3X26B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 5 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x26B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x26B02
2QDYB 3A8GB 2CYZB 4ZGDB 1UGSB 2CZ6B 2AHJB 3LW5E 2ZZDA 3HHTB 3VYGB 3WVEB 2DXBA 2WSEE 3A8LB 3A8OB 3A8HB 1PSEA 4OB0B 3X26B 3X24B 2PU9B 2DD5A 1UGRB 4Y28E 4L6V5 3X20B 4XK8E 1QP2A 1QP3A 2ZPHB 2CZ7B 2WSFE 2DXCA 2ZPGB 1PSFA 2PUOB 2DD4B 3QYHB 4OB3B 2ZPFB 3X28B 1JB0E 2ZPIB 2D0QB 2PVGB 1UGQB 2PVDB 2ZZDB 3QZ5B 2WSCE 4FM4B 3VYGA 1V29B 4KT0E 1AHJB 3X25B 2DXBB 2O01E 1GXIE 1DJ7B 2DPPB 2ZPEB 1IREB 2CZ0B 1UGPB 3QYGB 2ZPBB 2DD5B 4OB1B 5L8RE 4ZGJB 4RKUE 3VYHB 2ZCFB 2PUKB 3QXEB 2DXCB 2PVOB 4ZGEB 4OB2B 3A8MB 3QZ9B 2CZ1B 3WVDB 2DD4A
chains in the Genus database with same CATH superfamily
1RAEB 4EOKB 3SWNB 2J6KA 1RI9A 2QDJA 2WFYB 2RHUA 2J06A 3H0IA 2LQKA 1XO2A 4EOSB 1VQNQ 3CCMQ 4JJBA 2M1HA 4DEYA 3FEOA 1WJRA 2BPMB 2EWNA 4FT4A 1VQ4T 4JUVA 1KSWA 1OYXA 2GQIA 4CFUB 2QYZA 3SD4A 4A4EA 3EFOA 5I2MA 1Q81C 1OGUB 2KQWA 4WTOB 1ZLMA 2BE9B 4XTVA 4M7DE 2EAYA 1KC8C 4KBMB 4KRCB 2EKOA 4RTXA 3CPWP 4M77D 4LUEA 3M0TA 4II5B 3JCMe 2EJFA 4KH0B 3UT1A 1UDLA 1RAHB 1ZSZA 2GTJA 4HT8A 3PVLA 4J6XA 2ATCB 5FW9A 2DD4B 1AWJA 2CT4A 1C1AA 1RABB 3QDRB 3SB2A 3OYAA 4ATOA 4OR5B 2C5NB 2PHGA 2E65A 1IB8A 4RG8A 1MMGA 1UECA 3BHVB 2PVDB 2YUOA 1OIYB 1PM3A 4FU6A 3OYJA 4LDWA 1YJNQ 3VS3A 1YWPA 4II1A 1KQSS 2JMAA 3OYIA 3CCVQ 1Q7YR 1O9KB 4PJOD 1X2KA 1ZQ1A 1QVFA 1K1ZA 1X6BA 1H1RB 3A98A 2CZ0B 2KXCA 4EONB 1XQHA 3SWNC 2DO3A 2I53A 1G83A 4M7DF 4LD6A 5CEIB 1VQKQ 1K4US 4FT2A 2OAUA 2DTOA 3DB4A 4RMOA 3P8BB 2BZ8A 3ASKA 3CD6T 3N5BB 4A63B 2GFUA 2PVOB 4TVRA 4P5NA 5HBJB 2WPAB 2EPDA 4EDUA 5DLOA 2E5KA 3CBPA 2QA4Q 2HKQB 4JZ4A 3WVDB 1LVKA 2W96A 3HTRA 3H9NA 3CC4Q 2L5QA 4Z6YA 4M75G 2L0AA 2V8IA 3JB9F 3BG9A 3JCMf 1UJYA 4KULA 2KE9A 2KNBB 1EFNA 3SFMA 1LNXA 4XU1A 2M16A 4CRIA 5CCAA 1QCOA 8AT1B 2EQJA 1K9MC 4Z8AA 4ZTJA 2EQIA 4BY6B 2DMEA 5LJ3g 3DB3A 3E9GA 5FRNA 1VQ4Q 1MHNA 3FLGA 3C95A 4OB0B 2A08A 4FW1A 4ANJA 3CXCA 5GANe 4Y28E 4L6V5 2C5VB 1E9HB 2AT1B 4F7UG 1PNJA 4XK8E 1NJIR 1QP3A 3I55T 2RQVA 1OIUB 2KDSA 2XD0A 5ICPB 4PJOB 1WXTA 5GAOn 3ULRB 2EQMA 3CPWS 1SPKA 1Q86U 3SWNA 1D1AA 3X28B 1JB0E 1S72A 4BCOB 1VQMT 1T0HA 2J6FA 3QJYA 2RK1A 2WEVB 1PWTA 2D9TA 2EIFA 4F17A 5CK9A 4EMKB 1JKWA 5HKCA 3E19A 5KCOA 4KRDB 1GH6B 1D3BB 3H8ZA 1M3BA 4OMMA 1KQ1A 1MGQA 1TUGB 4QVDA 1IREB 2EYYA 3V8JA 1OU8A 4PL6A 3MCAB 3PVQA 3BDLA 4Q5WA 1V1CA 1T0JA 4OMQA 1G3WA 1NEGA 4DBRA 1QVGA 5GAN3 5DY9A 2AIRB 2QQAA 2O88A 2CP2A 4A54A 1YJWA 3CCJT 1GL5A 2H8HA 3CD6Q 4OB2B 2DL4A 5GANf 4BY6C 2MWPA 5CO7A 2DD4A 3SDZA 2KI7A 2CYZB 3GPLA 2LQWA 3J81E 4E7LA 1QWFA 3EG9B 3PIOA 2RO0A 2HSEB 1AWWA 2LJ1A 1GFDA 2KRNA 4LOCA 5LJ5e 4PJOE 1QVFP 1YFNA 3NFCA 2PQWA 3WVEB 2R5AA 3MHXA 4OMLA 4EOQB 2EYQA 1O9KA 4J83A 5FU7C 4QVZA 4AFQC 3GP8A 1KD1U 1G8XA 1I07A 2GF7A 5GMKe 4GLMA 4PJOC 2J6OA 3BFMA 2MWOA 3CCQT 4LNPA 2HAXA 1P92A 2LCSA 4M77F 3HSBA 4UN0A 1YITT 1N8RU 1K76A 2HSPA 1E7OA 3HRTA 4CC7A 4E7JA 2EYWA 3DJBA 2COZA 2A28A 4EMKC 5GAMg 1VQOT 3MKDA 2CP5A 2AK5A 3MP6A 4NL2A 1KXUA 3I55Q 1FXXA 3H41A 2C5OB 3EG1A 1K73U 2VVKA 3E2UA 1OKVB 3RGFB 4EORB 1WIEA 1RI0A 2HMAA 3OSSC 5CIUA 4HXJA 3QDFA 3NTIA 4E47A 4JRPA 1VQMQ 5I5ZB 1ZHIA 4BCQD 3Q1JA 2WSCE 1TU0B 1NYFA 1OX9A 4KT0E 2WMAB 3OYKA 3CC7T 2M02A 3OY9A 2GFAA 2FZGB 1B7TA 2E5QA 3MEAA 2K2MA 4RTTA 4AG2C 2E10A 2YUPA 2COYA 3CBMA 4BI8B 4JDSA 5LJ5f 2D8HA 4ZGJB 1TXQA 2E1HA 1RLQC 2X35A 1MUZA 4RUGA 2RK2A 2MK5A 4F6WB 1U8RA 5GAMe 2KXDA 3CCJQ 4QSHA 1M1GA 3UWNA 3GTMS 1ZBJA 5IF1B 4PJOA 2MCNA 2DK3A 3OYYA 5IT9E 4JX4A 3PT9A 3G7ZA 2QXFA 1UB4A 1YJ9T 2WXVB 3I5RA 3CCUT 5CKBA 4OMPA 2XDBA 2D6FA 3EGDB 2CP6A 1ZA2B 3VS5A 2JTEA 1M2VB 4BCND 2HNIA 2XKOC 4MDXA 1FYNA 1VOLA 5GANj 3JB9J 2E6NA 1X43A 4C8QB 2I0NA 4EMKA 1U1SA 5LQFB 1D3BA 3F70A 4DOWA 2V8KA 2CCHB 1ARKA 1YHQA 3FB9A 3NMZC 3EFRA 2VUBA 3BW1A 3FJPA 5LJ3d 4ORZA 3OYMA 2FRWA 3CCQQ 2DVEA 2MAMA 3FC3A 2UZDB 1MV3A 2A37A 2YUQA 4N4IA 3VUZA 5A2QE 3V8LA 1UGVA 2L3QA 1KQSA 2E3HA 3E1SA 4ROEA 1ENWA 1YITQ 5IHKA 1B34B 1FX7A 4GLKA 3LH0A 4J9GA 1WI7A 2RF0A 3CCQA 1M1KC 1VQOQ 1PSFA 1Q95G 1HYOA 2RJDA 4QT7A 4CFXB 3CCET 1O9SA 4KRTA 2ZPFB 1D0ZA 2P0QA 1KHIA 3ME9A 2LNVA 3EG9A 4A53A 1Q82C 1QKWA 3OYFA 1VOMA 2FEIA 2JN0A 2ROLA 1GBQA 4FM4B 4F7JB 4L5GA 1GXIE 2A3LA 2XK0A 3CC7Q 3MP1A 4EOPB 1C0MA 4IIOA 2F5TX 1WYXA 3H0FA 1X6OA 2KMTA 1VQ5A 2KVQG 4X34A 5IAYA 2R57A 1BCMA 5LL6S 2YHTA 4OVAA 3F5XB 4GBQA 2X3WD 3HFOA 2CT3A 3CC7A 2WJ9A 2RM4A 1JU5C 3P8HA 1F1BB 4C8QC 1H641 3VKGA 2DBMA 1OEBA 5LJ5j 3J80E 1Y0MA 3M55A 4XU0A 4HNUA 4C8QG 2YDLA 4C92F 5GAOm 1WHGA 1OPKA 4RTWA 5I2SA 2MI6A 4EOLB 2A0FB 2AHJB 5CYIB 5GJVB 1YJ9Q 1X69A 3CCUQ 4VUBA 3OS0A 1A0NB 2W99A 3I56T 5DQWA 5L23A 3TNIB 3PO3S 3CPWA 2VWFA 3LGLA 2DM1A 3M56A 3BE3A 5J26A 2V22B 1HSQA 1CSKA 1OU9A 3LX7A 2W2HA 4JRKA 1GRIA 3M54A 4L59A 3M0RA 4X9DA 3DDQB 1RAAB 5GJWB 2QEXT 3AHUA 2VGNA 1BI2A 5BNJB 1H4LD 1NPRA 2HEQA 4QQ6A 3O0GD 3CMET 4F04B 4M7AF 1GCPA 2M0OA 3RNJA 4QW2A 3C12A 4E2FB 1IZ6A 2VC8A 2HD0A 2D0QB 3NHNA 3CCEQ 3EGDA 2QGGA 1XJWB 1M2VA 2G6FX 3UPUA 3QZ5B 4M78F 1O75A 3CCLA 1FMVA 4BI4A 4C8QA 2LVMA 4BE1A 2O01E 3G1JA 2X3XD 3M4GA 3G71A 4J5YA 4HLQA 1PKTA 2K9GA 4MZMA 3JCMh 1YP5A 2PK2A 3UATA 2B8AA 1F5QB 1OKWB 3MIAB 3OYCA 3QWLA 3VU3C 1ZUKA 2Y4XA 1B34A 5KYUB 4M7DB 2DBKA 2DZCA 4JRQA 4AKGA 4MZTA 1UNGD 2WHBB 2L89A 2OTLA 3REAB 4BCJB 3CMAA 1QQJA 1M90R 2L3RA 3D7SB 3C4SA 3PMTA 1TTHB 1OL1B 1VQ7A 1M3CA 2PNIA 2IW9B 1M9SA 3JB9H 3HPWA 4DBQA 4HT9A 3JAME 4R55A 4AKHA 1RAFB 3I56Q 1SRMA 2VXFA 1H1QB 2J7IA 3A8HB 2RD1A 1SKUB 2DJQA 4ZN1A 2B86A 1K8AU 2IN3A 3V7RA 3M53A 2ESWA 5EC7A 2ROTA 2RJEA 3CCST 2E6ZA 4BCGB 4BCPB 5CR2A 2QEXQ 3OYNA 2OTJA 2VV5A 3OYEA 2AZSA 1AZGB 4X9CA 1IO6A 3G4ST 2EBPA 2X4YA 3TSZA 4AFZC 2MF2A 2RHIA 3CMEQ 3MEUA 1M2OA 2DYIA 1VQNA 3VS0A 3CCMA 4DOVA 1AEYA 5HVYB 1BU1A 5DM7R 2PVGB 4FX3B 4NOYA 2IG0A 2ZZDB 3HKSA 2KRSA 2RI5A 4BD3A 2X1NB 1SHGA 3BHUB 4Y72B 2KY9A 3KFVA 2KBTA 5GANh 4EIKA 4M7DC 3MO8A 3LLRA 5CAIA 2VYTA 3MP8A 2RPNA 4M4ZA 1XTDA 4Z89A 1PG5B 1VQPT 3V7CA 1MMNA 2ZGWA 1AD6A 1GCQC 4B9XA 2E70A 3M0SA 3BLRB 4J9BA 1HXDA 4M7DG 2O9VA 3QWYA 3S3OA 4NC6A 2BS3A 5CQYA 1JJ2S 1YBYA 1KK7A 1Q86C 1WHHA 1M30A 2E41A 2GGRA 1R77A 4PFPA 5GMKl 2FPEA 2CZ1B 4JJDA 1VQ8T 2BE7D 3IQLA 3H0HA 1PKSA 2O9SA 2LX7A 5IXBA 1YJNA 3JB9G 3E9FA 2BTTA 1AT1B 3DLMA 4A4GA 3EHQA 3TN8B 1NLOC 3EG3A 3QHRB 1EZZB 1WHMA 1XNIA 1VQLT 3CCVA 2G3RA 1TH7A 2K2VA 2X4JA 1Q7YU 2HDAA 2OAWA 2WMBB 2A7YA 1QWEA 3A8LB 4JLGA 3ER0A 4JX5A 3L1AA 1VQKA 4D8KA 2HBWA 3TVTA 4PFOA 2OI3A 2A36A 2K57A 4NSTB 4J9IA 3VKHA 2HQXA 2QA4A 2H3JA 1H92A 3CCSQ 2W9ZA 3S3NA 1Q81R 3K7AM 3CC4A 5KYUA 3KXTA 4M7DA 1SF9A 2JVVA 4M77B 3OS2A 3EJ1B 2E3IA 1OV3A 1IXDA 3VKIA 1KC8R 5J39A 3G4SQ 4KUDK 5LJ5h 5KYXB 2JT4A 2ENMA 1GCQA 1BU2A 2MPXC 1ZBXA 4LXCA 1WXBA 5GAN6 3OS5A 1KJWA 4JLIA 1VA7A 4FL6A 2DE0X 2DEUA 3AT1B 4CC4B 3PNWC 1KD1C 1WQWA 4LDVA 1Y07A 4GY5A 1VQ4A 3X25B 1M5Q1 4ZN3A 2C0OA 2DXBB 4BCIB 5FU7B 2L8DA 2OX7A 4EMGA 1GBRA 5EG2A 1AISB 2KSSA 2CP7A 1I81A 4M75F 1N8RC 1CKBA 2FPFA 3LQ5B 