3X24B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 120 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x24B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x24B02
1UGPB 4RKUE 3X20B 3VYGB 4OB2B 1UGRB 2PVDB 2DD5A 2O01E 2PVGB 2ZZDA 1QP3A 2PUOB 1QP2A 4ZGEB 4XK8E 1DJ7B 2ZPBB 4KT0E 4OB1B 3A8LB 3A8OB 3VYGA 3QZ9B 4Y28E 1AHJB 2CYZB 2CZ0B 2PU9B 1UGQB 2WSFE 2ZPIB 4OB3B 3A8HB 1PSEA 2D0QB 4L6V5 3QXEB 2CZ7B 4ZGJB 2AHJB 2DXBB 1UGSB 2QDYB 3A8GB 2DD5B 2DD4B 2ZPGB 2CZ1B 1JB0E 3HHTB 2WSCE 2DXCB 1GXIE 5L8RE 4ZGDB 2WSEE 2ZCFB 3A8MB 3QZ5B 2ZPEB 2ZPFB 2PUKB 4OB0B 3WVDB 1V29B 2CZ6B 3QYHB 2DXBA 2PVOB 2DD4A 1PSFA 3VYHB 2DPPB 3X24B 2DXCA 3X25B 1IREB 2ZZDB 2ZPHB 4FM4B 3WVEB 3LW5E 3X26B 3X28B 3QYGB
chains in the Genus database with same CATH superfamily
1T0HA 3DB4A 1XTDA 1QVGP 1N9SA 2LZ6B 4OB2B 1WHHA 4OP0A 4J9IA 1NJIC 4EONB 4MZPA 2XDDA 4IUTA 2HSPA 3TREA 3I55A 4HCZA 2EBPA 3EGXA 2FPDA 4E47A 4XK8E 3HFNA 5LJ3e 1PKSA 1BBZA 1NEBA 3DKMA 2D6FA 4ZN1A 4II5B 2XDPA 3VUBA 2DAQA 2FB7A 3MJXA 3M0UA 5GAN3 2KMTA 2HQEA 1VQ7Q 3SWNB 1MV0B 1VQPA 1YITT 1UGQB 1KC8C 2D0NA 2DA9A 1NZ9A 2QEXA 2RHZA 1NPRA 1CKAA 1G5VA 1VQ8T 2R5MA 1I5LA 1OU8A 5GMKm 5FW9A 2DERA 5GAOl 3I35A 1ZBXA 4LOCA 3JB9I 4LXCA 2BIVA 3HL8A 4EMHA 2GF7A 1K0XA 1WJRA 4AFZC 4RTVA 2ABLA 2YSQA 4D8KA 2KRMA 4CC3A 1KQSP 1K4US 1RLQC 2WEVB 2K2MA 3OYMA 3CC7T 4M75B 2EQKA 1JBMA 4N0AC 1OL1B 2QAZA 1MGQA 4D8DA 1M3AA 4CFWB 4AKGA 1NM7A 1ARKA 2KI7A 1R77A 2XIDA 1N8RR 3M4YA 4BBRM 2I53A 1H1QB 5CEIB 2H8HA 5DLQE 2ZZDB 1YI2T 1Q7YC 2KT8A 4EIKA 3CCVQ 4FM4B 1O75A 5BNJB 2BTTA 3LW5E 4Z89A 4XTZA 1SHGA 1FVVB 2C0OA 3LX7A 4F7JB 1VUBA 3QYGB 2FPEA 2QA4Q 1VQOA 2H3JA 4PFZA 3OYEA 2DEUA 2EJFA 4PNOA 4X9CA 1O9KB 4EORB 2DZCA 4EOKB 4HCKA 4MZMA 2HBPA 2HKNA 2RJEA 3HRUA 2MF2A 4M6VA 2J06A 3OSVA 4M77B 1ZSZA 4ANJA 1KD1U 2KNBB 4BCQB 1I1JA 5D7UA 2JTFA 3JCMJ 1Y07A 1NBEB 3EAEA 3MI9B 1VQ4T 1NPPA 1UDLA 5LJ5g 1S72A 4DQ2A 5CR2A 1X6OA 2LW4A 2KT1A 3DB3A 2ENMA 5FWBA 1AD6A 1M4ZA 1YHQT 2LX9A 1WHLA 1IXDA 1D1BA 1WHKA 5KYWB 3HFOA 3DL1A 2KROA 1AD5A 1BYMA 1FMKA 4L6V5 2HNIA 5GAN7 3CMAQ 3TW6A 5LJ3f 3JRZA 1FX7A 3GOXA 1AISB 3NTIA 2DTOA 4EPCA 2JUFA 3EG3A 3SWNA 1WXBA 3SHWA 1D0ZA 2FO0A 2HZYA 2OX7A 3RBBB 2WIPB 1OULA 3CXCA 2WSEE 2ZCFB 1D09B 3E19A 5HCKA 1NEGA 4M7AB 2ZPFB 3H9NA 1PHTA 5J26A 1GCQA 3JCMc 1IRXA 5FLXE 2KDSA 1SF9A 1UJ0A 3I56T 2CP3A 3VJPA 3MEVA 1IREB 4M77E 2RHXA 1SSHA 3HRTA 5LJ5d 4C92G 2RM4A 1WZOA 4X9DA 4M75A 3K7AM 3VS3A 5IT9E 1GL5A 5GMKh 4RMOA 1N4MA 1WDXA 2IIMA 2QI2A 4EOQB 1D1CA 2ED1A 4A53A 2A7YA 3RKYA 4M75F 2EGAA 1VYWB 3VS4A 4WCIA 4IUQA 1TXQA 1M8VA 1UB4A 2ZZDA 1QP3A 2YUPA 4C8QC 2DL3A 1KK7A 3PO3S 3CBPA 3EFSA 4DEXA 4J6WA 4M77G 4ELZC 1QP2A 3LQ5B 2KQWA 2MIOA 3EG9B 3OYBA 3M0SA 2VASA 3I56A 2COZA 2E1HA 2B86A 2IW8B 1O9KA 2EYXA 2EJGA 2QQBA 1UTIA 2V1QA 1VQOQ 2FPFA 2JM8A 2CSIA 5IXBA 4KRDB 1VIEA 4XAXB 3JCMP 3BG5A 4M77A 5IAYA 1P92A 2V22B 4JX5A 5CQXA 4OR5B 4EC9B 3JSCA 2Y4YA 2EIFA 4CC2A 3NTHA 3BHVB 4XU3A 4EOLB 5GANj 4M7AE 3CPWS 3A98A 4GLMA 1X69A 2QDJA 2E6ZA 5KYUA 3EIDB 3BHUB 4HT8A 5HVYB 2OTJT 4LUEA 2HQHA 3PE0A 4EOMB 2CZ1B 1D1AA 1RAFB 4M75D 3CD6A 2HD0A 5GJVB 5KYWA 4XTWA 4ZTJA 3LH0A 3LLRA 1H8KA 1RAAB 1WFWA 2VKNA 4FYVB 2RB6A 4M78G 1H4LD 1JXOA 1U5SA 2GQVA 2RK1A 4BDYA 3CCUA 3PTAA 3V8LA 3M4GA 1K9MR 4DBFA 3L2UA 2L89A 1YJNQ 2BE7D 2FZCB 4DOWA 1VOMA 3M0PA 3J80E 4C0DC 3KBGA 3META 3OYAA 1RI9A 4JS4A 4F7UF 4J7IA 4DBQA 4O6JA 5FU7B 1WPYA 2VB6A 5LJ5e 2EYYA 4M7AA 3T9NA 4KGZB 1BI1A 2LX7A 5KCHA 3CC4Q 7AT1B 3ZFJA 3G4ST 2HMAA 4RKUE 4M77D 3OSSC 4BCQD 5GAMj 1B34B 3VU3C 2M16A 1E6HA 4M7AF 5KCOA 5I21A 2COYA 4RTUA 1H24B 3EG1A 2QGGA 2C0IA 4UC4A 2UZEB 1JO8A 2JJ9A 1YNZA 4BI3A 2FZKB 2I0NA 1OI1A 1TD6A 5IDPB 1VQLT 3OW2A 1P5EB 3H4CA 1YIJQ 1OZ2A 1MMDA 4IMYB 4LNPA 4NOYA 2RA2A 3QHWB 3CMEA 5CKHA 3QG1A 4KH1B 4R55A 3FB9A 1H28B 5FU6B 3M03A 3NHNA 4OMNA 3EG9A 3A8HB 1VQMQ 3L2RA 1SRMA 3C95A 3H41A 5CK9A 1E7PA 2LCLA 1QWFA 4RTZA 4LD9K 3UF4A 1M90U 1G8XA 2L3PA 2DILA 3QYBA 1VQ9T 3RKWA 3JB9G 1QMZB 2VV5A 3CCRT 3FJ5A 2GNCA 3HHTB 4M7AD 5GMKl 3QYEA 1TSFA 1BK2A 4BY7X 5L8RE 4CFXB 3VS7A 1KD1C 1F5QB 1QCNA 1JJ2P 3EG0A 4A4GA 1N8RU 1XNIA 2P0KA 2V8JA 4ZN3A 2L0AA 5KYYB 1V29B 5D6YA 5I2MA 3BW1A 4FX3B 1PKDB 1RL2A 2V8KA 1QVGA 1AOJA 3TQ7P 3UT1A 4ELYC 4IKFA 2AIRB 1K8AR 4LE9A 2QQ9A 1WHJA 2HCKA 5CAIA 3VUZA 5FRNA 2QF7A 4PJNA 3CC2A 3GLXA 1VQ9A 2QGFB 3CD6Q 5L2WB 4V2SA 5C6SA 2DK3A 5D6WA 2CH4W 1PG5B 2E41A 2EJ9A 2F2WA 1SRLA 1ENWA 2IW6B 3G71T 1D0YA 1QVFS 2HDAA 4RODA 2OTLA 4ESRA 2YLBA 3M5AA 2GQIA 1VQ7T 2NUZA 4QQDA 9ATCB 4IUVA 2RO0A 4A4FA 4LDUA 5HK3A 3DLMA 1M2OA 3BE3A 4FL6A 3E9FA 2PZ1A 4C92C 1DJ7B 1YJ9Q 3BG9A 1RACB 4EMKB 2W0ZA 1WLPB 4JRQA 1B34A 2CZ0B 3GIBA 4AG1C 2MYSA 1ABQA 1OPLA 2A28A 5HQ0B 1RAHB 1VQ5Q 3TSZA 4M7DC 2V8IA 4DEYA 2C5OB 1KQSA 2CZ7B 1XQHA 3LGLA 8AT1B 4F7SB 5FROA 1ZA2B 2A36A 3OYKA 4PJOC 2LC4A 3M9QA 3PMTA 4JZ4A 4ATOA 2LJ3A 2W9ZA 4BY6C 4J7FA 5A0GA 4E7ZA 1R0BG 3UATA 2Y4XA 4JPBW 2DXCB 2HL5C 2J6OA 3NFCA 3CMEQ 5I22A 2DYBA 4IIMA 1GUXB 3CCVT 3M54A 2L2PA 1VQNT 4AFSC 2EAYA 1H3ZA 2PUKB 3P8BB 4F7NB 5AT1B 2QQ8A 1M1KR 3I5SA 3TU4K 2E5QA 2MAMA 1QLBA 3CCEA 2HBWA 2OJ2A 1MV3A 2DPPB 6AT1B 2GTJA 3OQ5A 2RHIA 5FGKB 3OYFA 1KFZA 1TUDA 1K0SA 1LCKA 3FEOA 3CBOA 3WVEB 2RI2A 4YTLA 1G3WA 2AZVA 5KYYA 3QJ6A 4M78C 1X2QA 3VYGB 1HXDA 3RMSA 1OV3A 4J6XA 1WYXA 1VQNA 4AKIA 3M58A 4EOPB 1WQWA 2BKDN 3S6WA 2QTVA 4F6UB 1ZLMA 3BDUA 3TN8B 4QSHA 3FLGA 2FVUA 2KYBA 4ORZA 5GMKe 2BZYA 4OB1B 1WXTA 3OYLA 1AZEA 3CCSQ 2DEQA 3M55A 4MZTA 3OMGA 4MMKA 2NUTB 3CCJA 5EG2A 5LJ3j 1ACMB 3RR6A 2WSFE 2FEIA 2BS4A 2DVEA 1WX6A 1VQ6A 1JRIA 5KE2A 5GAMh 4JLGA 3OS2A 2QTXA 4GLKA 1FWZA 2XDBA 2C4GB 2KYMA 2KBTA 4BE1A 4BUGA 2XHCA 1W98B 4EMKA 1K76A 3VV0A 2PTKA 1YJWA 1SKUB 4YOSA 3QO3A 3SEMA 2DD5B 3VRZA 3G33B 5GMKi 2ZPGB 1RUWA 2RHYA 4IUPA 4KGXB 1I5OB 2PHGA 2X9HA 1K9MU 1OQKA 4C8QF 4CXAB 1H3HA 1WJSA 1M5Q1 4CRLB 1YN8A 4K11A 2IVXA 3HO8A 2ZPEB 2YUNA 5I2SA 3JCMb 4A4HA 2CP0A 3F5XB 4E7JA 1TU0B 3LWHA 2DXCA 1MMNA 4D6WA 5J39A 2E70A 4PFPA 2LTOA 4JRKA 3BHTB 2AKLA 2X35A 1GUXA 5CQYA 3MEUA 1OU9A 1M90R 2P84A 4KRCB 3HTRA 1RAEB 4AI6A 4FT4A 3X26B 3X28B 2EVRA 3THKA 1UGPB 1E9HB 3VS1A 1YITA 3VS6A 3REAB 3OS0A 1OEBA 2CUDA 1M90C 2C6TB 3G1JA 2YDLA 2RN8A 2VWFA 1VQ8A 2KRSA 3ASKA 4C5IA 2RJDA 2E6NA 4E7IA 1FKMA 2E4HA 4PLIA 2DETA 4II1A 2JM9A 1N8RC 2EQIA 2IN3A 1OX8A 1NLOC 4HNUA 3VYGA 4F70B 2M51A 2B8AA 4HNTA 2FL7A 1GY3B 2K9GA 3MKDA 1XOVA 2FHDA 4R0KA 3CC7A 2CDTA 1M1GA 1SG5A 4LDWA 2DMOA 3UA6A 3PVQA 5GJWB 3M57A 1HD3A 4M4ZA 4NS5A 1PSEA 4HXJA 2CP5A 4VUBA 4Z6YA 4TTHA 3QXEB 3MO8A 3L1AA 2DTHA 1U8RA 1YI2A 1B7TA 1W2BS 4PFOA 1B3QA 2G3RA 2HQXA 3QSUA 2DXBB 3H0IA 3ME9A 2K5IA 4NSTB 2PJQA 1MUZA 1D3UB 4FIBA 2NUTA 5HK0A 3M0QA 2E5KA 4LD6A 4PJOB 1RLPC 2KGTA 3SFMA 4J9BA 4XU2A 1YFNA 4MDWA 3N5BB 4C5HA 3TVTA 3E1SA 4L59A 1K1ZA 4M75E 4PJMA 1K8AU 4CFVB 4F7UB 2XMFA 3I55Q 4OMLA 3CC4T 4F6WB 2CZ6B 2I2LA 1I07A 3ZEHA 4XU0A 3VYHB 4B9XA 4E7KA 4BCIB 2DYIA 1VQ4A 2LNHB 5IHYA 1ZP2A 2C5XB 4P5NA 2L3RA 2KY9A 5DQWA 5DQVA 1VQPQ 4MFDA 3EH1A 1YHQA 2DL4A 2J6FA 1Y71A 2QEXQ 3FJPA 