3X24B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 120 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x24B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x24B02
2ZPHB 2O01E 4ZGEB 4XK8E 4KT0E 3VYGA 3A8GB 4RKUE 2ZPFB 1IREB 2PUOB 2PUKB 3QYHB 4OB1B 3QZ9B 1PSEA 2PVOB 1QP3A 3X20B 2CYZB 3QXEB 3X24B 2ZZDA 2PVDB 2ZPGB 2CZ0B 2DXCA 4ZGDB 1AHJB 3X25B 4OB3B 2ZPIB 2CZ6B 2ZPBB 1JB0E 5L8RE 3A8HB 1QP2A 2ZCFB 2DXBA 2QDYB 3VYGB 4Y28E 2CZ1B 3HHTB 1PSFA 2PVGB 2PU9B 2WSCE 2DD4A 2WSFE 2ZPEB 1GXIE 3A8LB 4FM4B 4OB2B 2ZZDB 2D0QB 2DD4B 2DPPB 1DJ7B 3WVEB 1UGSB 2CZ7B 2DXCB 3A8OB 3QZ5B 1UGQB 3X26B 1V29B 2DD5A 4L6V5 3LW5E 2WSEE 3QYGB 2AHJB 2DXBB 3A8MB 4ZGJB 3WVDB 1UGRB 4OB0B 2DD5B 3VYHB 1UGPB 3X28B
chains in the Genus database with same CATH superfamily
2QGGA 2K57A 3R6NA 2IW9B 4ZGEB 2C06A 5DY9A 1B3QA 4X9CA 4PJOB 2X1NB 4J5YA 4RMOA 2E41A 1VQ9T 5GMKi 3LWIA 1AZEA 3ME9A 1QKXA 1FWZA 3CPWS 5IN1A 4J9GA 3I35A 1YN8A 2LJ0A 1U8RA 1VQ4A 4QQDA 1AT1B 2RB6A 3JV3A 5FWCA 4I3ZB 3CCRA 2CYZB 1JO8A 1YCSB 3G71T 1B34A 1VQ4T 4C8QB 5A2QE 3QPHA 1BBZA 1N9RA 3JRZA 2KYMA 2AKLA 2V22B 2EWNA 1C6VX 1KIKA 3CEYA 1UG1A 2EYQA 5IXBA 4N4HA 1BI1A 2ZPBB 3EGDA 4EOSB 3CBOA 3DL1A 1YNZA 2DRKA 2UZEB 2QAZA 2X9HA 3LLRA 5GANg 1VQLA 4JRIA 3TW6A 2CZ1B 2BS3A 1UHFA 3EOCB 3CD6A 2EFIA 1IRXA 3CCJQ 2A7YA 1QLBA 1NYFA 3AT1B 4KULA 4WCIA 4BCKB 4M7DD 4PJOA 1UUEA 1PD0A 1WXTA 1ZSZC 5CKEA 2MOXA 4CRIA 1BI0A 2KRMA 3M0UA 4N4GA 2BZYA 3G4SQ 1B07A 1BB9A 2JM8A 2OAUA 3QDFA 1ABQA 5GAOp 5FU7B 3MEVA 5HNBB 2W9FA 4HL4A 2M0OA 1AZGB 3OA6A 1UB4A 1AD6A 1QVFS 2I40B 1HK9A 1M3AA 3CXCS 2DL7A 2J05A 3QJ6A 3JCMc 2WSEE 5GAOq 3M4YA 2HZYA 4BY6C 4C8QA 2RQVA 2QQ9A 2O31A 2CDTA 5GAOl 1Q86U 4EORB 2DBKA 1Y71A 2YHTA 2CSQA 3OYNA 2EQKA 2HNIA 3MJXA 3RKYA 4M78B 4X9DA 3EIDB 1KSWA 2DVJA 4KH1B 4FT4A 1KG1A 5ECAA 4KT0E 1W2BS 2DMEA 2GF7A 3OBYA 3SDZA 2A3LA 4KRCB 3V7RA 1YJWA 5HBJB 2EPDA 2DM1A 2DFUA 3QYHB 1TTHB 1NZ9A 1O75A 1M90R 2LQKA 3KXTA 4C92E 3DJBA 2COZA 5LJ3j 2X4YA 2QA4T 2NUPB 2EQIA 5IF1B 1MGQA 2HMAA 3RKXA 2IG0A 4M77D 3FDRA 3PGGA 2EGAA 3OS2A 1LOJA 5LJ5f 3OW2S 2QFZA 3BG3A 3S3MA 3EH2A 1SG5A 2XDDA 2CP7A 1G3TA 3LGLA 1PD1A 1KQSS 4RTWA 1T0JA 5GAN7 2UZDB 1ZBJA 1PSFA 1YBYA 3TSWA 1W1FA 3H0FA 5KE2A 4LUEA 4M78A 5AT1B 4PJOC 3LH5A 1YIJA 2WFYB 1MNEA 3M0QA 3RERA 2DPPB 1MNDA 5KE3A 1S72Q 3I56T 1NJIU 2P0PA 3PE0A 1HD3A 3PIOA 1VOMA 3S6WA 4BDYA 3I55T 1R77A 1FYNA 1UEBA 1K4US 4PFPA 3VKIA 1K9AA 1W70A 2L89A 1SHFA 4C8QC 4BE2A 1WHHA 1O9KB 2NUPA 2KQWA 1MHNA 2V8KA 5D7UA 1YI2T 1VA7A 4EIKA 7AT1B 3VS5A 2KMTA 3WVDB 4BCOB 2DA9A 2IW6B 4A4KA 1VQNT 4PJOF 4D6WA 1D3UB 4OMNA 1ZBXA 4E7JA 1VQ8A 2L5QA 4BY1X 1XJWB 3HB9A 2WMAB 4F7UB 3DB4A 1VQ8T 3POMA 1PRMC 1H3ZA 5FU6B 1QMZB 4M75E 4C5GA 5GMKj 4A4GA 3VS1A 1SPKA 1VQPA 2VUBA 1NPPA 4ROCA 3M59A 2CT4A 4A53A 1X43A 4C92G 4KGZB 4M6VA 3D7SB 1PSEA 4C8QF 2YUQA 3X20B 4A54A 2DTOA 3FJ5A 5FU7C 5IH2A 2DEQA 3BLHB 1W4SA 3QBYA 2KRSA 3CCLQ 2PMIB 1VOLA 1YJ9T 3HL8A 3NGPA 2OTJA 4AMCA 2RQRA 2EW3A 1G2BA 4A4EA 1QVGA 1VQ7Q 2E10A 2JUFA 2OTJT 2GCXA 1VQ6A 1VYWB 1O9KA 3CCUQ 3VUZA 2WXVB 1URCB 4XU1A 2CH4A 1WNLA 2PU9B 2VC8A 4M78C 4BCND 3CCEQ 1M1KU 2ECZA 1AVZC 4MIMA 2Y4XA 1E9HB 1Q7YR 1WX6A 2KAFA 2QGSA 5CKDA 5DQWA 1X2QA 4F7UA 1WFWA 2RJDA 4LXCA 3V8JA 1BI3A 2FB7A 3J80E 2GNCA 5CK9A 2K5LA 3CMET 3V7CA 2DXCB 4XTVA 3PNWC 4ELZC 4EC8B 5AYFA 5BNJB 3EFRA 3VRYA 4AFUC 2YUOA 4HT8A 2H8HA 3P8DA 1KC8U 3TVTA 5GAN8 4DBQA 4RTTA 3EHRA 3HRSA 4M78F 1C9BA 3CCQQ 4CXAB 2LNHB 3H0HA 2YLCA 5CKFA 1UGPB 1G5VA 1NEGA 2YRVA 2JNGA 3SB2A 3L42A 2EJFA 4OGEA 3L1AA 2BZ8A 5GAMd 2HBWA 4E7HA 1QCFA 1FINB 4M75G 3OYJA 1ZX6A 3OQ5A 3CCVA 2HKQB 1VQKA 4QQGA 3QHSA 4XAXB 1U1TA 2VYTA 1HXDA 1JQQA 3CCVT 2V8IA 4NOYA 4QKUA 1WQ7A 2L3SA 2QQ8A 2K3XA 2C5NB 2DL8A 1M4ZA 1GCQC 5GJVB 5GMKl 1G8XA 2CZ0B 2QQRA 2R57A 5GAN6 2DXCA 1JJ2S 4BI8B 3MP1A 5C6SA 3TN8B 2WMBB 2OAWA 2DBMA 1D3BB 1SKUB 2RH2A 1KXUA 2L8DA 2HDAA 2MYSA 3TQ7P 3JCMf 1QKWA 2LQNA 1AOJA 3JCMb 4M77B 3FRNA 1M2VB 2JMAA 5J26A 2WSCE 2RQUA 1PWTA 4N0AA 3JCMW 1K0XA 1HYOA 4F7JB 1WJRA 1UECA 1VQ5T 1X01A 2R7GA 4BCJB 3CCMA 1GXIE 3CC4T 1WQWA 4NL3A 4TTHA 2HSEB 3NHNA 5HBHB 1GY3B 4EOLB 2DTIA 4FYVB 3CCMT 3QO3A 2BE9B 3MCAB 3WVEB 1ZA2B 2W9ZA 3JB9I 5CQYA 2LMJA 3IQLA 2E6NA 2YRDA 4EMHA 4CC7A 4E7ZA 1W6XA 2RHUA 3EGUA 2VKNA 2CCHB 4FYXB 2O4XB 4Z8AA 1OX9A 4F7UF 2RNAA 2DZCA 5GAMh 2LNVA 1LNXA 3BDLA 1D3BA 4C92D 1QWEA 2O01E 2C6TB 1WXUA 4J9FA 2RHZA 1BKBA 4AG2C 2IVXA 4Q5WA 3H8ZA 1TWBA 3M57A 1PKDB 3A8GB 3HPWA 4GBQA 1PM3A 2RPNA 1RL2A 3G1JA 1A0NB 3G33B 3H0IA 3VJPA 3L2WA 4FU6A 2DETA 3BHTB 2GQVA 3RDVA 2QXFA 5J39A 2EGEA 2M1HA 2DAQA 4BE1A 2RI3A 2QK0A 5KYXB 3HSBA 1SF9A 4F16A 2YXYA 2HQEA 3M0TA 1OIYB 1VQMQ 3MO8A 3HTRA 3ER0A 4RTVA 4AI6A 4PJNA 3HZJA 3JB9G 1KJWA 3BFMA 4RTXA 4BB7A 2DJZA 1CKBA 4OF1A 2RJFA 2JN0A 2QDJA 1D0YA 1GFCA 2KVQG 5EC7A 5FRNA 1FMVA 4J8OA 4YTLA 3TW7A 1QP2A 2XMFA 4EONB 5CQXA 3BHVB 2UZBB 2JM9A 5D6XA 1Q95G 1E6HA 3TREA 4RODA 1AWXA 4HVUA 4HCCA 3KHIA 1TFBA 3JCMX 4ELYC 3OYKA 1PKSA 2XDBA 4ZTFA 1IHWA 3HKSA 4CC2A 2AK5A 2J6OA 3SWNC 4DBFA 2RI2A 4BCNB 2ZGWA 3VS6A 4M7AG 2EAYA 3WXMB 5CCAA 3A8OB 2CP6A 1RADB 2B8AA 4A63B 3CCSA 1VIEA 3CCRQ 3S3OA 1AD5A 3VKHA 1QCOA 1QLYA 4AKGA 3H41A 2LCCA 2M16A 3CCST 1OX8A 3VUBA 2KYBA 3BHUB 4JJBA 4M75D 1U06A 1QMCA 2CCIB 1D0ZA 2IPOB 1TUGB 1ZSZA 3QWLA 3JCMe 4CC3A 5IHKA 5LJ5d 1X75C 4FL6A 4PFOA 1N5ZA 3GIBA 1VUBA 4X1VA 4WTOB 1VQLQ 4A4FA 4M77C 5HCKA 3BLQB 2MIOA 4KGXB 2J7IA 2L3RA 4RTZA 3CD6Q 3E9FA 4NSTB 2QQSA 5A0LA 2DXTA 2QGFB 1KD1C 1YJNA 3V7SA 2KEAA 4MZMA 4OMOA 2KXCA 1X6BA 2C5VB 4D8KA 4ESRA 5A0GA 2EQUA 1H1RB 3SD4A 2PVOB 2EKOA 4Z89A 3ULRB 3M4GA 2PVDB 2ZPGB 3MKDA 1VQ9A 2OTLQ 2LW4A 2BKDN 5FLXE 4EOJB 2O2OA 2HL3A 2XIDA 2QI2A 1ABOA 1S1NA 3OMGA 4M77F 1I81A 1MMNA 4JZ4A 1Q7YC 3ZBDA 4QVZA 1FX7A 3G71A 4E2FB 1BIBA 4LN2A 1NJIR 2DO3A 2DD4A 1JBMA 3SFMA 3CC7T 3SEMA 4F7SB 1WIEA 3TNWB 5LJ3f 3CMAT 1QCNA 1YJWQ 1YFNA 4XU2A 1H27B 2K9GA 2ZZDB 4KUIA 1R0BG 5GANj 2E65A 2DYIA 5GAOr 3E2UA 4PJLA 2DLPA 5GMKh 2UUEB 2QEXQ 1TS9A 3SHWA 3DKMA 2LTOA 3RUXA 2CT3A 4J9CA 1NG2A 5GAMg 1YITT 4PJOE 4RG2A 2CP2A 1E6GA 1Y7XA 4HT9A 1NLOC 1WHMA 1UGRB 5LJ5h 2K4YA 4LD9K 2M51A 4ELLA 4XTYA 2W2HA 2GTJA 1BI2A 4JPBW 3OYBA 2JTFA 1N8RU 3MEWA 3CC2A 2D9TA 2AZSA 1AWJA 3P8BB 1TXQA 5IHYA 2P84A 2PHGA 4C8QE 3CC2T 2DJQA 1M8VA 5IT9E 3JB9D 1QVGP 2OI3A 1JSUB 2EBPA 1YIJQ 1OZ2A 5FWBA 3TEEA 2E70A 2Y4YA 5GAMe 1Q81U 2LT4A 1FMWA 1QWFA 4MMKA 4GLKA 1JXMA 2ZZDA 3QXEB 5I2SA 2O88A 1X6OA 1PNJA 3LYIA 3OYEA 3PTAA 4RUGA 2QQAA 3A5ZB 1LCKA 2K5FA 5CO7A 5EJCA 1GH6B 1M1KR 3NFCA 5IXFA 1JSTB 3EFSA 1F1BB 4GLMA 3NMZC 5L8RE 2LX7A 4LOCA 2EUFA 2V26A 5GAN5 4NS5A 1AWWA 4JRPA 2QA4A 3N5BB 1KQ2A 3I5RA 4RTYA 4QVCA 4M7AD 3RMSA 6AT1B 2I53A 2BKZB 3E9GA 1K1ZA 3TNHB 2O9SA 2FZCB 1UE9A 1H1QB 1TU0B 2ZPEB 3H4CA 3HBLA 3EG0A 4R0KA 5IHNA 3URGA 2C0OA 2BIVA 4DBHA 1VQPQ 1KC8R 2GFAA 4AT1B 2L2PA 1ARKA 3GNFB 1M9SA 3MI9B 2FEIA 5HVYB 3UT1A 4CFNB 4M78E 2MPXC 2AT1B 2JJ9A 3CCJT 2DX1A 4FIBA 4PJOG 1GFDA 2QF7A 4LDXA 5HK0A 4B9XA 3I56A 5CAIA 2P4RA 3G4ST 3PVQA 4OB0B 1E7PA 3I55A 1VQ6Q 3L2VA 1ENWA 