4F6SB 2LQNA 2DD5B 1VQPQ 2JUFA 4FCYA 2EW3A 1NJIU 3KHIA 5GAN7 2C5XB 5C6SA 4BE2A 1K73C 2DETA 2DXCB 3RMQA 2J05A 2COWA 5IDNB 4CC2A 4KGZB 3RIRA 5LJ3e 1VQ8Q 3EH1A 2EYZA 4CC3A 1AD5A 2EJGA 4E7IA 2F1LA 3DL1A 4HVVA 4MDWA 4F7UF 3NGPA 2ZZDA 1W1FA 1VQLQ 1PRMC 4M77E 1OI9B 4RCBA 4D8DA 2ED0A 2RB6A 4EC9B 1Y96B 1ZX6A 4J7IA 3OQ5A 5A0GA 1N27A 4M77C 5FWCA 4E7HA 4YC3B 3M0PA 3L2ZA 2GCXA 2V8JA 1BKBA 4KUIA 5GAMh 1IRXA 4Y92A 1K9MR 4M77G 2Y90A 3CD6A 3TSWA 1M1FA 2QG9B 4C92D 1TG0A 2RQUA 3CC2T 1PC0A 3RMSA 3CCRT 4IURA 3JB9I 1R0CB 1K9AA 2QQ8A 4CFMB 1ZUYA 2K5LA 4BCKB 2R7GA 1VIEA 1D1BA 2DXUA 2HQEA 3MI9B 3TU4K 3L2VA 2RQTA 3QIIA 2Y4YA 2IW8B 1PCXA 2AZVA 2NUPB 1IGQA 2K6DA 2DXTA 3GLXA 5CQXA 2XICA 4PJOG 4ME7A 5ACBA 4HCZA 2XMFA 3MPUB 4FYVB 3PTAA 5LJ3f 1W2BS 1ZA1B 4C0FA 4RG2A 2DTIA 5IHYA 3S6WA 4BACA 1X27A 1LOJA 1WPYA 4M7AD 4DQ2A 2VXEA 3NTKA 4BUGA 4QQDA 1AVZC 4MIMA 3RDVA 2GNCA 3VRYA 1FINB 2BS2A 2JW4A 3I55A 4OGEA 5A0LA 2PTKA 4CXAB 5ECAA 1R8OB 2QQ9A 5AT1B 2DIQA 3QYEA 1WNLA 3BLHB 4EOIB 2DL7A 3INZA 4M77A 1OQKA 2JXBA 4YOOA 4M78D 3EFSA 4I3ZB 1TUDA 3CPFA 4E7KA 5KYXA 1VQMA 2FPDA 5GAN8 2CCIB 1UGSB 3EGUA 3QHWB 4UC4A 2QK0A 2G77A 2JMCA 4C0GA 5DQVA 4E7SA 2FYKA 3QWXX 2DXBA 2IPOB 2E12A 1JEGA 2F2WA 4C0ZA 3OA6A 4MFDA 2AKLA 2K5FA 4XTXA 1W6XA 3X26B 1AWXA 1H3HA 3B57A 1VQ6T 2DD5A 1FMKA 1Y71A 1QLYA 4BDYA 3CCJA 3FRNA 5GMKi 1WDXA 4O5VA 2YRCA 4TTHA 4J8OA 1ABQA 5D6YA 4HL4A 2DXCA 2CREA 2FL7A 1K0SA 4LE9A 3CC2Q 2R5MA 3CCRQ 1ACMB 1BIBA 2NYSA 3JCMQ 4C5GA 1QCNA 2FZKB 4M7AB 2LW4A 2GTOA 4N0AC 4RCCA 1VIFA 1JJ2A 2K3BA 3CCRA 1H28B 4LDUA 5EFQB 1YWOA 4DBHA 2EGCA 4BCQB 4HNTA 4FSXA 2JOYA 4BI3A 2KROA 3ZEHA 1IHWA 1Y96A 1MV0B 3NDQA 4AI6A 1U06A 4M78B 4F7SB 1OPLA 2DRKA 1ZUUA 2YSQA 5J3BA 1YIJT 1YITA 2IVWA 1T3LA 4PLIA 5A0DA 5LJ3j 4QVCA 4C92E 5GAMf 2O2OA 2K3XA 4OGCA 1OULA 2X51A 1VQOA 2LZ6B 3WXMB 1I8FA 3BDUA 4XTZA 3GNFB 3MY1B 4FYXB 3QXEB 4C92C 3CEYA 5IHIA 2XHCA 2VASA 1QKXA 2KGTA 1I0CA 1PHTA 5M9OA 1QVPA 4A4HA 1UE9A 4LDXA 2NUPA 2EQUA 1UEBA 1OI1A 3MEVA 3EG2A 2F2CA 2EYXA 3JRZA 2CP3A 2KRMA 2DF6A 4BCNB 4IUUA 5D7UA 1Z9QA 1EIFA 4YOSA 2K7AA 4WF2A 1VYWB 2KMGA 4ELZC 4A4FA 2RMOA 1X6GA 5HNBB 2QTVA 3TNWB 4M7AE 2M0YA 2KAFA 1PSEA 2MOXA 3VJPA 3TCJA 5CKEA 5GMKj 2UZLB 4N0AA 2CS7A 3SHWA 2CJMB 1UGRB 3CXCS 4M7AC 3X20B 2DLPA 2BKDN 3EIDB 4HCBA 1PD1A 2DTHA 5FU6C 1R0BG 1VQ6Q 1HJDA 2ZPHB 2K3YA 4MZPA 3HB9A 3VS1A 4M78E 2F69A 1YCSB 1BB9A 5IHNA 3UDCA 1WHLA 2XDPA 3PE0A 2PK9B 1YJ9A 4M78C 3CCUA 1RUWA 3OW2P 1M4ZA 2FZCB 4OMNA 2BZXA 3KUFA 2NLUA 4CFWB 3OBWA 1TSFA 5C0MA 1M1KR 2X4WA 1QMCA 2QGFB 3C94A 2JS0A 1OZ2A 1JQQA 1I4K1 4FSSA 4C92A 1AHJB 5FGKB 1M8VA 3OMCA 1K8AC 1KG1A 2BS4A 1Q82R 4C8QF 2XG8D 2LT4A 4PNOA 1U5SA 4JZ3A 1M1KU 4G6LB 1AZEA 3RUXA 2D8JA 1YIJQ 5GAOr 3BG5A 2C4GB 3RKXA 3BHTB 4HVWA 1QVGS 2DJZA 2C0IA 2RJFA 3S3MA 1CKAA 5FLXE 1G5VA 2FVUA 4YTLA 2RA2A 2DNUA 2KYBA 4FYYB 3CCEA 2O4XB 5KE3A 5GAMj 3GNGA 1X75C 1JJ2P 4M7AA 3GOXA 1RL2A 4JPBW 4XQ3A 1VYUA 4M75D 4IUQA 2FRYA 3JCMP 2LQ8A 1WJSA 2H3EB 4JRIA 2B9RA 2ZAEA 3M0QA 5GAOl 1UJ0A 4CFUD 4J7FA 1WHKA 1N6AA 2P84A 3NPFA 4M78A 4BCMD 3L42A 4EOMB 1IHVA 1MMDA 4OMOA 3QJ6A 1N9SA 2PU9B 4E6RA 5HK0A 1QW1A 3META 3OYBA 2KK4A 4OGRB 3I9QA 3URGA 1WA7A 3JCMJ 1UNLD 5I22A 1WLPB 1W70A 2DFUA 3DTOA 1BI0A 3OSVA 4RTZA 2UUEB 1YI2T 1H1PB 2JS2A 4PKCC 5GMKm 2HZYA 2EVRA 1G3NC 1U1TA 4R0KA 5KYYB 2DA9A 1E6HA 1M90U 2EFIA 1Q7YC 2XI9A 4PLLA 2BZYA 5GAN5 4OF1A 2JM9A 4J6YA 3U23A 3I56A 1W4SA 3JCMg 3OW2S 1JSUB 1H8KA 1RAIB 2IVXA 4FYWB 1V76A 4HVUA 2EJ9A 1UHCA 1Y7XA 2VB6A 1X01A 3M4YA 4N4HA 2QEXA 3LGFA 2DL5A 1JXOA 4ESRA 2QAZA 4KGXB 1YN8A 1K0XA 1N5ZA 2YLBA 3OYGA 4M75B 3DDPB 3CMEA 3MY5B 4XU2A 2ZCFB 2HKNA 5GAN2 3VS6A 1H1SB 3BLQB 3T9NA 2DRMA 3TQ7P 3REBB 1WJQA 3LWHA 3LH5A 1IGUA 2LX9A 1MMAA 1WHJA 3A8GB 4BCMB 4E7ZA 3JCMW 4WCIA 4Z02A 1S72T 3EAEA 2VKNA 1H24B 2RI2A 2FO0A 2CP0A 1RADB 2W0ZA 1H26B 2KR3A 4ZTFA 3L2UA 4ELLA 4F7UB 4CI0C 2RN8A 1UHFA 4ZNXA 2QDLA 1NJIC 1SEMA 1X2QA 4MMLA 2JNGA 5FWBA 3HRUA 4HCKA 3PIPA 1QMZB 5LJ3h 3M57A 1RAGB 3J7AF 2CZ7B 2X9HA 4F6UB 1YJWT 1I5OB 2IW6B 2ZPGB 3RESA 3RERA 5AYFA 1OZ3A 2O4XA 3PGGA 3BG3A 5GANg 4HCCA 2ZPIB 2HL5C 1YI2Q 2CSQA 4M75E 3TW6A 2C6TB 2F2XA 2YT6A 4CFNB 5CVIA 4M75C 1KHCA 3HP9A 1SSFA 1HK9A 1YI2A 2YUNA 4KGVB 1FVVB 3RBBB 1XOVA 1M27C 1KFZA 1BIAA 2V1RA 4ROCA 3H6ZA 2SEMA 1TS9A 1RACB 3QYGB 3JCMc 1FWZA 3CCSA 1LCKA 3RKYA 1NZ9A 1W2BP 5GMKh 2YWWA 3M9QA 2RHXA 1Q81U 1WGSA 2QI2A 4XU3A 4B9WA 3VS7A 2PUKB 2RQWA 3ZBDA 3G4SA 4F7UE 6AT1B 1FKMA 3HO8A 1JO8A 1KC8U 1TWBA 3QZ9B 3FDRA 3R6OA 2FG0A 5I21A 4JJCA 1B07A 2LJ3A 2R58A 4QQGA 1Q86R 5KYYA 1VQ9T 3QO3A 5KYWB 3LW5E 1MNEA 3HHTB 1S72Q 4AMCA 1TD6A 1JSTB 1C9BA 2JTMA 2M9UA 2BKZB 2P4TA 2KT8A 5D6XA 2XU8A 2WSEE 3UA7A 4JX6A 1WQ7A 3UF4A 3JV3A 1VQPA 1G3TA 2YRDA 2JM8A 1KQ2A 2YRVA 4BE0A 1G2BA 3X24B 1NLPC 4ELYC 4J9DA 1YCYA 4HA8A 2WACA 1LJOA 1GUXB 5LJ5g 4NL3A 4M75A 3LWIA 2KYMA 1SSHA 2IIMA 2RJCA 3QHSA 1TOVA 5DLQE 2LRQA 1VQ8A 5IN1A 2W10A 3G6ET 1YJWQ 4K11A 2DKGA 1VUBA 1WXUA 3BY7A 4DBFA 2EKHA 1VQLA 4J9EA 1G3SA 4F7LB 4BB7A 2SRCA 3DKMA 5CKDA 1H25B 4ELJA 5GAN4 1BCOA 4CRLB 4LD9K 1SG5A 3JCMd 2ZPEB 2BUDA 4F7UA 4C5EA 1KD1R 4XAXB 1N4MA 3UA6A 1GY3B 5KE2A 1K9MU 1PRLC 4JS4A 1YHQT 3M5AA 4FIBA 5L8RE 3VRZA 4EPCA 2CH4W 5EJCA 3OYDA 2DAQA 4BY1X 1N8RR 4OMFB 1SHFA 8ATCB 2LT1A 4PK4A 3VS4A 1TFBA 4ZGEB 3JSCA 2RNAA 2ECZA 5D6WA 1I1JA 2BIVA 1AWOA 4PJJA 1JBMA 1U3OA 9ATCB 2JGZB 2L3PA 1K73R 2L2PA 4RTYA 2KEAA 2MYSA 2AKKA 1NM7A 1JXMA 4C8QD 2JZ2A 3V8KA 2DL8A 1VQ9Q 3VYGB 3RR6A 3TEEA 1VINA 3H4CA 3FJ5A 3HBLA 2K79A 1BBZA 4EOOB 1MNDA 2P0KA 3HZJA 2P4RA 3GBQA 4EMHA 1NPPA 3TW7A 3KBGA 1GFCA 2FHDA 2RI3A 5CKHA 2LCLA 1VQ9A 4IKFA 3A5ZB 2NWMA 2DILA 3MJXA 4F16A 3L2QA 1VQ5T 3QKJA 3OW2A 1H27B 3GF5A 4PJOF 5KCHA 4YOZA 1WZOA 2LC4A 4J6WA 2G9XB 3R6NA 4N4GA 4PJLA 4C92B 3EG0A 2QQSA 3EHRA 3A1PA 4AT1B 1WX6A 1UFFA 1ABOA 3CXCP 3G6EQ 5GAOp 2DVJA 2PJQA 2NUTB 4M6VA 2C0TA 3EH2A 3OYLA 2F5KA 4IMYB 5GANd 5KYWA 4NS5A 5IXFA 3O8VA 2ED1A 4BCHB 3PFSA 1UNHD 2QF7A 3I5SA 2M51A 3EGXB 4RTUA 3G6EA 2HCKA 2L3SA 2QTXA 2W9FA 3THKA 1AOJA 4RODA 3ZFJA 2YLCA 1E7PA 1WFWA 4MMKA 4BXXX 3HRSA 4V2SA 4LUDA 3V7SA 1D3UB 1T3SA 1E6GA 1YHQQ 5FU6B 4DA4A 4R56A 4BDZA 3CC2A 1M8MA 1GUXA 4J9HA 1YNZA 2O31A 5I11A 2DZ9A 1UTIA 3M0UA 4PJMA 3I35A 5IDPB 1BI1A 1N9RA 4AFUC 1QVFS 5FROA 3QUIA 5HBHB 1QVGP 4PJNA 1SRLA 4Y91A 2UZBB 1HD3A 1OL2B 3G33B 2DEQA 5HK3A 1Z9ZA 1PD0A 2ABLA 3CCLT 2CSIA 2GBQA 3L2RA 2DX1A 2C06A 1LPLA 3G71T 1KIKA 4JJNK 2JTFA 3TREA 2XDDA 4C92G 1B3QA 1JRIA 1P5EB 5FRMA 1OOTA 4KH1B 2D1XA 3QYBA 3RKWA 2QASA 2V26A 2JJ9A 1ZP2A 1VQ5Q 2CGHA 2NUZA 4C5HA 2WSFE 2YXYA 2EGEA 5LJ5d 2LMJA 1TUCA 1BYMA 3CQTA 5KH6A 1J3TA 2PUOB 2QQBA 4OB3B 7AT1B 4BCFB 4CFVB 1OX8A 3M59A 2CKKA 5CKFA 5LMKB 4AG1C 4LDYA 1NEBA 4C8QE 2MMPA 2RH2A 3LYIA 1UGQB 2OTLT 4B6MA 3JCMX 1BK2A 1W98B 3VS2A 3OBYA 3CMAT 2DYBA 4C0DB 1VYVA 2QQRA 3VYGA 2DMOA 1VQ7T 1NG2A 4OP0A 2QGSA 4M7AG 2DPPB 3M58A 1D1CA 2P0PA 2MIOA 3OMGA 3EFOB 3OS1A 1VQ6A 4IUPA 4LN2A 4FW2A 1D09B 2GQVA 1Y57A 2ZPBB 3DOGB 3GIBA 4OB1B 4AFSC 1RLPC 4XTYA 4MFEA 1NE8A 2PZ1A 2RHYA 3VYHB 