4M75G 4OMFB 4AFQC 4QQ6A 1BIBA 2QYZA 1C6VX 1ZHIA 3OBWA 1QCOA 1KXUA 4MIMA 2JT4A 1KQ2A 2KR3A 5FRMA 4JLIA 1AWJA 3NDQA 2M1HA 2F5KA 2KR6A 3V7SA 5KH6A 4CC7A 5HBEB 1C1AA 1VQMT 3ULRB 3UPUA 1Q86R 5KYXB 2XD0A 3LYIA 3QZ9B 3JCMX 1Q81U 1F1BB 3H6ZA 2DFUA 1BU2A 2GFAA 2DJZA 5IN1A 4BI4A 1TS9A 2K5FA 1I8FA 4J9CA 2PK2A 2ZPIB 4BDZA 3CCLT 1VQ8Q 4OGRB 2RQRA 2EFIA 4F7UE 3CCMT 1VQKT 2DO3A 2AK5A 1JJ2A 2P4RA 3JCMQ 3BDLA 3QWYA 2A3LA 3EH2A 5LQFB 2DMEA 1K73U 2F2VA 3OYGA 1M1KU 2FYKA 1Q82U 3U23A 4ZNXA 1LJOA 3JCMW 1YWPA 3CCQT 1AVZC 4QVDA 2FRWA 2LNVA 5LJ3h 4C92F 5EC7A 1D0XA 4YC3B 1T0JA 3FRNA 4F7UG 1BCMA 1EIFA 4BD3A 2DXBA 3CCLA 2PVOB 2LMJA 1EFNA 2GGRA 2BKZB 3V8KA 2L3QA 2J6KA 4CFUB 3CCMA 1VQKA 4JDSA 4PJOA 1S72Q 4M7DF 1GCPA 3O8VA 1Y0MA 3WXMB 1C0MA 1NG2A 1VINA 4F7UA 2RHUA 1UFFA 3OBYA 1SHFA 4PJOF 2VYTA 4M7AG 1YJ9T 3OYHA 5GAN8 2DL8A 5LJ5j 3CCQA 2X4WA 5CO7A 3CEYA 1QVFP 1JKWA 3EOCB 3E9GA 2LQ8A 2F2CA 3HZJA 2UZLB 2QGSA 3E2UA 1K9MC 1ZQ1A 2WACA 2QDLA 3MPUB 2LQNA 1RABB 2OTJA 1VIFA 1PC0A 4HL4A 4EDUA 4OGEA 4JX6A 4HNVA 4KT0E 1IGUA 2W10A 1Y96B 2RF0A 4RCBA 3QDRB 4RUGA 1YHQQ 3L2QA 3I9QA 1NJIU 2FG0A 2CCHB 2XI9A 1OI9B 2ECZA 2F5TX 3G6ET 1IZ6A 3O0GD 5GAN6 2K57A 2ESWA 4LDYA 2BS2A 2YXYA 4OMQA 2LRQA 4KRTA 1RAGB 1JXMA 4O5VA 2WIHB 4FCYA 3J81E 2K3XA 1H1RB 4DBHA 4PJJA 1M3BA 1ZSZC 4C0ZA 3QHRB 5KYXA 1LPLA 3MEAA 4PJOD 2BS3A 2H3EB 3DOGB 4BY1X 4AKHA 1IO6A 1OYXA 1ZSGA 1KC8U 1JB0E 1G2BA 3G4SA 3QHSA 3PIPA 1G3NC 2VXFA 3MP6A 3RIRA 4AG2C 1JQQA 5HBHB 3MIAB 4DOVA 1CKBA 3IQLA 2GCXA 3BG3A 4RG2A 3WVDB 2KE9A 4RTTA 1U3OA 3QYHB 2DNUA 2G9XB 3I56Q 2YUQA 3VKGA 4JZ3A 2RQUA 1VQLA 3S3NA 1PD1A 2NWMA 1TTHB 1OOTA 3JV3A 4IUUA 1WI7A 4DBRA 4QT7A 5CKDA 2D8JA 4Y91A 4A54A 2CP6A 2K4YA 4G6LB 3V7RA 3RESA 5A0DA 2W96A 2ZAEA 3SWNC 1RADB 2SRCA 3VKIA 5M9OA 3NMZC 4C0FA 1N9RA 3TCJA 1YP5A 2E64A 2JOYA 1ZA1B 1UGRB 2FZGB 2AKKA 1NE8A 5I5ZB 1TWBA 1GFDA 1H92A 4FW2A 2XK0A 4HVVA 1Q7YU 5DM7R 1ZUUA 1WNLA 1GCQC 3URGA 2C5VB 3NPFA 4BCGB 3TNWB 3EG2A 2X4XA 3G7ZA 3EGUA 4AMCA 4HCCA 4CFMB 3OY9A 3CCRA 1VYVA 1K8AC 1AZGB 4FYXB 1W4SA 2EWNA 4KULA 1T3LA 1KSWA 1S1NA 2KAFA 4PJLA 4XTXA 2CYZB 2C5NB 1YCYA 3QIIA 1IHVA 1ZBJA 3CCUQ 3VS0A 3UA7A 4M75C 3HBLA 1PCXA 3OS5A 4HLQA 1X2KA 2E65A 1SPKA 1MHNA 5IDNB 4N0AA 2IW9B 2ZGWA 3LGFA 1AWWA 3M56A 2VGNA 1G3TA 1E7OA 1WA7A 3TSWA 2UZDB 3VS5A 1Y96A 1KQ1A 3PMIA 3JB9J 2OTJQ 4C8QB 2O2OA 1M3CA 4HT9A 1M9SA 2EKHA 3M53A 2O9VA 3QBYA 1BI2A 2E3IA 1YWOA 1BI3A 5GAOq 4AT1B 2LP5A 3G71A 8ATCB 3HB9A 1XO2A 3SD4A 1PNJA 2M02A 1Q81R 2DXUA 1UNLD 4NL2A 4CFUD 4M77C 1VQ7A 1E6GA 2E10A 3OB9A 1U06A 1GRIA 2DRKA 5LL6S 1I4K1 3CXCS 5GAOr 4KBMB 4QVZA 4JJBA 3ER0A 1TH7A 3KHIA 4XTVA 4EOSB 1PRMC 1FMVA 5GAMf 1QWEA 1W6XA 1KHCA 3PT9A 1H26B 4MDXA 4ELLA 1KHIA 1K73R 3X20B 1WIEA 2QA4T 1Q82R 4RTXA 2PVDB 2KEAA 2DX1A 2CKKA 1JSTB 5GANh 1Q86U 2CP2A 1NLPC 2Z0WA 3GNGA 2J05A 3S3OA 1M1KC 4XTYA 2MI6A 2PUOB 2YHTA 4C0DB 3NGPA 4ZGEB 3SDZA 3GBQA 5CIUA 3GP8A 4EOOB 2EYWA 2BZXA 2RNAA 3CPWA 4C8QE 2QXFA 1NYGA 1AHJB 3OYNA 2XU8A 3OA6A 4CFNB 2EW3A 4X34A 2PU9B 1H1SB 3CCVA 2EYZA 4E6RA 4M7AC 3OYDA 2MWOA 4OMPA 5GMKj 1QQJA 5EFQB 3JCMh 1RAIB 1OX9A 5LJ5h 4JRIA 4C5EA 2QA4A 3OYYA 3DLLA 1GBQA 5CKFA 1A0NB 1OPKA 2V26A 2XG8D 2MOXA 1HSQA 1Y57A 4GY5A 3CC2Q 1VQ9Q 1AT1B 4DA4A 2KMGA 3DDPB 3I55T 2GFUA 1GFCA 3CMAT 2FRYA 1VYTA 2WXVB 4BCJB 5IHIA 2XKOC 5FWCA 2JN0A 1M8MA 1W1FA 2LJ1A 1AWXA 1CSKA 1VOLA 2LT4A 3RERA 4JX4A 2MMPA 3RKXA 2OTLQ 5GAN5 5HKCA 1NJIR 3NTKA 2MCNA 2DIGA 1X6GA 1VQPT 2I40B 2AT1B 2X51A 4C8QA 2QEXT 1UE9A 1C9BA 4F04B 2DL7A 4PK4A 4L5GA 1LOJA 4RCCA 1WGSA 3CMAA 2ZPHB 2DZ9A 3MHXA 3VS2A 2RK2A 1JSUB 1R8OB 4BE2A 4ME7A 1TG0A 4N4IA 2RQWA 2LQWA 2L8DA 3G71Q 4BB7A 1KC8R 3DJBA 3H0FA 2L3SA 3EHRA 4F14A 3R6NA 2DL5A 1FINB 4BCNB 2JVVA 1BKBA 1SSFA 2DLPA 1FMWA 2UUEB 3OYCA 2EPDA 2A08A 1UNGD 1UNHD 2C06A 2K79A 3OYJA 4BXXX 1X75C 1GBRA 2LCSA 3MP1A 5EJCA 1VQOT 2BE9B 3KFVA 3MY1B 4F7LB 4JS5A 3CCEQ 1T3SA 2ROLA 2JGZB 3EFRA 2LCCA 2ED0A 4C8QD 3QDFA 3OW2S 2K2VA 3BFMA 1QVPA 5FU7C 3MY5B 3QJYA 1UG1A 3JCMV 1Q7YR 4BCFB 4IIOA 2IG0A 2QDYB 2IVWA 3AT1B 4E7HA 3P8HA 2UZBB 1H27B 4ELJA 4C92B 2CSQA 3FC3A 3V7CA 1MMAA 1BB9A 1UJYA 2R58A 1S72T 1VQNQ 2RD1A 2R7GA 3CPWP 4GBQA 5GANg 4A63B 4HA8A 2QQRA 2XICA 2E3HA 2LVMA 2K7AA 4A4EA 2A0FB 2X4JA 2VVKA 4M7DB 3HP9A 1FYNA 1YJNT 2D9TA 2YRVA 5IF1B 4QVCA 1X43A 1QVFA 2CP7A 3L2WA 4J9FA 3S3MA 1M1FA 3CCJQ 4ZTFA 4BY6B 1PM3A 2RJFA 1G3YA 1TUCA 2K3YA 2C0TA 1ZUKA 3RNJA 1VYUA 4KUIA 5FU6C 1VQ6Q 3JCMg 4Q5WA 5KYUB 4JJNK 1QVGS 2HEQA 1KIKA 1OZ3A 2DD5A 2O01E 4XQ3A 2OAUA 3MP8A 1WHMA 3MCAB 1YJWQ 3F70A 5HBJB 2PQWA 1HK9A 4R56A 2DXTA 4BCHB 2Y90A 3PFSA 1YJNA 4J8OA 4J9DA 3GNFB 4FYWB 4FT2A 2CS7A 2NYSA 1EZZB 2PNIA 2J7IA 4C5GA 3OYIA 2PMIB 3P8DA 4Y28E 2RMOA 1YIJT 1R0CB 4JJDA 5GAMg 2L5QA 4B6MA 1HJDA 5GANd 2D8HA 1NYFA 1UEBA 3PNWC 3HSBA 4TVRA 4C92E 5AYFA 1QKWA 3CC4A 2LJ0A 5IHKA 5I11A 5GAN4 4M78B 3GTMS 1PWTA 2M0YA 1V76A 3OS1A 3QKJA 2D0QB 3HRSA 1FXXA 1M2VB 1ZX6A 2K5LA 4ZGJB 2O88A 2EGEA 4BCKB 2GBQA 2KRNA 4M7DE 2R5AA 1WJQA 2IPOB 4B9WA 2PK9B 3A8GB 2QQAA 1BCOA 4J5YA 1N6AA 5KE3A 3JB9H 4RTYA 3QUIA 1PKTA 1YITQ 4LUDA 1Q86C 1QCFA 4F6SB 4CRIA 1ZUYA 4LN2A 1U1TA 5CCAA 4BCPB 3JCMd 4IURA 4Z88A 3R6OA 4PJOE 3KXTA 4PL6A 4HCBA 1YIJA 1KQSS 5A0LA 1SEMA 3M0RA 5HY6A 2LT1A 2MPXC 2P4TA 2X3WD 3A8MB 2RJCA 4PKCC 4PLLA 2QFZA 3L2ZA 4E2FB 2HKQB 4Y92A 4KUDK 1PSFA 4LDXA 4M7DG 1X01A 2CGHA 3HPWA 1G83A 4OMOA 4EMKC 1VQMA 4C92A 5A2QE 2G6FX 3C4SA 4QQGA 5IH2A 5KYNA 2W9FA 1UHCA 1LNXA 4PJOG 5GAMd 1U1SA 4CC4B 3CC7Q 2HAXA 1JOWA 4Z8AA 2NLUA 4N4GA 3CD6T 4FSSA 2DJQA 4BCND 2X3XD 4JJCA 5CKBA 1QW1A 4M7DA 3BLRB 2GTOA 4J83A 2SEMA 2CREA 3CCUT 1YI2Q 1WHGA 2WMBB 4M78E 4OMMA 2JTMA 5CVIA 3EJ1B 1KJWA 2WMAB 1N27A 2DBKA 2DF6A 2DTIA 1QKXA 5IXFA 4M77F 2R57A 1M30A 4JUVA 2CH4A 1IHWA 4BCMB 1WXUA 2K3BA 1LVKA 2EUFA 4EC8B 5GANe 3POMA 1O9SA 3HKSA 1X6BA 3LH5A 1V1CA 3M0TA 2M9UA 5GAOm 1VQ5T 2W99A 2BPMB 4Z02A 2KXDA 1OIUB 1VQ4Q 2WHBB 5DLOA 2P0PA 2DBMA 4C92D 2AHJB 2D1XA 5ECAA 3QWXX 5IHNA 2JTEA 1GH6B 2A37A 2WSCE 3JCMe 2KXCA 1D3BB 4M78A 2K6DA 1YJ9A 4J6YA 3BLHB 2F69A 4M7DD 3CMET 2O9SA 1EX4A 3RMQA 1H1PB 1M2VA 2DKGA 3I5RA 2DVJA 4M78F 5DY9A 1VQ5A 3EHQA 4HKEA 2NUPB 3EFOB 3CXCP 4Y72B 2CT3A 3C0CA 2YRDA 3X24B 4RG8A 3CQTA 2RI5A 3ZL7C 3EGDB 2P0QA 2WFYB 3TNHB 2KSSA 3PGGA 2JMCA 3QWLA 5GAMe 5CYIB 2CUBA 1TUGB 4WF2A 4QW2A 3G6EA 2EQMA 1UGVA 4FU6A 2MWPA 5D6XA 4BACA 2VC8A 3DDQB 3B57A 1Z9ZA 2O4XB 4F16A 1B07A 1N5ZA 4YOZA 4LDVA 1BI0A 4XTUA 2DM1A 2PVGB 1Q95G 5J3BA 3VKHA 1HYOA 3KUFA 1OGUB 1VA7A 2V1RA 2OAWA 2EQUA 2ZPBB 5LMKB 2YWWA 4BBSM 3A8LB 2MK5A 1OL2B 3A8OB 3CC2T 1I0CA 4J9GA 2F1LA 1KD1R 4M78D 1W2BA 2BUDA 4E7LA 1IGQA 4EMGA 3D7SB 3CCST 4I3ZB 2JNGA 2VXEA 3TNIB 1G3SA 3CCLQ 2YLCA 3PIOA 1Y7XA 4NC6A 3BLQB 4OB3B 3L2VA 5ACBA 3CCMQ 1VQKQ 2QQSA 4AFUC 2OTLT 4FSXA 4J9EA 2JS2A 4HVWA 1XJWB 2JXBA 1J3TA 2RPNA 3Q1JA 2X1NB 2WJ9A 4KGVB 2DD4B 4MMLA 1OKVB 2CT4A 2JMAA 2QASA 1W70A 5LJ3g 5GANf 1GXIE 3CCQQ 3JB9F 3ZBDA 4BI8B 4BCOB 4WTOB 2ROTA 2X4YA 3CCSA 4HVUA 3M59A 1Z9QA 3QZ5B 2HSEB 4OB0B 3INZA 1H641 1IB8A 2M0OA 3MEWA 3A1PA 