3X26B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 5 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x26B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x26B02
2ZPEB 3A8LB 4ZGJB 1AHJB 2DXCB 3QYGB 2PU9B 4KT0E 3HHTB 2DXBB 2WSEE 4OB3B 2D0QB 3X24B 2CZ0B 1UGPB 2WSFE 2PUOB 2ZPHB 4RKUE 3QXEB 1UGQB 1IREB 1QP3A 2ZPBB 2DPPB 3VYHB 3LW5E 3X25B 4OB2B 4ZGEB 3A8MB 4Y28E 1JB0E 2PVDB 2ZCFB 1V29B 2PVGB 1UGSB 2CYZB 2O01E 4OB0B 2DXBA 2CZ1B 1DJ7B 4OB1B 3A8HB 5L8RE 3X28B 3A8OB 2ZPFB 3VYGA 1PSFA 4XK8E 3WVEB 1PSEA 3QZ5B 2WSCE 3VYGB 2DXCA 2CZ7B 2ZPIB 3QZ9B 3WVDB 3X26B 2DD4A 3X20B 4FM4B 4L6V5 2QDYB 2AHJB 2DD5A 2ZPGB 1QP2A 2PUKB 2PVOB 2DD5B 4ZGDB 2ZZDB 1UGRB 3QYHB 2CZ6B 1GXIE 2DD4B 2ZZDA 3A8GB
chains in the Genus database with same CATH superfamily
1QVGP 1KC8R 3M55A 5D6YA 5IHIA 2KK4A 4ME7A 1UNLD 2EKOA 2EVRA 4BE1A 3HZJA 2LCCA 1MHNA 4PK4A 3CCMT 5GAN2 1I8FA 2J06A 3X24B 5LJ3e 2CZ0B 2WIHB 4BCIB 2WSFE 2EYYA 4RTXA 1PRMC 2EYWA 2XICA 2CP2A 4OGCA 3EFRA 4RMOA 3C0CA 3MIAB 3HFNA 3SHWA 1BI1A 2MK5A 1QMCA 3FJPA 4CC2A 1XQHA 1AWWA 1YHQT 1NM7A 4EOPB 2NUTB 1VQNQ 1IHWA 2EW3A 4IUPA 4LD6A 3CCMQ 3WXMB 4F70B 5KE3A 5FWCA 4BCPB 1LPLA 1D0YA 4N4IA 3L2RA 4QVCA 4YC3B 4F7UE 1K73C 1MMGA 3CCSA 1M8MA 4BCNB 1O9SA 1PHTA 2J6KA 2KXDA 2WPAB 1SSFA 1FX7A 3EGDB 1VQ8A 4ZTJA 4CFXB 1HXDA 4P5NA 1VYVA 2WHBB 3CBOA 2VB6A 3TU4K 2AZSA 1X69A 4OF1A 1R0CB 1VQMT 2DERA 2HEQA 3QHRB 2BE9B 2OAUA 2Y4XA 3JCMe 3VUBA 1K9MC 4M75D 2W99A 2RK1A 5GAOr 4BCMB 5CO7A 4M7DA 4JX6A 4BD3A 2L89A 4KULA 2XKOC 2JXBA 4PJJA 3NDQA 4JX5A 5GAN5 2QEXT 2RF0A 4LUEA 5GJWB 4N4GA 1D3BB 4BCHB 2K5FA 3QHWB 1GBRA 2A08A 1VQKT 4M77G 1I0CA 4AKGA 2X4WA 1GXIE 2DL3A 4HXJA 2NYSA 5HBHB 1NLOC 1MGQA 4EOMB 2DJQA 2RO0A 4KRDB 4A4KA 2DTHA 3BE3A 4HCZA 4FYVB 5GMKl 3QKJA 1AISB 3EAEA 2K4YA 5DLQE 2B86A 1VQKQ 9ATCB 5LQFB 4M75C 3EOCB 2MF2A 1VQKA 3QWXX 2FRYA 2MIOA 3HFOA 4M7DD 2BTTA 1S72Q 4CRIA 2EQIA 4MDXA 1HYOA 2EWNA 4M78C 3L2VA 2JZ2A 3S3MA 1YHQQ 1ZA1B 4K11A 2PJQA 1QP3A 1MNEA 2J7IA 4GBQA 2IG0A 3RMSA 2IPOB 1IXDA 2RQWA 1RACB 4A4FA 1X6OA 4PJOD 5FU6C 1YIJA 1OL1B 1YN8A 1G3SA 3QHSA 1SHGA 4CC4B 2PVDB 1WJSA 1OV3A 2C06A 2HNIA 1B3QA 3EHQA 4Z6YA 2ED1A 2EFIA 3H0IA 2DJZA 1KSWA 2A28A 2CZ1B 4PJOE 3ZFJA 4E7JA 4QKUA 1R0BG 2DEQA 4ESRA 1JJ2P 4EOLB 3V8KA 1TUGB 1D0XA 3L42A 4M7DB 4M7AC 1OQKA 4AI6A 3QO3A 5GMKj 4PL6A 4DBHA 2DYBA 1PSEA 2J6FA 1D0ZA 3VYGB 3SFMA 2C0TA 2M02A 2DE0X 2PMIB 3MEVA 2K2MA 2HSEB 1JOWA 3P8DA 1H4LD 1OX9A 1KQ1A 3QDFA 3TEEA 2ROLA 2V8JA 1D1AA 4HNVA 2Y4YA 4EORB 2JMAA 1K9AA 2YWWA 4CFWB 2W2HA 1EIFA 3JB9H 3A98A 2FL7A 4MFEA 2E4HA 1O9KA 1NPPA 3G71T 4HKEA 3CCMA 3EG2A 1YIJT 1YJNQ 4NC6A 1MV0B 2AK5A 1Q81R 2NUZA 1K73R 5M9OA 4EMGA 1TXQA 2UZDB 1Z9ZA 4DOWA 4ZGJB 2VGNA 2P0PA 1TS9A 1K76A 1GFDA 3CXCA 3CCVQ 4Q5WA 3RR6A 1OKVB 2GTJA 2PQWA 4PFZA 1B34A 4J7FA 1UGPB 1BBZA 3PMIA 1VQ4A 4PJOC 3QUIA 5GMKi 1X75C 2JM9A 2L3RA 4B9XA 5HK3A 3HRSA 4FW2A 2ZPBB 1XTDA 5LJ3g 2A0FB 1E6GA 2DTIA 2D6FA 3LLRA 3HTRA 2DIGA 4J9BA 1BKBA 3RKWA 1LNXA 1WGSA 4M77F 4R0KA 2CSIA 3UDCA 2CT3A 2A7YA 3JCMc 2JUFA 2YXYA 4C92G 5I2MA 5GAOn 2FHDA 2HDAA 5GAN6 2CYZB 1H1RB 3NTIA 3DLLA 4HL4A 2QEXA 1KQSA 4OB1B 5CVIA 2QEXQ 3A8HB 1BU1A 2LT1A 3X28B 4BY6B 2HQHA 1JO8A 4F7LB 4RODA 1RL2A 3C95A 3VYGA 2FPFA 4J83A 2LCSA 3F70A 1H27B 4C5EA 1K9MU 4HT8A 4BCQD 2JTEA 4OR5B 5KCOA 3OS2A 5KYNA 3S3NA 1OIYB 4RTTA 3J81E 1H28B 4C92A 1VQ8T 2I53A 3FJ5A 1BCMA 3VS5A 3JB9G 4BY6C 2GF7A 1X6GA 2A36A 5IHKA 1FMVA 3H0FA 1VQNA 1M1KU 1Y96A 1UDLA 2ECZA 4WCIA 4HLQA 5IN1A 2BS2A 1JSUB 