0 A;  4M75 A;  5LJ5 h;  4Y91 A;  4BE1 A;  5GMK e;  3J80 E;  1JJ2 S;  1VQL A;  4MDX A;  2A7Y A;  3SD4 A;  4IUV A;  1M4Z A;  2K57 A;  2K3X A;  2YLC A;  3HKS A;  3OYN A;  4M7D D;  1VQM A;  2CZ7 B;  2E70 A;  2OAU A;  1UGR B;  2XDD A;  5GAM j;  1FKM A;  2M16 A;  3VJP A;  4BB7 A;  5CCA A;  2PUO B;  4LD9 K;  1VQN A;  4C92 A;  4LDV A;  5J3B A;  2XKO C;  3CEY A;  4C8Q C;  4QVC A;  2VGM A;  1B34 A;  4RMO A;  4M7D F;  3S6W A;  2DEQ A;  2P0Q A;  2RO0 A;  3H8Z A;  4M6V A;  4ELZ C;  1KQS S;  2XI9 A;  4XTU A;  5FRM A;  5CKD A;  2DD4 B;  1R8O B;  2E12 A;  4J83 A;  3VYG A;  4BY6 C;  3CC4 T;  3HSB A;  3CCU A;  3DKM A;  5C6S A;  3JB9 D;  4C8Q A;  1XQH A;  3T9N A;  4OB3 B;  4M78 G;  3RUX A;  3RER A;  3WXM B;  3OMG A;  4X9D A;  1OI1 A;  1KG1 A;  1FXX A;  2EQJ A;  3OSS C;  4QSH A;  3MO8 A;  3H4C A;  2BS4 A;  1YI2 T;  5CO7 A;  4MDW A;  1D3B B;  2LRQ A;  3QZ5 B;  2KAF A;  5GAN j;  1GXI E;  4LOC A;  3EAE A;  4MIM A;  2RHI A;  4E7L A;  1VQ9 A;  4CI0 C;  4ZN1 A;  2OTL T;  2A3L A;  2M0O A;  3CBP A;  3JCM P;  1W2B A;  2E5Q A;  3QZ9 B;  2QI2 A;  1YHQ T;  3LWI A;  2MMP A;  4XU0 A;  3X25 B;  3CCE T;  2DPP B;  2DXU A;  4J6W A;  5GAM e;  4BE0 A;  2P0K A;  3QPH A;  4BDZ A;  2WSF E;  3OYB A;  3TCJ A;  3CCR T;  2Y4X A;  1Y96 B;  2R5M A;  2DAQ A;  4M7A C;  1N8R U;  2KY9 A;  4J7F A;  3OS5 A;  4PNO A;  2JVV A;  3SDZ A;  1I5L A;  2OTJ A;  2JZ2 A;  2RI2 A;  4M77 G;  3OW2 A;  4JX4 A;  3HRT A;  4MZM A;  4FT4 A;  2XG8 D;  5FLX E;  4M75 F;  4J5Y A;  2MI6 A;  5I2S A;  1KD1 C;  5DLQ E;  3OS2 A;  2XID A;  4QQ6 A;  2RA2 A;  5LJ3 g;  2ZZD B;  4BI4 A;  3LGF A;  2FVU A;  2MF2 A;  5GAN e;  3CC2 A;  3TW7 A;  2QQA A;  4M78 D;  5LJ3 f;  4M77 A;  4CRI A;  3OYE A;  1M1G A;  5GAM g;  3BW1 A;  3G4S A;  1M1K C;  1LNX A;  5GAO p;  1BI1 A;  4Q5W A;  3EFS A;  2DTO A;  2PVD B;  3MEW A;  3FC3 A;  4PJO B;  2RJE A;  1G3T A;  4KT0 E;  3KUF A;  2QQ8 A;  4M75 B;  1K73 C;  4VUB A;  3TRE A;  2L8D A;  2PU9 B;  3HP9 A;  3RKW A;  5HY6 A;  4C8Q G;  4MFE A;  1RL2 A;  1M90 C;  5J39 A;  1YBY A;  1I81 A;  5GAN 8;  4BE2 A;  4ZTJ A;  4C0D B;  2RD1 A;  3OYY A;  1QVP A;  3OYM A;  4M7D A;  3P8D A;  3QBY A;  1MGQ A;  3HRS A;  4EMK A;  3LX7 A;  1VIE A;  5CK9 A;  4C92 B;  4HL4 A;  3FJP A;  1K8A U;  3BFM A;  4ZGD B;  2EJ9 A;  4A4K A;  5DLO A;  2YLB A;  4M78 C;  