1MNDA 2DRMA 4OF1A 4X1VA 2JW4A 1URCB 2QK0A 3A5ZB 3X25B 2O31A 1D3BA 1WQ7A 2YT6A 1K9AA 3JCMf 3JAME 3EGXB 5LJ5f 4NL3A 1PRLC 3UDCA 5C0MA 4CI0C 4FYYB 2B9RA 2EYQA 1BU1A 2OI3A 3RUXA 3QPHA 1H25B 3PVLA 2HL3A 2AZSA 2NUPA 3CPFA 4OVAA 1PD0A 3EFOA 2KK4A 2G77A 5ICPB 1Q81C 2W2HA 5L23A 3FIFA 2KVQG 2CCIB 3REBB 3AHUA 4C0GA 2QG9B 3EGDA 3CCET 2EGCA 3JB9D 4BCMD 2WPAB 4UN0A 1YBYA 2EKOA 3RGFB 5CKEA 3G4SQ 1TFBA 5LJ3d 1KG1A 3TW7A 2F2XA 2YRCA 1M27C 3J7AF 2O4XA 2RI3A 4F17A 5HNBB 2JS0A 3H0HA 3O5ZA 2BZ8A 3G6EQ 2LQKA 4OGCA 1MNEA 2VUBA 4XU1A 1K73C 3GPLA 1AEYA 1Q82C 3OW2P 1VQLQ 4ROEA 3CBMA 3H8ZA 3UWNA 3V8JA 5GAN2 2JZ2A 1YCSB 2YUOA 1OKWB 3DTOA 4EOIB 1QLYA 4MFEA 4KH0B 1JEGA 2RQTA 1UGSB 3GF5A 3RDVA 1I81A 3C12A 3LWIA 4FW1A 4QKUA 4E7SA 4N4HA 3OMCA 1OIYB 2EQJA 4ROCA 4ZGDB 3L42A 2E12A 2RH2A 5GAOn 4YOOA 2VGMA 2CJMB 3VRYA 4A4KA 1JJ2S 3CCJT 3C94A 2RQVA 1MMGA 3FDRA 2DIQA 1W2BP 2ATCB 5GAOp 1BIAA 1VQ6T 4JRPA 4J9HA 1UUEA 1RI0A 2COWA 1QMCA 1TOVA 2DD4A 3CCRQ 1AWOA 4C8QG 4BE0A 2DE0X 2LDMA 1JU5C 1YJWT 1UECA 1ZSZB 3TEEA 1UHFA 4RTWA 1ABOA 4EOJB 3SB2A 1X27A 3BY7A
chains in the Genus database with same CATH topology
5FU6C 2E41A 4PJOF 2EJ9A 2VYTA 4Q5WA 3JCMg 3DB4A 1XTDA 4M7AG 1N9SA 1YJ9T 3OYHA 5GAN8 4OB2B 5LJ5j 4JJNK 1QVGS 3CCQA 2X4WA 5CO7A 3CEYA 4OP0A 3G71T 1OZ3A 2DD5A 3E9GA 2LQ8A 1QVFS 1NJIC 3HZJA 2O01E 2OTLA 4XQ3A 2OAUA 2YLBA 3MP8A 4MZPA 3MCAB 2XDDA 3F70A 4IUTA 3M5AA 1K9MC 1ZQ1A 2PQWA 2WACA 1VQ7T 1HK9A 3TREA 4QQDA 4R56A 2DXTA 2Y90A 4HCZA 4IUVA 3I55A 2RO0A 4A4FA 3PFSA 1YJNA 4LDUA 5HK3A 4E47A 2OTJA 1VIFA 3DLMA 4HL4A 4J8OA 4FL6A 3E9FA 3GNFB 4FT2A 4EDUA 4XK8E 4OGEA 4JX6A 4C92C 2CS7A 1DJ7B 3HFNA 5LJ3e 4HNVA 3BG9A 4KT0E 4EMKB 1Y96B 4RCBA 4JRQA 3DKMA 4C5GA 3OYIA 2D6FA 4ZN1A 3P8DA 2XDPA 3QDRB 4Y28E 3VUBA 2DAQA 3L2QA 2FB7A 1B34A 2CZ0B 1YIJT 1NJIU 3GIBA 2XI9A 5GAMg 2L5QA 2F5TX 5GAN3 5GANd 2KMTA 2HQEA 3PNWC 1UEBA 3SWNB 3G6ET 3HSBA 1IZ6A 5GAN6 4TVRA 1VQPA 4C92E 2K57A 5AYFA 4LDYA 2BS2A 1YITT 1UGQB 1KC8C 3CC4A 2LRQA 5GAN4 4M78B 4M7DC 1NZ9A 2V8IA 2QEXA 2RHZA 4O5VA 3OS1A 1NPRA 3J81E 2K3XA 3QKJA 2D0QB 3HRSA 1FXXA 1G5VA 1KQSA 1VQ8T 2CZ7B 1XQHA 3LGLA 2K5LA 4ZGJB 5FROA 2R5MA 4C0ZA 5GMKm 3OYKA 1I5LA 4PJOC 2LC4A 3M9QA 3PMTA 5GAOl 3MEAA 4PJOD 1ZBXA 2R5AA 4M7DE 2BS3A 1WJQA 4LOCA 3JB9I 4B9WA 4ATOA 3A8GB 4BY6C 2QQAA 2BIVA 4J7FA 3HL8A 4J5YA 4AKHA 1N6AA 2GF7A 4EMHA 5A0GA 1OYXA 5KE3A 3JB9H 3QUIA 2Y4XA 1KC8U 1JB0E 1WJRA 1Q86C 4CRIA 2DXCB 1U1TA 5CCAA 3JCMd 3G4SA 4IURA 3QHSA 3PIPA 3NFCA 2VXFA 3MP6A 3R6OA 4PJOE 3KXTA 3RIRA 4PL6A 4HCBA 1YIJA 1KQSS 5A0LA 5HY6A 2LT1A 3CCVT 2P4TA 3M54A 4DOVA 3OYMA 3A8MB 2RJCA 2GCXA 4M75B 4PKCC 4PLLA 2EAYA 3CC7T 3BG3A 1JBMA 2EQKA 2PUKB 4N0AC 2QFZA 1H3ZA 3P8BB 1MGQA 4RG2A 3L2ZA 2QQ8A 3WVDB 3TU4K 2E5QA 2MAMA 1QLBA 3QYHB 3CCEA 4KUDK 1PSFA 4LDXA 4AKGA 2DPPB 3VKGA 4M7DG 1VQLA 1X01A 3S3NA 2CGHA 3HPWA 2XIDA 3OQ5A 4IUUA 4EMKC 1VQMA 4C92A 5A2QE 3M4YA 4BBRM 1YI2T 5DLQE 2ZZDB 3C4SA 4QQGA 5CKDA 1Q7YC 2RHIA 4Y91A 4A54A 2K4YA 3OYFA 4FM4B 1O75A 3V7RA 1LNXA 3FEOA 4PJOG 1U1SA 3RESA 5GAMd 3CBOA 5A0DA 3WVEB 2HAXA 2NLUA 3LW5E 3SWNC 4XTZA 4N4GA 2RI2A 4YTLA 3CD6T 3VKIA 3LX7A 1VUBA 1VQOA 1G3WA 3QYGB 5M9OA 3QJ6A 2H3JA 4C0FA 3OYEA 1N9RA 4M78C 2E64A 2EJFA 3TCJA 2JOYA 3VYGB 1HXDA 4PNOA 4X9CA 1UGRB 4M7DA 5CKBA 1QW1A 3RMSA 2DZCA 1NE8A 4J6XA 4MZMA 4J83A 1VQNA 2HBPA 4AKIA 3M58A 3CCUT 2RJEA 1Q7YU 2XK0A 3HRUA 1WQWA 2BKDN 2MF2A 4M6VA 3OSVA 5DM7R 4M77B 3S6WA 1KD1U 4M78E 1WNLA 3BDUA 3URGA 2JTMA 5CVIA 4QSHA 3G7ZA 2X4XA 4HCCA 1N27A 3FLGA 2JTFA 3JCMJ 1Y07A 2FVUA 2DTIA 3OY9A 1VQNT 3CCRA 5GMKe 3EAEA 1K8AC 4M77F 1W4SA 2EWNA 4OB1B 2R57A 4KULA 1VQ4T 1NPPA 4JUVA 3OYLA 2KAFA 2DEQA 4XTXA 2CYZB 1YCYA 5LJ5g 1S72A 4DQ2A 3QIIA 3M55A 4MZTA 5CR2A 1X6OA 3OMGA 3DB3A 4M75C 3HBLA 3OS5A 1M4ZA 1YHQT 2LX9A 4HLQA 2E65A 4MMKA 5GANe 3CCJA 1O9SA 5EG2A 1MHNA 5LJ3j 3HKSA 4N0AA 2WSFE 2ZGWA 3HFOA 3LGFA 2BS4A 3M56A 2DVEA 3DL1A 1VQ6A 2VGNA 1JRIA 2M9UA 5KE2A 1G3TA 4JLGA 5GAMh 5GAOm 3OS2A 2QTXA 1VQ5T 4GLKA 1FWZA 2XDBA 1BYMA 4L6V5 4Z02A 2HNIA 4BUGA 2XHCA 4BE1A 5GAN7 5DLOA 4EMKA 2P0PA 1Y96A 3VV0A 1KQ1A 3TW6A 3PMIA 5LJ3f 3JRZA 4C92D 3JB9J 1FX7A 3GOXA 2AHJB 1YJWA 4C8QB 3NTIA 3QO3A 4HT9A 2DTOA 4EPCA 2DD5B 2JUFA 5GMKi 2ZPGB 1M9SA 2RHYA 4IUPA 3SWNA 3M53A 2WSCE 1K9MU 3JCMe 3QBYA 1BI2A 4C8QF 1D3BB 4M78A 1YJ9A 3CXCA 4J6YA 1WJSA 1BI3A 5GAOq 1M5Q1 2WSEE 2F69A 2ZCFB 3G71A 4M7DD 3CMET 3E19A 3HB9A 3SD4A 3RMQA 4M7AB 3HO8A 2ZPEB 2ZPFB 2DXUA 2DKGA 4NL2A 4M77C 1VQ7A 3OB9A 2E10A 4M78F 5J26A 4A4HA 5I2SA 3JCMb 5DY9A 1VQ5A 3JCMc 5FLXE 4HKEA 5LL6S 2KDSA 1I4K1 3I56T 3CXCS 4E7JA 3X24B 3LWHA 2DXCA 5GAOr 3VJPA 4KBMB 4QVZA 3MEVA 4RG8A 4D6WA 1IREB 2E70A 4M77E 5J39A 2RI5A 2LTOA 2RHXA 4JRKA 2P0QA 3HRTA 5LJ5d 4C92G 2X35A 2KSSA 3ER0A 1TH7A 3KHIA 3QWLA 2RM4A 3MEUA 3PGGA 4XTVA 5CQYA 5GAMe 5GAMf 4X9DA 3PT9A 1KHCA 4M75A 4WF2A 4QW2A 5IT9E 4MDXA 4AI6A 4FT4A 5GMKh 3G6EA 2EQMA 4RMOA 1KHIA 3X26B 3X28B 1UGPB 2MWPA 4FU6A 2QI2A 5D6XA 1YITA 4BACA 3X20B 2VC8A 2O4XB 3OS0A 2QA4T 1M90C 4A53A 2PVDB 4LDVA 1BI0A 2A7YA 3RKYA 4XTUA 2CKKA 4M75F 5GANh 2PVGB 1Q86U 1VQ8A 4IUQA 5J3BA 3GNGA 3VKHA 1UB4A 2ZZDA 3S3OA 1M1KC 1M8VA 1QP3A 4XTYA 4C8QC 2MI6A 3ASKA 3KUFA 3EFSA 3CBPA 4C5IA 2RJDA 2E6NA 2PUOB 4J6WA 4M77G 4ELZC 1QP2A 2YHTA 1FKMA 4E7IA 4C0DB 2KQWA 3OYBA 4PLIA 4II1A 4ZGEB 3I56A 1N8RC 3SDZA 3GP8A 5CIUA 2E1HA 2EQUA 2ZPBB 4BBSM 3A8LB 3CPWA 4HNUA 3A8OB 3VYGA 2B8AA 4C8QE 2QXFA 3CC2T 2EJGA 1AHJB 4HNTA 2FL7A 2QQBA 2XU8A 4M78D 3OYNA 3OA6A 4X34A 1XOVA 2FHDA 2PU9B 2BUDA 3CCVA 4E7LA 1W2BA 4EMGA 4M7AC 3CCST 3OYDA 2MWOA 3CC7A 5GMKj 2JNGA 1M1GA 4LDWA 2VXEA 1VIEA 4XAXB 3JCMh 3BG5A 1G3SA 4M77A 5IAYA 1P92A 3JCMP 2YLCA 4JX5A 5LJ5h 3PIOA 4JRIA 4C5EA 2QA4A 3OYYA 3DLLA 5CKFA 5CQXA 1Y7XA 4NC6A 4OB3B 2Y4YA 2EIFA 3JSCA 3M57A 3NTHA 3L2VA 4XU3A 4NS5A 1PSEA 4VUBA 2QQSA 4Z6YA 2XG8D 3CPWS 5GANj 2OTLT 4M7AE 3QXEB 4FSXA 3MO8A 3L1AA 2DTHA 4GY5A 1U8RA 1YI2A 2QDJA 2E6ZA 1W2BS 4DA4A 2KMGA 3I55T 2GFUA 2G3RA 2HQXA 3Q1JA 4HT8A 3QSUA 2DXBB 3CMAT 3ME9A 2WJ9A 2K5IA 2OTJT 2DD4B 4MMLA 2CZ1B 4FIBA 5HK0A 2XKOC 4M75D 3CD6A 2HD0A 2JN0A 5LJ3g 5GANf 1GXIE 4XTWA 4LD6A 3JB9F 4PJOB 4ZTJA 3LH0A 3LLRA 3SFMA 2LT4A 3ZBDA 4BI8B 3RERA 4XU2A 4JX4A 2MMPA 4M7AD 3RKXA 5GAN5 4MDWA 2X4YA 2RB6A 3N5BB 5HKCA 4M78G 4C5HA 2RK1A 3CCSA 2GQVA 4BDYA 3E1SA 3M59A 4L59A 3QZ5B 3NTKA 4M75E 3CCUA 2DIGA 3PTAA 1K8AU 1VQPT 4F7UB 4OB0B 3INZA 3V8LA 3CC4T 1H641 3M4GA 3L2UA 2L89A 2M0OA 4C8QA 3MEWA 2QEXT 2CZ6B 2I2LA 4DOWA 3J80E 4OF1A 3ZEHA 4C0DC 4L5GA 4XU0A 3VYHB 3KBGA 1LOJA 3META 3OYAA 4RCCA 4JS4A 4F7UF 4J7IA 4B9XA 4O6JA 4E7KA 5FU7B 3A5ZB 1WGSA 3X25B 1WPYA 1D3BA 1WQ7A 1VQ4A 3JCMf 5LJ5e 3JAME 2ZPHB 4P5NA 2DZ9A 3CMAA 2L3RA 5LJ5f 3MHXA 4NL3A 2KY9A 1R8OB 2RK2A 3UDCA 4BE2A 5C0MA 4MFDA 4M7AA 3T9NA 4CI0C 1YHQA 1BI1A 5KCHA 4ME7A 4N4IA 1Y71A 3ZFJA 2EYQA 3G4ST 2L8DA 3QPHA 3FJPA 4M75G 4OMFB 3RUXA 4BB7A 4RKUE 4QQ6A 4M77D 3OSSC 1BIBA 5GAMj 1B34B 3VU3C 3CPFA 2M16A 1ZHIA 3OBWA 4OVAA 2KK4A 2G77A 5KCOA 4M7AF 5I21A 1Q81C 4MIMA 1KQ2A 3FIFA 2KVQG 3AHUA 4C0GA 5FRMA 4UC4A 3CCET 4JLIA 