1N9RA 1Y96B 4AKIA 4AKHA 2QF7A 3CCRA 2R7GA 5EFQB 2JN0A 5FLXE 3AHUA 3EFOB 3BHTB 2H8HA 4KT0E 1H641 1C1AA 5C6SA 2HSPA 4DBRA 5GMKh 2E65A 2KE9A 2DMEA 2I40B 3G4ST 1OL2B 2HBWA 2EPDA 1NEGA 1N5ZA 1VQLQ 5LJ5f 3I55A 1BIBA 2HL3A 4QT7A 2QA4A 1LVKA 1X2KA 2QA4Q 4EPCA 4G6LB 2R5MA 4ELYC 1Q82R 3QG1A 3L2ZA 4M78F 3TREA 3TNWB 1VQ5Q 4F6SB 4LXCA 2RHZA 2EJFA 1Q7YR 2LDMA 4UN0A 2WMAB 2UZEB 2JS2A 1E9HB 2FG0A 4FU6A 3TNIB 1CSKA 5IF1B 3GOXA 4IUTA 2KRNA 2MOXA 5EG2A 3MEWA 2V8KA 4LN2A 2M1HA 3CD6T 2XMFA 2G9XB 1D09B 1B7TA 5L2WB 4HCCA 3HPWA 5HY6A 4BY7X 1OOTA 1ENWA 2RJFA 2X9HA 4OMFB 4NL2A 3M53A 3GBQA 3O5ZA 2GFAA 3EG1A 2QQ8A 3QSUA 1UHCA 2WSCE 4HNTA 2RK2A 1UNGD 2UZLB 2CH4A 1WPYA 3EG0A 1NYGA 4BY1X 2WXVB 2QAZA 3CMEA 2JJ9A 2HQEA 4C92E 3VKHA 4JPBW 2WACA 5A2QE 5GANg 4BCGB 3M9QA 4C92F 4B6MA 3J7AF 4IUVA 4UC4A 2ZZDA 3I35A 3UPUA 3CCRT 4LNPA 2OAWA 4EC9B 2G3RA 2QGSA 4F7UA 4D6WA 3M0RA 1Q82U 4QQ6A 1FWZA 1P92A 2F2WA 2QQAA 1VQ7A 4EOJB 4J9GA 1WHJA 2OTLA 2DFUA 4B9WA 3PO3S 1VQ8Q 2M51A 2FB7A 4M7DG 2QDLA 4L5GA 2F5KA 4FYYB 3OBYA 1QLBA 3NGPA 1M1KC 2VV5A 1WXUA 4EOKB 1G3TA 2DVEA 3SWNB 5LMKB 2HZYA 2F1LA 2KMTA 2VYTA 3POMA 2CGHA 5HCKA 2W0ZA 4C92B 4BCOB 1FXXA 2WJ9A 2RI2A 1PNJA 3PE0A 5LJ5e 1PKDB 2K3BA 2MMPA 3VUZA 3BDUA 1T3SA 4BCQB 5CYIB 2RQUA 5LJ3j 1KC8U 5GMKe 1G83A 2K7AA 2XK0A 1Q95G 3META 1UJ0A 2NUPA 2AT1B 1ARKA 3TNHB 2DTOA 3OW2S 3KXTA 1H24B 4M75G 4MZPA 4KH1B 1RLPC 4DA4A 3HBLA 4A4GA 1NYFA 1OX8A 2RA2A 1VIEA 2KR6A 1G3YA 1Y57A 1RAIB 3UT1A 1YIJQ 4BCJB 1T0HA 4J9EA 3TVTA 3NTKA 3QBYA 1QVFP 2QDYB 1M4ZA 4FCYA 1GL5A 5KH6A 1VYTA 4QVDA 4CRLB 2WMBB 3M0UA 3E9FA 1M27C 3CEYA 4RCBA 2LQKA 3CCQT 4PKCC 2KAFA 1C6VX 4WTOB 3VS1A 4AFZC 1RABB 4DEYA 4D8DA 3MCAB 1SRLA 3C94A 3G71A 1N8RR 2KR3A 2CUBA 2DXBB 5FU6B 1VQ5T 2D0QB 2EIFA 5GAN4 4ELJA 5FROA 2HBPA 4PJOA 5J26A 2LNVA 3OYGA 3HKSA 3QIIA 3EFOA 2F2XA 4A53A 3CPWA 4V2SA 2ESWA 3S6WA 3BHVB 1K73U 4M7AD 2EUFA 3B57A 4Y72B 2L8DA 5GAMh 4M77E 1YBYA 6AT1B 2KY9A 2E12A 3FC3A 1AT1B 2O88A 5HBEB 2RH2A 4EMHA 3CCET 4KH0B 3O8VA 3L1AA 4IMYB 2KEAA 1GCQA 2PNIA 4FYXB 2X4XA 2E64A 1O75A 2O01E 3BLHB 1V1CA 1YJWA 3JCMQ 4OGEA 1Q7YC 3HRUA 3RBBB 4C0DB 2P4TA 1BYMA 2MPXC 2DXUA 4EIKA 4MMKA 3I9QA 2DETA 4AG1C 4FYWB 1BK2A 1U3OA 2NUTA 1UG1A 3JCMg 1H1SB 3DDQB 4ATOA 2DD4A 2DL5A 1VQ4Q 3HL8A 3CMEQ 2BE7D 2ED0A 1YJ9Q 2AHJB 4ROEA 2EQMA 3OYJA 1VQ7Q 2FPEA 3CPFA 1LJOA 4M77D 5ECAA 1WI7A 4BE0A 2NWMA 5LJ3d 1VUBA 5FU7B 3CCUA 5LJ3f 4XTWA 3V7SA 1XO2A 1QVPA 2EGEA 5I22A 3OYEA 4J6XA 1K4US 1AWJA 1NEBA 2ZPEB 3JCMb 1C0MA 3ME9A 2JNGA 2JM8A 2E1HA 2E5QA 2WSEE 4DBQA 3PT9A 1ZX6A 2JT4A 2RPNA 3OYAA 1QLYA 4C8QG 2RQTA 2BKZB 3KBGA 2K79A 2CP5A 3CPWS 1HK9A 2IN3A 2W9ZA 1VQOA 3DOGB 3PMTA 2PUOB 2QG9B 3IQLA 4M78B 4EDUA 3FRNA 3KUFA 1MMAA 2DL4A 4R55A 1VOMA 5D6XA 1KG1A 3OYMA 4CI0C 1BB9A 2RHUA 1NJIC 1OU8A 1N27A 3EGXA 5HNBB 3S3OA 3CCEQ 2RJEA 1RAHB 2VXEA 2K3YA 1YWOA 1K8AU 2QYZA 1KQSP 1ZLMA 1PG5B 1WHKA 4CFMB 4M75E 5LL6S 4J6WA 3CPWP 3E19A 3M03A 2KSSA 5KCHA 2NLUA 2EYQA 3M54A 1VIFA 2K5IA 2EQUA 5L23A 5LJ5g 2W9FA 3DL1A 1PD1A 1D1BA 1Z9QA 5DM7R 5BNJB 2IW8B 2CUDA 4A63B 2K2VA 1YHQA 1GFCA 2A37A 3M57A 5I21A 3EFSA 3MEAA 2XHCA 2DXCA 2KBTA 1NJIU 3ER0A 3NTHA 4Z89A 2QDJA 1ACMB 4M77B 4MDWA 4J5YA 5HBJB 5GANd 5CCAA 2GTOA 1AVZC 1EFNA 1RLQC 4CFVB 4LDVA 4EOSB 1XNIA 1I07A 4ZGDB 2RB6A 1Q81C 2RQRA 5CAIA 1Q86U 2EQKA 1ZHIA 4X1VA 2LRQA 3OMGA 2YHTA 2DILA 4QW2A 1VQPT 4WF2A 4QQGA 2BZXA 1E7OA 2GQIA 2PU9B 3URGA 3CC2T 4EONB 3BLQB 1SKUB 3SD4A 4A4HA 2X4YA 4AFUC 4BI8B 4N0AA 4F14A 2GNCA 1BCOA 1KJWA 3OYYA 4N0AC 