2EQKA 4M7DD 4M78G 4RTVA 2WIHB 1I5LA 2PMIB 2WIPB 2OTJT 2I40B 1H3ZA 2UZEB 1ZSZB 1BI3A 4IIMA 1M90C 2RQRA 3HFNA 4Z88A 2DERA 2CDTA 4JS5A 5KYNA 4IUTA 3EOCB 2QDYB 4EC8B 4BBSM 4ZGDB 5HCKA 1ZSGA 2CZ6B 2HL3A 2LTOA 5HQ0B 3JCMb 1VQNT 2NUTA 3CCMT 3QBYA 4PFZA 1VYTA 4F7NB 2VGMA 3JB9D 2HQHA 4F70B 3MEWA 2EUFA 1D0XA 4BBRM 1UUEA 2QFZA 3EGXA 5HBEB 3C0CA 3HL8A 1Q82U 1NBEB 5GAMd 3VV0A 5L2WB 2F2VA 2KT1A 3A8OB 3FIFA 3VUBA 3CCLQ 1EX4A 4J9FA 1YIJA 1C6VX 4C5IA 2LJ0A 3G71Q 2HBPA 3O5ZA 3L2WA 5IH2A 2LNHB 2D0NA 5GAOq 1QP2A 4C0DC 1M3AA 4D6WA 3QSUA 2DL3A 3OYHA 2K4YA 1FMWA 2K5IA 3QYHB 4IUVA 1YJNT 2KR6A 2E64A 2OJ2A 1KQSP 3QG1A 1D0YA 3M03A 4AKIA 2LDMA 3JCMV 4HKEA 3CCVT 4XTWA 1W2BA 2OTLQ 4F14A 1V29B 4QKUA 3CMAQ 3SEMA 1S1NA 2RHZA 3CBOA 3ZL7C 1DJ7B 3P8DA 2CH4A 2V1QA 3OB9A 1ZSZC 1VQ7Q 3QPHA 2LCCA 1VQKT 1UGPB 3DLLA 3POMA 4XTUA 2LP5A 1JOWA 2CUBA 2Z0WA 3PMIA 1K8AR 4BY7X 1UG1A 2CUDA 1G3YA 2XIDA 2X4XA 2I2LA 4RKUE 1PKDB 1URCB 2FB7A 4EOJB 5HY6A 4X1VA 1NYGA 4DEXA 2QA4T 4A4KA 2EGAA 3NTHA 1QCFA 3CC4T 1QLBA 4O6JA 3A8MB 2E4HA 4HNVA 4J9CA 2DIGA 2OTJQ 3TNHB
chains in the Genus database with same CATH topology
5I21A 4HNUA 3CPFA 3SWNB 4C8QG 4E7KA 1VQMA 4C92F 2R58A 5GAN8 2QDJA 4QQGA 2RHUA 5GAOm 1UGSB 5I2SA 2MI6A 1VQ9T 3QO3A 2AHJB 2LQKA 3LW5E 4UC4A 4VUBA 2G77A 3OS0A 3HHTB 2M1HA 4C0GA 3I56T 2FYKA 3FEOA 2JTMA 2M9UA 1WJRA 2EWNA 2P4TA 5D6XA 2DXBA 2XU8A 4FT4A 2WSEE 1VQ4T 4JX6A 3CPWA 1Q81U 2E12A 1WQ7A 4JUVA 1VQPA 1OYXA 4C0ZA 1G3TA 3LGLA 3OA6A 3M56A 4MFDA 5J26A 2K5FA 4XTXA 3SD4A 4A4EA 1KQ2A 2YRVA 1Q81C 5I2MA 4BE0A 3X26B 3LX7A 4JRKA 3X24B 2KQWA 3M54A 4L59A 1VQ6T 2DD5A 4X9DA 4ELYC 1YCYA 2QEXT 3AHUA 4HA8A 2VGNA 1BI2A 4XTVA 1Y71A 2WACA 1LJOA 4BDYA 2EAYA 1NPRA 3FRNA 5GMKi 5LJ5g 3CCJA 1KC8C 4O5VA 4KBMB 4M75A 4QQ6A 4NL3A 3LWIA 2EKOA 4J8OA 4M77D 2RJCA 3CMET 3QHSA 5D6YA 4HL4A 2DXCA 5DLQE 2EJFA 3JCMe 2FL7A 2LRQA 1VQ8A 4M7AF 5IN1A 3UT1A 3G6ET 2R5MA 4HT8A 2M0OA 4QW2A 4J6XA 3C12A 3SB2A 2DD4B 1BIBA 1IZ6A 2DKGA 2VC8A 3QDRB 3JCMQ 1VUBA 3OYAA 4ATOA 2HD0A 3BY7A 1VQLA 4C5GA 4M7AB 2D0QB 1G3SA 2E65A 4RG8A 4N0AC 4RCCA 1VIFA 1JJ2A 2PVDB 4FU6A 4BB7A 3OYJA 4LDWA 3CCRA 3DKMA 4LDUA 3QZ5B 3UPUA 4M78F 1O75A 5CKDA 3CCLA 4ELJA 4BI4A 4C8QA 5GAN4 4II1A 2LVMA 4BE1A 1KQSS 4HNTA 3OYIA 4FSXA 2O01E 2JOYA 4BI3A 4LD9K 3JCMd 3ZEHA 4PJOD 1ZQ1A 3M4GA 1QVFA 2ZPEB 1Y96A 2BUDA 4F7UA 4C5EA 3G71A 4AI6A 4M78B 4J5YA 4XAXB 4HLQA 2CZ0B 5J3BA 5KE2A 4MZMA 3JCMh 1K9MU 1XQHA 3SWNC 2DO3A 4JS4A 1YHQT 4M7DF 1YIJT 3M5AA 2IVWA 4FIBA 4LD6A 1YITA 4PLIA 5A0DA 5LJ3j 5L8RE 2B8AA 4QVCA 4EPCA 4FT2A 2OAUA 4C92E 2DTOA 5GAMf 3OYCA 3QWLA 5EJCA 2K3XA 3DB4A 4RMOA 3P8BB 2DAQA 3ASKA 4OGCA 3VU3C 3OYDA 1VQOA 3CD6T 3WXMB 2Y4XA 3N5BB 1I8FA 4OMFB 3BDUA 4XTZA 3GNFB 3QXEB 1B34A 2GFUA 2LT1A 2PVOB 2DZCA 4P5NA 4TVRA 4C92C 4EDUA 4M7DB 5DLOA 3CEYA 4ZGEB 3JSCA 4JRQA 2XHCA 3CBPA 5D6WA 4AKGA 2BIVA 3WVDB 1JBMA 4MZTA 2L5QA 2L89A 4Z6YA 4M75G 3JB9F 2V8IA 5M9OA 1QVPA 4A4HA 4LDXA 2OTLA 3BG9A 2EQUA 3JCMf 3CMAA 1UEBA 4KULA 2L3RA 1OI1A 3MEVA 4C8QD 2JZ2A 3V8KA 3C4SA 3JRZA 3PMTA 3SFMA 3VYGB 1LNXA 1VQ7A 4XU1A 4IUUA 3TEEA 1M9SA 2M16A 4CRIA 3H4CA 5CCAA 3JB9H 1EIFA 3HPWA 4HT9A 3HBLA 2EQJA 3JAME 4R55A 1K9MC 4AKHA 2P0KA 3HZJA 4EMHA 4WF2A 1NPPA 4ZTJA 2KMGA 3TW7A 4BY6B 3KBGA 2VXFA 4ELZC 5LJ3g 4A4FA 3DB3A 3E9GA 2FHDA 3A8HB 2RD1A 5FRNA 4M7AE 2RI3A 1MHNA 5CKHA 3FLGA 2LCLA 2KAFA 4ZN1A 1PSEA 1VQ9A 3VJPA 3TCJA 1K8AU 5CKEA 3C95A 4OB0B 4IKFA 3A5ZB 5GMKj 3CXCA 4N0AA 3V7RA 3M53A 2CS7A 1UGRB 5GANe 3CXCS 4M7AC 4Y28E 4L6V5 3X20B 3L2QA 1VQ5T 3QKJA 2RJEA 2BKDN 3OW2A 3CCST 3GF5A 2E6ZA 4PJOF 5KCHA 2DTHA 4F7UG 5FU6C 4XK8E 4HCBA 2LC4A 4J6WA 5CR2A 1QP3A 2ZPHB 3OYNA 2K3YA 4N4GA 2OTJA 2VV5A 4MZPA 4C92B 3OYEA 3I55T 4X9CA 3HB9A 2QQSA 3G4ST 2KDSA 2XD0A 4M78E 2F69A 2X4YA 4PJOB 2MF2A 2RHIA 3UDCA 5GAOn 2EQMA 2XDPA 3CPWS 3MEUA 1Q86U 1YJ9A 4M78C 5GAOp 3CCUA 1VQNA 3SWNA 3CCMA 3X28B 4DOVA 1JB0E 1S72A 1M4ZA 1VQMT 4M6VA 5DM7R 3OYLA 2PVGB 2NLUA 2F5KA 3KUFA 3OBWA 4NOYA 5GANd 5C0MA 2IG0A 2X4WA 3QJYA 4NS5A 2ZZDB 2RK1A 3HKSA 3O8VA 3C94A 2RI5A 2D9TA 3PFSA 1OZ2A 2EIFA 4BD3A 5CK9A 2QF7A 4EMKB 1I4K1 5HKCA 3E19A 4C92A 5KCOA 1AHJB 2KY9A 3G6EA 1D3BB 1M8VA 2QTXA 3H8ZA 5GANh 3OMCA 1K8AC 4M7DC 3MO8A 3LLRA 1KQ1A 1MGQA 4QVDA 3ZFJA 5CAIA 1KG1A 1IREB 2VYTA 2YLCA 2BS4A 3MP8A 3V8JA 1XTDA 1E7PA 4C8QF 2XG8D 4MMKA 4PL6A 3V7CA 3MCAB 3HRSA 1VQPT 2LT4A 4V2SA 2ZGWA 3BDLA 4PNOA 1M1KU 4B9XA 4Q5WA 2E70A 3V7SA 4M7DG 1HXDA 3S3OA 3RUXA 4NC6A 1G3WA 2BS3A 4ZTFA 5FU6B 4DA4A 4R56A 5CQYA 4BDZA 3CC2A 1QVGA 5GAOr 5GAN3 3BG5A 5DY9A 3RKXA 2QQAA 1JJ2S 4A54A 1QVGS 1YBYA 3CCJT 1YJWA 2DJZA 2RJFA 1Q86C 3S3MA 5FLXE 1G5VA 2E41A 2DZ9A 2FVUA 4YTLA 5GMKl 2RA2A 4OB2B 5GANf 1BI1A 1N9RA 2CZ1B 1VQ8T 3CCEA 4BY6C 2MWPA 5CO7A 2O4XB 5KE3A 2DD4A 5GAMj 3SDZA 5FROA 1YJNA 1QVFS 3GNGA 3QUIA 3JB9G 3E9FA 3DLMA 4A4GA 2CYZB 3GPLA 3J81E 4E7LA 1X75C 4M7AA 3GOXA 1XNIA 1RL2A 4XQ3A 1VQLT 3PIOA 3CCVA 2RO0A 4M75D 4IUQA 2G3RA 4Y91A 3JCMP 1TH7A 2DEQA 2LQ8A 1WJSA 4LOCA 2K2VA 2X4JA 5HK3A 1Q7YU 5LJ5e 4JRIA 4PJOE 3CCLT 3NFCA 2PQWA 3WVEB 2R5AA 3MHXA 3GP8A 2EYQA 5FU7C 2A7YA 4J83A 4QVZA 5GAOl 3A8LB 4JLGA 3L2RA 3ER0A 1KD1U 4JX5A 4J7FA 3L1AA 2GF7A 5GMKe 1VQKA 2C06A 1N6AA 4PJOC 3BFMA 2MWOA 4M78A 3CCQT 3G71T 3L42A 4JJNK 2JTFA 2HAXA 3QJ6A 3TREA 2XDDA 4C92G 1P92A 1N9SA 1JRIA 5FRMA 2PU9B 5HK0A 2K57A 1QW1A 3META 4M77F 3OYBA 3HSBA 2KK4A 1YITT 1N8RU 3QYBA 3VKHA 3RKWA 2HQXA 3URGA 3HRTA 2QA4A 2H3JA 4E7JA 3JCMJ 2CGHA 4C5HA 3S3NA 2WSFE 3CC4A 4EMKC 5GAMg 1VQOT 5LJ5d 3KXTA 4M7DA 1BYMA 2JVVA 4M77B 3OS2A 3MP6A 5KH6A 4NL2A 1BI0A 3OSVA 1FXXA 3VKIA 1K73U 2PUOB 2QQBA 5J39A 4KUDK 1YI2T 5LJ5h 4OB3B 4PKCC 5GMKm 1U1TA 1ZBXA 1M90U 1RI0A 2CKKA 3M59A 2EFIA 3OSSC 5CIUA 5CKFA 1Q7YC 2XI9A 4LDYA 4PLLA 4C8QE 2MMPA 2RH2A 3LYIA 1UGQB 3OS5A 5GAN6 2OTLT 4JLIA 3JCMX 4FL6A 5GAN5 4OF1A 4J6YA 3NTIA 3OBYA 4E47A 4JRPA 3PNWC 1ZHIA 3I56A 4C0DB 1KD1C 1W4SA 3Q1JA 2QQRA 2WSCE 3JCMg 3VYGA 3OW2S 1WQWA 4LDVA 1Y07A 4GY5A 4KT0E 3CC7T 3OYKA 3X25B 1M5Q1 3OY9A 1VQ4A 2GFAA 4ZN3A 1VQ7T 2DXBB 4OP0A 5FU7B 2L8DA 4M7AG 2DPPB 4EMGA 3M58A 2P0PA 2E5QA 5EG2A 2KSSA 2EJ9A 3MEAA 1I81A 1Y7XA 4M75F 1N8RC 3OMGA 2E10A 1X01A 3OS1A 4IUPA 1VQ6A 3CBMA 4BI8B 3M4YA 4N4HA 4JDSA 2QEXA 3LGFA 5LJ5f 2GQVA 2ZPBB 2DD5B 3GIBA 4OB1B 2JUFA 4ZGJB 1NJIU 4XTYA 4MFEA 3KHIA 1NE8A 2RHYA 2YLBA 3OYGA 3VYHB 4M75B 5GAN7 2EQKA 3CMEA 2E1HA 4M7DD 4XU2A 2ZCFB 2X35A 4M78G 2RK2A 5C6SA 4BE2A 1K73C 5GAN2 1I5LA 2DXCB 3RMQA 1U8RA 2OTJT 5GAMe 1H3ZA 3T9NA 1BI3A 4QSHA 1M1GA 1M90C 3HFNA 3UWNA 1WJQA 4PJOA 4JS5A 2DK3A 3OYYA 5IT9E 4JX4A 3PT9A 3LWHA 4IUTA 2LX9A 3G7ZA 3RIRA 5LJ3e 2QXFA 1UB4A 2QDYB 3A8GB 4BBSM 4ZGDB 3JCMW 1YJ9T 2CZ6B 3CCUT 2LTOA 1VQNT 5CKBA 4Z02A 3JCMb 2EJGA 3CCMT 3QBYA 4E7IA 2XDBA 2D6FA 1S72T 3EAEA 2VGMA 3DL1A 4MDWA 4A4KA 4F7UF 3JB9D 2HNIA 2XKOC 4MDXA 2ZZDA 3MEWA 5GANj 3JB9J 2E6NA 4C8QB 4M77E 2RI2A 4BBRM 4EMKA 2QFZA 1U1SA 4RCBA 1D3BA 2RB6A 3HL8A 1Q82U 3F70A 1Y96B 4J7IA 4DOWA 2V8KA 3OQ5A 3VV0A 1N27A 4M77C 4F7UB 5A0GA 5GAMd 4CI0C 3A8OB 3L2UA 4E7HA 3FIFA 3VUBA 1NJIC 3L2ZA 2GCXA 