2R58A 2RQTA 2VGNA 2VGMA 4J7IA 2FO0A 1I1JA 1XNIA 2EYYA 2J6KA 2HQXA 3UA6A 4F17A 4OMPA 3JCMd 1OPLA 4C5IA 4C8QG 1YI2A 4RKUE 1FVVB 2LT1A 1OV3A 2PUOB 3L2QA 4HCZA 2FL7A 1YHQQ 3M54A 1VQNA 2YLBA 2EYWA 1K8AR 3UDCA 1OQKA 3ZL7C 1ZP2A 1RAEB 1YWPA 2GTOA 2R5AA 4Z88A 1WDXA 1P5EB 2IN3A 2QASA 2QG9B 4XTZA 4KGVB 4DEYA 2CZ6B 1O9SA 5EFQB 1NPRA 1M1FA 2NUZA 2VVKA 2MCNA 4ANJA 4D8DA 3RKWA 5GAOn 1RAFB 4DA4A 3OS1A 4C5HA 4BCMD 3EGXB 1YJ9A 4CFUD 1RACB 3GPLA 2O9VA 2WACA 3P8HA 3TU4K 2ROTA 3GF5A 3F70A 1VQOQ 1KD1R 1RI9A 1GCQA 1K9MU 1K73U 2NWMA 3A1PA 2ABLA 2CUBA 4Y72B 4Z6YA 5CEIB 3FJPA 1GUXB 1UNLD 4NC6A 4DOVA 2XICA 1VQKQ 3QHRB 1VYVA 4BACA 3OYHA 5HY6A 3QG1A 2E3HA 4MDWA 4F14A 5L2WB 5C0MA 4PLLA 3HRUA 4M78G 2KRNA 2XU8A 5LJ5g 1OIUB 1BU1A 4K11A 1T3SA 2PTKA 1Q82R 1C1AA 1H8KA 1V1CA 4FW2A 1HSQA 2K3BA 4F7UE 5GAN2 2AHJB 1H3HA 2FG0A 5KYUB 4IUTA 4DBRA 3A98A 3CMEA 2EJGA 1VINA 2HD0A 4BBSM 2DD5B 3VYHB 3MPUB 3X28B 4JZ3A 1I4K1 1S72T 4J9DA 5GMKe 2L3PA 1RABB 3FIFA 2WJ9A 3JCMh 2RF0A 3META 4M7DB 1M27C 1H26B 4F6UB 3QYEA 2E6ZA 4F6SB 5IAYA 1M90U 5IDPB 1AISB 4OMMA 2B9RA 2E5KA 3BG5A 4GY5A 2JVVA 4IMYB 5LJ5e 4QQ6A 4BDZA 2MWOA 3MHXA 3OYFA 3G7ZA 5FRMA 3QUIA 2IW8B 1GUXA 2JTMA 5KH6A 3QWYA 2XG8D 3JCMJ 3X24B 2HEQA 4EMKB 2CS7A 3RMQA 1LPLA 1Y0MA 3M56A 5I2MA 3OSVA 1EFNA 2KT1A 4B6MA 5I5ZB 2H3JA 4JS4A 3VS4A 2EYXA 4OB3B 2ZPIB 2RHYA 3SWNB 2BPMB 3CPWA 2K2VA 1NJIC 3OYIA 5GANd 3M9QA 1VYTA 1YCYA 2CSIA 5DQVA 2MMPA 3J81E 4AKHA 1OL2B 3C12A 2BUDA 5KYUA 2DL3A 3LH0A 2GQIA 3EH1A 3MIAB 3M0PA 1MMDA 2PVGB 2VB6A 5J3BA 5D6WA 2EQMA 3CCLT 2JT4A 4MMLA 1KFZA 3C4SA 5DLQE 5L23A 3VS7A 4C0FA 4PJOD 2DRMA 1VQ7T 1PHTA 4M7AB 3OB9A 1MV0B 3VS3A 3CCUA 4ORZA 1TOVA 5GAN4 2GGRA 5HKCA 3HFOA 3CCUT 4OP0A 5A0DA 3X26B 2A0FB 2FZGB 2CUDA 2X4JA 1VQ5A 4PFZA 5KYYB 3CCET 4RG8A 3CC4A 1TH7A 4EMKA 4B9WA 4F7UG 4C8QD 4CFXB 4Y92A 1RI0A 4LE9A 1WHGA 4RCCA 4YOSA 1NYGA 2LCSA 1BIAA 2ESWA 3SWNA 1BK2A 3UA7A 2CGHA 4BBRM 1QVFA 2I2LA 3CXCA 1OU9A 2PK2A 4II1A 4LD6A 2A28A 1RLQC 1GRIA 1WLPB 1WGSA 2MK5A 3CPFA 4BXXX 3QZ9B 2NUTB 2P4TA 2HAXA 4FYYB 2RO0A 2BS2A 2VWFA 2DYBA 4OR5B 2ATCB 4BE0A 3ZEHA 3CCQT 2G3RA 3V8KA 2EYZA 4BCPB 2PZ1A 2VV5A 4BI3A 5LJ3d 1QP3A 2CJMB 1UJYA 2G6FX 1M1KC 1P92A 4RTUA 4DQ2A 1SSFA 2E3IA 3GBQA 4M77E 3AHUA 1W2BA 3RGFB 4ZGDB 1UGVA 4M77A 4WF2A 5GANh 4HNUA 5HBEB 1M2VA 3M55A 1WZOA 5KYYA 2BE7D 3DTOA 1G3WA 3M03A 1MUZA 2JMCA 4CFMB 2KMGA 4JJNK 1WI7A 4JX4A 3G6EQ 1MV3A 2UZLB 1Q7YU 2XDPA 1KC8C 2MF2A 2E12A 3RBBB 1D1BA 2FHDA 4HA8A 4J9EA 4QSHA 4M7DC 4M78D 4AFSC 2J6FA 1M1GA 3CQTA 2V8JA 3M0SA 1IZ6A 3OW2A 2H3EB 2M9UA 5DM7R 2COWA 3C94A 1XQHA 1YJNQ 1DJ7B 1ZUKA 3O0GD 4Z02A 1D1AA 1PRLC 1G3NC 4EMKC 1PG5B 1V29B 2O4XA 1VQ9Q 4L6V5 4AFZC 1K0SA 2OJ2A 2ED1A 2EIFA 2VXEA 2DVEA 1WXBA 3GLXA 1X6GA 2KROA 3JCMg 2F2WA 1UDLA 3NTIA 3GTMS 4M7DF 1AWOA 4ROEA 4V2SA 4F04B 3THKA 3C0CA 3QDRB 2ZPHB 2YRCA 1Q86R 4JLIA 2DIQA 4ME7A 1FXXA 3G71Q 2DERA 4XTXA 3PFSA 3L2UA 1VQ4Q 3REAB 1HJDA 2LZ6B 5KYXA 1K8AC 1JOWA 2CP5A 3K7AM 4QVDA 5GANf 3PIPA 5CKBA 1RUWA 2ZPFB 1IREB 4O6JA 4EPCA 1QVGS 2KR6A 4KRDB 4BY7X 2KNBB 5LJ3h 5EG2A 3HFNA 4LDWA 4EDUA 4F7LB 4M7AC 2V1QA 3OSSC 4II5B 1GBQA 4C0DB 1WHJA 1PKTA 1X27A 4X34A 2G77A 2IVWA 3OS5A 4JLGA 1WJQA 1G3YA 1H24B 5CYIB 4P5NA 2K79A 1IGQA 1QQJA 2X4XA 2KDSA 3QJYA 3VS0A 5GMKm 3HP9A 3KUFA 3M53A 3R6OA 3JSCA 4MDXA 4PNOA 1SHGA 2LX9A 2RK1A 1VQMA 3OYMA 3C95A 2RQWA 2QDYB 2SEMA 2DTHA 3UWNA 1YWOA 3BDUA 1SSHA 3LGFA 4CC4B 2HBPA 2RN8A 1VQMT 1NBEB 5DLOA 1OKWB 2MI6A 4OGCA 5ICPB 3RNJA 3EGDB 4J7FA 3DDQB 3NDQA 4M7AF 2WSFE 2A08A 3LX7A 4CI0C 1OPKA 2HL5C 2YWWA 4PJJA 3NTHA 4LDVA 4LDYA 1Q82C 5KCHA 3PT9A 4BCHB 2IIMA 1PCXA 4HNTA 1UGSB 3E1SA 1UNGD 5FROA 2L0AA 3M5AA 1UJ0A 3UPUA 1OYXA 4TVRA 3CC7A 2C5OB 4IUUA 4JDSA 4J9IA 3CMAA 4IIOA 1OI1A 2K7AA 4HVVA 2EJ9A 1KK7A 3S3NA 2DXBB 3EG1A 4DOWA 2W0ZA 5ACBA 3B57A 3QHWB 1D0XA 4OMFB 4MFDA 2F2VA 1R8OB 3MP6A 2QA4Q 2E5QA 4HKEA 1OL1B 5LQFB 2VXFA 4XK8E 2D0NA 1YITA 5LL6S 1KQ1A 1YP5A 5GAMj 3CCRT 4KRTA 3LQ5B 3U23A 1GBRA 4IKFA 4DEXA 3QYBA 2CP0A 2JW4A 5LMKB 2QDLA 4ELJA 4E7LA 2BS4A 4KUDK 2DF6A 4N4IA 5IHIA 2AIRB 3EG9B 1N6AA 4JJDA 1VQLT 1NE8A 1NM7A 4E47A 1M8MA 1D1CA 2XI9A 3CD6T 4ZN3A 1N27A 3HRTA 1MMGA 2QQBA 1Z9QA 3X25B 2RHXA 4C92B 3H6ZA 1K9MR 1J3TA 1RAIB 1K73R 1ACMB 4IURA 1B7TA 2CREA 3PMTA 3I56Q 4MZPA 2OTLA 1ZA1B 2DXBA 5GJWB 4YC3B 4OMLA 3HHTB 3I55Q 1V76A 3OYDA 2OTLT 2LRQA 1M3CA 3EAEA 2LC4A 2D8JA 2F2XA 5GANe 3INZA 1JJ2A 2RD1A 4PLIA 4PJMA 3JCMV 3A8LB 3KBGA 1YI2Q 5CKHA 4FM4B 3OYLA 4OB2B 1RAHB 3LWHA 4FX3B 3PVLA 4BCGB 8ATCB 1VQNQ 4E7SA 2LQ8A 1AEYA 1WHKA 4J9BA 2JS0A 5M9OA 1M3BA 3BY7A 2AKKA 3QZ5B 1I0CA 2MWPA 1UNHD 3VV0A 3F5XB 1H25B 4XU0A 2W10A 3OYGA 4C0DC 4FSSA 1IHVA 2P0KA 1I8FA 4CRLB 1IGUA 1UTIA 4M4ZA 1VQ8Q 3VS2A 2NLUA 2X51A 2MAMA 2G9XB 3EG9A 2FRYA 3EHQA 2AZVA 3GNGA 1YJWT 2PQWA 3A8MB 2E1HA 2YDLA 2DXUA 4C92A 1JXOA 2ENMA 2KI7A 2QEXA 3VRZA 3CCJA 4LUDA 5LJ3g 1Y96B 1YJ9Q 4EOKB 3MEAA 5KCOA 2QEXT 4JUVA 2P0QA 3FEOA 3G4SA 4OB1B 4IUPA 2OTJQ 3CPWP 1LVKA 1VYUA 1ZUUA 3OYYA 4BI4A 3CBMA 2KSSA 2C5XB 1TG0A 2LVMA 4J9HA 2PJQA 2YUNA 2DKGA 3DLLA 1K76A 2CH4W 1H4LD 3I9QA 4M75B 4MFEA 2JXBA 4FT2A 2XKOC 4EOPB 2L3QA 3TCJA 3RR6A 4PL6A 1EZZB 5LJ3e 4AKIA 3T9NA 2LCLA 2RJCA 1YIJT 2K5IA 4F70B 3DLMA 2DZ9A 4HVWA 3CMEQ 3CBPA 2ZCFB 2C4GB 2W99A 4UC4A 1ZUYA 3JB9J 4OMQA 1G83A 3QKJA 1U3OA 1T3LA 2XK0A 2YUPA 1JEGA 4QW2A 3KFVA 1QW1A 1U5SA 1Y96A 2NYSA 4MZTA 3J7AF 4E7IA 1Z9ZA 2ZAEA 2FPFA 1UHCA 3EG2A 1GL5A 3L2RA 1N8RC 2D6FA 2WHBB 2KY9A 4C0ZA 3FB9A 4RCBA 2F1LA 4R55A 4FYWB 1QVFP 2LJ3A 4IIMA 2DL5A 3CXCP 3LW5E 1TUDA 1Q86C 1OU8A 2LDMA 1SRMA 1Q81C 3OY9A 4M75A 4G6LB 4L59A 4KBMB 1FKMA 2D1XA 1OKVB 3E19A 2X3XD 4O5VA 4C92C 3CCVQ 1VQPT 3BW1A 4J6WA 3DDPB 1X69A 5LJ5j 2C0TA 5CIUA 2DIGA 2KXDA 1BYMA 4EOQB 2F5KA 1OOTA 4AFQC 2HQHA 4EMGA 5HQ0B 3MY1B 1W2BP 1IXDA 1OZ3A 1OEBA 2F69A 8AT1B 3EJ1B 2CKKA 3UATA 1TUCA 4HNVA 2FRWA 2E64A 2WIHB 4J83A 1S72A 3EFOB 4BCFB 2PNIA 1WYXA 4EOOB 2K6DA 4HXJA 2ED0A 1VQ6T 3GOXA 2F5TX 9ATCB 1WA7A 4FSXA 2FPEA 1H28B 1ZSGA 5GAOm 4C92F 1NLPC 2VASA 5I21A 2CP3A 1YHQA 2EQJA 1R0CB 4F6WB 1VQ5Q 1EX4A 3EGXA 1N9SA 1AHJB 4JS5A 1JKWA 1OGUB 3CC4Q 4IUVA 1MMAA 3FC3A 1SRLA 2FPDA 3OW2P 1YHQT 1JB0E 3FLGA 3ASKA 2E4HA 3CCMQ 4XQ3A 2Y90A 3A8HB 4HCBA 2JZ2A 4OGRB 3VYGB 2M0YA 4L5GA 1KQSP 1Y57A 2RA2A 2OX7A 2Z0WA 2BTTA 3V8LA 3L2ZA 3PO3S 4XU3A 3JCMP 4LNPA 4XTWA 1JRIA 1CKAA 2D0QB 3O5ZA 3JAME 5I11A 4JX5A 4PKCC 2CZ7B 2KE9A 1VQOA 2PK9B 4CFWB 3CCLA 1H1SB 3TNIB 3EFOA 3RESA 3GP8A 3NTKA 3BG9A 4BCQD 1Y07A 2DD5A 1VQOT 2LP5A 2EGCA 2WEVB 4M7DE 2WIPB 4M75C 1VQ7A 2DEUA 4M7DA 4KH0B 2SRCA 1U1SA 1SEMA 4HCKA 3HO8A 4ZGJB 2JOYA 1VQKT 4XTUA 1NEBA 1UFFA 1XOVA 4J6YA 4JRQA 1WPYA 2X4WA 1F5QB 2LJ1A 4F7NB 5KYWB 3CCEA 4ATOA 2BZXA 1G3SA 4Y91A 4C0GA 2RM4A 2FVUA 3VYGA 1I5LA 2FYKA 3M58A 2QYZA 1WJSA 1K8AU 5FGKB 2A37A 4EC9B 3MEUA 2KK4A 3NPFA 3Q1JA 4E6RA 1OULA 2YSQA 4M75F 2LQWA 3PMIA 3OBWA 4C5EA 3OYCA 1H641 1K9MC 5IDNB 1K73C 4JX6A 1D09B 1RLPC 2DE0X 2R5MA 1LJOA 5FU6C 3M0RA 3CCQA 2GFUA 3JCMQ 4JRKA 1QVPA 2JTEA 1ZHIA 4FW1A 3UF4A 4UN0A 4M7AE 4BD3A 1KD1U 