2JVVA 3JB9D 1BKBA 1SSFA 4BI3A 1OI1A 2M1HA 2F5KA 1VQLT 2KR6A 2EKOA 3V7SA 1YBYA 5KH6A 5CKEA 3OYCA 1VQMT 5LJ3d 1KG1A 3OW2A 3TW7A 3UPUA 3H4CA 2C06A 3J7AF 1OZ2A 2XD0A 3LYIA 2O4XA 2RI3A 3QZ9B 3JCMX 3OYJA 4NOYA 2RA2A 1X75C 2LQKA 1Q81U 4OGCA 3CMEA 5CKHA 3QG1A 3MP1A 3H6ZA 5EJCA 1VQOT 4XU1A 2VUBA 4R55A 1K73C 2GFAA 2DJZA 3FB9A 5IN1A 4BI4A 3GPLA 4JS5A 5FU6B 2K5FA 1I8FA 1Q82C 2ZPIB 3EFRA 4BDZA 2LCCA 3CCLT 4C8QD 3OW2S 2K2VA 3A8HB 2EFIA 3BFMA 3CBMA 3H8ZA 1QVPA 3UWNA 3L2RA 3V8JA 3C95A 5CK9A 5GAN2 5FU7C 1E7PA 2LCLA 4F7UE 3CCMT 2JZ2A 1VQKT 3QJYA 2DO3A 3JCMV 4LD9K 1JJ2A 4MFEA 3JCMQ 3BDLA 1M90U 2A3LA 3QYBA 2IG0A 2IVWA 1UGSB 2QDYB 3RKWA 1VQ9T 3GF5A 3JB9G 1I81A 4E7HA 3C12A 2VV5A 3P8HA 3LWIA 3CCRT 1K73U 4N4HA 3HHTB 3OYGA 4ELJA 3QYEA 2FYKA 3OMCA 4C92B 5GMKl 2EQJA 1M1KU 1Q82U 5L8RE 3FC3A 4ZGDB 1LJOA 3V7CA 1KD1C 3JCMW 3L42A 2R58A 1S72T 2E12A 3CCQT 2RH2A 5GAOn 4QVDA 2VGMA 4A4GA 4A4KA 2RD1A 1N8RU 1JJ2S 1XNIA 2LNVA 3CCJT 5GANg 3C94A 5LJ3h 4C92F 2P0KA 2QQRA 2V8JA 2XICA 4HA8A 3FDRA 2DIQA 4ZN3A 1V29B 3FRNA 4F7UG 5D6YA 2LVMA 1BIAA 4BD3A 1EIFA 5GAOp 4A4EA 1VQ6T 2DXBA 4JRPA 3CCLA 2X4JA 2PVOB 5I2MA 3HP9A 4M7DB 1RI0A 3BW1A 2DD4A 1YJNT 1RL2A 2V8KA 2D9TA 4C8QG 3V8KA 1QVGA 3CCMA 4BE0A 1VQKA 3UT1A 2YRVA 4ELYC 2LDMA 4IKFA 4JDSA 4QVCA 1QVFA 4PJOA 2QQ9A 5CAIA 3VUZA 1YJWT 5FRNA 4M7DF 3TEEA 3L2WA 2QF7A 3CC2A 3GLXA 1VQ9A 3SB2A 3S3MA 3O8VA 1M1FA 4ZTFA 3WXMB 4BY6B 2RJFA 1G3YA 3BY7A 5C6SA 4V2SA 2K3YA 2DK3A 4F7UA 2RHUA 5D6WA 4KUIA 3OBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGP B;  4RKU E;  3X20 B;  3VYG B;  4OB2 B;  1UGR B;  2PVD B;  2DD5 A;  2O01 E;  2PVG B;  2ZZD A;  1QP3 A;  2PUO B;  1QP2 A;  4ZGE B;  4XK8 E;  1DJ7 B;  2ZPB B;  4KT0 E;  4OB1 B;  3A8L B;  3A8O B;  3VYG A;  3QZ9 B;  4Y28 E;  1AHJ B;  2CYZ B;  2CZ0 B;  2PU9 B;  1UGQ B;  2WSF E;  2ZPI B;  4OB3 B;  3A8H B;  1PSE A;  2D0Q B;  4L6V 5;  3QXE B;  2CZ7 B;  4ZGJ B;  2AHJ B;  2DXB B;  1UGS B;  2QDY B;  3A8G B;  2DD5 B;  2DD4 B;  2ZPG B;  2CZ1 B;  1JB0 E;  3HHT B;  2WSC E;  2DXC B;  1GXI E;  5L8R E;  4ZGD B;  2WSE E;  2ZCF B;  3A8M B;  3QZ5 B;  2ZPE B;  2ZPF B;  2PUK B;  4OB0 B;  3WVD B;  1V29 B;  2CZ6 B;  3QYH B;  2DXB A;  2PVO B;  2DD4 A;  1PSF A;  3VYH B;  2DPP B;  3X24 B;  2DXC A;  3X25 B;  1IRE B;  2ZZD B;  2ZPH B;  4FM4 B;  3WVE B;  3LW5 E;  3X26 B;  3X28 B;  3QYG B; 
#chains in the Genus database with same CATH topology
 1T0H A;  3DB4 A;  1XTD A;  1QVG P;  1N9S A;  2LZ6 B;  4OB2 B;  1WHH A;  4OP0 A;  4J9I A;  1NJI C;  4EON B;  4MZP A;  2XDD A;  4IUT A;  2HSP A;  3TRE A;  3I55 A;  4HCZ A;  2EBP A;  3EGX A;  2FPD A;  4E47 A;  4XK8 E;  3HFN A;  5LJ3 e;  1PKS A;  1BBZ A;  1NEB A;  3DKM A;  2D6F A;  4ZN1 A;  4II5 B;  2XDP A;  3VUB A;  2DAQ A;  2FB7 A;  3MJX A;  3M0U A;  5GAN 3;  2KMT A;  2HQE A;  1VQ7 Q;  3SWN B;  1MV0 B;  1VQP A;  1YIT T;  1UGQ B;  1KC8 C;  2D0N A;  2DA9 A;  1NZ9 A;  2QEX A;  2RHZ A;  1NPR A;  1CKA A;  1G5V A;  1VQ8 T;  2R5M A;  1I5L A;  1OU8 A;  5GMK m;  5FW9 A;  2DER A;  5GAO l;  3I35 A;  1ZBX A;  4LOC A;  3JB9 I;  4LXC A;  2BIV A;  3HL8 A;  4EMH A;  2GF7 A;  1K0X A;  1WJR A;  4AFZ C;  4RTV A;  2ABL A;  2YSQ A;  4D8K A;  2KRM A;  4CC3 A;  1KQS P;  1K4U S;  1RLQ C;  2WEV B;  2K2M A;  3OYM A;  3CC7 T;  4M75 B;  2EQK A;  1JBM A;  4N0A C;  1OL1 B;  2QAZ A;  1MGQ A;  4D8D A;  1M3A A;  4CFW B;  4AKG A;  1NM7 A;  1ARK A;  2KI7 A;  1R77 A;  2XID A;  1N8R R;  3M4Y A;  4BBR M;  2I53 A;  1H1Q B;  5CEI B;  2H8H A;  5DLQ E;  2ZZD B;  1YI2 T;  1Q7Y C;  2KT8 A;  4EIK A;  3CCV Q;  4FM4 B;  1O75 A;  5BNJ B;  2BTT A;  3LW5 E;  4Z89 A;  4XTZ A;  1SHG A;  1FVV B;  2C0O A;  3LX7 A;  4F7J B;  1VUB A;  3QYG B;  2FPE A;  2QA4 Q;  1VQO A;  2H3J A;  4PFZ A;  3OYE A;  2DEU A;  2EJF A;  4PNO A;  4X9C A;  1O9K B;  4EOR B;  2DZC A;  4EOK B;  4HCK A;  4MZM A;  2HBP A;  2HKN A;  2RJE A;  3HRU A;  2MF2 A;  4M6V A;  2J06 A;  3OSV A;  4M77 B;  1ZSZ A;  4ANJ A;  1KD1 U;  2KNB B;  4BCQ B;  1I1J A;  5D7U A;  2JTF A;  3JCM J;  1Y07 A;  1NBE B;  3EAE A;  3MI9 B;  1VQ4 T;  1NPP A;  1UDL A;  5LJ5 g;  1S72 A;  4DQ2 A;  5CR2 A;  1X6O A;  2LW4 A;  2KT1 A;  3DB3 A;  2ENM A;  5FWB A;  1AD6 A;  1M4Z A;  1YHQ T;  2LX9 A;  1WHL A;  1IXD A;  1D1B A;  1WHK A;  5KYW B;  3HFO A;  3DL1 A;  2KRO A;  1AD5 A;  1BYM A;  1FMK A;  4L6V 5;  2HNI A;  5GAN 7;  3CMA Q;  3TW6 A;  5LJ3 f;  3JRZ A;  1FX7 A;  3GOX A;  1AIS B;  3NTI A;  2DTO A;  4EPC A;  2JUF A;  3EG3 A;  3SWN A;  1WXB A;  3SHW A;  1D0Z A;  2FO0 A;  2HZY A;  2OX7 A;  3RBB B;  2WIP B;  1OUL A;  3CXC A;  2WSE E;  2ZCF B;  1D09 B;  3E19 A;  5HCK A;  1NEG A;  4M7A B;  2ZPF B;  3H9N A;  1PHT A;  5J26 A;  1GCQ A;  3JCM c;  1IRX A;  5FLX E;  2KDS A;  1SF9 A;  1UJ0 A;  3I56 T;  2CP3 A;  3VJP A;  3MEV A;  1IRE B;  4M77 E;  2RHX A;  1SSH A;  3HRT A;  5LJ5 d;  4C92 G;  2RM4 A;  1WZO A;  4X9D A;  4M75 A;  3K7A M;  3VS3 A;  5IT9 E;  1GL5 A;  5GMK h;  4RMO A;  1N4M A;  1WDX A;  2IIM A;  2QI2 A;  4EOQ B;  1D1C A;  2ED1 A;  4A53 A;  2A7Y A;  3RKY A;  4M75 F;  2EGA A;  1VYW B;  3VS4 A;  4WCI A;  4IUQ A;  1TXQ A;  1M8V A;  1UB4 A;  2ZZD A;  1QP3 A;  2YUP A;  4C8Q C;  2DL3 A;  1KK7 A;  3PO3 S;  3CBP A;  3EFS A;  4DEX A;  4J6W A;  4M77 G;  4ELZ C;  1QP2 A;  3LQ5 B;  2KQW A;  2MIO A;  3EG9 B;  3OYB A;  3M0S A;  2VAS A;  3I56 A;  2COZ A;  2E1H A;  2B86 A;  2IW8 B;  1O9K A;  2EYX A;  2EJG A;  2QQB A;  1UTI A;  2V1Q A;  1VQO Q;  2FPF A;  2JM8 A;  2CSI A;  5IXB A;  4KRD B;  1VIE A;  4XAX B;  3JCM P;  3BG5 A;  4M77 A;  5IAY A;  1P92 A;  2V22 B;  4JX5 A;  5CQX A;  4OR5 B;  4EC9 B;  3JSC A;  2Y4Y A;  2EIF A;  4CC2 A;  3NTH A;  3BHV B;  4XU3 A;  4EOL B;  5GAN j;  4M7A E;  3CPW S;  3A98 A;  4GLM A;  1X69 A;  2QDJ A;  2E6Z A;  5KYU A;  3EID B;  3BHU B;  4HT8 A;  5HVY B;  2OTJ T;  4LUE A;  2HQH A;  3PE0 A;  4EOM B;  2CZ1 B;  1D1A A;  1RAF B;  4M75 D;  3CD6 A;  2HD0 A;  5GJV B;  5KYW A;  4XTW A;  4ZTJ A;  3LH0 A;  3LLR A;  1H8K A;  1RAA B;  1WFW A;  2VKN A;  4FYV B;  2RB6 A;  4M78 G;  1H4L D;  1JXO A;  1U5S A;  2GQV A;  2RK1 A;  4BDY A;  3CCU A;  3PTA A;  3V8L A;  3M4G A;  1K9M R;  4DBF A;  3L2U A;  2L89 A;  1YJN Q;  2BE7 D;  2FZC B;  4DOW A;  1VOM A;  3M0P A;  3J80 E;  4C0D C;  3KBG A;  3MET A;  3OYA A;  1RI9 A;  4JS4 A;  4F7U F;  4J7I A;  4DBQ A;  4O6J A;  5FU7 B;  1WPY A;  2VB6 A;  5LJ5 e;  2EYY A;  4M7A A;  3T9N A;  4KGZ B;  1BI1 A;  2LX7 A;  5KCH A;  3CC4 Q;  7AT1 B;  3ZFJ A;  3G4S T;  2HMA A;  4RKU E;  4M77 D;  3OSS C;  4BCQ D;  5GAM j;  1B34 B;  3VU3 C;  2M16 A;  1E6H A;  4M7A F;  5KCO A;  5I21 A;  2COY A;  4RTU A;  1H24 B;  3EG1 A;  2QGG A;  2C0I A;  4UC4 A;  2UZE B;  1JO8 A;  2JJ9 A;  1YNZ A;  4BI3 A;  2FZK B;  2I0N A;  1OI1 A;  1TD6 A;  5IDP B;  1VQL T;  3OW2 A;  1P5E B;  3H4C A;  1YIJ Q;  1OZ2 A;  1MMD A;  4IMY B;  4LNP A;  4NOY A;  2RA2 A;  3QHW B;  3CME A;  5CKH A;  3QG1 A;  4KH1 B;  4R55 A;  3FB9 A;  1H28 B;  5FU6 B;  3M03 A;  3NHN A;  4OMN A;  3EG9 A;  3A8H B;  