5CQXA 3TSWA 2DL7A 2QGGA 4M75F 4J7IA 4HCBA 1YITT 3V7CA 1UGQB 2B9RA 4F7UF 3I56T 2DPPB 3VYHB 1M5Q1 1H3HA 2DRMA 1M90R 4JZ4A 5GAOl 1WA7A 4C0DC 3E1SA 1SF9A 2COZA 2LQ8A 2D9TA 4I3ZB 1VQPA 4JLIA 1W98B 3CCRQ 3ASKA 2X1NB 1N8RC 1AD6A 4M6VA 5EJCA 2PVGB 1AEYA 3LYIA 3OB9A 3C4SA 2A3LA 2O4XA 4MIMA 1U8RA 4YOOA 3RDVA 2OTLQ 1XJWB 1Y71A 3REAB 3G6EA 4F16A 2W96A 1W6XA 2FRWA 2VC8A 3CC2Q 2BS4A 1AOJA 1ZUUA 2C5XB 5AYFA 1G5VA 3CMAT 5CKHA 3TN8B 1RADB 3VS6A 4KRCB 2YUOA 5IHNA 2E6NA 2YDLA 5CIUA 1LOJA 3A8OB 2BZYA 2ZPFB 1QW1A 1QWFA 2DEUA 1JRIA 2DF6A 2V26A 4MMLA 1YFNA 4AT1B 1C9BA 3RKYA 1X43A 4JJNK 4PJOB 1QCOA 1JSTB 3DB4A 3CCVT 2FO0A 1AZEA 2IVWA 3GPLA 3QZ9B 3X26B 2D1XA 4FSXA 1I5LA 2COYA 5A0LA 5LJ5d 4ZTFA 2D8HA 2QQBA 2KRSA 1CKBA 1JJ2S 5HVYB 3M58A 4E7KA 2DMOA 4Y91A 4C8QC 3UA6A 2I0NA 3GP8A 2YRDA 4C0ZA 4C8QA 4ELZC 2RJDA 2W10A 5I11A 2FPDA 4BCFB 4X9CA 1RAAB 4KGXB 5HKCA 3MPUB 4DQ2A 4AG2C 1WDXA 4C5GA 4NL3A 1ZSZB 1FYNA 3CC7Q 4OMMA 2PHGA 5FU7C 3EGXB 3OSVA 4OMLA 4ZN3A 2ZGWA 2AZVA 4BCND 1VQOT 2RMOA 3JCMh 1W2BP 3OYKA 3OS0A 1Q7YU 3DDPB 1X01A 2CDTA 4XU1A 1S1NA 1B34B 1EZZB 3MO8A 1G2BA 4JJCA 4XTVA 2XG8D 4II1A 3CQTA 4EMKC 3Q1JA 5J39A 3JRZA 1FMKA 3M4GA 2LT4A 2E41A 3CCUT 1KHIA 4OMOA 3CC4T 3CCSQ 1ABOA 3I5SA 1JKWA 4RG2A 3VKGA 3JV3A 4CC7A 5HQ0B 3CBMA 2SRCA 1YI2T 1JXMA 2RI3A 2MWPA 3JB9J 1YJ9T 2GQVA 4M7DC 3OYBA 4BACA 2FZCB 1HSQA 4M7AB 2IW6B 5IT9E 4BCKB 2BZ8A 4JRKA 1WHLA 2M16A 5GAN3 2KT8A 1BU2A 1QVFA 4BI3A 4CC3A 2O2OA 1FMWA 3E9GA 1OPKA 2BS3A 2CSQA 2F2VA 3QJ6A 3CCLT 5LJ5j 2SEMA 5KYUA 2RHIA 3X20B 1TUDA 1UNHD 4A54A 2GGRA 2VKNA 3QYBA 2K5LA 4L6V5 2LNHB 3BG5A 1OI1A 2DD5A 3G33B 2DM1A 2RJCA 1QWEA 4IIOA 3MY5B 1F5QB 2DD5B 3QJYA 4PNOA 2O31A 2FYKA 1UECA 1M3AA 2Z0WA 1WHGA 3PVLA 3JCMf 4TTHA 2DBMA 4M7DE 4M77A 2IVXA 1M1GA 1W2BA 4XTXA 4PJLA 5KE2A 2C5VB 4M77C 4LDWA 3QYGB 4J6YA 3V8JA 1ZSGA 4TVRA 1K0SA 1TFBA 1VQ9T 1GUXA 4EMKA 4E7ZA 2CP3A 4IUQA 2CH4W 4OMPA 3JCMJ 1IB8A 1S72A 1UFFA 2CCHB 1SG5A 1OYXA 3MKDA 1MMDA 2ZPHB 3OA6A 3PIOA 3FEOA 1VYUA 2AKKA 4O6JA 1YI2Q 2QQ9A 1H3ZA 3REBB 2XDBA 1WYXA 3M0TA 3LW5E 3X25B 4LDUA 2L3PA 4J9DA 4PFPA 5KYYB 1N4MA 3VU3C 3CCUQ 4JLGA 1VQ6A 3SDZA 4ZGEB 3CCJT 1PWTA 1WQ7A 1PKTA 3RNJA 3GLXA 1YJNT 1QCFA 1JB0E 4RTVA 4X9DA 3O0GD 1N6AA 2KI7A 1YJ9A 3ULRB 2OJ2A 4XU0A 1YI2A 3L2WA 4IIMA 2FZKB 1Q86R 3OBWA 3OS1A 3CC4A 4FW1A 2F69A 2R57A 3M0PA 2QASA 1M90U 1ABQA 5GANj 1BIAA 4M78D 4M7AA 2X3XD 1IRXA 3EHRA 1YCSB 2XD0A 4XU3A 4YTLA 4JJBA 2LTOA 1M1KR 1QVFS 3QWLA 2BUDA 4MZMA 3LWIA 2OTJT 5GJVB 3LH0A 3JB9I 2X51A 2V1QA 4BUGA 2JOYA 3M4YA 4KRTA 2DBKA 3INZA 1WJQA 8AT1B 3TSZA 1K8AC 4PJMA 1VOLA 2QTXA 1RI9A 2C5NB 2VXFA 2HQXA 2L3QA 4EOIB 2C5OB 1WZOA 1H25B 1KK7A 2LZ6B 1NPRA 3LQ5B 1UGVA 4CFNB 5GAMj 2R58A 1ZSZC 2BPMB 4IKFA 1QP2A 1IHVA 2CCIB 2PUKB 3UA7A 3G1JA 4C8QD 4IUUA 1CKAA 1ZSZA 1YJNA 2CZ6B 4FX3B 1N8RU 4QSHA 1VQ6T 1WQWA 4E47A 4HA8A 1H1QB 3NFCA 2YUQA 3OYIA 2MWOA 1HD3A 1D1CA 2DVJA 3L2UA 4OB3B 2DK3A 4M75B 3FB9A 4BB7A 1V76A 5HK0A 1S72T 4JRPA 2IW9B 3P8BB 4F7UB 2KVQG 1VQ9A 2O9SA 4YOZA 5IXFA 5KYUB 1Q82C 3QXEB 1IREB 4C5HA 1FKMA 3VRZA 1KQSS 2YUNA 5KYYA 3RGFB 1KFZA 2EGAA 1WXTA 3OW2P 1SHFA 3CCVA 4J9CA 4RUGA 2LVMA 2LX7A 1RAGB 1M1FA 4M78E 2IIMA 2COWA 1UTIA 2ZCFB 1VQ9Q 3OW2A 2RHXA 3CMAA 2QGFB 2K3XA 2KXCA 3D7SB 3BFMA 1M2OA 2EJGA 2PZ1A 5J3BA 2BKDN 4Z88A 3CCLA 2YLCA 2XI9A 3GTMS 4HNUA 1UEBA 4NS5A 3CCLQ 3LX7A 1W1FA 5GAN7 2YUPA 3OYFA 3UWNA 1GCPA 4Y92A 1G3NC 1IZ6A 1RAEB 4XK8E 5CK9A 3OSSC 2V8IA 3H6ZA 4RCCA 2CZ7B 1M30A 2NUPB 3I56Q 3FDRA 3SWNC 4J9HA 5IAYA 4DEXA 