5I22A 4FCYA 4PK4A 1GCPA 1CSKA 4M7AA 4VUBA 1T0HA 2B86A 5KYNA 3CCSQ 5KYWA 1ZQ1A 4ZNXA 5CR2A 2EVRA 3MY5B 3TSZA 3REBB 5FW9A 4BUGA 1KHCA 1H92A 4EOMB 1Q82U 2QTXA 1M90C 1EIFA 1UGQB 4E7KA 4QT7A 1OI9B 2HSPA 4ZTJA 3BLRB 3H9NA 1X2KA 4M7DG 2X35A 2I0NA 3RIRA 2DILA 4BCMB 4CFUB 2RK2A 3MP8A 4JJCA 1BCMA 1BCOA 1RAGB 3OYAA 1KQSA 4YOOA 2KBTA 2A36A 2K3YA 2NUTA 2X3WD 2W96A 2RMOA 4A4HA 2HCKA 2ROLA 4HLQA 3I5SA 1N8RR 2DNUA 2DMOA 1ZSZB 2DL4A 2COYA 2PUKB 2EKHA 3BE3A 2WPAB 2C0IA 1I07A 3QSUA 4R56A 2V1RA 2RI5A 4N0AC 1M30A 1Q81R 4CFVB 4EOIB 2KGTA 1IB8A 1XO2A 2RHIA 3QWXX 4BY6B 2J06A 2YT6A 3CC7Q 2DK3A 1JJ2P 4BCIB 1BU2A 1H1PB 2JGZB 3CMAQ 2QTVA 4ZN1A 1N4MA 2FZKB 4AG1C 3DOGB 1FMKA 5GAMf 2D8HA 3VU3C 3JB9F 4IUQA 3OS0A 4Y28E 1M5Q1 3OMCA 2F2CA 3QIIA 2KT8A 1ZLMA 1I5OB 4M77G 1WHLA 5HK3A 3O8VA 4OVAA 1YITQ 1E7OA 1W98B 2GBQA 2RJEA 1M2OA 2KR3A 4J6XA 1PC0A 3EG3A 2JS2A 3G6EA 1B34B 2DD4B 1KHIA 5D6YA 1C0MA 5GAN3 3G6ET 2M02A 3ZFJA 1TD6A 2XD0A 3CC2Q 1JU5C 4YOZA 5CVIA 3QYGB 3DB3A 2K2MA 1VIFA 4LDUA 4NL2A 1IO6A 2HKNA 1TSFA 2XHCA 4BCQB 3VKGA 1YJNT 3JB9H 1RAAB 1XTDA
chains in the Genus database with same CATH topology
2LNVA 1LNXA 3BDLA 1D3BA 2K57A 4C92D 5GMKe 2O01E 2QEXA 3FIFA 2WJ9A 3CCJA 2RHZA 3JCMh 4ZGEB 1BKBA 5DY9A 2C06A 3META 1Y96B 5LJ3g 4M7DB 4Q5WA 4X9CA 4PJOB 3MEAA 5KCOA 3H8ZA 2QEXT 3QYEA 3M57A 4J5YA 2E6ZA 2E41A 5IAYA 3A8GB 5GMKi 4RMOA 3HPWA 1VQ9T 4JUVA 1M90U 3LWIA 1RL2A 2P0QA 3ME9A 3FEOA 3BG5A 4GY5A 3VJPA 3L2WA 4OB1B 2JVVA 4FU6A 3G4SA 2GQVA 4IUPA 1FWZA 3CPWS 5J39A 2QXFA 5IN1A 5LJ5e 4QQ6A 4BDZA 2MWOA 2M1HA 2DAQA 3MHXA 3OYYA 3G7ZA 4BI4A 3CBMA 2KSSA 2RI3A 3QUIA 3OYFA 4BE1A 5FRMA 3HSBA 2LVMA 1U8RA 2JTMA 1VQ4A 5KH6A 4QQDA 3JCMJ 2DKGA 2RB6A 2XG8D 3DLLA 3CCRA 2HQEA 2CYZB 3X24B 4EMKB 2CS7A 3RMQA 3CPWA 3MO8A 3G71T 3M56A 1B34A 3ER0A 1VQ4T 4C8QB 4AI6A 4M75B 5A2QE 3QPHA 3HZJA 5I2MA 1N9RA 3OSVA 3JRZA 4MFEA 3JB9G 4FT2A 2XKOC 3BFMA 2EWNA 3TCJA 2DJZA 2H3JA 4BB7A 4JS4A 4OF1A 2RJFA 3CEYA 4PL6A 2EYQA 2JN0A 2QDJA 4OB3B 4N4HA 2ZPIB 2RHYA 3SWNB 1BI1A 4AKIA 2K2VA 2ZPBB 2KVQG 3T9NA 5LJ3e 5GANd 3OYIA 3CBOA 3DL1A 2LCLA 3M9QA 5FRNA 2RJCA 1YCYA 4J8OA 4YTLA 3TW7A 1YIJT 2K5IA 3DLMA 2MMPA 2DZ9A 3J81E 1QP2A 3CBPA 4AKHA 5CQXA 2ZCFB 3C12A 2BUDA 3LLRA 4UC4A 5GANg 1VQLA 4JRIA 3JB9J 3LH0A 5D6XA 3TW6A 2CZ1B 2BS3A 3TREA 2PVGB 5J3BA 3QKJA 5D6WA 2EFIA 3CD6A 2EQMA 3CCLT 4MMLA 4HCCA 3KHIA 2A7YA 1QLBA 2XK0A 3C4SA 5DLQE 5GAMh 4KULA 3JCMX 4QW2A 4ELYC 3OYKA 1QW1A 4C0FA 1Y96A 4MZTA 2XDBA 3J7AF 4E7IA 4ZTFA 4M7DD 4PJOA 4PJOD 3HKSA 1VQ7T 5CKEA 4M7AB 4CRIA 1BI0A 3OB9A 3L2RA 1N8RC 4N4GA 3SWNC 2D6FA 3CCUA 2KY9A 4C0ZA 2OAUA 2RI2A 2ZGWA 5GAOp 5GAN4 4M7AG 3FB9A 5FU7B 4RCBA 2EAYA 3WXMB 3MEVA 5HKCA 5CCAA 3A8OB 3HFOA 3CCUT 4HL4A 4OP0A 2M0OA 5A0DA 3X26B 2B8AA 4R55A 3OA6A 1UB4A 3CCSA 1VIEA 1QVFS 3S3OA 2X4JA 1VQ5A 1HK9A 3VKHA 3CXCS 3QJ6A 4AKGA 3LW5E 4RG8A 3CC4A 1TH7A 3CCET 3JCMc 2LCCA 4EMKA 2WSEE 5GAOq 2M16A 3CCST 4B9WA 4F7UG 3M4YA 1Q86C 2LDMA 3VUBA 1Q81C 4BY6C 4C8QA 4C8QD 4M75A 3OY9A 4M75D 1RI0A 4L59A 2QQ9A 4KBMB 1FKMA 5GAOl 1Q86U 3E19A 4O5VA 4C92C 4RCCA 1VQPT 3BW1A 2YHTA 1Y71A 4J6WA 3QWLA 1BIAA 3JCMe 3SWNA 3OYNA 2EQKA 2HNIA 1X75C 4FL6A 3RKYA 4M78B 4X9DA 5LJ5j 5LJ5d 3GIBA 1VUBA 5CIUA 2DIGA 2CGHA 4BBRM 1QVFA 4FT4A 4A4FA 2I2LA 1BYMA 4M77C 3CXCA 2F5KA 1KG1A 4EMGA 4KT0E 1W2BS 4II1A 4LD6A 2L3RA 1OZ3A 2F69A 2GF7A 3E9FA 3OBYA 2A3LA 3SDZA 3V7RA 2QQSA 2CKKA 1YJWA 1WGSA 5A0LA 2DXTA 3CPFA 3QYHB 4HNVA 1KD1C 3QZ9B 2E64A 1YJNA 2P4TA 4MZMA 3V7SA 1NZ9A 2HAXA 2RO0A 1O75A 2BS2A 5A0GA 4J83A 1S72A 2LQKA 3KXTA 4BE0A 2EQUA 3ZEHA 3SD4A 3CCQT 4C92E 2G3RA 3V8KA 2VV5A 4BI3A 2PVOB 5LJ3d 1QP3A 5LJ3j 2EKOA 1VQ6T 1M1KC 1P92A 3GOXA 4DQ2A 2F5TX 1SSFA 2PVDB 2X4YA 3M4GA 2ZPGB 1NJIC 1VQ9A 2QA4T 4FSXA 5GAOm 2BKDN 4M77E 3AHUA 5FLXE 1W2BA 4C92F 1MGQA 3RKXA 4ZGDB 5I21A 1YHQA 2EQJA 2IG0A 4C92A 4M77A 4WF2A 4M77D 3FDRA 3PGGA 5GANh 3OS2A 4HNUA 1N9SA 1AHJB 2XIDA 4JS5A 2QI2A 4IUVA 1LOJA 5LJ5f 3FC3A 3OW2S 2QFZA 3M55A 1YHQT 1JB0E 3OMGA 4M77F 3FLGA 1G3WA 3ASKA 3BG3A 1I81A 3S3MA 4XQ3A 2Y90A 2XDDA 3A8HB 1Q7YC 2KMGA 2JZ2A 3ZBDA 1G3TA 4QVZA 1FX7A 3LGLA 3G71A 4JJNK 1KQSS 3VYGB 4JX4A 4L5GA 5GAN7 2RA2A 1BIBA 1PSFA 1YBYA 3V8LA 1Q7YU 2XDPA 1KC8C 2DO3A 2DD4A 2MF2A 5KE2A 2E12A 1JBMA 2FHDA 3L2ZA 4HA8A 4QSHA 4M7DC 4M78A 3SFMA 4M78D 3CC7T 4PJOC 1M1GA 4XU3A 2V8JA 5LJ3f 3JCMP 1YIJA 1IZ6A 3OW2A 3CMAT 4XTWA 1JRIA 4XU2A 2M9UA 2ZZDB 4KUIA 5DM7R 3C94A 2D0QB 1XQHA 5GANj 3RERA 2E65A 3JAME 2DPPB 4JX5A 1DJ7B 5KE3A 4PKCC 5GAOr 3I56T 1NJIU 2CZ7B 2P0PA 1VQOA 3PIOA 3CCLA 4Z02A 3RESA 3S6WA 5GMKh 3NTKA 3I55T 3BG9A 3GP8A 4BDYA 4EMKC 1V29B 1Y07A 2DD5A 3DKMA 1UEBA 1VQOT 2O4XA 2LTOA 4L6V5 3RUXA 3VKIA 2L89A 4M7DE 4C8QC 4BE2A 4M75C 5GAMg 1YITT 1VQ7A 4PJOE 2EIFA 4RG2A 2VXEA 2DVEA 2KQWA 3GLXA 4M7DA 3JCMg 1MHNA 1Y7XA 2V8KA 1YI2T 1U1SA 4HT9A 3NTIA 3HO8A 4ZGJB 2KMTA 3WVDB 1UGRB 2JOYA 5LJ5h 2K4YA 1VQKT 4LD9K 4M7DF 4A4KA 4V2SA 4XTUA 1VQNT 1XOVA 4XTYA 4PJOF 4D6WA 1BI2A 4J6YA 3OYBA 1WPYA 4JRQA 3QDRB 2ZPHB 1ZBXA 2JTFA 2X4WA 4JLIA 2DIQA 3MEWA 4ME7A 2L5QA 4E7JA 1FXXA 1N8RU 1VQ8A 3CCEA 4XTXA 3CC2A 4ATOA 3PFSA 3L2UA 3HB9A 1G3SA 2D9TA 4Y91A 2RM4A 4C0GA 1K8AC 2FVUA 3P8BB 4F7UB 3DB4A 4F7UF 4QVDA 3VYGA 5GANf 3PIPA 5CKBA 1VQ8T 1H3ZA 1I5LA 2FYKA 3M58A 5FU6B 4C8QE 3CC2T 4M75E 4C5GA 5GMKj 1M8VA 2ZPFB 1WJSA 4A4GA 5IT9E 1K8AU 3JB9D 1IREB 4O6JA 4EPCA 1QVGS 1VQPA 2VUBA 1NPPA 3MEUA 2KK4A 2KR6A 3M59A 3Q1JA 5LJ3h 5EG2A 4A53A 1OZ2A 3TEEA 3HFNA 2E70A 2Y4YA 4LDWA 4C92G 4EDUA 4M6VA 5GAMe 1Q81U 4M7AC 1PSEA 2LT4A 4C8QF 4M75F 3X20B 3PMIA 3OSSC 4MMKA 4A54A 4GLKA 3OBWA 4C0DB 4C5EA 2ZZDA 3QXEB 2DTOA 3OYCA 1H641 5FU7C 1K9MC 4X34A 2G77A 1K73C 2DEQA 2IVWA 1W4SA 3QBYA 1X6OA 5I2SA 4JX6A 3OS5A 3LYIA 3OYEA 3PTAA 1YJ9T 4JLGA 1WJQA 2QQAA 3A5ZB 2K5FA 3HL8A 1G3YA 5CO7A 2OTJA 4P5NA 5EJCA 2R5MA 1LJOA 2X4XA 2KDSA 3QJYA 5FU6C 4A4EA 1QVGA 3CCQA 5GMKm 3HP9A 3NFCA 2E10A 2GFUA 3EFSA 3KUFA 2JUFA 3M53A 3JSCA 3R6OA 4JRKA 3JCMQ 4MDXA 2OTJT 4PNOA 5L8RE 2GCXA 1VQ6A 1QVPA 4LOCA 1ZHIA 2LX9A 5GAN5 4NS5A 4M7AE 2RK1A 4BD3A 1VQMA 4JRPA 1KD1U 3OYMA 3C95A 2QA4A 3N5BB 2QDYB 3UWNA 2DTHA 1KQ2A 3VUZA 3BDUA 4QVCA 3LGFA 4M7AA 4M7AD 2HBPA 4XU1A 3RMSA 4VUBA 1WNLA 2PU9B 2VC8A 5DLOA 1VQMT 4M78C 2MI6A 4OGCA 4J7FA 3E9GA 1M1KU 4M7AF 2WSFE 3LX7A 4MIMA 2Y4XA 4CI0C 1ZQ1A 2ZPEB 5CR2A 3H4CA 2KAFA 3HBLA 5CKDA 3NTHA 4LDVA 4F7UA 4BUGA 2RJDA 4LDYA 3URGA 1KHCA 3V8JA 5KCHA 1Q82C 1BI3A 2FB7A 3J80E 3PT9A 2BIVA 1S72T 5CK9A 2K5LA 2GFAA 3CMET 1Q82U 4HNTA 1UGSB 3V7CA 2DXCB 3E1SA 3GNFB 2QTXA 1M9SA 3PNWC 4XTVA 5FROA 4ELZC 1M90C 1EIFA 1UGQB 3M5AA 4E7KA 3UPUA 1OYXA 4TVRA 3UT1A 3CC7A 5AYFA 4M78E 4ZTJA 3EFRA 3CCJT 4IUUA 4M7DG 4FIBA 2X35A 4JDSA 3CMAA 1OI1A 4PJOG 4HT8A 3RIRA 3P8DA 2EJ9A 1KC8U 5GAN8 3S3NA 2DXBB 2QF7A 4LDXA 5HK0A 4DOWA 4B9XA 3HRSA 4M78F 3I56A 2RK2A 3MP8A 5CAIA 3G4ST 4OMFB 4OB0B 1E7PA 2YLCA 4MFDA 5CKFA 1UGPB 3OYAA 3I55A 1G5VA 1R8OB 2YRVA 3L2VA 2JNGA 3MP6A 3SB2A 1KQSA 2R58A 3L42A 2K3YA 2EJFA 2VGNA 4OGEA 2VGMA 4J7IA 3L1AA 2E5QA 4HKEA 4A4HA 2VXFA 4XK8E 5GAMd 1XNIA 5LL6S 1KQ1A 5GAMj 