1VQM Q;  3L2R A;  1SRM A;  3C95 A;  3H41 A;  5CK9 A;  1E7P A;  2LCL A;  1QWF A;  4RTZ A;  4LD9 K;  3UF4 A;  1M90 U;  1G8X A;  2L3P A;  2DIL A;  3QYB A;  1VQ9 T;  3RKW A;  3JB9 G;  1QMZ B;  2VV5 A;  3CCR T;  3FJ5 A;  2GNC A;  3HHT B;  4M7A D;  5GMK l;  3QYE A;  1TSF A;  1BK2 A;  4BY7 X;  5L8R E;  4CFX B;  3VS7 A;  1KD1 C;  1F5Q B;  1QCN A;  1JJ2 P;  3EG0 A;  4A4G A;  1N8R U;  1XNI A;  2P0K A;  2V8J A;  4ZN3 A;  2L0A A;  5KYY B;  1V29 B;  5D6Y A;  5I2M A;  3BW1 A;  4FX3 B;  1PKD B;  1RL2 A;  2V8K A;  1QVG A;  1AOJ A;  3TQ7 P;  3UT1 A;  4ELY C;  4IKF A;  2AIR B;  1K8A R;  4LE9 A;  2QQ9 A;  1WHJ A;  2HCK A;  5CAI A;  3VUZ A;  5FRN A;  2QF7 A;  4PJN A;  3CC2 A;  3GLX A;  1VQ9 A;  2QGF B;  3CD6 Q;  5L2W B;  4V2S A;  5C6S A;  2DK3 A;  5D6W A;  2CH4 W;  1PG5 B;  2E41 A;  2EJ9 A;  2F2W A;  1SRL A;  1ENW A;  2IW6 B;  3G71 T;  1D0Y A;  1QVF S;  2HDA A;  4ROD A;  2OTL A;  4ESR A;  2YLB A;  3M5A A;  2GQI A;  1VQ7 T;  2NUZ A;  4QQD A;  9ATC B;  4IUV A;  2RO0 A;  4A4F A;  4LDU A;  5HK3 A;  3DLM A;  1M2O A;  3BE3 A;  4FL6 A;  3E9F A;  2PZ1 A;  4C92 C;  1DJ7 B;  1YJ9 Q;  3BG9 A;  1RAC B;  4EMK B;  2W0Z A;  1WLP B;  4JRQ A;  1B34 A;  2CZ0 B;  3GIB A;  4AG1 C;  2MYS A;  1ABQ A;  1OPL A;  2A28 A;  5HQ0 B;  1RAH B;  1VQ5 Q;  3TSZ A;  4M7D C;  2V8I A;  4DEY A;  2C5O B;  1KQS A;  2CZ7 B;  1XQH A;  3LGL A;  8AT1 B;  4F7S B;  5FRO A;  1ZA2 B;  2A36 A;  3OYK A;  4PJO C;  2LC4 A;  3M9Q A;  3PMT A;  4JZ4 A;  4ATO A;  2LJ3 A;  2W9Z A;  4BY6 C;  4J7F A;  5A0G A;  4E7Z A;  1R0B G;  3UAT A;  2Y4X A;  4JPB W;  2DXC B;  2HL5 C;  2J6O A;  3NFC A;  3CME Q;  5I22 A;  2DYB A;  4IIM A;  1GUX B;  3CCV T;  3M54 A;  2L2P A;  1VQN T;  4AFS C;  2EAY A;  1H3Z A;  2PUK B;  3P8B B;  4F7N B;  5AT1 B;  2QQ8 A;  1M1K R;  3I5S A;  3TU4 K;  2E5Q A;  2MAM A;  1QLB A;  3CCE A;  2HBW A;  2OJ2 A;  1MV3 A;  2DPP B;  6AT1 B;  2GTJ A;  3OQ5 A;  2RHI A;  5FGK B;  3OYF A;  1KFZ A;  1TUD A;  1K0S A;  1LCK A;  3FEO A;  3CBO A;  3WVE B;  2RI2 A;  4YTL A;  1G3W A;  2AZV A;  5KYY A;  3QJ6 A;  4M78 C;  1X2Q A;  3VYG B;  1HXD A;  3RMS A;  1OV3 A;  4J6X A;  1WYX A;  1VQN A;  4AKI A;  3M58 A;  4EOP B;  1WQW A;  2BKD N;  3S6W A;  2QTV A;  4F6U B;  1ZLM A;  3BDU A;  3TN8 B;  4QSH A;  3FLG A;  2FVU A;  2KYB A;  4ORZ A;  5GMK e;  2BZY A;  4OB1 B;  1WXT A;  3OYL A;  1AZE A;  3CCS Q;  2DEQ A;  3M55 A;  4MZT A;  3OMG A;  4MMK A;  2NUT B;  3CCJ A;  5EG2 A;  5LJ3 j;  1ACM B;  3RR6 A;  2WSF E;  2FEI A;  2BS4 A;  2DVE A;  1WX6 A;  1VQ6 A;  1JRI A;  5KE2 A;  5GAM h;  4JLG A;  3OS2 A;  2QTX A;  4GLK A;  1FWZ A;  2XDB A;  2C4G B;  2KYM A;  2KBT A;  4BE1 A;  4BUG A;  2XHC A;  1W98 B;  4EMK A;  1K76 A;  3VV0 A;  2PTK A;  1YJW A;  1SKU B;  4YOS A;  3QO3 A;  3SEM A;  2DD5 B;  3VRZ A;  3G33 B;  5GMK i;  2ZPG B;  1RUW A;  2RHY A;  4IUP A;  4KGX B;  1I5O B;  2PHG A;  2X9H A;  1K9M U;  1OQK A;  4C8Q F;  4CXA B;  1H3H A;  1WJS A;  1M5Q 1;  4CRL B;  1YN8 A;  4K11 A;  2IVX A;  3HO8 A;  2ZPE B;  2YUN A;  5I2S A;  3JCM b;  4A4H A;  2CP0 A;  3F5X B;  4E7J A;  1TU0 B;  3LWH A;  2DXC A;  1MMN A;  4D6W A;  5J39 A;  2E70 A;  4PFP A;  2LTO A;  4JRK A;  3BHT B;  2AKL A;  2X35 A;  1GUX A;  5CQY A;  3MEU A;  1OU9 A;  1M90 R;  2P84 A;  4KRC B;  3HTR A;  1RAE B;  4AI6 A;  4FT4 A;  3X26 B;  3X28 B;  2EVR A;  3THK A;  1UGP B;  1E9H B;  3VS1 A;  1YIT A;  3VS6 A;  3REA B;  3OS0 A;  1OEB A;  2CUD A;  1M90 C;  2C6T B;  3G1J A;  2YDL A;  2RN8 A;  2VWF A;  1VQ8 A;  2KRS A;  3ASK A;  4C5I A;  2RJD A;  2E6N A;  4E7I A;  1FKM A;  2E4H A;  4PLI A;  2DET A;  4II1 A;  2JM9 A;  1N8R C;  2EQI A;  2IN3 A;  1OX8 A;  1NLO C;  4HNU A;  3VYG A;  4F70 B;  2M51 A;  2B8A A;  4HNT A;  2FL7 A;  1GY3 B;  2K9G A;  3MKD A;  1XOV A;  2FHD A;  4R0K A;  3CC7 A;  2CDT A;  1M1G A;  1SG5 A;  4LDW A;  2DMO A;  3UA6 A;  3PVQ A;  5GJW B;  3M57 A;  1HD3 A;  4M4Z A;  4NS5 A;  1PSE A;  4HXJ A;  2CP5 A;  4VUB A;  4Z6Y A;  4TTH A;  3QXE B;  3MO8 A;  3L1A A;  2DTH A;  1U8R A;  1YI2 A;  1B7T A;  1W2B S;  4PFO A;  1B3Q A;  2G3R A;  2HQX A;  3QSU A;  2DXB B;  3H0I A;  3ME9 A;  2K5I A;  4NST B;  2PJQ A;  1MUZ A;  1D3U B;  4FIB A;  2NUT A;  5HK0 A;  3M0Q A;  2E5K A;  4LD6 A;  4PJO B;  1RLP C;  2KGT A;  3SFM A;  4J9B A;  4XU2 A;  1YFN A;  4MDW A;  3N5B B;  4C5H A;  3TVT A;  3E1S A;  4L59 A;  1K1Z A;  4M75 E;  4PJM A;  1K8A U;  4CFV B;  4F7U B;  2XMF A;  3I55 Q;  4OML A;  3CC4 T;  4F6W B;  2CZ6 B;  2I2L A;  1I07 A;  3ZEH A;  4XU0 A;  3VYH B;  4B9X A;  4E7K A;  4BCI B;  2DYI A;  1VQ4 A;  2LNH B;  5IHY A;  1ZP2 A;  2C5X B;  4P5N A;  2L3R A;  2KY9 A;  5DQW A;  5DQV A;  1VQP Q;  4MFD A;  3EH1 A;  1YHQ A;  2DL4 A;  2J6F A;  1Y71 A;  2QEX Q;  3FJP A;  4M75 G;  4OMF B;  4AFQ C;  4QQ6 A;  1BIB A;  2QYZ A;  1C6V X;  1ZHI A;  3OBW A;  1QCO A;  1KXU A;  4MIM A;  2JT4 A;  1KQ2 A;  2KR3 A;  5FRM A;  4JLI A;  1AWJ A;  3NDQ A;  2M1H A;  2F5K A;  2KR6 A;  3V7S A;  5KH6 A;  4CC7 A;  5HBE B;  1C1A A;  1VQM T;  3ULR B;  3UPU A;  1Q86 R;  5KYX B;  2XD0 A;  3LYI A;  3QZ9 B;  3JCM X;  1Q81 U;  1F1B B;  3H6Z A;  2DFU A;  1BU2 A;  2GFA A;  2DJZ A;  5IN1 A;  4BI4 A;  1TS9 A;  2K5F A;  1I8F A;  4J9C A;  2PK2 A;  2ZPI B;  4BDZ A;  3CCL T;  1VQ8 Q;  4OGR B;  2RQR A;  2EFI A;  4F7U E;  3CCM T;  1VQK T;  2DO3 A;  2AK5 A;  1JJ2 A;  2P4R A;  3JCM Q;  3BDL A;  3QWY A;  2A3L A;  3EH2 A;  5LQF B;  2DME A;  1K73 U;  2F2V A;  3OYG A;  1M1K U;  2FYK A;  1Q82 U;  3U23 A;  4ZNX A;  1LJO A;  3JCM W;  1YWP A;  3CCQ T;  1AVZ C;  4QVD A;  2FRW A;  2LNV A;  5LJ3 h;  4C92 F;  5EC7 A;  1D0X A;  4YC3 B;  1T0J A;  3FRN A;  4F7U G;  1BCM A;  1EIF A;  4BD3 A;  2DXB A;  3CCL A;  2PVO B;  2LMJ A;  1EFN A;  2GGR A;  2BKZ B;  3V8K A;  2L3Q A;  2J6K A;  4CFU B;  3CCM A;  1VQK A;  4JDS A;  4PJO A;  1S72 Q;  4M7D F;  1GCP A;  3O8V A;  1Y0M A;  3WXM B;  1C0M A;  1NG2 A;  1VIN A;  4F7U A;  2RHU A;  1UFF A;  3OBY A;  1SHF A;  4PJO F;  2VYT A;  4M7A G;  1YJ9 T;  3OYH A;  5GAN 8;  2DL8 A;  5LJ5 j;  3CCQ A;  2X4W A;  5CO7 A;  3CEY A;  1QVF P;  1JKW A;  3EOC B;  3E9G A;  2LQ8 A;  2F2C A;  3HZJ A;  2UZL B;  2QGS A;  3E2U A;  1K9M C;  1ZQ1 A;  2WAC A;  2QDL A;  3MPU B;  2LQN A;  1RAB B;  2OTJ A;  1VIF A;  1PC0 A;  4HL4 A;  4EDU A;  4OGE A;  4JX6 A;  4HNV A;  4KT0 E;  1IGU A;  2W10 A;  1Y96 B;  2RF0 A;  4RCB A;  3QDR B;  4RUG A;  1YHQ Q;  3L2Q A;  3I9Q A;  1NJI U;  2FG0 A;  2CCH B;  2XI9 A;  1OI9 B;  2ECZ A;  2F5T X;  3G6E T;  1IZ6 A;  3O0G D;  5GAN 6;  2K57 A;  2ESW A;  4LDY A;  2BS2 A;  2YXY A;  4OMQ A;  2LRQ A;  4KRT A;  1RAG B;  1JXM A;  4O5V A;  2WIH B;  4FCY A;  3J81 E;  2K3X A;  1H1R B;  4DBH A;  4PJJ A;  1M3B A;  1ZSZ C;  4C0Z A;  3QHR B;  5KYX A;  1LPL A;  3MEA A;  4PJO D;  2BS3 A;  2H3E B;  3DOG B;  4BY1 X;  4AKH A;  1IO6 A;  1OYX A;  1ZSG A;  1KC8 U;  1JB0 E;  1G2B A;  3G4S A;  3QHS A;  3PIP A;  1G3N C;  2VXF A;  3MP6 A;  3RIR A;  4AG2 C;  1JQQ A;  5HBH B;  3MIA B;  4DOV A;  1CKB A;  3IQL A;  2GCX A;  