3CCE A;  1X01 A;  5M9O A;  1QP3 A;  4M75 D;  3X20 B;  5IAY A;  2EFI A;  3WVD B;  5GMK l;  1NPR A;  2L89 A;  2XD0 A;  3ZBD A;  1YJ9 T;  3VYG B;  1SSF A;  3E19 A;  3E1S A;  3GNG A;  3G71 T;  3CME T;  4M7D G;  2PVO B;  4M75 E;  3BY7 A;  3OYK A;  2D0Q B;  5FU7 B;  3TW6 A;  5GAO m;  4C92 E;  3GOX A;  2LNV A;  4J8O A;  2OTJ T;  2LC4 A;  3PFS A;  5KCO A;  4QVD A;  2YRV A;  2DIQ A;  3JCM X;  2LQK A;  3V8K A;  1YIJ T;  2AHJ B;  3OYD A;  5LJ3 h;  2EJF A;  2K5L A;  2B8A A;  4DOW A;  3MCA B;  5A0L A;  3OYC A;  3M58 A;  4M7A D;  3N5B B;  2LTO A;  3A8O B;  1YIT A;  2BIV A;  5DM7 R;  2JTM A;  2QDJ A;  1WJS A;  3H6Z A;  4IKF A;  1IRE B;  4OB2 B;  3JB9 J;  1VQK A;  2KMG A;  3C4S A;  3O8V A;  4C0G A;  1QVG S;  5FU7 C;  3CCV T;  2V8I A;  4C5H A;  2JNG A;  4PJO C;  4BUG A;  5LJ3 d;  1I4K 1;  4IUU A;  4A4F A;  1K8A C;  4RCB A;  2RI3 A;  1WJR A;  5IN1 A;  5J26 A;  2LCC A;  2O4X B;  3UDC A;  4E47 A;  3MET A;  3CXC S;  2L5Q A;  2R57 A;  4M78 B;  1VQP T;  3L2W A;  1M5Q 1;  3VU3 C;  4A4E A;  1VQ8 T;  1VQN T;  2ZPE B;  3QXE B;  4AKH A;  1BI2 A;  3JCM V;  1E7P A;  5GAN g;  4PLI A;  2RJF A;  3OBW A;  3CCM A;  4RKU E;  4JS5 A;  3DLM A;  1VQ6 A;  3BDU A;  3M5A A;  3P8B B;  3MP6 A;  4OGC A;  3SFM A;  4XU3 A;  4C5G A;  2VUB A;  1TH7 A;  1K9M U;  2XDB A;  4M77 F;  2F69 A;  4BDY A;  4M78 F;  4C8Q B;  4UC4 A;  1LJO A;  3CD6 T;  3CBO A;  4M77 D;  4PL6 A;  3JCM b;  2KK4 A;  4HNT A;  2ZPG B;  3MP1 A;  4PLL A;  1QP2 A;  1PSE A;  3QWL A;  2QQB A;  1I8F A;  4B9W A;  1N6A A;  3TU4 K;  2VV5 A;  4N0A A;  1KQS A;  2EKO A;  5CKE A;  2LQ8 A;  3L42 A;  2EYQ A;  5IT9 E;  4PJO A;  2EJG A;  2XU8 A;  3E9F A;  2ZCF B;  3WVE B;  3DB4 A;  5EJC A;  2F5K A;  1VQ7 A;  4HT9 A;  1YHQ A;  1VQM T;  2FHD A;  1YIJ A;  3I56 A;  1Q82 C;  2HAX A;  3LH0 A;  4PJO D;  4KUI A;  3QYG B;  2DKG A;  4R56 A;  3LW5 E;  3KXT A;  3CCJ T;  3SB2 A;  1XTD A;  3L2Q A;  2FL7 A;  2GQV A;  4IUP A;  5LJ5 g;  3QYB A;  1H64 1;  1WQW A;  3CPW S;  2DJZ A;  3RIR A;  2EQK A;  5I21 A;  3JCM c;  3I55 T;  2MAM A;  3HFN A;  4C8Q E;  4EDU A;  3L2V A;  3M57 A;  2BKD N;  2K3Y A;  4WF2 A;  3PMT A;  2O01 E;  2R5A A;  2QA4 A;  3HBL A;  3MEU A;  4OGE A;  3MEV A;  3EFR A;  3J7A F;  1O9S A;  2RHY A;  4FT2 A;  3GF5 A;  3UPU A;  3M53 A;  2G3R A;  4HNU A;  4M7A F;  1IZ6 A;  2MWP A;  