1YHQA 4M7DE 1YIJA 2V8JA 3FB9A 3EFRA 2VUBA 3BW1A 1BKBA 3FJPA 4KUIA 5LJ3d 4C5IA 5GAMh 4MMLA 2JNGA 3OYMA 2DVEA 2MAMA 4M77G 3FC3A 4N4IA 2HBPA 2Y90A 3VUZA 3L2WA 3HRUA 3CD6A 1M1FA 5A2QE 3V8LA 3PIPA 4C92D 5GAOq 1QP2A 5LJ3h 3M57A 1KQSA 3E1SA 3J7AF 2CZ7B 3CC2T 4C0DC 3RMSA 1B34B 1FX7A 4GLKA 4IURA 3LH0A 4D6WA 3JB9I 3CCRT 3QSUA 2QQ8A 1YJWT 2K5LA 3OYHA 3CCQA 1M1KC 2K4YA 2ZPGB 3RESA 1VIEA 2DXUA 3TU4K 2HQEA 1PSFA 3RERA 3L2VA 5AYFA 2K5IA 1OZ3A 2RJDA 2O4XA 3PGGA 3BG3A 3QYHB 3QIIA 3CCET 1O9SA 4IUVA 5GANg 2ZPFB 2Y4YA 1YJNT 4HCCA 2P0QA 2KR6A 1KHIA 2ZPIB 2E64A 3ME9A 2LNVA 4M75E 3TW6A 3QG1A 4A53A 2DXTA 3GLXA 4AKIA 5CQXA 1Q82C 2XICA 2LDMA 4PJOG 3JCMV 4HKEA 3OYFA 2JN0A 4ME7A 3CCVT 4XTWA 4FM4B 1W2BA 5CVIA 1V29B 4M75C 1KHCA 4HCZA 3HP9A 1SSFA 3PTAA 1W2BS 5LJ3f 4L5GA 1HK9A 2RHZA 1GXIE 4C0FA 3CBOA 2A3LA 1DJ7B 3P8DA 2XK0A 1YI2A 4RG2A 3OB9A 2DTIA 3MP1A 3S6WA 3QPHA 1XOVA 1BIAA 2LCCA 4BACA 3H6ZA 2F5TX 1UGPB 1LOJA 1WPYA 3DLLA 1VQKT 3QYGB 1X6OA 2VXEA 3JCMc 4XTUA 2KMTA 4DQ2A 3NTKA 4BUGA 4M7AD 1VQ5A 1FWZA 2KVQG 4X34A 3CCSA 3PMIA 5IAYA 4QQDA 1G3YA 2R57A 5LL6S 3RKYA 1NZ9A 2YHTA 4MIMA 4OVAA 2XIDA 5GMKh 3M9QA 2BS2A 3HFOA 3CC7A 2X4XA 2I2LA 4RKUE 2RHXA 3I55A 1WGSA 2QI2A 4OGEA 4XU3A 2WJ9A 4B9WA 2FB7A 2RM4A 2PUKB 3P8HA 5A0LA 3ZBDA 5HY6A 3G4SA 4C8QC 2QA4T 4F7UE 1FKMA 3HO8A 1R8OB 1H641 3QYEA 2DIQA 2QQ9A 3NTHA 1WNLA 3VKGA 3CC4T 3INZA 4M77A 1KC8U 1QLBA 4O6JA 3A8MB 5LJ5j 3J80E 3QZ9B 4HNVA 3FDRA 4M78D 3M55A 2DIGA 3EFSA 4XU0A 3R6OA 3CMAT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDY B;  3A8G B;  2CYZ B;  4ZGD B;  1UGS B;  2CZ6 B;  2AHJ B;  3LW5 E;  2ZZD A;  3HHT B;  3VYG B;  3WVE B;  2DXB A;  2WSE E;  3A8L B;  3A8O B;  3A8H B;  1PSE A;  4OB0 B;  3X26 B;  3X24 B;  2PU9 B;  2DD5 A;  1UGR B;  4Y28 E;  4L6V 5;  3X20 B;  4XK8 E;  1QP2 A;  1QP3 A;  2ZPH B;  2CZ7 B;  2WSF E;  2DXC A;  2ZPG B;  1PSF A;  2PUO B;  2DD4 B;  3QYH B;  4OB3 B;  2ZPF B;  3X28 B;  1JB0 E;  2ZPI B;  2D0Q B;  2PVG B;  1UGQ B;  2PVD B;  2ZZD B;  3QZ5 B;  2WSC E;  4FM4 B;  3VYG A;  1V29 B;  4KT0 E;  1AHJ B;  3X25 B;  2DXB B;  2O01 E;  1GXI E;  1DJ7 B;  2DPP B;  2ZPE B;  1IRE B;  2CZ0 B;  1UGP B;  3QYG B;  2ZPB B;  2DD5 B;  4OB1 B;  5L8R E;  4ZGJ B;  4RKU E;  3VYH B;  2ZCF B;  2PUK B;  3QXE B;  2DXC B;  2PVO B;  4ZGE B;  4OB2 B;  3A8M B;  3QZ9 B;  2CZ1 B;  3WVD B;  2DD4 A; 
#chains in the Genus database with same CATH topology
 1RAE B;  4EOK B;  3SWN B;  2J6K A;  1RI9 A;  2QDJ A;  2WFY B;  2RHU A;  2J06 A;  3H0I A;  2LQK A;  1XO2 A;  4EOS B;  1VQN Q;  3CCM Q;  4JJB A;  2M1H A;  4DEY A;  3FEO A;  1WJR A;  2BPM B;  2EWN A;  4FT4 A;  1VQ4 T;  4JUV A;  1KSW A;  1OYX A;  2GQI A;  4CFU B;  2QYZ A;  3SD4 A;  4A4E A;  3EFO A;  5I2M A;  1Q81 C;  1OGU B;  2KQW A;  4WTO B;  1ZLM A;  2BE9 B;  4XTV A;  4M7D E;  2EAY A;  1KC8 C;  4KBM B;  4KRC B;  2EKO A;  4RTX A;  3CPW P;  4M77 D;  4LUE A;  3M0T A;  4II5 B;  3JCM e;  2EJF A;  4KH0 B;  3UT1 A;  1UDL A;  1RAH B;  1ZSZ A;  2GTJ A;  4HT8 A;  3PVL A;  4J6X A;  2ATC B;  5FW9 A;  2DD4 B;  1AWJ A;  2CT4 A;  1C1A A;  1RAB B;  3QDR B;  3SB2 A;  3OYA A;  4ATO A;  4OR5 B;  2C5N B;  2PHG A;  2E65 A;  1IB8 A;  4RG8 A;  1MMG A;  1UEC A;  3BHV B;  2PVD B;  2YUO A;  1OIY B;  1PM3 A;  4FU6 A;  3OYJ A;  4LDW A;  1YJN Q;  3VS3 A;  1YWP A;  4II1 A;  1KQS S;  2JMA A;  3OYI A;  3CCV Q;  1Q7Y R;  1O9K B;  4PJO D;  1X2K A;  1ZQ1 A;  1QVF A;  1K1Z A;  1X6B A;  1H1R B;  3A98 A;  2CZ0 B;  2KXC A;  4EON B;  1XQH A;  3SWN C;  2DO3 A;  2I53 A;  1G83 A;  4M7D F;  4LD6 A;  5CEI B;  1VQK Q;  1K4U S;  4FT2 A;  2OAU A;  2DTO A;  3DB4 A;  4RMO A;  3P8B B;  2BZ8 A;  3ASK A;  3CD6 T;  3N5B B;  4A63 B;  2GFU A;  2PVO B;  4TVR A;  4P5N A;  5HBJ B;  2WPA B;  2EPD A;  4EDU A;  5DLO A;  2E5K A;  3CBP A;  2QA4 Q;  2HKQ B;  4JZ4 A;  3WVD B;  1LVK A;  2W96 A;  3HTR A;  3H9N A;  3CC4 Q;  2L5Q A;  4Z6Y A;  4M75 G;  2L0A A;  2V8I A;  3JB9 F;  3BG9 A;  3JCM f;  1UJY A;  4KUL A;  2KE9 A;  2KNB B;  1EFN A;  3SFM A;  1LNX A;  4XU1 A;  2M16 A;  4CRI A;  5CCA A;  1QCO A;  8AT1 B;  2EQJ A;  1K9M C;  4Z8A A;  4ZTJ A;  2EQI A;  4BY6 B;  2DME A;  5LJ3 g;  3DB3 A;  3E9G A;  5FRN A;  1VQ4 Q;  1MHN A;  3FLG A;  3C95 A;  4OB0 B;  2A08 A;  4FW1 A;  4ANJ A;  3CXC A;  5GAN e;  4Y28 E;  4L6V 5;  2C5V B;  1E9H B;  2AT1 B;  4F7U G;  1PNJ A;  4XK8 E;  1NJI R;  1QP3 A;  3I55 T;  2RQV A;  1OIU B;  2KDS A;  2XD0 A;  5ICP B;  4PJO B;  1WXT A;  5GAO n;  3ULR B;  2EQM A;  3CPW S;  1SPK A;  1Q86 U;  3SWN A;  1D1A A;  3X28 B;  1JB0 E;  1S72 A;  4BCO B;  1VQM T;  1T0H A;  2J6F A;  3QJY A;  2RK1 A;  2WEV B;  1PWT A;  2D9T A;  2EIF A;  4F17 A;  5CK9 A;  4EMK B;  1JKW A;  5HKC A;  3E19 A;  5KCO A;  4KRD B;  1GH6 B;  1D3B B;  3H8Z A;  1M3B A;  4OMM A;  1KQ1 A;  1MGQ A;  1TUG B;  4QVD A;  1IRE B;  2EYY A;  3V8J A;  1OU8 A;  4PL6 A;  3MCA B;  3PVQ A;  3BDL A;  4Q5W A;  1V1C A;  1T0J A;  4OMQ A;  1G3W A;  1NEG A;  4DBR A;  1QVG A;  5GAN 3;  5DY9 A;  2AIR B;  2QQA A;  2O88 A;  2CP2 A;  4A54 A;  1YJW A;  3CCJ T;  1GL5 A;  2H8H A;  3CD6 Q;  4OB2 B;  2DL4 A;  5GAN f;  4BY6 C;  2MWP A;  5CO7 A;  2DD4 A;  3SDZ A;  2KI7 A;  2CYZ B;  3GPL A;  2LQW A;  3J81 E;  4E7L A;  1QWF A;  3EG9 B;  3PIO A;  2RO0 A;  2HSE B;  1AWW A;  2LJ1 A;  1GFD A;  2KRN A;  4LOC A;  5LJ5 e;  4PJO E;  1QVF P;  1YFN A;  3NFC A;  2PQW A;  3WVE B;  2R5A A;  3MHX A;  4OML A;  4EOQ B;  2EYQ A;  1O9K A;  4J83 A;  5FU7 C;  4QVZ A;  4AFQ C;  3GP8 A;  1KD1 U;  1G8X A;  1I07 A;  2GF7 A;  5GMK e;  4GLM A;  4PJO C;  2J6O A;  3BFM A;  2MWO A;  3CCQ T;  4LNP A;  2HAX A;  1P92 A;  2LCS A;  4M77 F;  3HSB A;  4UN0 A;  1YIT T;  1N8R U;  1K76 A;  2HSP A;  1E7O A;  3HRT A;  4CC7 A;  4E7J A;  2EYW A;  3DJB A;  2COZ A;  2A28 A;  4EMK C;  5GAM g;  1VQO T;  3MKD A;  2CP5 A;  2AK5 A;  3MP6 A;  4NL2 A;  1KXU A;  3I55 Q;  1FXX A;  3H41 A;  2C5O B;  3EG1 A;  1K73 U;  2VVK A;  3E2U A;  1OKV B;  3RGF B;  4EOR B;  1WIE A;  1RI0 A;  2HMA A;  3OSS C;  5CIU A;  4HXJ A;  3QDF A;  3NTI A;  4E47 A;  4JRP A;  1VQM Q;  5I5Z B;  1ZHI A;  4BCQ D;  3Q1J A;  2WSC E;  1TU0 B;  1NYF A;  1OX9 A;  4KT0 E;  2WMA B;  3OYK A;  3CC7 T;  2M02 A;  3OY9 A;  2GFA A;  2FZG B;  1B7T A;  2E5Q A;  3MEA A;  2K2M A;  4RTT A;  4AG2 C;  2E10 A;  2YUP A;  2COY A;  3CBM A;  4BI8 B;  4JDS A;  5LJ5 f;  2D8H A;  4ZGJ B;  1TXQ A;  2E1H A;  1RLQ C;  2X35 A;  1MUZ A;  4RUG A;  2RK2 A;  2MK5 A;  4F6W B;  1U8R A;  5GAM e;  2KXD A;  3CCJ Q;  4QSH A;  1M1G A;  3UWN A;  3GTM S;  1ZBJ A;  5IF1 B;  4PJO A;  2MCN A;  2DK3 A;  3OYY A;  5IT9 E;  4JX4 A;  3PT9 A;  3G7Z A;  2QXF A;  1UB4 A;  1YJ9 T;  2WXV B;  3I5R A;  3CCU T;  5CKB A;  4OMP A;  2XDB A;  2D6F A;  3EGD B;  2CP6 A;  1ZA2 B;  3VS5 A;  2JTE A;  1M2V B;  4BCN D;  2HNI A;  2XKO C;  4MDX A;  1FYN A;  1VOL A;  5GAN j;  3JB9 J;  2E6N A;  1X43 A;  4C8Q B;  2I0N A;  4EMK A;  1U1S A;  5LQF B;  1D3B A;  3F70 A;  4DOW A;  2V8K A;  2CCH B;  1ARK A;  1YHQ A;  3FB9 A;  3NMZ C;  3EFR