3BG3 A;  4RG2 A;  3WVD B;  2KE9 A;  4RTT A;  1U3O A;  3QYH B;  2DNU A;  2G9X B;  3I56 Q;  2YUQ A;  3VKG A;  4JZ3 A;  2RQU A;  1VQL A;  3S3N A;  1PD1 A;  2NWM A;  1TTH B;  1OOT A;  3JV3 A;  4IUU A;  1WI7 A;  4DBR A;  4QT7 A;  5CKD A;  2D8J A;  4Y91 A;  4A54 A;  2CP6 A;  2K4Y A;  4G6L B;  3V7R A;  3RES A;  5A0D A;  2W96 A;  2ZAE A;  3SWN C;  1RAD B;  2SRC A;  3VKI A;  5M9O A;  3NMZ C;  4C0F A;  1N9R A;  3TCJ A;  1YP5 A;  2E64 A;  2JOY A;  1ZA1 B;  1UGR B;  2FZG B;  2AKK A;  1NE8 A;  5I5Z B;  1TWB A;  1GFD A;  1H92 A;  4FW2 A;  2XK0 A;  4HVV A;  1Q7Y U;  5DM7 R;  1ZUU A;  1WNL A;  1GCQ C;  3URG A;  2C5V B;  3NPF A;  4BCG B;  3TNW B;  3EG2 A;  2X4X A;  3G7Z A;  3EGU A;  4AMC A;  4HCC A;  4CFM B;  3OY9 A;  3CCR A;  1VYV A;  1K8A C;  1AZG B;  4FYX B;  1W4S A;  2EWN A;  4KUL A;  1T3L A;  1KSW A;  1S1N A;  2KAF A;  4PJL A;  4XTX A;  2CYZ B;  2C5N B;  1YCY A;  3QII A;  1IHV A;  1ZBJ A;  3CCU Q;  3VS0 A;  3UA7 A;  4M75 C;  3HBL A;  1PCX A;  3OS5 A;  4HLQ A;  1X2K A;  2E65 A;  1SPK A;  1MHN A;  5IDN B;  4N0A A;  2IW9 B;  2ZGW A;  3LGF A;  1AWW A;  3M56 A;  2VGN A;  1G3T A;  1E7O A;  1WA7 A;  3TSW A;  2UZD B;  3VS5 A;  1Y96 A;  1KQ1 A;  3PMI A;  3JB9 J;  2OTJ Q;  4C8Q B;  2O2O A;  1M3C A;  4HT9 A;  1M9S A;  2EKH A;  3M53 A;  2O9V A;  3QBY A;  1BI2 A;  2E3I A;  1YWO A;  1BI3 A;  5GAO q;  4AT1 B;  2LP5 A;  3G71 A;  8ATC B;  3HB9 A;  1XO2 A;  3SD4 A;  1PNJ A;  2M02 A;  1Q81 R;  2DXU A;  1UNL D;  4NL2 A;  4CFU D;  4M77 C;  1VQ7 A;  1E6G A;  2E10 A;  3OB9 A;  1U06 A;  1GRI A;  2DRK A;  5LL6 S;  1I4K 1;  3CXC S;  5GAO r;  4KBM B;  4QVZ A;  4JJB A;  3ER0 A;  1TH7 A;  3KHI A;  4XTV A;  4EOS B;  1PRM C;  1FMV A;  5GAM f;  1QWE A;  1W6X A;  1KHC A;  3PT9 A;  1H26 B;  4MDX A;  4ELL A;  1KHI A;  1K73 R;  3X20 B;  1WIE A;  2QA4 T;  1Q82 R;  4RTX A;  2PVD B;  2KEA A;  2DX1 A;  2CKK A;  1JST B;  5GAN h;  1Q86 U;  2CP2 A;  1NLP C;  2Z0W A;  3GNG A;  2J05 A;  3S3O A;  1M1K C;  4XTY A;  2MI6 A;  2PUO B;  2YHT A;  4C0D B;  3NGP A;  4ZGE B;  3SDZ A;  3GBQ A;  5CIU A;  3GP8 A;  4EOO B;  2EYW A;  2BZX A;  2RNA A;  3CPW A;  4C8Q E;  2QXF A;  1NYG A;  1AHJ B;  3OYN A;  2XU8 A;  3OA6 A;  4CFN B;  2EW3 A;  4X34 A;  2PU9 B;  1H1S B;  3CCV A;  2EYZ A;  4E6R A;  4M7A C;  3OYD A;  2MWO A;  4OMP A;  5GMK j;  1QQJ A;  5EFQ B;  3JCM h;  1RAI B;  1OX9 A;  5LJ5 h;  4JRI A;  4C5E A;  2QA4 A;  3OYY A;  3DLL A;  1GBQ A;  5CKF A;  1A0N B;  1OPK A;  2V26 A;  2XG8 D;  2MOX A;  1HSQ A;  1Y57 A;  4GY5 A;  3CC2 Q;  1VQ9 Q;  1AT1 B;  4DA4 A;  2KMG A;  3DDP B;  3I55 T;  2GFU A;  1GFC A;  3CMA T;  2FRY A;  1VYT A;  2WXV B;  4BCJ B;  5IHI A;  2XKO C;  5FWC A;  2JN0 A;  1M8M A;  1W1F A;  2LJ1 A;  1AWX A;  1CSK A;  1VOL A;  2LT4 A;  3RER A;  4JX4 A;  2MMP A;  3RKX A;  2OTL Q;  5GAN 5;  5HKC A;  1NJI R;  3NTK A;  2MCN A;  2DIG A;  1X6G A;  1VQP T;  2I40 B;  2AT1 B;  2X51 A;  4C8Q A;  2QEX T;  1UE9 A;  1C9B A;  4F04 B;  2DL7 A;  4PK4 A;  4L5G A;  1LOJ A;  4RCC A;  1WGS A;  3CMA A;  2ZPH B;  2DZ9 A;  3MHX A;  3VS2 A;  2RK2 A;  1JSU B;  1R8O B;  4BE2 A;  4ME7 A;  1TG0 A;  4N4I A;  2RQW A;  2LQW A;  2L8D A;  3G71 Q;  4BB7 A;  1KC8 R;  3DJB A;  3H0F A;  2L3S A;  3EHR A;  4F14 A;  3R6N A;  2DL5 A;  1FIN B;  4BCN B;  2JVV A;  1BKB A;  1SSF A;  2DLP A;  1FMW A;  2UUE B;  3OYC A;  2EPD A;  2A08 A;  1UNG D;  1UNH D;  2C06 A;  2K79 A;  3OYJ A;  4BXX X;  1X75 C;  1GBR A;  2LCS A;  3MP1 A;  5EJC A;  1VQO T;  2BE9 B;  3KFV A;  3MY1 B;  4F7L B;  4JS5 A;  3CCE Q;  1T3S A;  2ROL A;  2JGZ B;  3EFR A;  2LCC A;  2ED0 A;  4C8Q D;  3QDF A;  3OW2 S;  2K2V A;  3BFM A;  1QVP A;  5FU7 C;  3MY5 B;  3QJY A;  1UG1 A;  3JCM V;  1Q7Y R;  4BCF B;  4IIO A;  2IG0 A;  2QDY B;  2IVW A;  3AT1 B;  4E7H A;  3P8H A;  2UZB B;  1H27 B;  4ELJ A;  4C92 B;  2CSQ A;  3FC3 A;  3V7C A;  1MMA A;  1BB9 A;  1UJY A;  2R58 A;  1S72 T;  1VQN Q;  2RD1 A;  2R7G A;  3CPW P;  4GBQ A;  5GAN g;  4A63 B;  4HA8 A;  2QQR A;  2XIC A;  2E3H A;  2LVM A;  2K7A A;  4A4E A;  2A0F B;  2X4J A;  2VVK A;  4M7D B;  3HP9 A;  1FYN A;  1YJN T;  2D9T A;  2YRV A;  5IF1 B;  4QVC A;  1X43 A;  1QVF A;  2CP7 A;  3L2W A;  4J9F A;  3S3M A;  1M1F A;  3CCJ Q;  4ZTF A;  4BY6 B;  1PM3 A;  2RJF A;  1G3Y A;  1TUC A;  2K3Y A;  2C0T A;  1ZUK A;  3RNJ A;  1VYU A;  4KUI A;  5FU6 C;  1VQ6 Q;  3JCM g;  4Q5W A;  5KYU B;  4JJN K;  1QVG S;  2HEQ A;  1KIK A;  1OZ3 A;  2DD5 A;  2O01 E;  4XQ3 A;  2OAU A;  3MP8 A;  1WHM A;  3MCA B;  1YJW Q;  3F70 A;  5HBJ B;  2PQW A;  1HK9 A;  4R56 A;  2DXT A;  4BCH B;  2Y90 A;  3PFS A;  1YJN A;  4J8O A;  4J9D A;  3GNF B;  4FYW B;  4FT2 A;  2CS7 A;  2NYS A;  1EZZ B;  2PNI A;  2J7I A;  4C5G A;  3OYI A;  2PMI B;  3P8D A;  4Y28 E;  2RMO A;  1YIJ T;  1R0C B;  4JJD A;  5GAM g;  2L5Q A;  4B6M A;  1HJD A;  5GAN d;  2D8H A;  1NYF A;  1UEB A;  3PNW C;  3HSB A;  4TVR A;  4C92 E;  5AYF A;  1QKW A;  3CC4 A;  2LJ0 A;  5IHK A;  5I11 A;  5GAN 4;  4M78 B;  3GTM S;  1PWT A;  2M0Y A;  1V76 A;  3OS1 A;  3QKJ A;  2D0Q B;  3HRS A;  1FXX A;  1M2V B;  1ZX6 A;  2K5L A;  4ZGJ B;  2O88 A;  2EGE A;  4BCK B;  2GBQ A;  2KRN A;  4M7D E;  2R5A A;  1WJQ A;  2IPO B;  4B9W A;  2PK9 B;  3A8G B;  2QQA A;  1BCO A;  4J5Y A;  1N6A A;  5KE3 A;  3JB9 H;  4RTY A;  3QUI A;  1PKT A;  1YIT Q;  4LUD A;  1Q86 C;  1QCF A;  4F6S B;  4CRI A;  1ZUY A;  4LN2 A;  1U1T A;  5CCA A;  4BCP B;  3JCM d;  4IUR A;  4Z88 A;  3R6O A;  4PJO E;  3KXT A;  4PL6 A;  4HCB A;  1YIJ A;  1KQS S;  5A0L A;  1SEM A;  3M0R A;  5HY6 A;  2LT1 A;  2MPX C;  2P4T A;  2X3W D;  3A8M B;  2RJC A;  4PKC C;  4PLL A;  2QFZ A;  3L2Z A;  4E2F B;  2HKQ B;  4Y92 A;  4KUD K;  1PSF A;  4LDX A;  4M7D G;  1X01 A;  2CGH A;  3HPW A;  1G83 A;  4OMO A;  4EMK C;  1VQM A;  4C92 A;  5A2Q E;  2G6F X;  3C4S A;  4QQG A;  5IH2 A;  5KYN A;  2W9F A;  1UHC A;  1LNX A;  4PJO G;  5GAM d;  1U1S A;  4CC4 B;  3CC7 Q;  2HAX A;  1JOW A;  4Z8A A;  2NLU A;  4N4G A;  3CD6 T;  4FSS A;  2DJQ A;  4BCN D;  2X3X D;  4JJC A;  5CKB A;  1QW1 A;  4M7D A;  3BLR B;  2GTO A;  4J83 A;  2SEM A;  2CRE A;  3CCU T;  1YI2 Q;  1WHG A;  2WMB B;  4M78 E;  4OMM A;  2JTM A;  5CVI A;  3EJ1 B;  1KJW A;  2WMA B;  1N27 A;  2DBK A;  2DF6 A;  2DTI A;  1QKX A;  5IXF A;  4M77 F;  2R57 A;  1M30 A;  4JUV A;  2CH4 A;  1IHW A;  4BCM B;  1WXU A;  2K3B A;  1LVK A;  2EUF A;  4EC8 B;  5GAN e;  3POM A;  1O9S A;  3HKS A;  1X6B A;  3LH5 A;  1V1C A;  3M0T A;  2M9U A;  5GAO m;  1VQ5 T;  2W99 A;  2BPM B;  4Z02 A;  2KXD A;  1OIU B;  1VQ4 Q;  2WHB B;  5DLO A;  2P0P A;  2DBM A;  4C92 D;  2AHJ B;  2D1X A;  5ECA A;  3QWX X;  5IHN A;  2JTE A;  1GH6 B;  2A37 A;  2WSC E;  3JCM e;  2KXC A;  1D3B B;  4M78 A;  2K6D A;  1YJ9 A;  4J6Y A;  3BLH B;  2F69 A;  4M7D D;  3CME T;  2O9S A;  1EX4 A;  3RMQ A;  1H1P B;  1M2V A;  2DKG A;  3I5R A;  2DVJ A;  4M78 F;  5DY9 A;  1VQ5 A;  3EHQ A;  4HKE A;  2NUP B;  3EFO B;  3CXC P;  4Y72 B;  2CT3 A;  3C0C A;  2YRD A;  3X24 B;  4RG8 A;  3CQT A;  2RI5 A;  3ZL7 