4M7AG 1PD0A 3I56A 5FGKB 2KDSA 3OYHA 2PTKA 2E10A 2DL8A 2MAMA 2YRVA 5KYXA 4N4HA 4C92C 2JVVA 3EG9B 4E6RA 1TOVA 2PVOB 3EG3A 1BI3A 5GAMd 1UGRB 4EC8B 1ZBJA 2LMJA 3CD6Q 3HSBA 4IURA 1VYWB 3CC2A 1WNLA 2QQRA 1QCNA 3VS0A 1OZ2A 3PVQA 3MY1B 1G3WA 3I55Q 3PGGA 1AHJB 2RD1A 2FEIA 4HT9A 4XTZA 3BDLA 1VINA 2EYXA 3RIRA 3FIFA 3UF4A 5DY9A 3G6EQ 1GY3B 4HVWA 1GH6B 1GRIA 4JRQA 1OGUB 2QA4T 1VQMQ 2WIPB 3EG9A 1MUZA 3JCMX 1GBQA 1WXBA 5GAOm 4FT4A 2P0QA 2HL5C 4D8KA 2F5TX 2CS7A 4ZN1A 1JEGA 2KYBA 3VV0A 4ELLA 4AMCA 4OP0A 2LW4A 2RM4A 1UJYA 2V22B 1R77A 1KD1U 3F5XB 1IGUA 4JDSA 4PLLA 4BBRM 5KYWB 2G77A 2JTMA 2LJ0A 5AT1B 4F6UB 2LX9A 1NBEB 1VQNT 4DBFA 1I81A 1U1TA 3QPHA 1ZUKA 5DLOA 4RTUA 1SRMA 4C8QE 3EGDA 4M7AF 1JXOA 2LC4A 3DJBA 1M90C 2KYMA 4KBMB 2RNAA 2J05A 4C8QB 2UUEB 1MNDA 3TW7A 2P84A 3JCMP 1AWXA 3MHXA 2DLPA 2E5KA 3QZ5B 2QXFA 3MJXA 2DAQA 2P4RA 4M78G 1FINB 1Y7XA 4GY5A 2LJ1A 4E7HA 3FLGA 3G6ET 1IO6A 8ATCB 2HKNA 1OULA 2VUBA 1I1JA 4BI4A 3THKA 3PTAA 2ZZDB 3LH5A 3E2UA 4LDYA 3MI9B 1SSHA 1TSFA 1M3CA 2EBPA 2DRKA 2LCLA 4LE9A 2DD4B 4OGRB 4PFOA 4FIBA 3A8LB 4KUIA 3N5BB 5GAMg 1IGQA 2YSQA 3BW1A 4F7UG 3HHTB 2KRMA 1VA7A 4C92D 3H41A 2E3IA 2F2CA 4M7AE 2DIQA 3OYNA 4C8QF 1NZ9A 4PJOF 4RTZA 5D6WA 1X27A 4YOSA 1NLPC 4XU2A 4F7SB 1VQ4T 2JGZB 4RKUE 4JZ3A 2C6TB 4CFUB 3CMAQ 3H9NA 2OI3A 1QVGA 3OYCA 2PK9B 2QQSA 2X3WD 1I4K1 3RUXA 5DQVA 4X34A 2EQJA 3HP9A 2PK2A 5ICPB 1E7PA 2FZGB 4LDXA 1TD6A 3GNFB 3M56A 4KUDK 4FSSA 1TUCA 1T0JA 4OMQA 1W2BS 2GBQA 2CKKA 5GAMf 3JSCA 1JU5C 1KC8C 1JQQA 3HO8A 3RESA 4L59A 1X2QA 1TG0A 2WFYB 4BBSM 1ZA2B 5IHYA 1W4SA 2QTVA 4OB0B 4QVZA 2CP0A 2WEVB 3ZL7C 5D7UA 1TH7A 3V7RA 3OYLA 4F7NB 2L0AA 1NJIR 2CP7A 3LGFA 4BE2A 3CCEA 2AIRB 1OKWB 1D3UB 1MMNA 1PKSA 5IXBA 3DTOA 4M4ZA 5GAOq 1H8KA 4E7LA 5GAMe 2DZ9A 1M2VB 3LWHA 4Z02A 3CBPA 3M0QA 2HKQB 2RHYA 2ZPIB 1WLPB 1GCQC 2KQWA 4QQDA 1URCB 2DYIA 3RMQA 4ZNXA 3KFVA 3BG9A 2L3SA 3CCQQ 1K9MR 4F7JB 5KYWA 3BG3A 3JCMd 1N9SA 3M59A 4M78A 1VQ5A 2DX1A 2HMAA 2RQVA 3VS2A 2Y90A 3R6OA 4MZTA 5IDNB 4GLMA 7AT1B 4XTUA 3MP1A 2RN8A 4LD9K 4R56A 3A1PA 3OQ5A 3RERA 3L2QA 4LUDA 2K9GA 5FRMA 1XOVA 2OTJQ 3J80E 3CCQA 2DKGA 2GFUA 1RAFB 4BDYA 4JX4A 3A5ZB 4KGZB 4F6WB 4KGVB 1YNZA 2DXTA 2MYSA 5A0GA 1M3BA 2C0IA 3JB9D 4HVUA 4PJOG 2XIDA 4EOOB 1X6BA 4LOCA 1WHMA 1KIKA 4BCMD 4PLIA 1FVVB 3VS3A 2OTJA 3TW6A 1LCKA 4Z8AA 3QYEA 4OMNA 3G4SQ 5LJ5h 3G7ZA 4PJNA 1YWPA 1K0XA 2EKHA 4JS5A 4E2FB 5DQWA 3A8MB 4Y28E 1QKXA 4CXAB 3NHNA 1ZUYA 1WX6A 3JCMV 4ROCA 1ZBXA 2M9UA 2J6OA 5A0DA 4HCKA 1UGSB 2X4JA 2ROTA 1BI2A 2MCNA 2E6ZA 3CCJA 1KXUA 4J9FA 4E7SA 2H3JA 4FT2A 4ANJA 3DB3A 3ZEHA 3GNGA 2EGCA 2OX7A 3EH1A 1YITQ 3VS4A 3SWNA 4JS4A 3SEMA 1JJ2A 3H0HA 1NE8A 1TWBA 4C0FA 2JMCA 1VQMA 1E6HA 1YJWT 3AT1B 4J8OA 4FM4B 1B07A 3HRTA 3TCJA 2ZPGB 2I2LA 5CKBA 1O9KB 2YRCA 3K7AM 3EGUA 4BDZA 5IH2A 1PRLC 3VS7A 2VASA 3PNWC 3CC4Q 3CCST 3QYHB 3OY9A 1KD1C 3PIPA 1VQ7T 4RG8A 1QKWA 5GANe 4DOVA 4O5VA 3A8GB 4VUBA 1U5SA 4OVAA 2XU8A 2O4XB 2KNBB 4XAXB 2HCKA 1RUWA 1RI0A 1K8AR 1P5EB 5CR2A 1AD5A 4II5B 1M2VA 5CKDA 4C5IA 4M75A 1ZQ1A 2DO3A 4GLKA 3MEUA 3T9NA 1G8XA 2ATCB 2C0OA 2DZCA 4RTYA 5GANf 1SEMA 1I5OB 5GANh 1Q86C 4OB2B 2EYZA 3C12A 1QQJA 2XDDA 5GMKm 3M0SA 2HAXA 4BXXX 2LJ3A 1W70A 1V29B 5FRNA 1UE9A 3H4CA 1OI9B 4RTWA 5C0MA 3ZBDA 4JJDA 2L2PA 1BI0A 1UHFA 3CC7T 3DLMA 3I5RA 5I2SA 2ENMA 2DXBA 3CD6A 1YCYA 2XDPA 4NOYA 2JS0A 3VJPA 2P0KA 2EJ9A 1VQLT 5CQYA 2DNUA 3SB2A 4MFDA 3JAME 3OYDA 1TTHB 2RI5A 3P8HA 4HVVA 1KQ2A 4M7DF 1TU0B 1M9SA 3CXCS 1OPLA 2B8AA 4C0GA 3MP6A 1PCXA 2GCXA 4JUVA 4F04B 