1PSF A;  1RI0 A;  4Y28 E;  3R6O A;  1VQ6 T;  1M8V A;  4M7D E;  3OW2 S;  4N0A C;  4XAX B;  3V7C A;  1NE8 A;  1VUB A;  4RG8 A;  3ZEH A;  3CCS A;  1K73 U;  2V8J A;  3RKX A;  4C92 G;  3A8G B;  2EIF A;  4MML A;  5I2M A;  2D6F A;  4HCZ A;  4XK8 E;  3OYF A;  1VQ5 T;  4JDS A;  4MFD A;  3CD6 A;  4AKI A;  3KHI A;  2GF7 A;  2MWO A;  2VXF A;  2LDM A;  3M55 A;  3CCR A;  2RJD A;  3OSV A;  4ZGJ B;  1VQO T;  1KQ2 A;  4M7A G;  3A5Z B;  4C92 D;  4DA4 A;  5GAN 5;  2O4X A;  2DXC A;  4LDY A;  2QQ9 A;  5D6W A;  5GAN 7;  4BI8 B;  4M77 C;  1JB0 E;  3OYH A;  4JX5 A;  1OYX A;  3INZ A;  1BKB A;  2RHZ A;  3MP8 A;  1WQ7 A;  3JCM g;  1N8R C;  4M7D B;  4EMK B;  3OYG A;  3OS1 A;  4F7U A;  2CZ1 B;  3CPF A;  2ZPB B;  1G3W A;  4OVA A;  4XTV A;  1G3Y A;  4A54 A;  5HK3 A;  3CC7 A;  3NTI A;  4JX6 A;  2DXB A;  1N27 A;  3C94 A;  3CCJ A;  3GNF B;  2QF7 A;  3UWN A;  1KC8 U;  1UGS B;  2DD5 B;  3QYH B;  2EAY A;  4C0Z A;  3X28 B;  3CMA A;  4AKG A;  2QTX A;  2CYZ B;  4JRK A;  4LDU A;  3RMQ A;  3C12 A;  3SWN C;  1QW1 A;  3GLX A;  5KCH A;  3I55 A;  4EMH A;  1UGQ B;  1BI3 A;  1YJW T;  3RMS A;  4JLI A;  3RKY A;  1M1K U;  1VIF A;  3JSC A;  1G3S A;  3ASK A;  3PNW C;  3A8L B;  3QJY A;  2CGH A;  4B9X A;  4OB0 B;  3OMC A;  1Y71 A;  2DTH A;  3NTH A;  4XTW A;  1Q82 U;  4OF1 A;  2C06 A;  2M1H A;  1X75 C;  5LJ5 e;  3DLL A;  5CAI A;  1JBM A;  3CCV A;  5GAO n;  3M4Y A;  4JRP A;  3OY9 A;  4OMF B;  4NL3 A;  4V2S A;  4IUR A;  2E6Z A;  1HXD A;  3CC4 A;  3JRZ A;  3M9Q A;  2HD0 A;  2LX9 A;  2RK2 A;  1WNL A;  4C0D C;  4O5V A;  5HKC A;  3CCL T;  1OZ2 A;  1XNI A;  2EQU A;  2VGN A;  4M78 A;  2G77 A;  3HL8 A;  3OS0 A;  1YJ9 A;  4C92 F;  5A0D A;  1S72 T;  2KMT A;  1MHN A;  2RK1 A;  2WSC E;  1YI2 A;  4EMK C;  3CCM T;  3L2U A;  2K5I A;  3PGG A;  4X34 A;  3FEO A;  5D6Y A;  2XIC A;  5GAN h;  4L6V 5;  3QDR B;  1JRI A;  3QHS A;  3SWN A;  2OTL A;  3JB9 H;  1VQ9 T;  3HPW A;  4HCC A;  4Z6Y A;  3CBM A;  1W4S A;  4A53 A;  5AYF A;  3JCM h;  4C92 C;  2ZPI B;  3FB9 A;  4J6X A;  4F7U E;  5GAN 3;  1BIB A;  2LCL A;  3OYA A;  2FYK A;  4ZGE B;  1Q86 C;  2XHC A;  1ZHI A;  3HB9 A;  2DVE A;  2QQR A;  5GAN d;  4XQ3 A;  3CMA T;  4O6J A;  4QVZ A;  4XTY A;  1Q7Y U;  5GAO l;  3V8J A;  3MHX A;  2QFZ A;  1YJN T;  3QYE A;  5GAN 6;  1YJW A;  5KE3 A;  1NZ9 A;  4N4G A;  2ZGW