C;  3EGD B;  2P0Q A;  2WFY B;  3TNH B;  2KSS A;  3PGG A;  2JMC A;  3QWL A;  5GAM e;  5CYI B;  2CUB A;  1TUG B;  4WF2 A;  4QW2 A;  3G6E A;  2EQM A;  1UGV A;  4FU6 A;  2MWP A;  5D6X A;  4BAC A;  2VC8 A;  3DDQ B;  3B57 A;  1Z9Z A;  2O4X B;  4F16 A;  1B07 A;  1N5Z A;  4YOZ A;  4LDV A;  1BI0 A;  4XTU A;  2DM1 A;  2PVG B;  1Q95 G;  5J3B A;  3VKH A;  1HYO A;  3KUF A;  1OGU B;  1VA7 A;  2V1R A;  2OAW A;  2EQU A;  2ZPB B;  5LMK B;  2YWW A;  4BBS M;  3A8L B;  2MK5 A;  1OL2 B;  3A8O B;  3CC2 T;  1I0C A;  4J9G A;  2F1L A;  1KD1 R;  4M78 D;  1W2B A;  2BUD A;  4E7L A;  1IGQ A;  4EMG A;  3D7S B;  3CCS T;  4I3Z B;  2JNG A;  2VXE A;  3TNI B;  1G3S A;  3CCL Q;  2YLC A;  3PIO A;  1Y7X A;  4NC6 A;  3BLQ B;  4OB3 B;  3L2V A;  5ACB A;  3CCM Q;  1VQK Q;  2QQS A;  4AFU C;  2OTL T;  4FSX A;  4J9E A;  2JS2 A;  4HVW A;  1XJW B;  2JXB A;  1J3T A;  2RPN A;  3Q1J A;  2X1N B;  2WJ9 A;  4KGV B;  2DD4 B;  4MML A;  1OKV B;  2CT4 A;  2JMA A;  2QAS A;  1W70 A;  5LJ3 g;  5GAN f;  1GXI E;  3CCQ Q;  3JB9 F;  3ZBD A;  4BI8 B;  4BCO B;  4WTO B;  2ROT A;  2X4Y A;  3CCS A;  4HVU A;  3M59 A;  1Z9Q A;  3QZ5 B;  2HSE B;  4OB0 B;  3INZ A;  1H64 1;  1IB8 A;  2M0O A;  3MEW A;  3A1P A;  1MND A;  2DRM A;  4OF1 A;  4X1V A;  2JW4 A;  1URC B;  2QK0 A;  3A5Z B;  3X25 B;  2O31 A;  1D3B A;  1WQ7 A;  2YT6 A;  1K9A A;  3JCM f;  3JAM E;  3EGX B;  5LJ5 f;  4NL3 A;  1PRL C;  3UDC A;  5C0M A;  4CI0 C;  4FYY B;  2B9R A;  2EYQ A;  1BU1 A;  2OI3 A;  3RUX A;  3QPH A;  1H25 B;  3PVL A;  2HL3 A;  2AZS A;  2NUP A;  3CPF A;  4OVA A;  1PD0 A;  3EFO A;  2KK4 A;  2G77 A;  5ICP B;  1Q81 C;  2W2H A;  5L23 A;  3FIF A;  2KVQ G;  2CCI B;  3REB B;  3AHU A;  4C0G A;  2QG9 B;  3EGD A;  3CCE T;  2EGC A;  3JB9 D;  4BCM D;  2WPA B;  4UN0 A;  1YBY A;  2EKO A;  3RGF B;  5CKE A;  3G4S Q;  1TFB A;  5LJ3 d;  1KG1 A;  3TW7 A;  2F2X A;  2YRC A;  1M27 C;  3J7A F;  2O4X A;  2RI3 A;  4F17 A;  5HNB B;  2JS0 A;  3H0H A;  3O5Z A;  2BZ8 A;  3G6E Q;  2LQK A;  4OGC A;  1MNE A;  2VUB A;  4XU1 A;  1K73 C;  3GPL A;  1AEY A;  1Q82 C;  3OW2 P;  1VQL Q;  4ROE A;  3CBM A;  3H8Z A;  3UWN A;  3V8J A;  5GAN 2;  2JZ2 A;  1YCS B;  2YUO A;  1OKW B;  3DTO A;  4EOI B;  1QLY A;  4MFE A;  4KH0 B;  1JEG A;  2RQT A;  1UGS B;  3GF5 A;  3RDV A;  1I81 A;  3C12 A;  3LWI A;  4FW1 A;  4QKU A;  4E7S A;  4N4H A;  3OMC A;  1OIY B;  2EQJ A;  4ROC A;  4ZGD B;  3L42 A;  2E12 A;  2RH2 A;  5GAO n;  4YOO A;  2VGM A;  2CJM B;  3VRY A;  4A4K A;  1JJ2 S;  3CCJ T;  3C94 A;  2RQV A;  1MMG A;  3FDR A;  2DIQ A;  1W2B P;  2ATC B;  5GAO p;  1BIA A;  1VQ6 T;  4JRP A;  4J9H A;  1UUE A;  1RI0 A;  2COW A;  1QMC A;  1TOV A;  2DD4 A;  3CCR Q;  1AWO A;  4C8Q G;  4BE0 A;  2DE0 X;  2LDM A;  1JU5 C;  1YJW T;  1UEC A;  1ZSZ B;  3TEE A;  1UHF A;  4RTW A;  1ABO A;  4EOJ B;  3SB2 A;  1X27 A;  3BY7 A; 
#chains in the Genus database with same CATH homology
 5FU6 C;  2E41 A;  4PJO F;  2EJ9 A;  2VYT A;  4Q5W A;  3JCM g;  3DB4 A;  1XTD A;  4M7A G;  1N9S A;  1YJ9 T;  3OYH A;  5GAN 8;  4OB2 B;  5LJ5 j;  4JJN K;  1QVG S;  3CCQ A;  2X4W A;  5CO7 A;  3CEY A;  4OP0 A;  3G71 T;  1OZ3 A;  2DD5 A;  3E9G A;  2LQ8 A;  1QVF S;  1NJI C;  3HZJ A;  2O01 E;  2OTL A;  4XQ3 A;  2OAU A;  2YLB A;  3MP8 A;  4MZP A;  3MCA B;  2XDD A;  3F70 A;  4IUT A;  3M5A A;  1K9M C;  1ZQ1 A;  2PQW A;  2WAC A;  1VQ7 T;  1HK9 A;  3TRE A;  4QQD A;  4R56 A;  2DXT A;  2Y90 A;  4HCZ A;  4IUV A;  3I55 A;  2RO0 A;  4A4F A;  3PFS A;  1YJN A;  4LDU A;  5HK3 A;  4E47 A;  2OTJ A;  1VIF A;  3DLM A;  4HL4 A;  4J8O A;  4FL6 A;  3E9F A;  3GNF B;  4FT2 A;  4EDU A;  4XK8 E;  4OGE A;  4JX6 A;  4C92 C;  2CS7 A;  1DJ7 B;  3HFN A;  5LJ3 e;  4HNV A;  3BG9 A;  4KT0 E;  4EMK B;  1Y96 B;  4RCB A;  4JRQ A;  3DKM A;  4C5G A;  3OYI A;  2D6F A;  4ZN1 A;  3P8D A;  2XDP A;  3QDR B;  4Y28 E;  3VUB A;  2DAQ A;  3L2Q A;  2FB7 A;  1B34 A;  2CZ0 B;  1YIJ T;  1NJI U;  3GIB A;  2XI9 A;  5GAM g;  2L5Q A;  2F5T X;  5GAN 3;  5GAN d;  2KMT A;  2HQE A;  3PNW C;  1UEB A;  3SWN B;  3G6E T;  3HSB A;  1IZ6 A;  5GAN 6;  4TVR A;  1VQP A;  4C92 E;  2K57 A;  5AYF A;  4LDY A;  2BS2 A;  1YIT T;  1UGQ B;  1KC8 C;  3CC4 A;  2LRQ A;  5GAN 4;  4M78 B;  4M7D C;  1NZ9 A;  2V8I A;  2QEX A;  2RHZ A;  4O5V A;  3OS1 A;  1NPR A;  3J81 E;  2K3X A;  3QKJ A;  2D0Q B;  3HRS A;  1FXX A;  1G5V A;  1KQS A;  1VQ8 T;  2CZ7 B;  1XQH A;  3LGL A;  2K5L A;  4ZGJ B;  5FRO A;  2R5M A;  4C0Z A;  5GMK m;  3OYK A;  1I5L A;  4PJO C;  2LC4 A;  3M9Q A;  3PMT A;  5GAO l;  3MEA A;  4PJO D;  1ZBX A;  2R5A A;  4M7D E;  2BS3 A;  1WJQ A;  4LOC A;  3JB9 I;  4B9W A;  4ATO A;  3A8G B;  4BY6 C;  2QQA A;  2BIV A;  4J7F A;  3HL8 A;  4J5Y A;  4AKH A;  1N6A A;  2GF7 A;  4EMH A;  5A0G A;  1OYX A;  5KE3 A;  3JB9 H;  3QUI A;  2Y4X A;  1KC8 U;  1JB0 E;  1WJR A;  1Q86 C;  4CRI A;  2DXC B;  1U1T A;  5CCA A;  3JCM d;  3G4S A;  4IUR A;  3QHS A;  3PIP A;  3NFC A;  2VXF A;  3MP6 A;  3R6O A;  4PJO E;  3KXT A;  3RIR A;  4PL6 A;  4HCB A;  1YIJ A;  1KQS S;  5A0L A;  5HY6 A;  2LT1 A;  3CCV T;  2P4T A;  3M54 A;  4DOV A;  3OYM A;  3A8M B;  2RJC A;  2GCX A;  4M75 B;  4PKC C;  4PLL A;  2EAY A;  3CC7 T;  3BG3 A;  1JBM A;  2EQK A;  2PUK B;  4N0A C;  2QFZ A;  1H3Z A;  3P8B B;  1MGQ A;  4RG2 A;  3L2Z A;  2QQ8 A;  3WVD B;  3TU4 K;  2E5Q A;  2MAM A;  1QLB A;  3QYH B;  3CCE A;  4KUD K;  1PSF A;  4LDX A;  4AKG A;  2DPP B;  3VKG A;  4M7D G;  1VQL A;  1X01 A;  3S3N A;  2CGH A;  3HPW A;  2XID A;  3OQ5 A;  4IUU A;  4EMK C;  1VQM A;  4C92 A;  5A2Q E;  3M4Y A;  4BBR M;  1YI2 T;  5DLQ E;  2ZZD B;  3C4S A;  4QQG A;  5CKD A;  1Q7Y C;  2RHI A;  4Y91 A;  4A54 A;  2K4Y A;  3OYF A;  4FM4 B;  1O75 A;  3V7R A;  1LNX A;  3FEO A;  4PJO G;  1U1S A;  3RES A;  5GAM d;  3CBO A;  5A0D A;  3WVE B;  2HAX A;  2NLU A;  3LW5 E;  3SWN C;  4XTZ A;  4N4G A;  2RI2 A;  4YTL A;  3CD6 T;  3VKI A;  3LX7 A;  1VUB A;  1VQO A;  1G3W A;  3QYG B;  5M9O A;  3QJ6 A;  2H3J A;  4C0F A;  3OYE A;  1N9R A;  4M78 C;  2E64 A;  2EJF A;  3TCJ A;  2JOY A;  3VYG B;  1HXD A;  4PNO A;  4X9C A;  1UGR B;  4M7D A;  5CKB A;  1QW1 A;  3RMS A;  2DZC A;  1NE8 A;  4J6X A;  4MZM A;  4J83 A;  1VQN A;  2HBP A;  4AKI A;  3M58 A;  3CCU T;  2RJE A;  1Q7Y U;  2XK0 A;  3HRU A;  1WQW A;  2BKD N;  2MF2 A;  4M6V A;  3OSV A;  5DM7 R;  4M77 B;  3S6W A;  1KD1 U;  4M78 E;  1WNL A;  3BDU A;  3URG A;  2JTM A;  5CVI A;  4QSH A;  3G7Z A;  2X4X A;  4HCC A;  1N27 A;  3FLG A;  2JTF A;  3JCM J;  1Y07 A;  2FVU A;  2DTI A;  3OY9 A;  1VQN T;  3CCR A;  5GMK e;  3EAE A;  1K8A C;  4M77 F;  1W4S A;  2EWN A;  4OB1 B;  2R57 A;  4KUL A;  1VQ4 T;  1NPP A;  4JUV A;  3OYL A;  2KAF A;  2DEQ A;  4XTX A;  2CYZ B;  1YCY A;  5LJ5 g;  1S72 A;  4DQ2 A;  3QII A;  3M55 A;  4MZT A;  5CR2 A;  1X6O A;  3OMG A;  3DB3 A;  4M75 C;  3HBL A;  3OS5 A;  1M4Z A;  1YHQ T;  2LX9 A;  4HLQ A;  2E65 A;  4MMK A;  5GAN e;  3CCJ A;  1O9S A;  5EG2 A;  1MHN A;  5LJ3 j;  3HKS A;  4N0A A;  2WSF E;  2ZGW A;  3HFO A;  3LGF A;  2BS4 A;  