1VQ6Q 3WVDB 5KYXB 2K6DA 2E70A 3BLRB 2BIVA 3LGLA 3QWYA 3I55T 4EOQB 2MI6A 4JRIA 3UATA 1Q81U 1AWOA 1WFWA 5CEIB 1AZGB 3G4SA 2M0OA 2D8JA 5IDPB 5GAN8 1WJRA 1GUXB 1OIUB 4EMKB 3H8ZA 5CKFA 1QMZB 2R5AA 1R8OB 1D3BA 1H1PB 5FW9A 4ORZA 3V8LA 1OZ3A 2VWFA 2DXCB 2QFZA 2CREA 2KMGA 5EC7A 1WHHA 1H26B 2LQWA 1HJDA 1KHCA 2ABLA 2JTFA 4AFSC 1YJWQ 2YLBA 1T3LA 4J9IA 3R6NA 2E3HA 5CKEA 4A4EA 5LJ3h 3HB9A 1UB4A 2OTLT 1YP5A 3VRYA 1MV3A 2JW4A 1OEBA 5GAOp 3M5AA 1EX4A 3U23A 4F17A 3VKIA 2L5QA 1OU9A 2AKLA 3EJ1B 1H92A 3OS5A 1F1BB 2X35A 5FWBA 3CCJQ 4XTYA 1U06A 4NSTB 2VVKA 2HD0A 4AFQC 3EH2A 2FVUA 3OMCA 3NPFA 2V1RA 2LP5A 1K1ZA 2CJMB 2CP6A 2YT6A 3CMET 1DJ7B 3BY7A 3JCMW 2M0YA 1VQPQ 2C4GB 4CFUD 2K57A 5L8RE 2EAYA 1Y07A 3G71Q 1SPKA 1A0NB 1QVGS 4XQ3A 2KGTA 3MP8A 3JB9F 2KROA 1PSFA 3NMZC 3WVEB 1PC0A 2QI2A 2H3EB 1YITA 2KT1A 1WIEA 4E7IA 3CXCP 2UZBB 1U1SA 3TQ7P 1Y0MA 2CT4A 2LQNA 3PFSA 1VQLA 1VQOQ 1J3TA 2G6FX 2O9VA 2ZAEA 3RKXA 2D0NA 1ZP2A 3BHUB 3KHIA 1KD1R 2DA9A 2VGMA 5I5ZB 1NG2A 1JBMA 3QDRB 4FL6A 3CC7A 1UUEA 1M8VA 1PM3A 3GIBA 3DKMA 3EIDB 2QK0A 5ACBA 3GF5A
chains in the Genus database with same CATH topology
4F7UA 4D6WA 3A8LB 3M55A 1Q82U 5D6YA 4KUIA 4QQ6A 1FWZA 4X9CA 1P92A 3N5BB 2KK4A 4ME7A 5GAMg 5HKCA 3BW1A 2QQAA 2EKOA 4F7UG 4DQ2A 3HHTB 1VQ7A 4BE1A 4C92D 2OTLA 3HZJA 4C5GA 2LCCA 1MHNA 4B9WA 4NL3A 3CCMT 5GAN2 4M7AE 2DIQA 3OYNA 4C8QF 1NZ9A 4PJOF 1I8FA 2FB7A 3X24B 5LJ3e 4M7DG 2CZ0B 4L5GA 2F5KA 3OBYA 5FU7C 1QLBA 5D6WA 2WSFE 4XU2A 1M1KC 2VV5A 3OSVA 4ZN3A 2XICA 1VQ4T 2ZGWA 4OGCA 3EFRA 4RKUE 1VQOT 4RMOA 1G3TA 2DVEA 3SWNB 3JCMh 3HFNA 1QVGA 1BI1A 3OYCA 2QQSA 3OYKA 3RUXA 1I4K1 3OS0A 1Q7YU 3FJPA 1XQHA 4X34A 1YHQT 1X01A 2EQJA 2KMTA 3HP9A 2VYTA 4XU1A 2CGHA 1E7PA 4IUPA 4LD6A 1B34B 4C92B 3WXMB 5KE3A 4LDXA 3GNFB 3M56A 3MO8A 4KUDK 4N4IA 3L2RA 1FXXA 4XTVA 4QVCA 2XG8D 1W2BS 2WJ9A 2RI2A 2CKKA 5GAMf 4II1A 3JSCA 4EMKC 4F7UE 5LJ5e 1KC8C 3Q1JA 5J39A 3HO8A 3JRZA 1K73C 2MMPA 3M4GA 3VUZA 3RESA 3BDUA 2LT4A 3CCSA 4L59A 2E41A 1O9SA 5LJ3j 1KC8U 3CCUT 1KHIA 3CC4T 4BBSM 5GMKe 1SSFA 1FX7A 4M7DF 1W4SA 2XK0A 1VQ8A 4OB0B 3META 4QVZA 4RG2A 4ZTJA 1HXDA 3VKGA 4P5NA 1TH7A 3V7RA 3OYLA 3CBOA 3CBMA 3TU4K 1YI2T 2DTOA 3LGFA 2RI3A 3OW2S 4BE2A 3CCEA 2MWPA 3JB9J 1YJ9T 3KXTA 4OF1A 2GQVA 4M7DC 3OYBA 4M75G 4M7AB 4BACA 1VQMT 4MZPA 2OAUA 2Y4XA 3JCMe 5IT9E 3VUBA 1K9MC 4JRKA 4DA4A 4M75D 2RK1A 3HBLA 5GAOq 4E7LA 5CO7A 4A4GA 2M16A 5GAN3 5GAMe 2DZ9A 2RA2A 4JX6A 4BI3A 1QVFA 1VIEA 4BD3A 2KR6A 3LWHA 4Z02A 3CBPA 3E9GA 2L89A 1G3YA 2BS3A 2RHYA 2XKOC 4KULA 2ZPIB 3QJ6A 3CCLT 4JX5A 5GAN5 5LJ5j 2QEXT 3UT1A 2KQWA 2RHIA 4QQDA 3X20B 4N4GA 1D3BB 4A54A 3RMQA 3NTKA 3QBYA 3QYBA 2K5LA 2QDYB 1M4ZA 3BG5A 1OI1A 4L6V5 2K5FA 2DD5A 3BG9A 2RJCA 5KH6A 4QVDA 3BG3A 3JCMd 2DD5B 1N9SA 1VQKT 3M59A 3QJYA 4M78A 4PNOA 3E9FA 4M77G 2FYKA 1VQ5A 2Y90A 3R6OA 3CEYA 4MZTA 4RCBA 4AKGA 2LQKA 2X4WA 3JCMf 1GXIE 3CCQT 4XTUA 4M7DE 4PKCC 4M77A 2KAFA 3MP1A 1M1GA 1MGQA 4LD9K 1W2BA 4XTXA 2RO0A 4R56A 3MCAB 5KE2A 3C94A 3G71A 4M77C 3OQ5A 2DTHA 4A4KA 3RERA 4LDWA 3L2QA 3QYGB 4HCZA 4J6YA 3V8JA 3QKJA 5GMKl 3EAEA 5FRMA 1XOVA 3J80E 3CCQA 2DXBB 4TVRA 2K4YA 2DKGA 2GFUA 5FU6B 5DLQE 1VQ9T 4BDYA 4EMKA 4JX4A 3A5ZB 1VQ5T 4IUQA 2D0QB 2EIFA 4M75C 4ELJA 5FROA 2MF2A 5GAN4 2HBPA 2DXTA 3JCMJ 1VQKA 5A0GA 4PJOA 5J26A 2LNVA 1S72A 3OYGA 3HFOA 4M7DD 1OYXA 3JB9D 4CRIA 3HKSA 3QIIA 4PJOG 2XIDA 4MDXA 4LOCA 2ZPHB 2EWNA 4M78C 3PIOA 3OA6A 2JZ2A 4A53A 3L2VA 3FEOA 4PLIA 3CPWA 3S3MA 4O6JA 4V2SA 2QQ9A 1H3ZA 1QP3A 3S6WA 2XDBA 3RMSA 2IG0A 1K73U 2OTJA 