1YITA 3CCRT 2HQXA 4E7HA 3JCMd 4HLQA 4IKFA 4C5IA 4C8QG 3QYBA 4M75G 4RKUE 1YI2A 3OYJA 2LT1A 2PUOB 3L2QA 2PUKB 4HCZA 3OQ5A 2FL7A 3CCVA 1VQKA 4QQGA 4ELJA 3M54A 3QHSA 1VQNA 4XAXB 1U1TA 4E7LA 2BS4A 2VYTA 1HXDA 2YLBA 4R56A 3QSUA 3UDCA 3CCVT 2V8IA 4NOYA 2RI5A 4KUDK 1WQ7A 2QQ8A 2K3XA 4N4IA 4N0AC 1M4ZA 5GMKl 1N6AA 2CZ0B 1VQLT 2QQRA 1NE8A 2R57A 5GAN6 4E47A 2R5AA 2DXCA 2RHIA 2XI9A 4BY6B 3CD6T 4ZN3A 1JJ2S 1N27A 2DK3A 3HRTA 3MP1A 4BI8B 5C6SA 2QQBA 4XTZA 3X25B 2RHXA 2CZ6B 4ZN1A 4C92B 1O9SA 3H6ZA 1D3BB 2RH2A 1NPRA 2L8DA 1M1FA 4IURA 5GAMf 3PMTA 3VU3C 3JB9F 4IUQA 3RKWA 4MZPA 2OTLA 5GAOn 3OS0A 2DXBA 3JCMf 4DA4A 4Y28E 1M5Q1 3OMCA 3JCMb 4M77B 4C5HA 3OS1A 1YJ9A 3FRNA 3HHTB 3QIIA 3GPLA 2WACA 3OYDA 3P8HA 3TU4K 2OTLT 5J26A 2LRQA 2WSCE 3F70A 3GF5A 4M77G 4N0AA 3EAEA 2LC4A 5HK3A 3O8VA 4OVAA 3INZA 5GANe 3JCMW 1JJ2A 1K9MU 2RD1A 4PLIA 1WJRA 1K73U 1VQ5T 3JCMV 1X01A 2RJEA 4Z6YA 1GXIE 3A8LB 3FJPA 3KBGA 3CCMA 3CC4T 1WQWA 4FM4B 4NC6A 4J6XA 5CKHA 4NL3A 3OYLA 4OB2B 4DOVA 3LWHA 2XICA 3G6EA 1B34B 2DD4B 2DTIA 3CCMT 3QO3A 3OYHA 4BACA 2LQ8A 3MCAB 5HY6A 3WVEB 3QG1A 1KHIA 5M9OA 3BY7A 4MDWA 5D6YA 3QZ5B 5GAN3 2MWPA 3G6ET 3JB9I 3VV0A 4HCBA 4XU0A 5C0MA 3OYGA 4PLLA 3HRUA 4C0DC 4M78G 5CQYA 3ZFJA 2P0KA 2XU8A 1I8FA 5LJ5g 2E6NA 4EMHA 2NLUA 2XD0A 2MAMA 4F7UE 5CVIA 3QYGB 2AHJB 3DB3A 5GAN2 1VIFA 4IUTA 4LDUA 3GNGA 4NL2A 3CMEA 1YJWT 2EJGA 2PQWA 2RHUA 2XHCA 3A8MB 2HD0A 3VKGA 1YJNT 3JB9H 4BBSM 2E1HA 2DD5B 3VYHB 2O4XB 1XTDA 3X28B 2DZCA 1I4K1 2DXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPH B;  2O01 E;  4ZGE B;  4XK8 E;  4KT0 E;  3VYG A;  3A8G B;  4RKU E;  2ZPF B;  1IRE B;  2PUO B;  2PUK B;  3QYH B;  4OB1 B;  3QZ9 B;  1PSE A;  2PVO B;  1QP3 A;  3X20 B;  2CYZ B;  3QXE B;  3X24 B;  2ZZD A;  2PVD B;  2ZPG B;  2CZ0 B;  2DXC A;  4ZGD B;  1AHJ B;  3X25 B;  4OB3 B;  2ZPI B;  2CZ6 B;  2ZPB B;  1JB0 E;  5L8R E;  3A8H B;  1QP2 A;  2ZCF B;  2DXB A;  2QDY B;  3VYG B;  4Y28 E;  2CZ1 B;  3HHT B;  1PSF A;  2PVG B;  2PU9 B;  2WSC E;  2DD4 A;  2WSF E;  2ZPE B;  1GXI E;  3A8L B;  4FM4 B;  4OB2 B;  2ZZD B;  2D0Q B;  2DD4 B;  2DPP B;  1DJ7 B;  3WVE B;  1UGS B;  2CZ7 B;  2DXC B;  3A8O B;  3QZ5 B;  1UGQ B;  3X26 B;  1V29 B;  2DD5 A;  4L6V 5;  3LW5 E;  2WSE E;  3QYG B;  2AHJ B;  2DXB B;  3A8M B;  4ZGJ B;  3WVD B;  1UGR B;  4OB0 B;  2DD5 B;  3VYH B;  1UGP B;  3X28 B; 
#chains in the Genus database with same CATH topology
 2QGG A;  2K57 A;  3R6N A;  2IW9 B;  4ZGE B;  2C06 A;  5DY9 A;  1B3Q A;  4X9C A;  4PJO B;  2X1N B;  4J5Y A;  4RMO A;  2E41 A;  1VQ9 T;  5GMK i;  3LWI A;  1AZE A;  3ME9 A;  1QKX A;  1FWZ A;  3CPW S;  5IN1 A;  4J9G A;  3I35 A;  1YN8 A;  2LJ0 A;  1U8R A;  1VQ4 A;  4QQD A;  1AT1 B;  2RB6 A;  3JV3 A;  5FWC A;  4I3Z B;  3CCR A;  2CYZ B;  1JO8 A;  1YCS B;  3G71 T;  1B34 A;  1VQ4 T;  4C8Q B;  5A2Q E;  3QPH A;  1BBZ A;  1N9R A;  3JRZ A;  2KYM A;  2AKL A;  2V22 B;  2EWN A;  1C6V X;  1KIK A;  3CEY A;  1UG1 A;  2EYQ A;  5IXB A;  4N4H A;  1BI1 A;  2ZPB B;  3EGD A;  4EOS B;  3CBO A;  3DL1 A;  1YNZ A;  2DRK A;  2UZE B;  2QAZ A;  2X9H A;  3LLR A;  5GAN g;  1VQL A;  4JRI A;  3TW6 A;  2CZ1 B;  2BS3 A;  1UHF A;  3EOC B;  3CD6 A;  2EFI A;  1IRX A;  3CCJ Q;  2A7Y A;  1QLB A;  1NYF A;  3AT1 B;  4KUL A;  4WCI A;  4BCK B;  4M7D D;  4PJO A;  1UUE A;  1PD0 A;  1WXT A;  1ZSZ C;  5CKE A;  2MOX A;  4CRI A;  1BI0 A;  2KRM A;  3M0U A;  4N4G A;  2BZY A;  3G4S Q;  1B07 A;  1BB9 A;  2JM8 A;  2OAU A;  3QDF A;  1ABQ A;  5GAO p;  5FU7 B;  3MEV A;  5HNB B;  2W9F A;  4HL4 A;  2M0O A;  1AZG B;  3OA6 A;  1UB4 A;  1AD6 A;  1QVF S;  2I40 B;  1HK9 A;  1M3A A;  3CXC S;  2DL7 A;  2J05 A;  3QJ6 A;  3JCM c;  2WSE E;  5GAO q;  3M4Y A;  2HZY A;  4BY6 C;  4C8Q A;  2RQV A;  2QQ9 A;  2O31 A;  2CDT A;  5GAO l;  1Q86 U;  4EOR B;  2DBK A;  1Y71 A;  2YHT A;  2CSQ A;  3OYN A;  2EQK A;  2HNI A;  3MJX A;  3RKY A;  4M78 B;  4X9D A;  3EID B;  1KSW A;  2DVJ A;  4KH1 B;  4FT4 A;  1KG1 A;  5ECA A;  4KT0 E;  1W2B S;  2DME A;  2GF7 A;  3OBY A;  3SDZ A;  2A3L A;  4KRC B;  3V7R A;  1YJW A;  5HBJ B;  2EPD A;  2DM1 A;  2DFU A;  3QYH B;  1TTH B;  1NZ9 A;  1O75 A;  1M90 R;  2LQK A;  3KXT A;  4C92 E;  3DJB A;  2COZ A;  5LJ3 j;  2X4Y A;  2QA4 T;  2NUP B;  2EQI A;  5IF1 B;  1MGQ A;  2HMA A;  3RKX A;  2IG0 A;  4M77 D;  3FDR A;  3PGG A;  2EGA A;  3OS2 A;  1LOJ A;  5LJ5 f;  3OW2 S;  2QFZ A;  3BG3 A;  3S3M A;  3EH2 A;  1SG5 A;  2XDD A;  2CP7 A;  1G3T A;  3LGL A;  1PD1 A;  1KQS S;  4RTW A;  1T0J A;  5GAN 7;  2UZD B;  1ZBJ A;  1PSF A;  1YBY A;  3TSW A;  1W1F A;  3H0F A;  5KE2 A;  4LUE A;  4M78 A;  5AT1 B;  4PJO C;  3LH5 A;  1YIJ A;  2WFY B;  1MNE A;  3M0Q A;  3RER A;  2DPP B;  1MND A;  5KE3 A;  1S72 Q;  3I56 T;  1NJI U;  2P0P A;  3PE0 A;  1HD3 A;  3PIO A;  1VOM A;  3S6W A;  4BDY A;  3I55 T;  1R77 A;  1FYN A;  1UEB A;  1K4U S;  4PFP A;  3VKI A;  1K9A A;  1W70 A;  2L89 A;  1SHF A;  4C8Q C;  4BE2 A;  1WHH A;  1O9K B;  2NUP A;  2KQW A;  1MHN A;  2V8K A;  5D7U A;  1YI2 T;  1VA7 A;  4EIK A;  7AT1 B;  3VS5 A;  2KMT A;  3WVD B;  4BCO B;  2DA9 A;  2IW6 B;  4A4K A;  1VQN T;  4PJO F;  4D6W A;  1D3U B;  4OMN A;  1ZBX A;  4E7J A;  1VQ8 A;  2L5Q A;  4BY1 X;  1XJW B;  3HB9 A;  2WMA B;  4F7U B;  3DB4 A;  1VQ8 T;  3POM A;  1PRM C;  1H3Z A;  5FU6 B;  1QMZ B;  4M75 E;  4C5G A;  5GMK j;  4A4G A;  3VS1 A;  1SPK A;  1VQP A;  2VUB A;  1NPP A;  4ROC A;  3M59 A;  2CT4 A;  4A53 A;  1X43 A;  4C92 G;  4KGZ B;  4M6V A;  3D7S B;  1PSE A;  4C8Q F;  2YUQ A;  3X20 B;  4A54 A;  2DTO A;  3FJ5 A;  5FU7 C;  5IH2 A;  2DEQ A;  3BLH B;  1W4S A;  3QBY A;  2KRS A;  3CCL Q;  2PMI B;  1VOL A;  1YJ9 T;  3HL8 A;  3NGP A;  2OTJ A;  4AMC A;  2RQR A;  2EW3 A;  1G2B A;  4A4E A;  1QVG A;  1VQ7 Q;  2E10 A;  2JUF A;  2OTJ T;  2GCX A;  1VQ6 A;  1VYW B;  1O9K A;  3CCU Q;  3VUZ A;  2WXV B;  1URC B;  4XU1 A;  2CH4 A;  1WNL A;  2PU9 B;  2VC8 A;  4M78 C;  4BCN D;  3CCE Q;  1M1K U;  2ECZ A;  1AVZ C;  4MIM A;  2Y4X A;  1E9H B;  1Q7Y R;  1WX6 A;  2KAF A;  2QGS A;  5CKD A;  5DQW A;  1X2Q A;  4F7U A;  1WFW A;  2RJD A;  4LXC A;  3V8J A;  1BI3 A;  2FB7 A;  3J80 E;  2GNC A;  5CK9 A;  2K5L A;  3CME T;  3V7C A;  2DXC B;  4XTV A;  3PNW C;  4ELZ C;  4EC8 B;  5AYF A;  5BNJ B;  3EFR A;  3VRY A;  4AFU C;  2YUO A;  4HT8 A;  2H8H A;  3P8D A;  1KC8 U;  3TVT A;  5GAN 8;  4DBQ A;  4RTT A;  3EHR A;  3HRS A;  4M78 F;  1C9B A;  3CCQ Q;  4CXA B;  2LNH B;  3H0H A;  2YLC A;  5CKF A;  1UGP B;  1G5V A;  1NEG A;  2YRV A;  2JNG A;  3SB2 A;  3L42 A;  2EJF A;  4OGE A;  3L1A A;  2BZ8 A;  5GAM d;  2HBW A;  4E7H A;  1QCF A;  1FIN B;  4M75 G;  3OYJ A;  1ZX6 A;  3OQ5 A;  3CCV A;  2HKQ B;  1VQK A;  4QQG A;  3QHS A;  4XAX B;  1U1T A;  2VYT A;  1HXD A;  1JQQ A;  3CCV T;  2V8I A;  4NOY A;  4QKU A;  1WQ7 A;  2L3S A;  2QQ8 A;  2K3X A;  2C5N B;  2DL8 A;  1M4Z A;  1GCQ C;  5GJV B;  5GMK l;  1G8X A;  2CZ0 B;  2QQR A;  2R57 A;  5GAN 6;  2DXC A;  1JJ2 S;  4BI8 B;  3MP1 A;  5C6S A;  3TN8 B;  2WMB B;  2OAW A;  2DBM A;  1D3B B;  