A;  2VUB A;  3BW1 A;  3FJP A;  5LJ3 d;  4ORZ A;  3OYM A;  2FRW A;  3CCQ Q;  2DVE A;  2MAM A;  3FC3 A;  2UZD B;  1MV3 A;  2A37 A;  2YUQ A;  4N4I A;  3VUZ A;  5A2Q E;  3V8L A;  1UGV A;  2L3Q A;  1KQS A;  2E3H A;  3E1S A;  4ROE A;  1ENW A;  1YIT Q;  5IHK A;  1B34 B;  1FX7 A;  4GLK A;  3LH0 A;  4J9G A;  1WI7 A;  2RF0 A;  3CCQ A;  1M1K C;  1VQO Q;  1PSF A;  1Q95 G;  1HYO A;  2RJD A;  4QT7 A;  4CFX B;  3CCE T;  1O9S A;  4KRT A;  2ZPF B;  1D0Z A;  2P0Q A;  1KHI A;  3ME9 A;  2LNV A;  3EG9 A;  4A53 A;  1Q82 C;  1QKW A;  3OYF A;  1VOM A;  2FEI A;  2JN0 A;  2ROL A;  1GBQ A;  4FM4 B;  4F7J B;  4L5G A;  1GXI E;  2A3L A;  2XK0 A;  3CC7 Q;  3MP1 A;  4EOP B;  1C0M A;  4IIO A;  2F5T X;  1WYX A;  3H0F A;  1X6O A;  2KMT A;  1VQ5 A;  2KVQ G;  4X34 A;  5IAY A;  2R57 A;  1BCM A;  5LL6 S;  2YHT A;  4OVA A;  3F5X B;  4GBQ A;  2X3W D;  3HFO A;  2CT3 A;  3CC7 A;  2WJ9 A;  2RM4 A;  1JU5 C;  3P8H A;  1F1B B;  4C8Q C;  1H64 1;  3VKG A;  2DBM A;  1OEB A;  5LJ5 j;  3J80 E;  1Y0M A;  3M55 A;  4XU0 A;  4HNU A;  4C8Q G;  2YDL A;  4C92 F;  5GAO m;  1WHG A;  1OPK A;  4RTW A;  5I2S A;  2MI6 A;  4EOL B;  2A0F B;  2AHJ B;  5CYI B;  5GJV B;  1YJ9 Q;  1X69 A;  3CCU Q;  4VUB A;  3OS0 A;  1A0N B;  2W99 A;  3I56 T;  5DQW A;  5L23 A;  3TNI B;  3PO3 S;  3CPW A;  2VWF A;  3LGL A;  2DM1 A;  3M56 A;  3BE3 A;  5J26 A;  2V22 B;  1HSQ A;  1CSK A;  1OU9 A;  3LX7 A;  2W2H A;  4JRK A;  1GRI A;  3M54 A;  4L59 A;  3M0R A;  4X9D A;  3DDQ B;  1RAA B;  5GJW B;  2QEX T;  3AHU A;  2VGN A;  1BI2 A;  5BNJ B;  1H4L D;  1NPR A;  2HEQ A;  4QQ6 A;  3O0G D;  3CME T;  4F04 B;  4M7A F;  1GCP A;  2M0O A;  3RNJ A;  4QW2 A;  3C12 A;  4E2F B;  1IZ6 A;  2VC8 A;  2HD0 A;  2D0Q B;  3NHN A;  3CCE Q;  3EGD A;  2QGG A;  1XJW B;  1M2V A;  2G6F X;  3UPU A;  3QZ5 B;  4M78 F;  1O75 A;  3CCL A;  1FMV A;  4BI4 A;  4C8Q A;  2LVM A;  4BE1 A;  2O01 E;  3G1J A;  2X3X D;  3M4G A;  3G71 A;  4J5Y A;  4HLQ A;  1PKT A;  2K9G A;  4MZM A;  3JCM h;  1YP5 A;  2PK2 A;  3UAT A;  2B8A A;  1F5Q B;  1OKW B;  3MIA B;  3OYC A;  3QWL A;  3VU3 C;  1ZUK A;  2Y4X A;  1B34 A;  5KYU B;  4M7D B;  2DBK A;  2DZC A;  4JRQ A;  4AKG A;  4MZT A;  1UNG D;  2WHB B;  2L89 A;  2OTL A;  3REA B;  4BCJ B;  3CMA A;  1QQJ A;  1M90 R;  2L3R A;  3D7S B;  3C4S A;  3PMT A;  1TTH B;  1OL1 B;  1VQ7 A;  1M3C A;  2PNI A;  2IW9 B;  1M9S A;  3JB9 H;  3HPW A;  4DBQ A;  4HT9 A;  3JAM E;  4R55 A;  4AKH A;  1RAF B;  3I56 Q;  1SRM A;  2VXF A;  1H1Q B;  2J7I A;  3A8H B;  2RD1 A;  1SKU B;  2DJQ A;  4ZN1 A;  2B86 A;  1K8A U;  2IN3 A;  3V7R A;  3M53 A;  2ESW A;  5EC7 A;  2ROT A;  2RJE A;  3CCS T;  2E6Z A;  4BCG B;  4BCP B;  5CR2 A;  2QEX Q;  3OYN A;  2OTJ A;  2VV5 A;  3OYE A;  2AZS A;  1AZG B;  4X9C A;  1IO6 A;  3G4S T;  2EBP A;  2X4Y A;  3TSZ A;  4AFZ C;  2MF2 A;  2RHI A;  3CME Q;  3MEU A;  1M2O A;  2DYI A;  1VQN A;  3VS0 A;  3CCM A;  4DOV A;  1AEY A;  5HVY B;  1BU1 A;  5DM7 R;  2PVG B;  4FX3 B;  4NOY A;  2IG0 A;  2ZZD B;  3HKS A;  2KRS A;  2RI5 A;  4BD3 A;  2X1N B;  1SHG A;  3BHU B;  4Y72 B;  2KY9 A;  3KFV A;  2KBT A;  5GAN h;  4EIK A;  4M7D C;  3MO8 A;  3LLR A;  5CAI A;  2VYT A;  3MP8 A;  2RPN A;  4M4Z A;  1XTD A;  4Z89 A;  1PG5 B;  1VQP T;  3V7C A;  1MMN A;  2ZGW A;  1AD6 A;  1GCQ C;  4B9X A;  2E70 A;  3M0S A;  3BLR B;  4J9B A;  1HXD A;  4M7D G;  2O9V A;  3QWY A;  3S3O A;  4NC6 A;  2BS3 A;  5CQY A;  1JJ2 S;  1YBY A;  1KK7 A;  1Q86 C;  1WHH A;  1M30 A;  2E41 A;  2GGR A;  1R77 A;  4PFP A;  5GMK l;  2FPE A;  2CZ1 B;  4JJD A;  1VQ8 T;  2BE7 D;  3IQL A;  3H0H A;  1PKS A;  2O9S A;  2LX7 A;  5IXB A;  1YJN A;  3JB9 G;  3E9F A;  2BTT A;  1AT1 B;  3DLM A;  4A4G A;  3EHQ A;  3TN8 B;  1NLO C;  3EG3 A;  3QHR B;  1EZZ B;  1WHM A;  1XNI A;  1VQL T;  3CCV A;  2G3R A;  1TH7 A;  2K2V A;  2X4J A;  1Q7Y U;  2HDA A;  2OAW A;  2WMB B;  2A7Y A;  1QWE A;  3A8L B;  4JLG A;  3ER0 A;  4JX5 A;  3L1A A;  1VQK A;  4D8K A;  2HBW A;  3TVT A;  4PFO A;  2OI3 A;  2A36 A;  2K57 A;  4NST B;  4J9I A;  3VKH A;  2HQX A;  2QA4 A;  2H3J A;  1H92 A;  3CCS Q;  2W9Z A;  3S3N A;  1Q81 R;  3K7A M;  3CC4 A;  5KYU A;  3KXT A;  4M7D A;  1SF9 A;  2JVV A;  4M77 B;  3OS2 A;  3EJ1 B;  2E3I A;  1OV3 A;  1IXD A;  3VKI A;  1KC8 R;  5J39 A;  3G4S Q;  4KUD K;  5LJ5 h;  5KYX B;  2JT4 A;  2ENM A;  1GCQ A;  1BU2 A;  2MPX C;  1ZBX A;  4LXC A;  1WXB A;  5GAN 6;  3OS5 A;  1KJW A;  4JLI A;  1VA7 A;  4FL6 A;  2DE0 X;  2DEU A;  3AT1 B;  4CC4 B;  3PNW C;  1KD1 C;  1WQW A;  4LDV A;  1Y07 A;  4GY5 A;  1VQ4 A;  3X25 B;  1M5Q 1;  4ZN3 A;  2C0O A;  2DXB B;  4BCI B;  5FU7 B;  2L8D A;  2OX7 A;  4EMG A;  1GBR A;  5EG2 A;  1AIS B;  2KSS A;  2CP7 A;  1I81 A;  4M75 F;  1N8R C;  1CKB A;  2FPF A;  3LQ5 B;  4F6S B;  2LQN A;  2DD5 B;  1VQP Q;  2JUF A;  4FCY A;  2EW3 A;  1NJI U;  3KHI A;  5GAN 7;  2C5X B;  5C6S A;  4BE2 A;  1K73 C;  2DET A;  2DXC B;  3RMQ A;  2J05 A;  2COW A;  5IDN B;  4CC2 A;  4KGZ B;  3RIR A;  5LJ3 e;  1VQ8 Q;  3EH1 A;  2EYZ A;  4CC3 A;  1AD5 A;  2EJG A;  4E7I A;  2F1L A;  3DL1 A;  4HVV A;  4MDW A;  4F7U F;  3NGP A;  2ZZD A;  1W1F A;  1VQL Q;  1PRM C;  4M77 E;  1OI9 B;  4RCB A;  4D8D A;  2ED0 A;  2RB6 A;  4EC9 B;  1Y96 B;  1ZX6 A;  4J7I A;  3OQ5 A;  5A0G A;  1N27 A;  4M77 C;  5FWC A;  4E7H A;  4YC3 B;  3M0P A;  3L2Z A;  2GCX A;  2V8J A;  1BKB A;  4KUI A;  5GAM h;  1IRX A;  4Y92 A;  1K9M R;  4M77 G;  2Y90 A;  3CD6 A;  3TSW A;  1M1F A;  2QG9 B;  4C92 D;  1TG0 A;  2RQU A;  3CC2 T;  1PC0 A;  3RMS A;  3CCR T;  4IUR A;  3JB9 I;  1R0C B;  1K9A A;  2QQ8 A;  4CFM B;  1ZUY A;  2K5L A;  4BCK B;  2R7G A;  1VIE A;  1D1B A;  2DXU A;  2HQE A;  3MI9 B;  3TU4 K;  3L2V A;  2RQT A;  3QII A;  2Y4Y A;  2IW8 B;  1PCX A;  2AZV A;  2NUP B;  1IGQ A;  2K6D A;  2DXT A;  3GLX A;  5CQX A;  2XIC A;  4PJO G;  4ME7 A;  5ACB A;  4HCZ A;  2XMF A;  3MPU B;  4FYV B;  3PTA A;  5LJ3 f;  1W2B S;  1ZA1 B;  4C0F A;  4RG2 A;  2DTI A;  5IHY A;  3S6W A;  4BAC A;  1X27 A;  1LOJ A;  1WPY A;  4M7A D;  4DQ2 A;  2VXE A;  3NTK A;  4BUG A;  4QQD A;  1AVZ C;  4MIM A;  3RDV A;  2GNC A;  3VRY A;  1FIN B;  2BS2 A;  2JW4 A;  3I55 A;  4OGE A;  5A0L A;  2PTK A;  4CXA B;  5ECA A;  1R8O B;  2QQ9 A;  5AT1 B;  2DIQ A;  3QYE A;  1WNL A;  3BLH B;  4EOI B;  2DL7 A;  3INZ A;  4M77 A;  1OQK A;  2JXB A;  4YOO A;  4M78 D;  3EFS A;  4I3Z B;  1TUD A;  3CPF A;  4E7K A;  5KYX A;  1VQM A;  2FPD A;  5GAN 8;  2CCI B;  1UGS B;  3EGU A;  3QHW B;  4UC4 A;  2QK0 A;  2G77 A;  2JMC A;  4C0G A;  5DQV A;  4E7S A;  2FYK A;  3QWX X;  2DXB A;  2IPO B;  2E12 A;  1JEG A;  2F2W A;  4C0Z A;  3OA6 A;  4MFD A;  2AKL A;  2K5F A;  4XTX A;  1W6X A;  3X26 B;  1AWX A;  1H3H A;  3B57 A;  1VQ6 T;  2DD5 A;  1FMK A;  1Y71 A;  1QLY A;  4BDY A;  3CCJ A;  3FRN A;  5GMK i;  1WDX A;  4O5V A;  2YRC A;  4TTH A;  4J8O A;  1ABQ A;  5D6Y A;  4HL4 A;  2DXC A;  2CRE A;  2FL7 A;  1K0S A;  4LE9 A;  3CC2 Q;  2R5M A;  3CCR Q;  1ACM B;  1BIB A;  2NYS A;  3JCM Q;  4C5G A;  1QCN A;  2FZK B;  4M7A B;  2LW4 A;  