3TW6A 3LW5E 4M7AD 3X25B 4LDUA 3QYEA 2L8DA 5GAMh 4M77E 5LJ5h 3G7ZA 4A4FA 1X6OA 3VU3C 4JLGA 4PJOD 1VQ6A 3SDZA 4ZGEB 1YBYA 2KY9A 5FU6C 4JS5A 1YIJA 1G3SA 2E12A 3QHSA 3FC3A 3CCJT 1WQ7A 1YJNT 3A8MB 3GLXA 4Y28E 1JB0E 4X9DA 2PVDB 2RH2A 1N6AA 3JCMV 1WJSA 1YJ9A 4EMHA 3CCET 5GAOr 4XU0A 3O8VA 1ZBXA 2M9UA 1YI2A 2C06A 2HNIA 3L1AA 3L2WA 5A0DA 4Z6YA 2X4XA 1UGSB 2E64A 1KQ2A 1O75A 2EFIA 2X4JA 2O01E 1YJWA 2DJZA 3JCMQ 3OBWA 1BI2A 2CZ1B 3OS1A 2E6ZA 4OGEA 3CC4A 2F69A 2R57A 3HRUA 3ZFJA 4E7JA 4C0DB 1Q7YC 3CCJA 2DEQA 1M90U 4PJOE 5GANj 1BIAA 2P4TA 4M78D 4M7AA 1BYMA 2H3JA 4FT2A 3V8KA 2XD0A 2DXUA 4XU3A 4YTLA 3DB3A 3ZEHA 2LTOA 3L42A 1QVFS 3QWLA 4M7DB 3GNGA 2BUDA 4M7AC 4AI6A 3QO3A 4MZMA 5GMKj 3LWIA 2OTJT 4PL6A 3LH0A 4MMKA 3JB9I 3SWNA 1PSEA 4BUGA 2JOYA 3M4YA 4JS4A 1JJ2A 3VYGB 3INZA 1WJQA 1NE8A 3SFMA 1K8AC 3MEVA 4C0FA 2QTXA 3JCMg 2VXFA 2HQXA 1VQMA 3P8DA 4ATOA 2DD4A 1KQ1A 3TEEA 1YJWT 2V8JA 3HL8A 4J8OA 4FM4B 4HNVA 2Y4YA 1NPRA 2AHJB 3HRTA 3TCJA 2ZPGB 2EQMA 2I2LA 5GAMj 5CKBA 3OYJA 2R58A 4IKFA 1QP2A 4BDZA 2PUKB 1EIFA 3JB9H 3CPFA 2FL7A 4MFEA 1LJOA 4M77D 4C8QD 4IUUA 4BE0A 5LJ3d 1NPPA 1VUBA 3PNWC 5FU7B 3G71T 3CCUA 4HKEA 3CCMA 5LJ3f 1YJNA 4XTWA 3V7SA 1QVPA 3CCST 3QYHB 2CZ6B 3OY9A 1YIJT 1N8RU 4QSHA 3PIPA 4NC6A 3OYEA 4RG8A 1KD1C 1VQ7T 1WQWA 1VQ6T 5GANe 4J6XA 4DOVA 4O5VA 4E47A 5M9OA 4EMGA 3A8GB 4HA8A 2ZPEB 4VUBA 4OVAA 2XU8A 2O4XB 3JCMb 3NFCA 3OYIA 3ME9A 4XAXB 4DOWA 2JNGA 4ZGJB 2VGNA 1RI0A 2MWOA 2E1HA 2P0PA 2E5QA 5CR2A 3L2UA 2WSEE 3PT9A 3CXCA 4OB3B 2DK3A 3OYAA 4Q5WA 4C8QG 4M75B 3FB9A 3KBGA 2PQWA 4BB7A 1B34A 5HK0A 3CPWS 1S72T 1HK9A 4J7FA 4JRPA 1UGPB 5CKDA 3P8BB 4C5IA 4F7UB 2KVQG 4M75A 1ZQ1A 2DO3A 3PMTA 4GLKA 2PUOB 3PMIA 3MEUA 1VQ4A 1VQOA 3QUIA 5GMKi 3T9NA 1X75C 1VQ9A 4PJOC 4M78B 4EDUA 2L3RA 1Q82C 3QXEB 4B9XA 5HK3A 3FRNA 3KUFA 2DZCA 3HRSA 1IREB 4C5HA 1FKMA 2ZPBB 1XTDA 5GANf 1KQSS 5LJ3g 4R55A 5D6XA 5GANh 1Q86C 1KG1A 2DTIA 2D6FA 4OB2B 3LLRA 4CI0C 3OYMA 3CCVA 2DIGA 2RHUA 3C12A 1NJIC 1BKBA 1N27A 2LVMA 3RKWA 2XDDA 1LNXA 5GMKm 1M1FA 1WGSA 4M77F 2HAXA 3S3OA 4M78E 2RJEA 3UDCA 2VXEA 2K3YA 1K8AU 2ZCFB 1V29B 5FRNA 2A7YA 3JCMc 2JUFA 3H4CA 3OW2A 2RHXA 5C0MA 3CMAA 4C92G 3ZBDA 2K3XA 4M75E 5I2MA 5LL6S 5GAOn 2FHDA 4J6WA 3BFMA 3E19A 1BI0A 2CYZB 5GAN6 2KSSA 3NTIA 5KCHA 3DLLA 4HL4A 2NLUA 3CC7T 3DLMA 2EYQA 2EJGA 5I2SA 2DXBA 3CD6A 3M54A 1YCYA 2XDPA 1VIFA 2K5IA 2EQUA 4NOYA 5J3BA 2BKDN 2QEXA 3CCLA 2YLCA 1KQSA 4OB1B 2XI9A 5CVIA 3VJPA 5LJ5g 3A8HB 4HNUA 1UEBA 4NS5A 3DL1A 2P0KA 2EJ9A 2LT1A 3LX7A 5GAN7 3X28B 4BY6B 5DM7R 3OYFA 3UWNA 1VQLT 5CQYA 2K2VA 3SB2A 4MFDA 3JAME 3OYDA 1YHQA 1IZ6A 1RL2A 3C95A 3VYGA 4XK8E 2RI5A 5CK9A 3OSSC 4J83A 2V8IA 3F70A 3P8HA 3H6ZA 3M57A 4C5EA 3EFSA 5I21A 4RCCA 3MEAA 1M9SA 2XHCA 1K9MU 3CXCS 2DXCA 2B8AA 2CZ7B 4C0GA 3MP6A 1NJIU 4HT8A 2GCXA 3FDRA 5KCOA 3ER0A 4JUVA 3SWNC 5IAYA 3NTHA 3OS2A 3S3NA 3J81E 4M7AG 3WVDB 3I56A 2QDJA 2E70A 4C92A 4M77B 4MDWA 3I55T 2BIVA 3LGLA 1VQ8T 2KDSA 3OYHA 4J5YA 2E10A 5GANd 2MI6A 4JRIA 2MAMA 2YRVA 5CCAA 4N4HA 4C92C 3JB9G 4BY6C 2JVVA 2GF7A 1Q81U 2PVOB 4LDVA 1XNIA 1VQNA 1BI3A 4ZGDB 3G4SA 1M1KU 2M0OA 5GAN8 1Y96A 2RB6A 5GAMd 1UGRB 1WJRA 4EMKB 3HSBA 1Q81C 5CAIA 4HLQA 4IURA 3H8ZA 2BS2A 5IN1A 1N9RA 5CKFA 3CC2A 1Y96B 4AKIA 1R8OB 4AKHA 2QF7A 1D3BA 1WNLA 2QQRA 2EQKA 2R5AA 1ZHIA 3CCRA 1Q86U 1OZ2A 2JN0A 5FLXE 3AHUA 2LRQA 3OMGA 1G3WA 3V8LA 2YHTA 1OZ3A 3PGGA 4QW2A 1AHJB 2DXCB 2QFZA 2RD1A 4QQGA 4WF2A 1VQPT 4HT9A 2KMGA 2PU9B 4KT0E 1H641 3URGA 4XTZA 3BDLA 3CC2T 3RIRA 5C6SA 1KHCA 3FIFA 3SD4A 