3M56 A;  2DVE A;  3DL1 A;  1VQ6 A;  2VGN A;  1JRI A;  2M9U A;  5KE2 A;  1G3T A;  4JLG A;  5GAM h;  5GAO m;  3OS2 A;  2QTX A;  1VQ5 T;  4GLK A;  1FWZ A;  2XDB A;  1BYM A;  4L6V 5;  4Z02 A;  2HNI A;  4BUG A;  2XHC A;  4BE1 A;  5GAN 7;  5DLO A;  4EMK A;  2P0P A;  1Y96 A;  3VV0 A;  1KQ1 A;  3TW6 A;  3PMI A;  5LJ3 f;  3JRZ A;  4C92 D;  3JB9 J;  1FX7 A;  3GOX A;  2AHJ B;  1YJW A;  4C8Q B;  3NTI A;  3QO3 A;  4HT9 A;  2DTO A;  4EPC A;  2DD5 B;  2JUF A;  5GMK i;  2ZPG B;  1M9S A;  2RHY A;  4IUP A;  3SWN A;  3M53 A;  2WSC E;  1K9M U;  3JCM e;  3QBY A;  1BI2 A;  4C8Q F;  1D3B B;  4M78 A;  1YJ9 A;  3CXC A;  4J6Y A;  1WJS A;  1BI3 A;  5GAO q;  1M5Q 1;  2WSE E;  2F69 A;  2ZCF B;  3G71 A;  4M7D D;  3CME T;  3E19 A;  3HB9 A;  3SD4 A;  3RMQ A;  4M7A B;  3HO8 A;  2ZPE B;  2ZPF B;  2DXU A;  2DKG A;  4NL2 A;  4M77 C;  1VQ7 A;  3OB9 A;  2E10 A;  4M78 F;  5J26 A;  4A4H A;  5I2S A;  3JCM b;  5DY9 A;  1VQ5 A;  3JCM c;  5FLX E;  4HKE A;  5LL6 S;  2KDS A;  1I4K 1;  3I56 T;  3CXC S;  4E7J A;  3X24 B;  3LWH A;  2DXC A;  5GAO r;  3VJP A;  4KBM B;  4QVZ A;  3MEV A;  4RG8 A;  4D6W A;  1IRE B;  2E70 A;  4M77 E;  5J39 A;  2RI5 A;  2LTO A;  2RHX A;  4JRK A;  2P0Q A;  3HRT A;  5LJ5 d;  4C92 G;  2X35 A;  2KSS A;  3ER0 A;  1TH7 A;  3KHI A;  3QWL A;  2RM4 A;  3MEU A;  3PGG A;  4XTV A;  5CQY A;  5GAM e;  5GAM f;  4X9D A;  3PT9 A;  1KHC A;  4M75 A;  4WF2 A;  4QW2 A;  5IT9 E;  4MDX A;  4AI6 A;  4FT4 A;  5GMK h;  3G6E A;  2EQM A;  4RMO A;  1KHI A;  3X26 B;  3X28 B;  1UGP B;  2MWP A;  4FU6 A;  2QI2 A;  5D6X A;  1YIT A;  4BAC A;  3X20 B;  2VC8 A;  2O4X B;  3OS0 A;  2QA4 T;  1M90 C;  4A53 A;  2PVD B;  4LDV A;  1BI0 A;  2A7Y A;  3RKY A;  4XTU A;  2CKK A;  4M75 F;  5GAN h;  2PVG B;  1Q86 U;  1VQ8 A;  4IUQ A;  5J3B A;  3GNG A;  3VKH A;  1UB4 A;  2ZZD A;  3S3O A;  1M1K C;  1M8V A;  1QP3 A;  4XTY A;  4C8Q C;  2MI6 A;  3ASK A;  3KUF A;  3EFS A;  3CBP A;  4C5I A;  2RJD A;  2E6N A;  2PUO B;  4J6W A;  4M77 G;  4ELZ C;  1QP2 A;  2YHT A;  1FKM A;  4E7I A;  4C0D B;  2KQW A;  3OYB A;  4PLI A;  4II1 A;  4ZGE B;  3I56 A;  1N8R C;  3SDZ A;  3GP8 A;  5CIU A;  2E1H A;  2EQU A;  2ZPB B;  4BBS M;  3A8L B;  3CPW A;  4HNU A;  3A8O B;  3VYG A;  2B8A A;  4C8Q E;  2QXF A;  3CC2 T;  2EJG A;  1AHJ B;  4HNT A;  2FL7 A;  2QQB A;  2XU8 A;  4M78 D;  3OYN A;  3OA6 A;  4X34 A;  1XOV A;  2FHD A;  2PU9 B;  2BUD A;  3CCV A;  4E7L A;  1W2B A;  4EMG A;  4M7A C;  3CCS T;  3OYD A;  2MWO A;  3CC7 A;  5GMK j;  2JNG A;  1M1G A;  4LDW A;  2VXE A;  1VIE A;  4XAX B;  3JCM h;  3BG5 A;  1G3S A;  4M77 A;  5IAY A;  1P92 A;  3JCM P;  2YLC A;  4JX5 A;  5LJ5 h;  3PIO A;  4JRI A;  4C5E A;  2QA4 A;  3OYY A;  3DLL A;  5CKF A;  5CQX A;  1Y7X A;  4NC6 A;  4OB3 B;  2Y4Y A;  2EIF A;  3JSC A;  3M57 A;  3NTH A;  3L2V A;  4XU3 A;  4NS5 A;  1PSE A;  4VUB A;  2QQS A;  4Z6Y A;  2XG8 D;  3CPW S;  5GAN j;  2OTL T;  4M7A E;  3QXE B;  4FSX A;  3MO8 A;  3L1A A;  2DTH A;  4GY5 A;  1U8R A;  1YI2 A;  2QDJ A;  2E6Z A;  1W2B S;  4DA4 A;  2KMG A;  3I55 T;  2GFU A;  2G3R A;  2HQX A;  3Q1J A;  4HT8 A;  3QSU A;  2DXB B;  3CMA T;  3ME9 A;  2WJ9 A;  2K5I A;  2OTJ T;  2DD4 B;  4MML A;  2CZ1 B;  4FIB A;  5HK0 A;  2XKO C;  4M75 D;  3CD6 A;  2HD0 A;  2JN0 A;  5LJ3 g;  5GAN f;  1GXI E;  4XTW A;  4LD6 A;  3JB9 F;  4PJO B;  4ZTJ A;  3LH0 A;  3LLR A;  3SFM A;  2LT4 A;  3ZBD A;  4BI8 B;  3RER A;  4XU2 A;  4JX4 A;  2MMP A;  4M7A D;  3RKX A;  5GAN 5;  4MDW A;  2X4Y A;  2RB6 A;  3N5B B;  5HKC A;  4M78 G;  4C5H A;  2RK1 A;  3CCS A;  2GQV A;  4BDY A;  3E1S A;  3M59 A;  4L59 A;  3QZ5 B;  3NTK A;  4M75 E;  3CCU A;  2DIG A;  3PTA A;  1K8A U;  1VQP T;  4F7U B;  4OB0 B;  3INZ A;  3V8L A;  3CC4 T;  1H64 1;  3M4G A;  3L2U A;  2L89 A;  2M0O A;  4C8Q A;  3MEW A;  2QEX T;  2CZ6 B;  2I2L A;  4DOW A;  3J80 E;  4OF1 A;  3ZEH A;  4C0D C;  4L5G A;  4XU0 A;  3VYH B;  3KBG A;  1LOJ A;  3MET A;  3OYA A;  4RCC A;  4JS4 A;  4F7U F;  4J7I A;  4B9X A;  4O6J A;  4E7K A;  5FU7 B;  3A5Z B;  1WGS A;  3X25 B;  1WPY A;  1D3B A;  1WQ7 A;  1VQ4 A;  3JCM f;  5LJ5 e;  3JAM E;  2ZPH B;  4P5N A;  2DZ9 A;  3CMA A;  2L3R A;  5LJ5 f;  3MHX A;  4NL3 A;  2KY9 A;  1R8O B;  2RK2 A;  3UDC A;  4BE2 A;  5C0M A;  4MFD A;  4M7A A;  3T9N A;  4CI0 C;  1YHQ A;  1BI1 A;  5KCH A;  4ME7 A;  4N4I A;  1Y71 A;  3ZFJ A;  2EYQ A;  3G4S T;  2L8D A;  3QPH A;  3FJP A;  4M75 G;  4OMF B;  3RUX A;  4BB7 A;  4RKU E;  4QQ6 A;  4M77 D;  3OSS C;  1BIB A;  5GAM j;  1B34 B;  3VU3 C;  3CPF A;  2M16 A;  1ZHI A;  3OBW A;  4OVA A;  2KK4 A;  2G77 A;  5KCO A;  4M7A F;  5I21 A;  1Q81 C;  4MIM A;  1KQ2 A;  3FIF A;  2KVQ G;  3AHU A;  4C0G A;  5FRM A;  4UC4 A;  3CCE T;  4JLI A;  2JVV A;  3JB9 D;  1BKB A;  1SSF A;  4BI3 A;  1OI1 A;  2M1H A;  2F5K A;  1VQL T;  2KR6 A;  2EKO A;  3V7S A;  1YBY A;  5KH6 A;  5CKE A;  3OYC A;  1VQM T;  5LJ3 d;  1KG1 A;  3OW2 A;  3TW7 A;  3UPU A;  3H4C A;  2C06 A;  3J7A F;  1OZ2 A;  2XD0 A;  3LYI A;  2O4X A;  2RI3 A;  3QZ9 B;  3JCM X;  3OYJ A;  4NOY A;  2RA2 A;  1X75 C;  2LQK A;  1Q81 U;  4OGC A;  3CME A;  5CKH A;  3QG1 A;  3MP1 A;  3H6Z A;  5EJC A;  1VQO T;  4XU1 A;  2VUB A;  4R55 A;  1K73 C;  2GFA A;  2DJZ A;  3FB9 A;  5IN1 A;  4BI4 A;  3GPL A;  4JS5 A;  5FU6 B;  2K5F A;  1I8F A;  1Q82 C;  2ZPI B;  3EFR A;  4BDZ A;  2LCC A;  3CCL T;  4C8Q D;  3OW2 S;  2K2V A;  3A8H B;  2EFI A;  3BFM A;  3CBM A;  3H8Z A;  1QVP A;  3UWN A;  3L2R A;  3V8J A;  3C95 A;  5CK9 A;  5GAN 2;  5FU7 C;  1E7P A;  2LCL A;  4F7U E;  3CCM T;  2JZ2 A;  1VQK T;  3QJY A;  2DO3 A;  3JCM V;  4LD9 K;  1JJ2 A;  4MFE A;  3JCM Q;  3BDL A;  1M90 U;  2A3L A;  3QYB A;  2IG0 A;  2IVW A;  1UGS B;  2QDY B;  3RKW A;  1VQ9 T;  3GF5 A;  3JB9 G;  1I81 A;  4E7H A;  3C12 A;  2VV5 A;  3P8H A;  3LWI A;  3CCR T;  1K73 U;  4N4H A;  3HHT B;  3OYG A;  4ELJ A;  3QYE A;  2FYK A;  3OMC A;  4C92 B;  5GMK l;  2EQJ A;  1M1K U;  1Q82 U;  5L8R E;  3FC3 A;  4ZGD B;  1LJO A;  3V7C A;  1KD1 C;  3JCM W;  3L42 A;  2R58 A;  1S72 T;  2E12 A;  3CCQ T;  2RH2 A;  5GAO n;  4QVD A;  2VGM A;  4A4G A;  4A4K A;  2RD1 A;  1N8R U;  1JJ2 S;  1XNI A;  2LNV A;  3CCJ T;  5GAN g;  3C94 A;  5LJ3 h;  4C92 F;  2P0K A;  2QQR A;  2V8J A;  2XIC A;  4HA8 A;  3FDR A;  2DIQ A;  4ZN3 A;  1V29 B;  3FRN A;  4F7U G;  5D6Y A;  2LVM A;  1BIA A;  4BD3 A;  1EIF A;  5GAO p;  4A4E A;  1VQ6 T;  2DXB A;  4JRP A;  3CCL A;  2X4J A;  2PVO B;  5I2M A;  3HP9 A;  4M7D B;  1RI0 A;  3BW1 A;  2DD4 A;  1YJN T;  1RL2 A;  2V8K A;  2D9T A;  4C8Q G;  3V8K A;  1QVG A;  3CCM A;  4BE0 A;  1VQK A;  3UT1 A;  2YRV A;  4ELY C;  2LDM A;  4IKF A;  4JDS A;  4QVC A;  1QVF A;  4PJO A;  2QQ9 A;  5CAI A;  3VUZ A;  1YJW T;  5FRN A;  4M7D F;  3TEE A;  3L2W A;  2QF7 A;  3CC2 A;  3GLX A;  1VQ9 A;  3SB2 A;  3S3M A;  3O8V A;  1M1F A;  4ZTF A;  3WXM B;  4BY6 B;  2RJF A;  1G3Y A;  3BY7 A;  5C6S A;  4V2S A;  2K3Y A;  2DK3 A;  4F7U A;  2RHU A;  5D6W A;  4KUI A;  3OBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...