2GTO A;  4N0A C;  4RCC A;  1VIF A;  1JJ2 A;  2K3B A;  3CCR A;  1H28 B;  4LDU A;  5EFQ B;  1YWO A;  4DBH A;  2EGC A;  4BCQ B;  4HNT A;  4FSX A;  2JOY A;  4BI3 A;  2KRO A;  3ZEH A;  1IHW A;  1Y96 A;  1MV0 B;  3NDQ A;  4AI6 A;  1U06 A;  4M78 B;  4F7S B;  1OPL A;  2DRK A;  1ZUU A;  2YSQ A;  5J3B A;  1YIJ T;  1YIT A;  2IVW A;  1T3L A;  4PLI A;  5A0D A;  5LJ3 j;  4QVC A;  4C92 E;  5GAM f;  2O2O A;  2K3X A;  4OGC A;  1OUL A;  2X51 A;  1VQO A;  2LZ6 B;  3WXM B;  1I8F A;  3BDU A;  4XTZ A;  3GNF B;  3MY1 B;  4FYX B;  3QXE B;  4C92 C;  3CEY A;  5IHI A;  2XHC A;  2VAS A;  1QKX A;  2KGT A;  1I0C A;  1PHT A;  5M9O A;  1QVP A;  4A4H A;  1UE9 A;  4LDX A;  2NUP A;  2EQU A;  1UEB A;  1OI1 A;  3MEV A;  3EG2 A;  2F2C A;  2EYX A;  3JRZ A;  2CP3 A;  2KRM A;  2DF6 A;  4BCN B;  4IUU A;  5D7U A;  1Z9Q A;  1EIF A;  4YOS A;  2K7A A;  4WF2 A;  1VYW B;  2KMG A;  4ELZ C;  4A4F A;  2RMO A;  1X6G A;  5HNB B;  2QTV A;  3TNW B;  4M7A E;  2M0Y A;  2KAF A;  1PSE A;  2MOX A;  3VJP A;  3TCJ A;  5CKE A;  5GMK j;  2UZL B;  4N0A A;  2CS7 A;  3SHW A;  2CJM B;  1UGR B;  3CXC S;  4M7A C;  3X20 B;  2DLP A;  2BKD N;  3EID B;  4HCB A;  1PD1 A;  2DTH A;  5FU6 C;  1R0B G;  1VQ6 Q;  1HJD A;  2ZPH B;  2K3Y A;  4MZP A;  3HB9 A;  3VS1 A;  4M78 E;  2F69 A;  1YCS B;  1BB9 A;  5IHN A;  3UDC A;  1WHL A;  2XDP A;  3PE0 A;  2PK9 B;  1YJ9 A;  4M78 C;  3CCU A;  1RUW A;  3OW2 P;  1M4Z A;  2FZC B;  4OMN A;  2BZX A;  3KUF A;  2NLU A;  4CFW B;  3OBW A;  1TSF A;  5C0M A;  1M1K R;  2X4W A;  1QMC A;  2QGF B;  3C94 A;  2JS0 A;  1OZ2 A;  1JQQ A;  1I4K 1;  4FSS A;  4C92 A;  1AHJ B;  5FGK B;  1M8V A;  3OMC A;  1K8A C;  1KG1 A;  2BS4 A;  1Q82 R;  4C8Q F;  2XG8 D;  2LT4 A;  4PNO A;  1U5S A;  4JZ3 A;  1M1K U;  4G6L B;  1AZE A;  3RUX A;  2D8J A;  1YIJ Q;  5GAO r;  3BG5 A;  2C4G B;  3RKX A;  3BHT B;  4HVW A;  1QVG S;  2DJZ A;  2C0I A;  2RJF A;  3S3M A;  1CKA A;  5FLX E;  1G5V A;  2FVU A;  4YTL A;  2RA2 A;  2DNU A;  2KYB A;  4FYY B;  3CCE A;  2O4X B;  5KE3 A;  5GAM j;  3GNG A;  1X75 C;  1JJ2 P;  4M7A A;  3GOX A;  1RL2 A;  4JPB W;  4XQ3 A;  1VYU A;  4M75 D;  4IUQ A;  2FRY A;  3JCM P;  2LQ8 A;  1WJS A;  2H3E B;  4JRI A;  2B9R A;  2ZAE A;  3M0Q A;  5GAO l;  1UJ0 A;  4CFU D;  4J7F A;  1WHK A;  1N6A A;  2P84 A;  3NPF A;  4M78 A;  4BCM D;  3L42 A;  4EOM B;  1IHV A;  1MMD A;  4OMO A;  3QJ6 A;  1N9S A;  2PU9 B;  4E6R A;  5HK0 A;  1QW1 A;  3MET A;  3OYB A;  2KK4 A;  4OGR B;  3I9Q A;  3URG A;  1WA7 A;  3JCM J;  1UNL D;  5I22 A;  1WLP B;  1W70 A;  2DFU A;  3DTO A;  1BI0 A;  3OSV A;  4RTZ A;  2UUE B;  1YI2 T;  1H1P B;  2JS2 A;  4PKC C;  5GMK m;  2HZY A;  2EVR A;  1G3N C;  1U1T A;  4R0K A;  5KYY B;  2DA9 A;  1E6H A;  1M90 U;  2EFI A;  1Q7Y C;  2XI9 A;  4PLL A;  2BZY A;  5GAN 5;  4OF1 A;  2JM9 A;  4J6Y A;  3U23 A;  3I56 A;  1W4S A;  3JCM g;  3OW2 S;  1JSU B;  1H8K A;  1RAI B;  2IVX A;  4FYW B;  1V76 A;  4HVU A;  2EJ9 A;  1UHC A;  1Y7X A;  2VB6 A;  1X01 A;  3M4Y A;  4N4H A;  2QEX A;  3LGF A;  2DL5 A;  1JXO A;  4ESR A;  2QAZ A;  4KGX B;  1YN8 A;  1K0X A;  1N5Z A;  2YLB A;  3OYG A;  4M75 B;  3DDP B;  3CME A;  3MY5 B;  4XU2 A;  2ZCF B;  2HKN A;  5GAN 2;  3VS6 A;  1H1S B;  3BLQ B;  3T9N A;  2DRM A;  3TQ7 P;  3REB B;  1WJQ A;  3LWH A;  3LH5 A;  1IGU A;  2LX9 A;  1MMA A;  1WHJ A;  3A8G B;  4BCM B;  4E7Z A;  3JCM W;  4WCI A;  4Z02 A;  1S72 T;  3EAE A;  2VKN A;  1H24 B;  2RI2 A;  2FO0 A;  2CP0 A;  1RAD B;  2W0Z A;  1H26 B;  2KR3 A;  4ZTF A;  3L2U A;  4ELL A;  4F7U B;  4CI0 C;  2RN8 A;  1UHF A;  4ZNX A;  2QDL A;  1NJI C;  1SEM A;  1X2Q A;  4MML A;  2JNG A;  5FWB A;  3HRU A;  4HCK A;  3PIP A;  1QMZ B;  5LJ3 h;  3M57 A;  1RAG B;  3J7A F;  2CZ7 B;  2X9H A;  4F6U B;  1YJW T;  1I5O B;  2IW6 B;  2ZPG B;  3RES A;  3RER A;  5AYF A;  1OZ3 A;  2O4X A;  3PGG A;  3BG3 A;  5GAN g;  4HCC A;  2ZPI B;  2HL5 C;  1YI2 Q;  2CSQ A;  4M75 E;  3TW6 A;  2C6T B;  2F2X A;  2YT6 A;  4CFN B;  5CVI A;  4M75 C;  1KHC A;  3HP9 A;  1SSF A;  1HK9 A;  1YI2 A;  2YUN A;  4KGV B;  1FVV B;  3RBB B;  1XOV A;  1M27 C;  1KFZ A;  1BIA A;  2V1R A;  4ROC A;  3H6Z A;  2SEM A;  1TS9 A;  1RAC B;  3QYG B;  3JCM c;  1FWZ A;  3CCS A;  1LCK A;  3RKY A;  1NZ9 A;  1W2B P;  5GMK h;  2YWW A;  3M9Q A;  2RHX A;  1Q81 U;  1WGS A;  2QI2 A;  4XU3 A;  4B9W A;  3VS7 A;  2PUK B;  2RQW A;  3ZBD A;  3G4S A;  4F7U E;  6AT1 B;  1FKM A;  3HO8 A;  1JO8 A;  1KC8 U;  1TWB A;  3QZ9 B;  3FDR A;  3R6O A;  2FG0 A;  5I21 A;  4JJC A;  1B07 A;  2LJ3 A;  2R58 A;  4QQG A;  1Q86 R;  5KYY A;  1VQ9 T;  3QO3 A;  5KYW B;  3LW5 E;  1MNE A;  3HHT B;  1S72 Q;  4AMC A;  1TD6 A;  1JST B;  1C9B A;  2JTM A;  2M9U A;  2BKZ B;  2P4T A;  2KT8 A;  5D6X A;  2XU8 A;  2WSE E;  3UA7 A;  4JX6 A;  1WQ7 A;  3UF4 A;  3JV3 A;  1VQP A;  1G3T A;  2YRD A;  2JM8 A;  1KQ2 A;  2YRV A;  4BE0 A;  1G2B A;  3X24 B;  1NLP C;  4ELY C;  4J9D A;  1YCY A;  4HA8 A;  2WAC A;  1LJO A;  1GUX B;  5LJ5 g;  4NL3 A;  4M75 A;  3LWI A;  2KYM A;  1SSH A;  2IIM A;  2RJC A;  3QHS A;  1TOV A;  5DLQ E;  2LRQ A;  1VQ8 A;  5IN1 A;  2W10 A;  3G6E T;  1YJW Q;  4K11 A;  2DKG A;  1VUB A;  1WXU A;  3BY7 A;  4DBF A;  2EKH A;  1VQL A;  4J9E A;  1G3S A;  4F7L B;  4BB7 A;  2SRC A;  3DKM A;  5CKD A;  1H25 B;  4ELJ A;  5GAN 4;  1BCO A;  4CRL B;  4LD9 K;  1SG5 A;  3JCM d;  2ZPE B;  2BUD A;  4F7U A;  4C5E A;  1KD1 R;  4XAX B;  1N4M A;  3UA6 A;  1GY3 B;  5KE2 A;  1K9M U;  1PRL C;  4JS4 A;  1YHQ T;  3M5A A;  4FIB A;  5L8R E;  3VRZ A;  4EPC A;  2CH4 W;  5EJC A;  3OYD A;  2DAQ A;  4BY1 X;  1N8R R;  4OMF B;  1SHF A;  8ATC B;  2LT1 A;  4PK4 A;  3VS4 A;  1TFB A;  4ZGE B;  3JSC A;  2RNA A;  2ECZ A;  5D6W A;  1I1J A;  2BIV A;  1AWO A;  4PJJ A;  1JBM A;  1U3O A;  9ATC B;  2JGZ B;  2L3P A;  1K73 R;  2L2P A;  4RTY A;  2KEA A;  2MYS A;  2AKK A;  1NM7 A;  1JXM A;  4C8Q D;  2JZ2 A;  3V8K A;  2DL8 A;  1VQ9 Q;  3VYG B;  3RR6 A;  3TEE A;  1VIN A;  3H4C A;  3FJ5 A;  3HBL A;  2K79 A;  1BBZ A;  4EOO B;  1MND A;  2P0K A;  3HZJ A;  2P4R A;  3GBQ A;  4EMH A;  1NPP A;  3TW7 A;  3KBG A;  1GFC A;  2FHD A;  2RI3 A;  5CKH A;  2LCL A;  1VQ9 A;  4IKF A;  3A5Z B;  2NWM A;  2DIL A;  3MJX A;  4F16 A;  3L2Q A;  1VQ5 T;  3QKJ A;  3OW2 A;  1H27 B;  3GF5 A;  4PJO F;  5KCH A;  4YOZ A;  1WZO A;  2LC4 A;  4J6W A;  2G9X B;  3R6N A;  4N4G A;  4PJL A;  4C92 B;  3EG0 A;  2QQS A;  3EHR A;  3A1P A;  4AT1 B;  1WX6 A;  1UFF A;  1ABO A;  3CXC P;  3G6E Q;  5GAO p;  2DVJ A;  2PJQ A;  2NUT B;  4M6V A;  2C0T A;  3EH2 A;  3OYL A;  2F5K A;  4IMY B;  5GAN d;  5KYW A;  4NS5 A;  5IXF A;  3O8V A;  2ED1 A;  4BCH B;  3PFS A;  1UNH D;  2QF7 A;  3I5S A;  2M51 A;  3EGX B;  4RTU A;  3G6E A;  2HCK A;  2L3S A;  2QTX A;  2W9F A;  3THK A;  1AOJ A;  4ROD A;  3ZFJ A;  2YLC A;  1E7P A;  1WFW A;  4MMK A;  4BXX X;  3HRS A;  4V2S A;  4LUD A;  3V7S A;  1D3U B;  1T3S A;  1E6G A;  1YHQ Q;  5FU6 B;  4DA4 A;  4R56 A;  4BDZ A;  3CC2 A;  1M8M A;  1GUX A;  4J9H A;  1YNZ A;  2O31 A;  5I11 A;  2DZ9 A;  1UTI A;  3M0U