1SKU B;  2RH2 A;  1KXU A;  2L8D A;  2HDA A;  2MYS A;  3TQ7 P;  3JCM f;  1QKW A;  2LQN A;  1AOJ A;  3JCM b;  4M77 B;  3FRN A;  1M2V B;  2JMA A;  5J26 A;  2WSC E;  2RQU A;  1PWT A;  4N0A A;  3JCM W;  1K0X A;  1HYO A;  4F7J B;  1WJR A;  1UEC A;  1VQ5 T;  1X01 A;  2R7G A;  4BCJ B;  3CCM A;  1GXI E;  3CC4 T;  1WQW A;  4NL3 A;  4TTH A;  2HSE B;  3NHN A;  5HBH B;  1GY3 B;  4EOL B;  2DTI A;  4FYV B;  3CCM T;  3QO3 A;  2BE9 B;  3MCA B;  3WVE B;  1ZA2 B;  2W9Z A;  3JB9 I;  5CQY A;  2LMJ A;  3IQL A;  2E6N A;  2YRD A;  4EMH A;  4CC7 A;  4E7Z A;  1W6X A;  2RHU A;  3EGU A;  2VKN A;  2CCH B;  4FYX B;  2O4X B;  4Z8A A;  1OX9 A;  4F7U F;  2RNA A;  2DZC A;  5GAM h;  2LNV A;  1LNX A;  3BDL A;  1D3B A;  4C92 D;  1QWE A;  2O01 E;  2C6T B;  1WXU A;  4J9F A;  2RHZ A;  1BKB A;  4AG2 C;  2IVX A;  4Q5W A;  3H8Z A;  1TWB A;  3M57 A;  1PKD B;  3A8G B;  3HPW A;  4GBQ A;  1PM3 A;  2RPN A;  1RL2 A;  3G1J A;  1A0N B;  3G33 B;  3H0I A;  3VJP A;  3L2W A;  4FU6 A;  2DET A;  3BHT B;  2GQV A;  3RDV A;  2QXF A;  5J39 A;  2EGE A;  2M1H A;  2DAQ A;  4BE1 A;  2RI3 A;  2QK0 A;  5KYX B;  3HSB A;  1SF9 A;  4F16 A;  2YXY A;  2HQE A;  3M0T A;  1OIY B;  1VQM Q;  3MO8 A;  3HTR A;  3ER0 A;  4RTV A;  4AI6 A;  4PJN A;  3HZJ A;  3JB9 G;  1KJW A;  3BFM A;  4RTX A;  4BB7 A;  2DJZ A;  1CKB A;  4OF1 A;  2RJF A;  2JN0 A;  2QDJ A;  1D0Y A;  1GFC A;  2KVQ G;  5EC7 A;  5FRN A;  1FMV A;  4J8O A;  4YTL A;  3TW7 A;  1QP2 A;  2XMF A;  4EON B;  5CQX A;  3BHV B;  2UZB B;  2JM9 A;  5D6X A;  1Q95 G;  1E6H A;  3TRE A;  4ROD A;  1AWX A;  4HVU A;  4HCC A;  3KHI A;  1TFB A;  3JCM X;  4ELY C;  3OYK A;  1PKS A;  2XDB A;  4ZTF A;  1IHW A;  3HKS A;  4CC2 A;  2AK5 A;  2J6O A;  3SWN C;  4DBF A;  2RI2 A;  4BCN B;  2ZGW A;  3VS6 A;  4M7A G;  2EAY A;  3WXM B;  5CCA A;  3A8O B;  2CP6 A;  1RAD B;  2B8A A;  4A63 B;  3CCS A;  1VIE A;  3CCR Q;  3S3O A;  1AD5 A;  3VKH A;  1QCO A;  1QLY A;  4AKG A;  3H41 A;  2LCC A;  2M16 A;  3CCS T;  1OX8 A;  3VUB A;  2KYB A;  3BHU B;  4JJB A;  4M75 D;  1U06 A;  1QMC A;  2CCI B;  1D0Z A;  2IPO B;  1TUG B;  1ZSZ A;  3QWL A;  3JCM e;  4CC3 A;  5IHK A;  5LJ5 d;  1X75 C;  4FL6 A;  4PFO A;  1N5Z A;  3GIB A;  1VUB A;  4X1V A;  4WTO B;  1VQL Q;  4A4F A;  4M77 C;  5HCK A;  3BLQ B;  2MIO A;  4KGX B;  2J7I A;  2L3R A;  4RTZ A;  3CD6 Q;  3E9F A;  4NST B;  2QQS A;  5A0L A;  2DXT A;  2QGF B;  1KD1 C;  1YJN A;  3V7S A;  2KEA A;  4MZM A;  4OMO A;  2KXC A;  1X6B A;  2C5V B;  4D8K A;  4ESR A;  5A0G A;  2EQU A;  1H1R B;  3SD4 A;  2PVO B;  2EKO A;  4Z89 A;  3ULR B;  3M4G A;  2PVD B;  2ZPG B;  3MKD A;  1VQ9 A;  2OTL Q;  2LW4 A;  2BKD N;  5FLX E;  4EOJ B;  2O2O A;  2HL3 A;  2XID A;  2QI2 A;  1ABO A;  1S1N A;  3OMG A;  4M77 F;  1I81 A;  1MMN A;  4JZ4 A;  1Q7Y C;  3ZBD A;  4QVZ A;  1FX7 A;  3G71 A;  4E2F B;  1BIB A;  4LN2 A;  1NJI R;  2DO3 A;  2DD4 A;  1JBM A;  3SFM A;  3CC7 T;  3SEM A;  4F7S B;  1WIE A;  3TNW B;  5LJ3 f;  3CMA T;  1QCN A;  1YJW Q;  1YFN A;  4XU2 A;  1H27 B;  2K9G A;  2ZZD B;  4KUI A;  1R0B G;  5GAN j;  2E65 A;  2DYI A;  5GAO r;  3E2U A;  4PJL A;  2DLP A;  5GMK h;  2UUE B;  2QEX Q;  1TS9 A;  3SHW A;  3DKM A;  2LTO A;  3RUX A;  2CT3 A;  4J9C A;  1NG2 A;  5GAM g;  1YIT T;  4PJO E;  4RG2 A;  2CP2 A;  1E6G A;  1Y7X A;  4HT9 A;  1NLO C;  1WHM A;  1UGR B;  5LJ5 h;  2K4Y A;  4LD9 K;  2M51 A;  4ELL A;  4XTY A;  2W2H A;  2GTJ A;  1BI2 A;  4JPB W;  3OYB A;  2JTF A;  1N8R U;  3MEW A;  3CC2 A;  2D9T A;  2AZS A;  1AWJ A;  3P8B B;  1TXQ A;  5IHY A;  2P84 A;  2PHG A;  4C8Q E;  3CC2 T;  2DJQ A;  1M8V A;  5IT9 E;  3JB9 D;  1QVG P;  2OI3 A;  1JSU B;  2EBP A;  1YIJ Q;  1OZ2 A;  5FWB A;  3TEE A;  2E70 A;  2Y4Y A;  5GAM e;  1Q81 U;  2LT4 A;  1FMW A;  1QWF A;  4MMK A;  4GLK A;  1JXM A;  2ZZD A;  3QXE B;  5I2S A;  2O88 A;  1X6O A;  1PNJ A;  3LYI A;  3OYE A;  3PTA A;  4RUG A;  2QQA A;  3A5Z B;  1LCK A;  2K5F A;  5CO7 A;  5EJC A;  1GH6 B;  1M1K R;  3NFC A;  5IXF A;  1JST B;  3EFS A;  1F1B B;  4GLM A;  3NMZ C;  5L8R E;  2LX7 A;  4LOC A;  2EUF A;  2V26 A;  5GAN 5;  4NS5 A;  1AWW A;  4JRP A;  2QA4 A;  3N5B B;  1KQ2 A;  3I5R A;  4RTY A;  4QVC A;  4M7A D;  3RMS A;  6AT1 B;  2I53 A;  2BKZ B;  3E9G A;  1K1Z A;  3TNH B;  2O9S A;  2FZC B;  1UE9 A;  1H1Q B;  1TU0 B;  2ZPE B;  3H4C A;  3HBL A;  3EG0 A;  4R0K A;  5IHN A;  3URG A;  2C0O A;  2BIV A;  4DBH A;  1VQP Q;  1KC8 R;  2GFA A;  4AT1 B;  2L2P A;  1ARK A;  3GNF B;  1M9S A;  3MI9 B;  2FEI A;  5HVY B;  3UT1 A;  4CFN B;  4M78 E;  2MPX C;  2AT1 B;  2JJ9 A;  3CCJ T;  2DX1 A;  4FIB A;  4PJO G;  1GFD A;  2QF7 A;  4LDX A;  5HK0 A;  4B9X A;  3I56 A;  5CAI A;  2P4R A;  3G4S T;  3PVQ A;  4OB0 B;  1E7P A;  3I55 A;  1VQ6 Q;  3L2V A;  1ENW A;  2R58 A;  2RQT A;  2VGN A;  2VGM A;  4J7I A;  2FO0 A;  1I1J A;  1XNI A;  2EYY A;  2J6K A;  2HQX A;  3UA6 A;  4F17 A;  4OMP A;  3JCM d;  1OPL A;  4C5I A;  4C8Q G;  1YI2 A;  4RKU E;  1FVV B;  2LT1 A;  1OV3 A;  2PUO B;  3L2Q A;  4HCZ A;  2FL7 A;  1YHQ Q;  3M54 A;  1VQN A;  2YLB A;  2EYW A;  1K8A R;  3UDC A;  1OQK A;  3ZL7 C;  1ZP2 A;  1RAE B;  1YWP A;  2GTO A;  2R5A A;  4Z88 A;  1WDX A;  1P5E B;  2IN3 A;  2QAS A;  2QG9 B;  4XTZ A;  4KGV B;  4DEY A;  2CZ6 B;  1O9S A;  5EFQ B;  1NPR A;  1M1F A;  2NUZ A;  2VVK A;  2MCN A;  4ANJ A;  4D8D A;  3RKW A;  5GAO n;  1RAF B;  4DA4 A;  3OS1 A;  4C5H A;  4BCM D;  3EGX B;  1YJ9 A;  4CFU D;  1RAC B;  3GPL A;  2O9V A;  2WAC A;  3P8H A;  3TU4 K;  2ROT A;  3GF5 A;  3F70 A;  1VQO Q;  1KD1 R;  1RI9 A;  1GCQ A;  1K9M U;  1K73 U;  2NWM A;  3A1P A;  2ABL A;  2CUB A;  4Y72 B;  4Z6Y A;  5CEI B;  3FJP A;  1GUX B;  1UNL D;  4NC6 A;  4DOV A;  2XIC A;  1VQK Q;  3QHR B;  1VYV A;  4BAC A;  3OYH A;  5HY6 A;  3QG1 A;  2E3H A;  4MDW A;  4F14 A;  5L2W B;  5C0M A;  4PLL A;  3HRU A;  4M78 G;  2KRN A;  2XU8 A;  5LJ5 g;  1OIU B;  1BU1 A;  4K11 A;  1T3S A;  2PTK A;  1Q82 R;  1C1A A;  1H8K A;  1V1C A;  4FW2 A;  1HSQ A;  2K3B A;  4F7U E;  5GAN 2;  2AHJ B;  1H3H A;  2FG0 A;  5KYU B;  4IUT A;  4DBR A;  3A98 A;  3CME A;  2EJG A;  1VIN A;  2HD0 A;  4BBS M;  2DD5 B;  3VYH B;  3MPU B;  3X28 B;  4JZ3 A;  1I4K 1;  1S72 T;  4J9D A;  5GMK e;  2L3P A;  1RAB B;  3FIF A;  2WJ9 A;  3JCM h;  2RF0 A;  3MET A;  4M7D B;  1M27 C;  1H26 B;  4F6U B;  3QYE A;  2E6Z A;  4F6S B;  5IAY A;  1M90 U;  5IDP B;  1AIS B;  4OMM A;  2B9R A;  2E5K A;  3BG5 A;  4GY5 A;  2JVV A;  4IMY B;  5LJ5 e;  4QQ6 A;  4BDZ A;  2MWO A;  3MHX A;  3OYF A;  3G7Z A;  5FRM A;  3QUI A;  2IW8 B;  1GUX A;  2JTM A;  5KH6 A;  3QWY A;  2XG8 D;  3JCM J;  3X24 B;  2HEQ A;  4EMK B;  2CS7 A;  3RMQ A;  1LPL A;  1Y0M A;  3M56 A;  5I2M A;  3OSV A;  1EFN A;  2KT1 A;  4B6M A;  5I5Z B;  2H3J A;  4JS4 A;  3VS4 A;  2EYX A;  4OB3 B;  2ZPI B;  2RHY A;  3SWN B;  2BPM B;  3CPW A;  2K2V A;  1NJI C;  3OYI A;  5GAN d;  3M9Q A;  1VYT A;  1YCY A;  2CSI A;  5DQV A;  2MMP A;  3J81 E;  4AKH A;  1OL2 B;  3C12 A;  2BUD A;  5KYU A;  2DL3 A;  3LH0 A;  2GQI A;  3EH1 A;  3MIA B;  3M0P A;  