2JTFA 4A4HA 2X4YA 5DY9A 5GMKh 2E65A 4BI8B 4N0AA 3G4ST 2YLBA 4JRQA 2QA4T 3OYYA 4N0AC 5CQXA 5CKEA 4M75F 4A4EA 5LJ3h 3HB9A 1UB4A 4J7IA 5LJ5f 3JCMX 5GAOm 2OTLT 4FT4A 1YITT 3I55A 4HCBA 1BIBA 2QA4A 3V7CA 2P0QA 1UGQB 4F7UF 5GAOp 3M5AA 3I56T 2DPPB 4EPCA 3VYHB 2R5MA 1M5Q1 4ELYC 3VKIA 3QG1A 3L2ZA 4M78F 3TREA 5GAOl 2L5QA 2F5TX 2CS7A 4C0DC 3E1SA 3OS5A 2RHZA 2LQ8A 2D9TA 2EJFA 2X35A 4XTYA 3VV0A 4ZN1A 1VQPA 4JLIA 2LDMA 2HD0A 4OP0A 2RM4A 3ASKA 1N8RC 1KD1U 4FU6A 4M6VA 2FVUA 3OMCA 5EJCA 2PVGB 3LYIA 4IUTA 4JDSA 4PLLA 3GOXA 4BBRM 3OB9A 3C4SA 5EG2A 2G77A 2JTMA 2A3LA 2O4XA 4MIMA 3MEWA 2V8KA 1U8RA 2LX9A 2M1HA 3CD6T 1Y71A 3G6EA 1VQNT 1I81A 3CMET 1U1TA 3QPHA 5DLOA 2VC8A 1DJ7B 3BY7A 3JCMW 2BS4A 4C8QE 4HCCA 4M7AF 3HPWA 5AYFA 5HY6A 1G5VA 2K57A 2LC4A 5CKHA 5L8RE 3CMAT 2RJFA 2E6NA 2EAYA 1Y07A 5CIUA 1LOJA 4OMFB 1M90C 3A8OB 4KBMB 2ZPFB 1QW1A 4NL2A 4XQ3A 3M53A 3MP8A 4C8QB 1JRIA 4MMLA 1QVGS 3JB9F 1PSFA 3TW7A 2GFAA 3WVEB 3RKYA 2QQ8A 4JJNK 2QI2A 3JCMP 3MHXA 3QSUA 4PJOB 3QZ5B 2QXFA 2WSCE 3DB4A 3CCVT 1YITA 2DAQA 4HNTA 2RK2A 4M78G 4E7IA 2IVWA 1U1SA 1WPYA 3GPLA 3QZ9B 3X26B 1Y7XA 4FSXA 4GY5A 4E7HA 1I5LA 3FLGA 3PFSA 1VQLA 5A0LA 3CMEA 3G6ET 2HQEA 4C92E 5LJ5d 3VKHA 2WACA 5A2QE 3RKXA 5GANg 2VUBA 3M9QA 4ZTFA 4C92F 2QQBA 3KHIA 2VGMA 4BI4A 1JJ2S 3M58A 4E7KA 1JBMA 3QDRB 4FL6A 3PTAA 3J7AF 3CC7A 1M8VA 4IUVA 4Y91A 4C8QC 2ZZDB 3GIBA 4LDYA 4UC4A 3DKMA 3GP8A 2LCLA 4C0ZA 2DD4B 2ZZDA 3UPUA 4C8QA 3CCRT 4M7DA 4ELZC 4FIBA 2RJDA 2G3RA 3GF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPE B;  3A8L B;  4ZGJ B;  1AHJ B;  2DXC B;  3QYG B;  2PU9 B;  4KT0 E;  3HHT B;  2DXB B;  2WSE E;  4OB3 B;  2D0Q B;  3X24 B;  2CZ0 B;  1UGP B;  2WSF E;  2PUO B;  2ZPH B;  4RKU E;  3QXE B;  1UGQ B;  1IRE B;  1QP3 A;  2ZPB B;  2DPP B;  3VYH B;  3LW5 E;  3X25 B;  4OB2 B;  4ZGE B;  3A8M B;  4Y28 E;  1JB0 E;  2PVD B;  2ZCF B;  1V29 B;  2PVG B;  1UGS B;  2CYZ B;  2O01 E;  4OB0 B;  2DXB A;  2CZ1 B;  1DJ7 B;  4OB1 B;  3A8H B;  5L8R E;  3X28 B;  3A8O B;  2ZPF B;  3VYG A;  1PSF A;  4XK8 E;  3WVE B;  1PSE A;  3QZ5 B;  2WSC E;  3VYG B;  2DXC A;  2CZ7 B;  2ZPI B;  3QZ9 B;  3WVD B;  3X26 B;  2DD4 A;  3X20 B;  4FM4 B;  4L6V 5;  2QDY B;  2AHJ B;  2DD5 A;  2ZPG B;  1QP2 A;  2PUK B;  2PVO B;  2DD5 B;  4ZGD B;  2ZZD B;  1UGR B;  3QYH B;  2CZ6 B;  1GXI E;  2DD4 B;  2ZZD A;  3A8G B; 
#chains in the Genus database with same CATH topology
 1QVG P;  1KC8 R;  3M55 A;  5D6Y A;  5IHI A;  2KK4 A;  4ME7 A;  1UNL D;  2EKO A;  2EVR A;  4BE1 A;  3HZJ A;  2LCC A;  1MHN A;  4PK4 A;  3CCM T;  5GAN 2;  1I8F A;  2J06 A;  3X24 B;  5LJ3 e;  2CZ0 B;  2WIH B;  4BCI B;  2WSF E;  2EYY A;  4RTX A;  1PRM C;  2EYW A;  2XIC A;  2CP2 A;  4OGC A;  3EFR A;  4RMO A;  3C0C A;  3MIA B;  3HFN A;  3SHW A;  1BI1 A;  2MK5 A;  1QMC A;  3FJP A;  4CC2 A;  1XQH A;  1AWW A;  1YHQ T;  1NM7 A;  4EOP B;  2NUT B;  1VQN Q;  1IHW A;  2EW3 A;  4IUP A;  4LD6 A;  3CCM Q;  3WXM B;  4F70 B;  5KE3 A;  5FWC A;  4BCP B;  1LPL A;  1D0Y A;  4N4I A;  3L2R A;  4QVC A;  4YC3 B;  4F7U E;  1K73 C;  1MMG A;  3CCS A;  1M8M A;  4BCN B;  1O9S A;  1PHT A;  2J6K A;  2KXD A;  2WPA B;  1SSF A;  1FX7 A;  3EGD B;  1VQ8 A;  4ZTJ A;  4CFX B;  1HXD A;  4P5N A;  1VYV A;  2WHB B;  3CBO A;  2VB6 A;  3TU4 K;  2AZS A;  1X69 A;  4OF1 A;  1R0C B;  1VQM T;  2DER A;  2HEQ A;  3QHR B;  2BE9 B;  2OAU A;  2Y4X A;  3JCM e;  3VUB A;  1K9M C;  4M75 D;  2W99 A;  2RK1 A;  5GAO r;  4BCM B;  5CO7 A;  4M7D A;  4JX6 A;  4BD3 A;  2L89 A;  