A;  4PJM A;  3I35 A;  5IDP B;  1BI1 A;  1N9R A;  4AFU C;  1QVF S;  5FRO A;  3QUI A;  5HBH B;  1QVG P;  4PJN A;  1SRL A;  4Y91 A;  2UZB B;  1HD3 A;  1OL2 B;  3G33 B;  2DEQ A;  5HK3 A;  1Z9Z A;  1PD0 A;  2ABL A;  3CCL T;  2CSI A;  2GBQ A;  3L2R A;  2DX1 A;  2C06 A;  1LPL A;  3G71 T;  1KIK A;  4JJN K;  2JTF A;  3TRE A;  2XDD A;  4C92 G;  1B3Q A;  1JRI A;  1P5E B;  5FRM A;  1OOT A;  4KH1 B;  2D1X A;  3QYB A;  3RKW A;  2QAS A;  2V26 A;  2JJ9 A;  1ZP2 A;  1VQ5 Q;  2CGH A;  2NUZ A;  4C5H A;  2WSF E;  2YXY A;  2EGE A;  5LJ5 d;  2LMJ A;  1TUC A;  1BYM A;  3CQT A;  5KH6 A;  1J3T A;  2PUO B;  2QQB A;  4OB3 B;  7AT1 B;  4BCF B;  4CFV B;  1OX8 A;  3M59 A;  2CKK A;  5CKF A;  5LMK B;  4AG1 C;  4LDY A;  1NEB A;  4C8Q E;  2MMP A;  2RH2 A;  3LYI A;  1UGQ B;  2OTL T;  4B6M A;  3JCM X;  1BK2 A;  1W98 B;  3VS2 A;  3OBY A;  3CMA T;  2DYB A;  4C0D B;  1VYV A;  2QQR A;  3VYG A;  2DMO A;  1VQ7 T;  1NG2 A;  4OP0 A;  2QGS A;  4M7A G;  2DPP B;  3M58 A;  1D1C A;  2P0P A;  2MIO A;  3OMG A;  3EFO B;  3OS1 A;  1VQ6 A;  4IUP A;  4LN2 A;  4FW2 A;  1D09 B;  2GQV A;  1Y57 A;  2ZPB B;  3DOG B;  3GIB A;  4OB1 B;  4AFS C;  1RLP C;  4XTY A;  4MFE A;  1NE8 A;  2PZ1 A;  2RHY A;  3VYH B;  2EQK A;  4M7D D;  4M78 G;  4RTV A;  2WIH B;  1I5L A;  2PMI B;  2WIP B;  2OTJ T;  2I40 B;  1H3Z A;  2UZE B;  1ZSZ B;  1BI3 A;  4IIM A;  1M90 C;  2RQR A;  3HFN A;  4Z88 A;  2DER A;  2CDT A;  4JS5 A;  5KYN A;  4IUT A;  3EOC B;  2QDY B;  4EC8 B;  4BBS M;  4ZGD B;  5HCK A;  1ZSG A;  2CZ6 B;  2HL3 A;  2LTO A;  5HQ0 B;  3JCM b;  1VQN T;  2NUT A;  3CCM T;  3QBY A;  4PFZ A;  1VYT A;  4F7N B;  2VGM A;  3JB9 D;  2HQH A;  4F70 B;  3MEW A;  2EUF A;  1D0X A;  4BBR M;  1UUE A;  2QFZ A;  3EGX A;  5HBE B;  3C0C A;  3HL8 A;  1Q82 U;  1NBE B;  5GAM d;  3VV0 A;  5L2W B;  2F2V A;  2KT1 A;  3A8O B;  3FIF A;  3VUB A;  3CCL Q;  1EX4 A;  4J9F A;  1YIJ A;  1C6V X;  4C5I A;  2LJ0 A;  3G71 Q;  2HBP A;  3O5Z A;  3L2W A;  5IH2 A;  2LNH B;  2D0N A;  5GAO q;  1QP2 A;  4C0D C;  1M3A A;  4D6W A;  3QSU A;  2DL3 A;  3OYH A;  2K4Y A;  1FMW A;  2K5I A;  3QYH B;  4IUV A;  1YJN T;  2KR6 A;  2E64 A;  2OJ2 A;  1KQS P;  3QG1 A;  1D0Y A;  3M03 A;  4AKI A;  2LDM A;  3JCM V;  4HKE A;  3CCV T;  4XTW A;  1W2B A;  2OTL Q;  4F14 A;  1V29 B;  4QKU A;  3CMA Q;  3SEM A;  1S1N A;  2RHZ A;  3CBO A;  3ZL7 C;  1DJ7 B;  3P8D A;  2CH4 A;  2V1Q A;  3OB9 A;  1ZSZ C;  1VQ7 Q;  3QPH A;  2LCC A;  1VQK T;  1UGP B;  3DLL A;  3POM A;  4XTU A;  2LP5 A;  1JOW A;  2CUB A;  2Z0W A;  3PMI A;  1K8A R;  4BY7 X;  1UG1 A;  2CUD A;  1G3Y A;  2XID A;  2X4X A;  2I2L A;  4RKU E;  1PKD B;  1URC B;  2FB7 A;  4EOJ B;  5HY6 A;  4X1V A;  1NYG A;  4DEX A;  2QA4 T;  4A4K A;  2EGA A;  3NTH A;  1QCF A;  3CC4 T;  1QLB A;  4O6J A;  3A8M B;  2E4H A;  4HNV A;  4J9C A;  2DIG A;  2OTJ Q;  3TNH B; 
#chains in the Genus database with same CATH homology
 5I21 A;  4HNU A;  3CPF A;  3SWN B;  4C8Q G;  4E7K A;  1VQM A;  4C92 F;  2R58 A;  5GAN 8;  2QDJ A;  4QQG A;  2RHU A;  5GAO m;  1UGS B;  5I2S A;  2MI6 A;  1VQ9 T;  3QO3 A;  2AHJ B;  2LQK A;  3LW5 E;  4UC4 A;  4VUB A;  2G77 A;  3OS0 A;  3HHT B;  2M1H A;  4C0G A;  3I56 T;  2FYK A;  3FEO A;  2JTM A;  2M9U A;  1WJR A;  2EWN A;  2P4T A;  5D6X A;  2DXB A;  2XU8 A;  4FT4 A;  2WSE E;  1VQ4 T;  4JX6 A;  3CPW A;  1Q81 U;  2E12 A;  1WQ7 A;  4JUV A;  1VQP A;  1OYX A;  4C0Z A;  1G3T A;  3LGL A;  3OA6 A;  3M56 A;  4MFD A;  5J26 A;  2K5F A;  4XTX A;  3SD4 A;  4A4E A;  1KQ2 A;  2YRV A;  1Q81 C;  5I2M A;  4BE0 A;  3X26 B;  3LX7 A;  4JRK A;  3X24 B;  2KQW A;  3M54 A;  4L59 A;  1VQ6 T;  2DD5 A;  4X9D A;  4ELY C;  1YCY A;  2QEX T;  3AHU A;  4HA8 A;  2VGN A;  1BI2 A;  4XTV A;  1Y71 A;  2WAC A;  1LJO A;  4BDY A;  2EAY A;  1NPR A;  3FRN A;  5GMK i;  5LJ5 g;  3CCJ A;  1KC8 C;  4O5V A;  4KBM B;  4M75 A;  4QQ6 A;  4NL3 A;  3LWI A;  2EKO A;  4J8O A;  4M77 D;  2RJC A;  3CME T;  3QHS A;  5D6Y A;  4HL4 A;  2DXC A;  5DLQ E;  2EJF A;  3JCM e;  2FL7 A;  2LRQ A;  1VQ8 A;  4M7A F;  5IN1 A;  3UT1 A;  3G6E T;  2R5M A;  4HT8 A;  2M0O A;  4QW2 A;  4J6X A;  3C12 A;  3SB2 A;  2DD4 B;  1BIB A;  1IZ6 A;  2DKG A;  2VC8 A;  3QDR B;  3JCM Q;  1VUB A;  3OYA A;  4ATO A;  2HD0 A;  3BY7 A;  1VQL A;  4C5G A;  4M7A B;  2D0Q B;  1G3S A;  2E65 A;  4RG8 A;  4N0A C;  4RCC A;  1VIF A;  1JJ2 A;  2PVD B;  4FU6 A;  4BB7 A;  3OYJ A;  4LDW A;  3CCR A;  3DKM A;  4LDU A;  3QZ5 B;  3UPU A;  4M78 F;  1O75 A;  5CKD A;  3CCL A;  4ELJ A;  4BI4 A;  4C8Q A;  5GAN 4;  4II1 A;  2LVM A;  4BE1 A;  1KQS S;  4HNT A;  3OYI A;  4FSX A;  2O01 E;  2JOY A;  4BI3 A;  4LD9 K;  3JCM d;  3ZEH A;  4PJO D;  1ZQ1 A;  3M4G A;  1QVF A;  2ZPE B;  1Y96 A;  2BUD A;  4F7U A;  4C5E A;  3G71 A;  4AI6 A;  4M78 B;  4J5Y A;  4XAX B;  4HLQ A;  2CZ0 B;  5J3B A;  5KE2 A;  4MZM A;  3JCM h;  1K9M U;  1XQH A;  3SWN C;  2DO3 A;  4JS4 A;  1YHQ T;  4M7D F;  1YIJ T;  3M5A A;  2IVW A;  4FIB A;  4LD6 A;  1YIT A;  4PLI A;  5A0D A;  5LJ3 j;  5L8R E;  2B8A A;  4QVC A;  4EPC A;  4FT2 A;  2OAU A;  4C92 E;  2DTO A;  5GAM f;  3OYC A;  3QWL A;  5EJC A;  2K3X A;  3DB4 A;  4RMO A;  3P8B B;  2DAQ A;  3ASK A;  4OGC A;  3VU3 C;  3OYD A;  1VQO A;  3CD6 T;  3WXM B;  2Y4X A;  3N5B B;  1I8F A;  4OMF B;  3BDU A;  4XTZ A;  3GNF B;  3QXE B;  1B34 A;  2GFU A;  2LT1 A;  2PVO B;  2DZC A;  4P5N A;  4TVR A;  4C92 C;  4EDU A;  4M7D B;  5DLO A;  3CEY A;  4ZGE B;  3JSC A;  4JRQ A;  2XHC A;  3CBP A;  5D6W A;  4AKG A;  2BIV A;  3WVD B;  1JBM A;  4MZT A;  2L5Q A;  2L89 A;  4Z6Y A;  4M75 G;  3JB9 F;  2V8I A;  5M9O A;  1QVP A;  4A4H A;  4LDX A;  2OTL A;  3BG9 A;  2EQU A;  3JCM f;  3CMA A;  1UEB A;  4KUL A;  2L3R A;  1OI1 A;  3MEV A;  4C8Q D;  2JZ2 A;  3V8K A;  3C4S A;  3JRZ A;  3PMT A;  3SFM A;  3VYG B;  1LNX A;  1VQ7 A;  4XU1 A;  4IUU A;  3TEE A;  1M9S A;  2M16 A;  4CRI A;  3H4C A;  5CCA A;  3JB9 H;  1EIF A;  3HPW A;  4HT9 A;  3HBL A;  2EQJ A;  3JAM E;  4R55 A;  1K9M C;  4AKH A;  2P0K A;  3HZJ A;  4EMH A;  4WF2 A;  1NPP A;  4ZTJ A;  2KMG A;  3TW7 A;  4BY6 B;  3KBG A;  2VXF A;  4ELZ C;  5LJ3 g;  4A4F A;  3DB3 A;  3E9G A;  2FHD A;  3A8H B;  2RD1 A;  5FRN A;  4M7A E;  2RI3 A;  1MHN A;  5CKH A;  3FLG A;  2LCL A;  2KAF A;  4ZN1 A;  1PSE A;  1VQ9 A;  3VJP A;  3TCJ A;  1K8A U;  5CKE A;  3C95 A;  4OB0 B;  4IKF A;  3A5Z B;  5GMK j;  3CXC A;  4N0A A;  3V7R A;  3M53 A;  2CS7 A;  1UGR B;  5GAN e;  3CXC S;  4M7A C;  4Y28 E;  4L6V 5;  3X20 B;  3L2Q A;  1VQ5 T;  3QKJ A;  2RJE A;  2BKD N;  3OW2 A;  3CCS T;  3GF5 A;  2E6Z A;  4PJO F;  5KCH A;  2DTH A;  4F7U G;  5FU6 C;  4XK8 E;  4HCB A;  2LC4 A;  4J6W A;  5CR2 A;  1QP3 A;  2ZPH B;  3OYN A;  2K3Y A;  4N4G A;  2OTJ A;  2VV5 A;  4MZP A;  4C92 B;  3OYE A;  3I55 T;  4X9C A;  3HB9 A;  2QQS A;  3G4S T;  2KDS A;  2XD0 A;  4M78 E;  2F69 A;  2X4Y A;  4PJO B;  2MF2 A;  2RHI A;  3UDC A;  5GAO n;  2EQM A;  2XDP A;  3CPW S;  3MEU A;  1Q86 U;  1YJ9 A;  4M78 C;  5GAO p;  3CCU A;  1VQN A;  3SWN A;  3CCM A;  3X28 B;  