A;  3JCM d;  1WGS A;  2F5T X;  3F70 A;  4PJO E;  2BS2 A;  3V7R A;  5CVI A;  1M90 U;  1KHC A;  3PTA A;  2CS7 A;  1VQ4 A;  1U1T A;  3HO8 A;  4BBR M;  3VKG A;  4E7J A;  3PMI A;  3QKJ A;  4PJO F;  1W2B S;  4KBM B;  5KE2 A;  4C5E A;  2CZ0 B;  3G7Z A;  2VXE A;  2PQW A;  2X4J A;  4F7U B;  4X9C A;  2PVG B;  2R58 A;  5FU6 B;  2JTF A;  2WAC A;  2LVM A;  1M9S A;  4MZP A;  2P0P A;  2BS3 A;  4E7K A;  3AHU A;  2DK3 A;  4J6Y A;  2KDS A;  1UEB A;  4II1 A;  3CCL A;  3JB9 F;  4ATO A;  5CR2 A;  1Q86 U;  5CKH A;  1QVF A;  3GIB A;  3L2R A;  3CPW A;  4MZT A;  5FU6 C;  4D6W A;  2XK0 A;  2DTI A;  4M7A B;  5GMK m;  3PIO A;  3CCQ A;  2RM4 A;  5C0M A;  4LDX A;  2KVQ G;  3ER0 A;  4EPC A;  1U8R A;  3V7S A;  4EMG A;  1JJ2 A;  1KHI A;  5EG2 A;  5FRN A;  3LYI A;  1VQ7 T;  3VUB A;  1NPP A;  3QSU A;  4NC6 A;  5A0G A;  3V8L A;  3HHT B;  2E65 A;  3A8H B;  4E7I A;  5FRO A;  5LJ5 d;  3ME9 A;  5GAN 4;  3L1A A;  3OQ5 A;  3G71 A;  1BI0 A;  3CME A;  5LL6 S;  1VQO A;  5GAN 2;  2KQW A;  2X35 A;  5GAN f;  1EIF A;  2EQM A;  4OB1 B;  3M59 A;  2DXC B;  3OYJ A;  2QA4 T;  2HQE A;  3MEA A;  4IUT A;  4ZTF A;  3OBY A;  4HLQ A;  3BDL A;  1HK9 A;  4L5G A;  3JCM f;  3CC7 T;  2DZC A;  5GAM d;  2K4Y A;  2DO3 A;  2NLU A;  4C0F A;  4BI3 A;  4M7A E;  1B34 B;  2DXB B;  4LDW A;  4JRI A;  1FWZ A;  1WPY A;  2E41 A;  2QQS A;  4XU1 A;  3SWN B;  4C8Q F;  3S3O A;  2DD5 A;  1YIT T;  1VQK T;  4NOY A;  2VC8 A;  2GCX A;  2DD4 A;  4F7U F;  2YHT A;  4OP0 A;  3G6E A;  4FU6 A;  4XTZ A;  1NJI C;  3VKH A;  3LGL A;  4M75 C;  4TVR A;  4GLK A;  1P92 A;  5GAM h;  3C95 A;  3CCS T;  3CCU T;  2Y90 A;  4E7H A;  1Q81 C;  4QQG A;  4NL2 A;  1VQP A;  2IG0 A;  3JCM J;  3DL1 A;  1Y96 A;  3OB9 A;  3PIP A;  4BBS M;  1V29 B;  4L59 A;  3S3M A;  4BD3 A;  1AHJ B;  3FDR A;  3L2Z A;  1VQ8 A;  4ELJ A;  4F7U G;  4AI6 A;  2RI5 A;  4GY5 A;  4LD6 A;  1ZQ1 A;  3BG9 A;  2E6N A;  5LJ3 e;  3QG1 A;  2JOY A;  1Q81 U;  3CC2 T;  1OZ3 A;  4KUD K;  1BYM A;  4XTX A;  2DXT A;  2I2L A;  3G4S T;  2QEX T;  2WSE E;  4MMK A;  1X6O A;  2IVW A;  2CKK A;  3QII A;  2HNI A;  1H3Z A;  2Y4Y A;  2ZPH B;  3URG A;  2DZ9 A;  3LLR A;  2M9U A;  3JAM E;  5GMK i;  4JUV A;  1BIA A;  2KR6 A;  3X24 B;  2LT4 A;  3PT9 A;  5L8R E;  4A4H A;  5LJ5 j;  2CZ6 B;  1QLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...