1MMD A;  2PVG B;  2VB6 A;  5J3B A;  5D6W A;  2EQM A;  3CCL T;  2JT4 A;  4MML A;  1KFZ A;  3C4S A;  5DLQ E;  5L23 A;  3VS7 A;  4C0F A;  4PJO D;  2DRM A;  1VQ7 T;  1PHT A;  4M7A B;  3OB9 A;  1MV0 B;  3VS3 A;  3CCU A;  4ORZ A;  1TOV A;  5GAN 4;  2GGR A;  5HKC A;  3HFO A;  3CCU T;  4OP0 A;  5A0D A;  3X26 B;  2A0F B;  2FZG B;  2CUD A;  2X4J A;  1VQ5 A;  4PFZ A;  5KYY B;  3CCE T;  4RG8 A;  3CC4 A;  1TH7 A;  4EMK A;  4B9W A;  4F7U G;  4C8Q D;  4CFX B;  4Y92 A;  1RI0 A;  4LE9 A;  1WHG A;  4RCC A;  4YOS A;  1NYG A;  2LCS A;  1BIA A;  2ESW A;  3SWN A;  1BK2 A;  3UA7 A;  2CGH A;  4BBR M;  1QVF A;  2I2L A;  3CXC A;  1OU9 A;  2PK2 A;  4II1 A;  4LD6 A;  2A28 A;  1RLQ C;  1GRI A;  1WLP B;  1WGS A;  2MK5 A;  3CPF A;  4BXX X;  3QZ9 B;  2NUT B;  2P4T A;  2HAX A;  4FYY B;  2RO0 A;  2BS2 A;  2VWF A;  2DYB A;  4OR5 B;  2ATC B;  4BE0 A;  3ZEH A;  3CCQ T;  2G3R A;  3V8K A;  2EYZ A;  4BCP B;  2PZ1 A;  2VV5 A;  4BI3 A;  5LJ3 d;  1QP3 A;  2CJM B;  1UJY A;  2G6F X;  1M1K C;  1P92 A;  4RTU A;  4DQ2 A;  1SSF A;  2E3I A;  3GBQ A;  4M77 E;  3AHU A;  1W2B A;  3RGF B;  4ZGD B;  1UGV A;  4M77 A;  4WF2 A;  5GAN h;  4HNU A;  5HBE B;  1M2V A;  3M55 A;  1WZO A;  5KYY A;  2BE7 D;  3DTO A;  1G3W A;  3M03 A;  1MUZ A;  2JMC A;  4CFM B;  2KMG A;  4JJN K;  1WI7 A;  4JX4 A;  3G6E Q;  1MV3 A;  2UZL B;  1Q7Y U;  2XDP A;  1KC8 C;  2MF2 A;  2E12 A;  3RBB B;  1D1B A;  2FHD A;  4HA8 A;  4J9E A;  4QSH A;  4M7D C;  4M78 D;  4AFS C;  2J6F A;  1M1G A;  3CQT A;  2V8J A;  3M0S A;  1IZ6 A;  3OW2 A;  2H3E B;  2M9U A;  5DM7 R;  2COW A;  3C94 A;  1XQH A;  1YJN Q;  1DJ7 B;  1ZUK A;  3O0G D;  4Z02 A;  1D1A A;  1PRL C;  1G3N C;  4EMK C;  1PG5 B;  1V29 B;  2O4X A;  1VQ9 Q;  4L6V 5;  4AFZ C;  1K0S A;  2OJ2 A;  2ED1 A;  2EIF A;  2VXE A;  2DVE A;  1WXB A;  3GLX A;  1X6G A;  2KRO A;  3JCM g;  2F2W A;  1UDL A;  3NTI A;  3GTM S;  4M7D F;  1AWO A;  4ROE A;  4V2S A;  4F04 B;  3THK A;  3C0C A;  3QDR B;  2ZPH B;  2YRC A;  1Q86 R;  4JLI A;  2DIQ A;  4ME7 A;  1FXX A;  3G71 Q;  2DER A;  4XTX A;  3PFS A;  3L2U A;  1VQ4 Q;  3REA B;  1HJD A;  2LZ6 B;  5KYX A;  1K8A C;  1JOW A;  2CP5 A;  3K7A M;  4QVD A;  5GAN f;  3PIP A;  5CKB A;  1RUW A;  2ZPF B;  1IRE B;  4O6J A;  4EPC A;  1QVG S;  2KR6 A;  4KRD B;  4BY7 X;  2KNB B;  5LJ3 h;  5EG2 A;  3HFN A;  4LDW A;  4EDU A;  4F7L B;  4M7A C;  2V1Q A;  3OSS C;  4II5 B;  1GBQ A;  4C0D B;  1WHJ A;  1PKT A;  1X27 A;  4X34 A;  2G77 A;  2IVW A;  3OS5 A;  4JLG A;  1WJQ A;  1G3Y A;  1H24 B;  5CYI B;  4P5N A;  2K79 A;  1IGQ A;  1QQJ A;  2X4X A;  2KDS A;  3QJY A;  3VS0 A;  5GMK m;  3HP9 A;  3KUF A;  3M53 A;  3R6O A;  3JSC A;  4MDX A;  4PNO A;  1SHG A;  2LX9 A;  2RK1 A;  1VQM A;  3OYM A;  3C95 A;  2RQW A;  2QDY B;  2SEM A;  2DTH A;  3UWN A;  1YWO A;  3BDU A;  1SSH A;  3LGF A;  4CC4 B;  2HBP A;  2RN8 A;  1VQM T;  1NBE B;  5DLO A;  1OKW B;  2MI6 A;  4OGC A;  5ICP B;  3RNJ A;  3EGD B;  4J7F A;  3DDQ B;  3NDQ A;  4M7A F;  2WSF E;  2A08 A;  3LX7 A;  4CI0 C;  1OPK A;  2HL5 C;  2YWW A;  4PJJ A;  3NTH A;  4LDV A;  4LDY A;  1Q82 C;  5KCH A;  3PT9 A;  4BCH B;  2IIM A;  1PCX A;  4HNT A;  1UGS B;  3E1S A;  1UNG D;  5FRO A;  2L0A A;  3M5A A;  1UJ0 A;  3UPU A;  1OYX A;  4TVR A;  3CC7 A;  2C5O B;  4IUU A;  4JDS A;  4J9I A;  3CMA A;  4IIO A;  1OI1 A;  2K7A A;  4HVV A;  2EJ9 A;  1KK7 A;  3S3N A;  2DXB B;  3EG1 A;  4DOW A;  2W0Z A;  5ACB A;  3B57 A;  3QHW B;  1D0X A;  4OMF B;  4MFD A;  2F2V A;  1R8O B;  3MP6 A;  2QA4 Q;  2E5Q A;  4HKE A;  1OL1 B;  5LQF B;  2VXF A;  4XK8 E;  2D0N A;  1YIT A;  5LL6 S;  1KQ1 A;  1YP5 A;  5GAM j;  3CCR T;  4KRT A;  3LQ5 B;  3U23 A;  1GBR A;  4IKF A;  4DEX A;  3QYB A;  2CP0 A;  2JW4 A;  5LMK B;  2QDL A;  4ELJ A;  4E7L A;  2BS4 A;  4KUD K;  2DF6 A;  4N4I A;  5IHI A;  2AIR B;  3EG9 B;  1N6A A;  4JJD A;  1VQL T;  1NE8 A;  1NM7 A;  4E47 A;  1M8M A;  1D1C A;  2XI9 A;  3CD6 T;  4ZN3 A;  1N27 A;  3HRT A;  1MMG A;  2QQB A;  1Z9Q A;  3X25 B;  2RHX A;  4C92 B;  3H6Z A;  1K9M R;  1J3T A;  1RAI B;  1K73 R;  1ACM B;  4IUR A;  1B7T A;  2CRE A;  3PMT A;  3I56 Q;  4MZP A;  2OTL A;  1ZA1 B;  2DXB A;  5GJW B;  4YC3 B;  4OML A;  3HHT B;  3I55 Q;  1V76 A;  3OYD A;  2OTL T;  2LRQ A;  1M3C A;  3EAE A;  2LC4 A;  2D8J A;  2F2X A;  5GAN e;  3INZ A;  1JJ2 A;  2RD1 A;  4PLI A;  4PJM A;  3JCM V;  3A8L B;  3KBG A;  1YI2 Q;  5CKH A;  4FM4 B;  3OYL A;  4OB2 B;  1RAH B;  3LWH A;  4FX3 B;  3PVL A;  4BCG B;  8ATC B;  1VQN Q;  4E7S A;  2LQ8 A;  1AEY A;  1WHK A;  4J9B A;  2JS0 A;  5M9O A;  1M3B A;  3BY7 A;  2AKK A;  3QZ5 B;  1I0C A;  2MWP A;  1UNH D;  3VV0 A;  3F5X B;  1H25 B;  4XU0 A;  2W10 A;  3OYG A;  4C0D C;  4FSS A;  1IHV A;  2P0K A;  1I8F A;  4CRL B;  1IGU A;  1UTI A;  4M4Z A;  1VQ8 Q;  3VS2 A;  2NLU A;  2X51 A;  2MAM A;  2G9X B;  3EG9 A;  2FRY A;  3EHQ A;  2AZV A;  3GNG A;  1YJW T;  2PQW A;  3A8M B;  2E1H A;  2YDL A;  2DXU A;  4C92 A;  1JXO A;  2ENM A;  2KI7 A;  2QEX A;  3VRZ A;  3CCJ A;  4LUD A;  5LJ3 g;  1Y96 B;  1YJ9 Q;  4EOK B;  3MEA A;  5KCO A;  2QEX T;  4JUV A;  2P0Q A;  3FEO A;  3G4S A;  4OB1 B;  4IUP A;  2OTJ Q;  3CPW P;  1LVK A;  1VYU A;  1ZUU A;  3OYY A;  4BI4 A;  3CBM A;  2KSS A;  2C5X B;  1TG0 A;  2LVM A;  4J9H A;  2PJQ A;  2YUN A;  2DKG A;  3DLL A;  1K76 A;  2CH4 W;  1H4L D;  3I9Q A;  4M75 B;  4MFE A;  2JXB A;  4FT2 A;  2XKO C;  4EOP B;  2L3Q A;  3TCJ A;  3RR6 A;  4PL6 A;  1EZZ B;  5LJ3 e;  4AKI A;  3T9N A;  2LCL A;  2RJC A;  1YIJ T;  2K5I A;  4F70 B;  3DLM A;  2DZ9 A;  4HVW A;  3CME Q;  3CBP A;  2ZCF B;  2C4G B;  2W99 A;  4UC4 A;  1ZUY A;  3JB9 J;  4OMQ A;  1G83 A;  3QKJ A;  1U3O A;  1T3L A;  2XK0 A;  2YUP A;  1JEG A;  4QW2 A;  3KFV A;  1QW1 A;  1U5S A;  1Y96 A;  2NYS A;  4MZT A;  3J7A F;  4E7I A;  1Z9Z A;  2ZAE A;  2FPF A;  1UHC A;  3EG2 A;  1GL5 A;  3L2R A;  1N8R C;  2D6F A;  2WHB B;  2KY9 A;  4C0Z A;  3FB9 A;  4RCB A;  2F1L A;  4R55 A;  4FYW B;  1QVF P;  2LJ3 A;  4IIM A;  2DL5 A;  3CXC P;  3LW5 E;  1TUD A;  1Q86 C;  1OU8 A;  2LDM A;  1SRM A;  1Q81 C;  3OY9 A;  4M75 A;  4G6L B;  4L59 A;  4KBM B;  1FKM A;  2D1X A;  1OKV B;  3E19 A;  2X3X D;  4O5V A;  4C92 C;  3CCV Q;  1VQP T;  3BW1 A;  4J6W A;  3DDP B;  1X69 A;  5LJ5 j;  2C0T A;  5CIU A;  2DIG A;  2KXD A;  1BYM A;  4EOQ B;  2F5K A;  1OOT A;  4AFQ C;  2HQH A;  4EMG A;  5HQ0 B;  3MY1 B;  1W2B P;  1IXD A;  1OZ3 A;  1OEB A;  2F69 A;  8AT1 B;  3EJ1 B;  2CKK A;  3UAT A;  1TUC A;  4HNV A;  2FRW A;  2E64 A;  2WIH B;  4J83 A;  1S72 A;  3EFO B;  4BCF B;  2PNI A;  1WYX A;  4EOO B;  2K6D A;  4HXJ A;  2ED0 A;  1VQ6 T;  3GOX A;  2F5T X;  9ATC B;  1WA7 A;  4FSX A;  2FPE A;  1H28 B;  1ZSG A;  5GAO m;  4C92 F;  1NLP C;  2VAS A;  5I21 A;  2CP3 A;  1YHQ A;  2EQJ A;  1R0C B;  4F6W B;  1VQ5 Q;  1EX4 A;  3EGX A;  1N9S A;  1AHJ B;  4JS5 A;  1JKW A;  1OGU B;  3CC4 Q;  4IUV A;  1MMA A;  3FC3 A;  1SRL A;  2FPD A;  3OW2 P;  1YHQ T;  1JB0 E;  3FLG A;  3ASK A;  2E4H A;  3CCM Q;  4XQ3 A;  2Y90 A;  3A8H B;  4HCB A;  2JZ2 