4DOV A;  1JB0 E;  1S72 A;  1M4Z A;  1VQM T;  4M6V A;  5DM7 R;  3OYL A;  2PVG B;  2NLU A;  2F5K A;  3KUF A;  3OBW A;  4NOY A;  5GAN d;  5C0M A;  2IG0 A;  2X4W A;  3QJY A;  4NS5 A;  2ZZD B;  2RK1 A;  3HKS A;  3O8V A;  3C94 A;  2RI5 A;  2D9T A;  3PFS A;  1OZ2 A;  2EIF A;  4BD3 A;  5CK9 A;  2QF7 A;  4EMK B;  1I4K 1;  5HKC A;  3E19 A;  4C92 A;  5KCO A;  1AHJ B;  2KY9 A;  3G6E A;  1D3B B;  1M8V A;  2QTX A;  3H8Z A;  5GAN h;  3OMC A;  1K8A C;  4M7D C;  3MO8 A;  3LLR A;  1KQ1 A;  1MGQ A;  4QVD A;  3ZFJ A;  5CAI A;  1KG1 A;  1IRE B;  2VYT A;  2YLC A;  2BS4 A;  3MP8 A;  3V8J A;  1XTD A;  1E7P A;  4C8Q F;  2XG8 D;  4MMK A;  4PL6 A;  3V7C A;  3MCA B;  3HRS A;  1VQP T;  2LT4 A;  4V2S A;  2ZGW A;  3BDL A;  4PNO A;  1M1K U;  4B9X A;  4Q5W A;  2E70 A;  3V7S A;  4M7D G;  1HXD A;  3S3O A;  3RUX A;  4NC6 A;  1G3W A;  2BS3 A;  4ZTF A;  5FU6 B;  4DA4 A;  4R56 A;  5CQY A;  4BDZ A;  3CC2 A;  1QVG A;  5GAO r;  5GAN 3;  3BG5 A;  5DY9 A;  3RKX A;  2QQA A;  1JJ2 S;  4A54 A;  1QVG S;  1YBY A;  3CCJ T;  1YJW A;  2DJZ A;  2RJF A;  1Q86 C;  3S3M A;  5FLX E;  1G5V A;  2E41 A;  2DZ9 A;  2FVU A;  4YTL A;  5GMK l;  2RA2 A;  4OB2 B;  5GAN f;  1BI1 A;  1N9R A;  2CZ1 B;  1VQ8 T;  3CCE A;  4BY6 C;  2MWP A;  5CO7 A;  2O4X B;  5KE3 A;  2DD4 A;  5GAM j;  3SDZ A;  5FRO A;  1YJN A;  1QVF S;  3GNG A;  3QUI A;  3JB9 G;  3E9F A;  3DLM A;  4A4G A;  2CYZ B;  3GPL A;  3J81 E;  4E7L A;  1X75 C;  4M7A A;  3GOX A;  1XNI A;  1RL2 A;  4XQ3 A;  1VQL T;  3PIO A;  3CCV A;  2RO0 A;  4M75 D;  4IUQ A;  2G3R A;  4Y91 A;  3JCM P;  1TH7 A;  2DEQ A;  2LQ8 A;  1WJS A;  4LOC A;  2K2V A;  2X4J A;  5HK3 A;  1Q7Y U;  5LJ5 e;  4JRI A;  4PJO E;  3CCL T;  3NFC A;  2PQW A;  3WVE B;  2R5A A;  3MHX A;  3GP8 A;  2EYQ A;  5FU7 C;  2A7Y A;  4J83 A;  4QVZ A;  5GAO l;  3A8L B;  4JLG A;  3L2R A;  3ER0 A;  1KD1 U;  4JX5 A;  4J7F A;  3L1A A;  2GF7 A;  5GMK e;  1VQK A;  2C06 A;  1N6A A;  4PJO C;  3BFM A;  2MWO A;  4M78 A;  3CCQ T;  3G71 T;  3L42 A;  4JJN K;  2JTF A;  2HAX A;  3QJ6 A;  3TRE A;  2XDD A;  4C92 G;  1P92 A;  1N9S A;  1JRI A;  5FRM A;  2PU9 B;  5HK0 A;  2K57 A;  1QW1 A;  3MET A;  4M77 F;  3OYB A;  3HSB A;  2KK4 A;  1YIT T;  1N8R U;  3QYB A;  3VKH A;  3RKW A;  2HQX A;  3URG A;  3HRT A;  2QA4 A;  2H3J A;  4E7J A;  3JCM J;  2CGH A;  4C5H A;  3S3N A;  2WSF E;  3CC4 A;  4EMK C;  5GAM g;  1VQO T;  5LJ5 d;  3KXT A;  4M7D A;  1BYM A;  2JVV A;  4M77 B;  3OS2 A;  3MP6 A;  5KH6 A;  4NL2 A;  1BI0 A;  3OSV A;  1FXX A;  3VKI A;  1K73 U;  2PUO B;  2QQB A;  5J39 A;  4KUD K;  1YI2 T;  5LJ5 h;  4OB3 B;  4PKC C;  5GMK m;  1U1T A;  1ZBX A;  1M90 U;  1RI0 A;  2CKK A;  3M59 A;  2EFI A;  3OSS C;  5CIU A;  5CKF A;  1Q7Y C;  2XI9 A;  4LDY A;  4PLL A;  4C8Q E;  2MMP A;  2RH2 A;  3LYI A;  1UGQ B;  3OS5 A;  5GAN 6;  2OTL T;  4JLI A;  3JCM X;  4FL6 A;  5GAN 5;  4OF1 A;  4J6Y A;  3NTI A;  3OBY A;  4E47 A;  4JRP A;  3PNW C;  1ZHI A;  3I56 A;  4C0D B;  1KD1 C;  1W4S A;  3Q1J A;  2QQR A;  2WSC E;  3JCM g;  3VYG A;  3OW2 S;  1WQW A;  4LDV A;  1Y07 A;  4GY5 A;  4KT0 E;  3CC7 T;  3OYK A;  3X25 B;  1M5Q 1;  3OY9 A;  1VQ4 A;  2GFA A;  4ZN3 A;  1VQ7 T;  2DXB B;  4OP0 A;  5FU7 B;  2L8D A;  4M7A G;  2DPP B;  4EMG A;  3M58 A;  2P0P A;  2E5Q A;  5EG2 A;  2KSS A;  2EJ9 A;  3MEA A;  1I81 A;  1Y7X A;  4M75 F;  1N8R C;  3OMG A;  2E10 A;  1X01 A;  3OS1 A;  4IUP A;  1VQ6 A;  3CBM A;  4BI8 B;  3M4Y A;  4N4H A;  4JDS A;  2QEX A;  3LGF A;  5LJ5 f;  2GQV A;  2ZPB B;  2DD5 B;  3GIB A;  4OB1 B;  2JUF A;  4ZGJ B;  1NJI U;  4XTY A;  4MFE A;  3KHI A;  1NE8 A;  2RHY A;  2YLB A;  3OYG A;  3VYH B;  4M75 B;  5GAN 7;  2EQK A;  3CME A;  2E1H A;  4M7D D;  4XU2 A;  2ZCF B;  2X35 A;  4M78 G;  2RK2 A;  5C6S A;  4BE2 A;  1K73 C;  5GAN 2;  1I5L A;  2DXC B;  3RMQ A;  1U8R A;  2OTJ T;  5GAM e;  1H3Z A;  3T9N A;  1BI3 A;  4QSH A;  1M1G A;  1M90 C;  3HFN A;  3UWN A;  1WJQ A;  4PJO A;  4JS5 A;  2DK3 A;  3OYY A;  5IT9 E;  4JX4 A;  3PT9 A;  3LWH A;  4IUT A;  2LX9 A;  3G7Z A;  3RIR A;  5LJ3 e;  2QXF A;  1UB4 A;  2QDY B;  3A8G B;  4BBS M;  4ZGD B;  3JCM W;  1YJ9 T;  2CZ6 B;  3CCU T;  2LTO A;  1VQN T;  5CKB A;  4Z02 A;  3JCM b;  2EJG A;  3CCM T;  3QBY A;  4E7I A;  2XDB A;  2D6F A;  1S72 T;  3EAE A;  2VGM A;  3DL1 A;  4MDW A;  4A4K A;  4F7U F;  3JB9 D;  2HNI A;  2XKO C;  4MDX A;  2ZZD A;  3MEW A;  5GAN j;  3JB9 J;  2E6N A;  4C8Q B;  4M77 E;  2RI2 A;  4BBR M;  4EMK A;  2QFZ A;  1U1S A;  4RCB A;  1D3B A;  2RB6 A;  3HL8 A;  1Q82 U;  3F70 A;  1Y96 B;  4J7I A;  4DOW A;  2V8K A;  3OQ5 A;  3VV0 A;  1N27 A;  4M77 C;  4F7U B;  5A0G A;  5GAM d;  4CI0 C;  3A8O B;  3L2U A;  4E7H A;  3FIF A;  3VUB A;  1NJI C;  3L2Z A;  2GCX A;  1YHQ A;  4M7D E;  1YIJ A;  2V8J A;  3FB9 A;  3EFR A;  2VUB A;  3BW1 A;  1BKB A;  3FJP A;  4KUI A;  5LJ3 d;  4C5I A;  5GAM h;  4MML A;  2JNG A;  3OYM A;  2DVE A;  2MAM A;  4M77 G;  3FC3 A;  4N4I A;  2HBP A;  2Y90 A;  3VUZ A;  3L2W A;  3HRU A;  3CD6 A;  1M1F A;  5A2Q E;  3V8L A;  3PIP A;  4C92 D;  5GAO q;  1QP2 A;  5LJ3 h;  3M57 A;  1KQS A;  3E1S A;  3J7A F;  2CZ7 B;  3CC2 T;  4C0D C;  3RMS A;  1B34 B;  1FX7 A;  4GLK A;  4IUR A;  3LH0 A;  4D6W A;  3JB9 I;  3CCR T;  3QSU A;  2QQ8 A;  1YJW T;  2K5L A;  3OYH A;  3CCQ A;  1M1K C;  2K4Y A;  2ZPG B;  3RES A;  1VIE A;  2DXU A;  3TU4 K;  2HQE A;  1PSF A;  3RER A;  3L2V A;  5AYF A;  2K5I A;  1OZ3 A;  2RJD A;  2O4X A;  3PGG A;  3BG3 A;  3QYH B;  3QII A;  3CCE T;  1O9S A;  4IUV A;  5GAN g;  2ZPF B;  2Y4Y A;  1YJN T;  4HCC A;  2P0Q A;  2KR6 A;  1KHI A;  2ZPI B;  2E64 A;  3ME9 A;  2LNV A;  4M75 E;  3TW6 A;  3QG1 A;  4A53 A;  2DXT A;  3GLX A;  4AKI A;  5CQX A;  1Q82 C;  2XIC A;  2LDM A;  4PJO G;  3JCM V;  4HKE A;  3OYF A;  2JN0 A;  4ME7 A;  3CCV T;  4XTW A;  4FM4 B;  1W2B A;  5CVI A;  1V29 B;  4M75 C;  1KHC A;  4HCZ A;  3HP9 A;  1SSF A;  3PTA A;  1W2B S;  5LJ3 f;  4L5G A;  1HK9 A;  2RHZ A;  1GXI E;  4C0F A;  3CBO A;  2A3L A;  1DJ7 B;  3P8D A;  2XK0 A;  1YI2 A;  4RG2 A;  3OB9 A;  2DTI A;  3MP1 A;  3S6W A;  3QPH A;  1XOV A;  1BIA A;  2LCC A;  4BAC A;  3H6Z A;  2F5T X;  1UGP B;  1LOJ A;  1WPY A;  3DLL A;  1VQK T;  3QYG B;  1X6O A;  2VXE A;  3JCM c;  4XTU A;  2KMT A;  4DQ2 A;  3NTK A;  4BUG A;  4M7A D;  1VQ5 A;  1FWZ A;  2KVQ G;  4X34 A;  3CCS A;  3PMI A;  5IAY A;  4QQD A;  1G3Y A;  2R57 A;  5LL6 S;  3RKY A;  1NZ9 A;  2YHT A;  4MIM A;  4OVA A;  2XID A;  5GMK h;  3M9Q A;  2BS2 A;  3HFO A;  3CC7 A;  2X4X A;  2I2L A;  4RKU E;  2RHX A;  3I55 A;  1WGS A;  2QI2 A;  4OGE A;  4XU3 A;  2WJ9 A;  4B9W A;  2FB7 A;  2RM4 A;  2PUK B;  3P8H A;  5A0L A;  3ZBD A;  5HY6 A;  3G4S A;  4C8Q C;  2QA4 T;  4F7U E;  1FKM A;  3HO8 A;  1R8O B;  1H64 1;  3QYE A;  2DIQ A;  2QQ9 A;  3NTH A;  1WNL A;  3VKG A;  3CC4 T;  3INZ A;  4M77 A;  1KC8 U;  1QLB A;  4O6J A;  3A8M B;  5LJ5 j;  3J80 E;  3QZ9 B;  4HNV A;  3FDR A;  4M78 D;  3M55 A;  2DIG A;  3EFS A;  4XU0 A;  3R6O A;  3CMA T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...