A;  4OGR B;  3VYG B;  2M0Y A;  4L5G A;  1KQS P;  1Y57 A;  2RA2 A;  2OX7 A;  2Z0W A;  2BTT A;  3V8L A;  3L2Z A;  3PO3 S;  4XU3 A;  3JCM P;  4LNP A;  4XTW A;  1JRI A;  1CKA A;  2D0Q B;  3O5Z A;  3JAM E;  5I11 A;  4JX5 A;  4PKC C;  2CZ7 B;  2KE9 A;  1VQO A;  2PK9 B;  4CFW B;  3CCL A;  1H1S B;  3TNI B;  3EFO A;  3RES A;  3GP8 A;  3NTK A;  3BG9 A;  4BCQ D;  1Y07 A;  2DD5 A;  1VQO T;  2LP5 A;  2EGC A;  2WEV B;  4M7D E;  2WIP B;  4M75 C;  1VQ7 A;  2DEU A;  4M7D A;  4KH0 B;  2SRC A;  1U1S A;  1SEM A;  4HCK A;  3HO8 A;  4ZGJ B;  2JOY A;  1VQK T;  4XTU A;  1NEB A;  1UFF A;  1XOV A;  4J6Y A;  4JRQ A;  1WPY A;  2X4W A;  1F5Q B;  2LJ1 A;  4F7N B;  5KYW B;  3CCE A;  4ATO A;  2BZX A;  1G3S A;  4Y91 A;  4C0G A;  2RM4 A;  2FVU A;  3VYG A;  1I5L A;  2FYK A;  3M58 A;  2QYZ A;  1WJS A;  1K8A U;  5FGK B;  2A37 A;  4EC9 B;  3MEU A;  2KK4 A;  3NPF A;  3Q1J A;  4E6R A;  1OUL A;  2YSQ A;  4M75 F;  2LQW A;  3PMI A;  3OBW A;  4C5E A;  3OYC A;  1H64 1;  1K9M C;  5IDN B;  1K73 C;  4JX6 A;  1D09 B;  1RLP C;  2DE0 X;  2R5M A;  1LJO A;  5FU6 C;  3M0R A;  3CCQ A;  2GFU A;  3JCM Q;  4JRK A;  1QVP A;  2JTE A;  1ZHI A;  4FW1 A;  3UF4 A;  4UN0 A;  4M7A E;  4BD3 A;  1KD1 U;  5I22 A;  4FCY A;  4PK4 A;  1GCP A;  1CSK A;  4M7A A;  4VUB A;  1T0H A;  2B86 A;  5KYN A;  3CCS Q;  5KYW A;  1ZQ1 A;  4ZNX A;  5CR2 A;  2EVR A;  3MY5 B;  3TSZ A;  3REB B;  5FW9 A;  4BUG A;  1KHC A;  1H92 A;  4EOM B;  1Q82 U;  2QTX A;  1M90 C;  1EIF A;  1UGQ B;  4E7K A;  4QT7 A;  1OI9 B;  2HSP A;  4ZTJ A;  3BLR B;  3H9N A;  1X2K A;  4M7D G;  2X35 A;  2I0N A;  3RIR A;  2DIL A;  4BCM B;  4CFU B;  2RK2 A;  3MP8 A;  4JJC A;  1BCM A;  1BCO A;  1RAG B;  3OYA A;  1KQS A;  4YOO A;  2KBT A;  2A36 A;  2K3Y A;  2NUT A;  2X3W D;  2W96 A;  2RMO A;  4A4H A;  2HCK A;  2ROL A;  4HLQ A;  3I5S A;  1N8R R;  2DNU A;  2DMO A;  1ZSZ B;  2DL4 A;  2COY A;  2PUK B;  2EKH A;  3BE3 A;  2WPA B;  2C0I A;  1I07 A;  3QSU A;  4R56 A;  2V1R A;  2RI5 A;  4N0A C;  1M30 A;  1Q81 R;  4CFV B;  4EOI B;  2KGT A;  1IB8 A;  1XO2 A;  2RHI A;  3QWX X;  4BY6 B;  2J06 A;  2YT6 A;  3CC7 Q;  2DK3 A;  1JJ2 P;  4BCI B;  1BU2 A;  1H1P B;  2JGZ B;  3CMA Q;  2QTV A;  4ZN1 A;  1N4M A;  2FZK B;  4AG1 C;  3DOG B;  1FMK A;  5GAM f;  2D8H A;  3VU3 C;  3JB9 F;  4IUQ A;  3OS0 A;  4Y28 E;  1M5Q 1;  3OMC A;  2F2C A;  3QII A;  2KT8 A;  1ZLM A;  1I5O B;  4M77 G;  1WHL A;  5HK3 A;  3O8V A;  4OVA A;  1YIT Q;  1E7O A;  1W98 B;  2GBQ A;  2RJE A;  1M2O A;  2KR3 A;  4J6X A;  1PC0 A;  3EG3 A;  2JS2 A;  3G6E A;  1B34 B;  2DD4 B;  1KHI A;  5D6Y A;  1C0M A;  5GAN 3;  3G6E T;  2M02 A;  3ZFJ A;  1TD6 A;  2XD0 A;  3CC2 Q;  1JU5 C;  4YOZ A;  5CVI A;  3QYG B;  3DB3 A;  2K2M A;  1VIF A;  4LDU A;  4NL2 A;  1IO6 A;  2HKN A;  1TSF A;  2XHC A;  4BCQ B;  3VKG A;  1YJN T;  3JB9 H;  1RAA B;  1XTD A; 
#chains in the Genus database with same CATH homology
 2LNV A;  1LNX A;  3BDL A;  1D3B A;  2K57 A;  4C92 D;  5GMK e;  2O01 E;  2QEX A;  3FIF A;  2WJ9 A;  3CCJ A;  2RHZ A;  3JCM h;  4ZGE B;  1BKB A;  5DY9 A;  2C06 A;  3MET A;  1Y96 B;  5LJ3 g;  4M7D B;  4Q5W A;  4X9C A;  4PJO B;  3MEA A;  5KCO A;  3H8Z A;  2QEX T;  3QYE A;  3M57 A;  4J5Y A;  2E6Z A;  2E41 A;  5IAY A;  3A8G B;  5GMK i;  4RMO A;  3HPW A;  1VQ9 T;  4JUV A;  1M90 U;  3LWI A;  1RL2 A;  2P0Q A;  3ME9 A;  3FEO A;  3BG5 A;  4GY5 A;  3VJP A;  3L2W A;  4OB1 B;  2JVV A;  4FU6 A;  3G4S A;  2GQV A;  4IUP A;  1FWZ A;  3CPW S;  5J39 A;  2QXF A;  5IN1 A;  5LJ5 e;  4QQ6 A;  4BDZ A;  2MWO A;  2M1H A;  2DAQ A;  3MHX A;  3OYY A;  3G7Z A;  4BI4 A;  3CBM A;  2KSS A;  2RI3 A;  3QUI A;  3OYF A;  4BE1 A;  5FRM A;  3HSB A;  2LVM A;  1U8R A;  2JTM A;  1VQ4 A;  5KH6 A;  4QQD A;  3JCM J;  2DKG A;  2RB6 A;  2XG8 D;  3DLL A;  3CCR A;  2HQE A;  2CYZ B;  3X24 B;  4EMK B;  2CS7 A;  3RMQ A;  3CPW A;  3MO8 A;  3G71 T;  3M56 A;  1B34 A;  3ER0 A;  1VQ4 T;  4C8Q B;  4AI6 A;  4M75 B;  5A2Q E;  3QPH A;  3HZJ A;  5I2M A;  1N9R A;  3OSV A;  3JRZ A;  4MFE A;  3JB9 G;  4FT2 A;  2XKO C;  3BFM A;  2EWN A;  3TCJ A;  2DJZ A;  2H3J A;  4BB7 A;  4JS4 A;  4OF1 A;  2RJF A;  3CEY A;  4PL6 A;  2EYQ A;  2JN0 A;  2QDJ A;  4OB3 B;  4N4H A;  2ZPI B;  2RHY A;  3SWN B;  1BI1 A;  4AKI A;  2K2V A;  2ZPB B;  2KVQ G;  3T9N A;  5LJ3 e;  5GAN d;  3OYI A;  3CBO A;  3DL1 A;  2LCL A;  3M9Q A;  5FRN A;  2RJC A;  1YCY A;  4J8O A;  4YTL A;  3TW7 A;  1YIJ T;  2K5I A;  3DLM A;  2MMP A;  2DZ9 A;  3J81 E;  1QP2 A;  3CBP A;  4AKH A;  5CQX A;  2ZCF B;  3C12 A;  2BUD A;  3LLR A;  4UC4 A;  5GAN g;  1VQL A;  4JRI A;  3JB9 J;  3LH0 A;  5D6X A;  3TW6 A;  2CZ1 B;  2BS3 A;  3TRE A;  2PVG B;  5J3B A;  3QKJ A;  5D6W A;  2EFI A;  3CD6 A;  2EQM A;  3CCL T;  4MML A;  4HCC A;  3KHI A;  2A7Y A;  1QLB A;  2XK0 A;  3C4S A;  5DLQ E;  5GAM h;  4KUL A;  3JCM X;  4QW2 A;  4ELY C;  3OYK A;  1QW1 A;  4C0F A;  1Y96 A;  4MZT A;  2XDB A;  3J7A F;  4E7I A;  4ZTF A;  4M7D D;  4PJO A;  4PJO D;  3HKS A;  1VQ7 T;  5CKE A;  4M7A B;  4CRI A;  1BI0 A;  3OB9 A;  3L2R A;  1N8R C;  4N4G A;  3SWN C;  2D6F A;  3CCU A;  2KY9 A;  4C0Z A;  2OAU A;  2RI2 A;  2ZGW A;  5GAO p;  5GAN 4;  4M7A G;  3FB9 A;  5FU7 B;  4RCB A;  2EAY A;  3WXM B;  3MEV A;  5HKC A;  5CCA A;  3A8O B;  3HFO A;  3CCU T;  4HL4 A;  4OP0 A;  2M0O A;  5A0D A;  3X26 B;  2B8A A;  4R55 A;  3OA6 A;  1UB4 A;  3CCS A;  1VIE A;  1QVF S;  3S3O A;  2X4J A;  1VQ5 A;  1HK9 A;  3VKH A;  3CXC S;  3QJ6 A;  4AKG A;  3LW5 E;  4RG8 A;  3CC4 A;  1TH7 A;  3CCE T;  3JCM c;  2LCC A;  4EMK A;  2WSE E;  5GAO q;  2M16 A;  3CCS T;  4B9W A;  4F7U G;  3M4Y A;  1Q86 C;  2LDM A;  3VUB A;  1Q81 C;  4BY6 C;  4C8Q A;  4C8Q D;  4M75 A;  3OY9 A;  4M75 D;  1RI0 A;  4L59 A;  2QQ9 A;  4KBM B;  1FKM A;  5GAO l;  1Q86 U;  3E19 A;  4O5V A;  4C92 C;  4RCC A;  1VQP T;  3BW1 A;  2YHT A;  1Y71 A;  4J6W A;  3QWL A;  1BIA A;  3JCM e;  3SWN A;  3OYN A;  2EQK A;  2HNI A;  1X75 C;  4FL6 A;  3RKY A;  4M78 B;  4X9D A;  5LJ5 j;  5LJ5 d;  3GIB A;  1VUB A;  5CIU A;  2DIG A;  2CGH A;  4BBR M;  1QVF A;  4FT4 A;  4A4F A;  2I2L A;  1BYM A;  4M77 C;  3CXC A;  2F5K A;  1KG1 A;  4EMG A;  4KT0 E;  1W2B S;  4II1 A;  4LD6 A;  2L3R A;  1OZ3 A;  2F69 A;  2GF7 A;  3E9F A;  3OBY A;  2A3L A;  3SDZ A;  3V7R A;  2QQS A;  2CKK A;  1YJW A;  1WGS A;  5A0L A;  2DXT A;  3CPF A;  3QYH B;  4HNV A;  1KD1 C;  3QZ9 B;  2E64 A;  1YJN A;  2P4T A;  4MZM A;  3V7S A;  1NZ9 A;  2HAX A;  2RO0 A;  1O75 A;  2BS2 A;  5A0G A;  4J83 A;  1S72 A;  2LQK A;  3KXT A;  4BE0 A;  2EQU A;  3ZEH A;  3SD4 A;  3CCQ T;  4C92 E;  2G3R A;  3V8K A;  2VV5 A;  4BI3 A;  2PVO B;  5LJ3 d;  1QP3 A;  5LJ3 j;  2EKO A;  1VQ6 T;  1M1K C;  1P92 A;  3GOX A;  4DQ2 A;  2F5T X;  1SSF A;  2PVD B;  2X4Y A;  3M4G A;  2ZPG B;  1NJI C;  1VQ9 A;  2QA4 T;  4FSX A;  5GAO m;  2BKD N;  4M77 E;  3AHU A;  5FLX E;  1W2B A;  4C92 F;  1MGQ A;  3RKX A;  4ZGD B;  5I21 A;  1YHQ A;  2EQJ A;  2IG0 A;  4C92 A;  4M77 A;  4WF2 A;  4M77 D;  3FDR A;  3PGG A;  5GAN h;  3OS2 A;  4HNU A;  1N9S A;  1AHJ B;  2XID A;  4JS5 A;  2QI2 A;  4IUV A;  1LOJ A;  5LJ5 f;  3FC3 A;  3OW2 S;  2QFZ A;  3M55 A;  1YHQ T;  1JB0 E;  3OMG A;  4M77 F;  3FLG A;  1G3W A;  3ASK A;  3BG3 A;  1I81 A;  3S3M A;  4XQ3 A;  2Y90 A;  2XDD A;  3A8H B;  1Q7Y C;  2KMG A;  2JZ2 A;  3ZBD A;  1G3T A;  4QVZ A;  1FX7 A;  3LGL A;  3G71 A;  4JJN K;  1KQS S;  3VYG B;  4JX4 A;  4L5G A;  5GAN 7;  2RA2 A;  1BIB A;  1PSF A;  1YBY A;  3V8L A;  1Q7Y U;  2XDP A;  1KC8 C;  2DO3 A;  2DD4 A;  2MF2 A;  5KE2 A;  2E12 A;  1JBM A;  2FHD A;  3L2Z A;  4HA8 A;  4QSH A;  4M7D C;  4M78 A;  3SFM A;  4M78 D;  3CC7 T;  4PJO C;  1M1G A;  4XU3 A;  2V8J A;  5LJ3 f;  3JCM P;  1YIJ A;  1IZ6 A;  3OW2 A;  3CMA T;  4XTW A;  1JRI A;  4XU2 A;  2M9U A;  2ZZD B;  4KUI A;  5DM7 R;  3C94 A;  2D0Q B;  1XQH A;  5GAN j;  3RER A;  2E65 A;  3JAM E;  2DPP B;  4JX5 A;  1DJ7 B;  5KE3 A;  4PKC C;  5GAO r;  3I56 T;  1NJI U;  2CZ7 B;  2P0P A;  1VQO A;  3PIO A;  3CCL A;  4Z02 A;  3RES A;  3S6W A;  5GMK h;  3NTK A;  3I55 T;  3BG9 A;  3GP8 A;  4BDY A;  4EMK C;  1V29 B;  1Y07 A;  2DD5 A;  3DKM A;  1UEB A;  1VQO T;  2O4X A;  2LTO A;  4L6V 5;  3RUX A;  3VKI A;  2L89 A;  4M7D E;  4C8Q C;  4BE2 A;  4M75 C;  5GAM g;  1YIT T;  1VQ7 A;  4PJO E;  2EIF A;  4RG2 A;  2VXE A;  2DVE A;  2KQW A;  3GLX A;  4M7D A;  3JCM g;  1MHN A;  1Y7X A;  2V8K A;  1YI2 T;  1U1S A;  4HT9 A;  3NTI A;  3HO8 A;  4ZGJ B;  2KMT A;  3WVD B;  1UGR B;  2JOY A;  5LJ5 h;  2K4Y A;  1VQK T;  4LD9 K;  4M7D F;  4A4K A;  4V2S A;  4XTU A;  1VQN T;  1XOV A;  4XTY A;  4PJO F;  4D6W A;  1BI2 A;  4J6Y A;  3OYB A;  1WPY A;  4JRQ A;  3QDR B;  2ZPH B;  1ZBX A;  2JTF A;  2X4W A;  4JLI A;  2DIQ A;  3MEW A;  4ME7 A;  2L5Q A;  4E7J A;  1FXX A;  1N8R U;  1VQ8 A;  3CCE A;  4XTX A;  3CC2 A;  4ATO A;  3PFS A;  3L2U A;  3HB9 A;  1G3S A;  2D9T A;  4Y91 A;  2RM4 A;  4C0G A;  1K8A C;  2FVU A;  3P8B B;  4F7U B;  3DB4 A;  4F7U F;  4QVD A;  3VYG A;  5GAN f;  3PIP A;  5CKB A;  1VQ8 T;  1H3Z A;  1I5L A;  2FYK A;  3M58 A;  5FU6 B;  4C8Q E;  3CC2 T;  4M75 E;  4C5G A;  5GMK j;  1M8V A;  2ZPF B;  1WJS A;  4A4G A;  5IT9 E;  1K8A U;  3JB9 D;  1IRE B;  4O6J A;  4EPC A;  1QVG S;  1VQP A;  2VUB A;  1NPP A;  3MEU A;  2KK4 A;  2KR6 A;  3M59 A;  3Q1J A;  5LJ3 h;  5EG2 A;  4A53 A;  1OZ2 A;  3TEE A;  3HFN A;  2E70 A;  2Y4Y A;  4LDW A;  4C92 G;  4EDU A;  4M6V A;  5GAM e;  1Q81 U;  4M7A C;  1PSE A;  2LT4 A;  4C8Q F;  4M75 F;  3X20 B;  3PMI A;  3OSS C;  4MMK A;  4A54 A;  4GLK A;  3OBW A;  4C0D B;  4C5E A;  2ZZD A;  3QXE B;  2DTO A;  3OYC A;  1H64 1;  5FU7 C;  1K9M C;  4X34 A;  2G77 A;  1K73 C;  2DEQ A;  2IVW A;  1W4S A;  3QBY A;  1X6O A;  5I2S A;  4JX6 A;  3OS5 A;  3LYI A;  3OYE A;  3PTA A;  1YJ9 T;  4JLG A;  1WJQ A;  2QQA A;  3A5Z B;  2K5F A;  3HL8 A;  1G3Y A;  5CO7 A;  2OTJ A;  4P5N A;  5EJC A;  2R5M A;  1LJO A;  2X4X A;  2KDS A;  3QJY A;  5FU6 C;  4A4E A;  1QVG A;  3CCQ A;  5GMK m;  3HP9 A;  3NFC A;  2E10 A;  2GFU A;  3EFS A;  3KUF A;  2JUF A;  3M53 A;  3JSC A;  3R6O A;  4JRK A;  3JCM Q;  4MDX A;  2OTJ T;  4PNO A;  5L8R E;  2GCX A;  1VQ6 A;  1QVP A;  4LOC A;  1ZHI A;  2LX9 A;  5GAN 5;  4NS5 A;  4M7A E;  2RK1 A;  4BD3 A;  1VQM A;  4JRP A;  1KD1 U;  3OYM A;  3C95 A;  2QA4 A;  3N5B B;  2QDY B;  3UWN A;  2DTH A;  1KQ2 A;  3VUZ A;  3BDU A;  4QVC A;  3LGF A;  4M7A A;  4M7A D;  2HBP A;  4XU1 A;  3RMS A;  4VUB A;  1WNL A;  2PU9 B;  2VC8 A;  5DLO A;  1VQM T;  4M78 C;  2MI6 A;  4OGC A;  4J7F A;  3E9G A;  1M1K U;  4M7A F;  2WSF E;  3LX7 A;  4MIM A;  2Y4X A;  4CI0 C;  1ZQ1 A;  2ZPE B;  5CR2 A;  3H4C A;  2KAF A;  3HBL A;  5CKD A;  3NTH A;  4LDV A;  4F7U A;  4BUG A;  2RJD A;  4LDY A;  3URG A;  1KHC A;  3V8J A;  5KCH A;  1Q82 C;  1BI3 A;  2FB7 A;  3J80 E;  3PT9 A;  2BIV A;  1S72 T;  5CK9 A;  2K5L A;  2GFA A;  3CME T;  1Q82 U;  4HNT A;  1UGS B;  3V7C A;  2DXC B;  3E1S A;  3GNF B;  2QTX A;  1M9S A;  3PNW C;  4XTV A;  5FRO A;  4ELZ C;  1M90 C;  1EIF A;  1UGQ B;  3M5A A;  4E7K A;  3UPU A;  1OYX A;  4TVR A;  3UT1 A;  3CC7 A;  5AYF A;  4M78 E;  4ZTJ A;  3EFR A;  3CCJ T;  4IUU A;  4M7D G;  4FIB A;  2X35 A;  4JDS A;  3CMA A;  1OI1 A;  4PJO G;  4HT8 A;  3RIR A;  3P8D A;  2EJ9 A;  1KC8 U;  5GAN 8;  3S3N A;  2DXB B;  2QF7 A;  4LDX A;  5HK0 A;  4DOW A;  4B9X A;  3HRS A;  4M78 F;  3I56 A;  2RK2 A;  3MP8 A;  5CAI A;  3G4S T;  4OMF B;  4OB0 B;  1E7P A;  2YLC A;  4MFD A;  5CKF A;  1UGP B;  3OYA A;  3I55 A;  1G5V A;  1R8O B;  2YRV A;  3L2V A;  2JNG A;  3MP6 A;  3SB2 A;  1KQS A;  2R58 A;  3L42 A;  2K3Y A;  2EJF A;  2VGN A;  4OGE A;  2VGM A;  4J7I A;  3L1A A;  2E5Q A;  4HKE A;  4A4H A;  2VXF A;  4XK8 E;  5GAM d;  1XNI A;  5LL6 S;  1KQ1 A;  5GAM j;  1YIT A;  3CCR T;  2HQX A;  4E7H A;  3JCM d;  4HLQ A;  4IKF A;  4C5I A;  4C8Q G;  3QYB A;  4M75 G;  4RKU E;  1YI2 A;  3OYJ A;  2LT1 A;  2PUO B;  3L2Q A;  2PUK B;  4HCZ A;  3OQ5 A;  2FL7 A;  3CCV A;  1VQK A;  4QQG A;  4ELJ A;  3M54 A;  3QHS A;  1VQN A;  4XAX B;  1U1T A;  4E7L A;  2BS4 A;  2VYT A;  1HXD A;  2YLB A;  4R56 A;  3QSU A;  3UDC A;  3CCV T;  2V8I A;  4NOY A;  2RI5 A;  4KUD K;  1WQ7 A;  2QQ8 A;  2K3X A;  4N4I A;  4N0A C;  1M4Z A;  5GMK l;  1N6A A;  2CZ0 B;  1VQL T;  2QQR A;  1NE8 A;  2R57 A;  5GAN 6;  4E47 A;  2R5A A;  2DXC A;  2RHI A;  2XI9 A;  4BY6 B;  3CD6 T;  4ZN3 A;  1JJ2 S;  1N27 A;  2DK3 A;  3HRT A;  3MP1 A;  4BI8 B;  5C6S A;  2QQB A;  4XTZ A;  3X25 B;  2RHX A;  2CZ6 B;  4ZN1 A;  4C92 B;  1O9S A;  3H6Z A;  1D3B B;  2RH2 A;  1NPR A;  2L8D A;  1M1F A;  4IUR A;  5GAM f;  3PMT A;  3VU3 C;  3JB9 F;  4IUQ A;  3RKW A;  4MZP A;  2OTL A;  5GAO n;  3OS0 A;  2DXB A;  3JCM f;  4DA4 A;  4Y28 E;  1M5Q 1;  3OMC A;  3JCM b;  4M77 B;  4C5H A;  3OS1 A;  1YJ9 A;  3FRN A;  3HHT B;  3QII A;  3GPL A;  2WAC A;  3OYD A;  3P8H A;  3TU4 K;  2OTL T;  5J26 A;  2LRQ A;  2WSC E;  3F70 A;  3GF5 A;  4M77 G;  4N0A A;  3EAE A;  2LC4 A;  5HK3 A;  3O8V A;  4OVA A;  3INZ A;  5GAN e;  3JCM W;  1JJ2 A;  1K9M U;  2RD1 A;  4PLI A;  1WJR A;  1K73 U;  1VQ5 T;  3JCM V;  1X01 A;  2RJE A;  4Z6Y A;  1GXI E;  3A8L B;  3FJP A;  3KBG A;  3CCM A;  3CC4 T;  1WQW A;  4FM4 B;  4NC6 A;  4J6X A;  5CKH A;  4NL3 A;  3OYL A;  4OB2 B;  4DOV A;  3LWH A;  2XIC A;  3G6E A;  1B34 B;  2DD4 B;  2DTI A;  3CCM T;  3QO3 A;  3OYH A;  4BAC A;  2LQ8 A;  3MCA B;  5HY6 A;  3WVE B;  3QG1 A;  1KHI A;  5M9O A;  3BY7 A;  4MDW A;  5D6Y A;  3QZ5 B;  5GAN 3;  2MWP A;  3G6E T;  3JB9 I;  3VV0 A;  4HCB A;  4XU0 A;  5C0M A;  3OYG A;  4PLL A;  3HRU A;  4C0D C;  4M78 G;  5CQY A;  3ZFJ A;  2P0K A;  2XU8 A;  1I8F A;  5LJ5 g;  2E6N A;  4EMH A;  2NLU A;  2XD0 A;  2MAM A;  4F7U E;  5CVI A;  3QYG B;  2AHJ B;  3DB3 A;  5GAN 2;  1VIF A;  4IUT A;  4LDU A;  3GNG A;  4NL2 A;  3CME A;  1YJW T;  2EJG A;  2PQW A;  2RHU A;  2XHC A;  3A8M B;  2HD0 A;  3VKG A;  1YJN T;  3JB9 H;  4BBS M;  2E1H A;  2DD5 B;  3VYH B;  2O4X B;  1XTD A;  3X28 B;  2DZC A;  1I4K 1;  2DXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...