4KUL A;  2XKO C;  2JXB A;  4PJJ A;  3NDQ A;  4JX5 A;  5GAN 5;  2QEX T;  2RF0 A;  4LUE A;  5GJW B;  4N4G A;  1D3B B;  4BCH B;  2K5F A;  3QHW B;  1GBR A;  2A08 A;  1VQK T;  4M77 G;  1I0C A;  4AKG A;  2X4W A;  1GXI E;  2DL3 A;  4HXJ A;  2NYS A;  5HBH B;  1NLO C;  1MGQ A;  4EOM B;  2DJQ A;  2RO0 A;  4KRD B;  4A4K A;  2DTH A;  3BE3 A;  4HCZ A;  4FYV B;  5GMK l;  3QKJ A;  1AIS B;  3EAE A;  2K4Y A;  5DLQ E;  2B86 A;  1VQK Q;  9ATC B;  5LQF B;  4M75 C;  3EOC B;  2MF2 A;  1VQK A;  3QWX X;  2FRY A;  2MIO A;  3HFO A;  4M7D D;  2BTT A;  1S72 Q;  4CRI A;  2EQI A;  4MDX A;  1HYO A;  2EWN A;  4M78 C;  3L2V A;  2JZ2 A;  3S3M A;  1YHQ Q;  1ZA1 B;  4K11 A;  2PJQ A;  1QP3 A;  1MNE A;  2J7I A;  4GBQ A;  2IG0 A;  3RMS A;  2IPO B;  1IXD A;  2RQW A;  1RAC B;  4A4F A;  1X6O A;  4PJO D;  5FU6 C;  1YIJ A;  1OL1 B;  1YN8 A;  1G3S A;  3QHS A;  1SHG A;  4CC4 B;  2PVD B;  1WJS A;  1OV3 A;  2C06 A;  2HNI A;  1B3Q A;  3EHQ A;  4Z6Y A;  2ED1 A;  2EFI A;  3H0I A;  2DJZ A;  1KSW A;  2A28 A;  2CZ1 B;  4PJO E;  3ZFJ A;  4E7J A;  4QKU A;  1R0B G;  2DEQ A;  4ESR A;  1JJ2 P;  4EOL B;  3V8K A;  1TUG B;  1D0X A;  3L42 A;  4M7D B;  4M7A C;  1OQK A;  4AI6 A;  3QO3 A;  5GMK j;  4PL6 A;  4DBH A;  2DYB A;  1PSE A;  2J6F A;  1D0Z A;  3VYG B;  3SFM A;  2C0T A;  2M02 A;  2DE0 X;  2PMI B;  3MEV A;  2K2M A;  2HSE B;  1JOW A;  3P8D A;  1H4L D;  1OX9 A;  1KQ1 A;  3QDF A;  3TEE A;  2ROL A;  2V8J A;  1D1A A;  4HNV A;  2Y4Y A;  4EOR B;  2JMA A;  1K9A A;  2YWW A;  4CFW B;  2W2H A;  1EIF A;  3JB9 H;  3A98 A;  2FL7 A;  4MFE A;  2E4H A;  1O9K A;  1NPP A;  3G71 T;  4HKE A;  3CCM A;  3EG2 A;  1YIJ T;  1YJN Q;  4NC6 A;  1MV0 B;  2AK5 A;  1Q81 R;  2NUZ A;  1K73 R;  5M9O A;  4EMG A;  1TXQ A;  2UZD B;  1Z9Z A;  4DOW A;  4ZGJ B;  2VGN A;  2P0P A;  1TS9 A;  1K76 A;  1GFD A;  3CXC A;  3CCV Q;  4Q5W A;  3RR6 A;  1OKV B;  2GTJ A;  2PQW A;  4PFZ A;  1B34 A;  4J7F A;  1UGP B;  1BBZ A;  3PMI A;  1VQ4 A;  4PJO C;  3QUI A;  5GMK i;  1X75 C;  2JM9 A;  2L3R A;  4B9X A;  5HK3 A;  3HRS A;  4FW2 A;  2ZPB B;  1XTD A;  5LJ3 g;  2A0F B;  1E6G A;  2DTI A;  2D6F A;  3LLR A;  3HTR A;  2DIG A;  4J9B A;  1BKB A;  3RKW A;  1LNX A;  1WGS A;  4M77 F;  4R0K A;  2CSI A;  3UDC A;  2CT3 A;  2A7Y A;  3JCM c;  2JUF A;  2YXY A;  4C92 G;  5I2M A;  5GAO n;  2FHD A;  2HDA A;  5GAN 6;  2CYZ B;  1H1R B;  3NTI A;  3DLL A;  4HL4 A;  2QEX A;  1KQS A;  4OB1 B;  5CVI A;  2QEX Q;  3A8H B;  1BU1 A;  2LT1 A;  3X28 B;  4BY6 B;  2HQH A;  1JO8 A;  4F7L B;  4ROD A;  1RL2 A;  3C95 A;  3VYG A;  2FPF A;  4J83 A;  2LCS A;  3F70 A;  1H27 B;  4C5E A;  1K9M U;  4HT8 A;  4BCQ D;  2JTE A;  4OR5 B;  5KCO A;  3OS2 A;  5KYN A;  3S3N A;  1OIY B;  4RTT A;  3J81 E;  1H28 B;  4C92 A;  1VQ8 T;  2I53 A;  3FJ5 A;  1BCM A;  3VS5 A;  3JB9 G;  4BY6 C;  2GF7 A;  1X6G A;  2A36 A;  5IHK A;  1FMV A;  3H0F A;  1VQN A;  1M1K U;  1Y96 A;  1UDL A;  2ECZ A;  4WCI A;  4HLQ A;  5IN1 A;  2BS2 A;  1JSU B;  1N9R A;  1Y96 B;  4AKI A;  4AKH A;  2QF7 A;  3CCR A;  2R7G A;  5EFQ B;  2JN0 A;  5FLX E;  3AHU A;  3EFO B;  3BHT B;  2H8H A;  4KT0 E;  1H64 1;  1C1A A;  5C6S A;  2HSP A;  4DBR A;  5GMK h;  2E65 A;  2KE9 A;  2DME A;  2I40 B;  3G4S T;  1OL2 B;  2HBW A;  2EPD A;  1NEG A;  1N5Z A;  1VQL Q;  5LJ5 f;  3I55 A;  1BIB A;  2HL3 A;  4QT7 A;  2QA4 A;  1LVK A;  1X2K A;  2QA4 Q;  4EPC A;  4G6L B;  2R5M A;  4ELY C;  1Q82 R;  3QG1 A;  3L2Z A;  4M78 F;  3TRE A;  3TNW B;  1VQ5 Q;  4F6S B;  4LXC A;  2RHZ A;  2EJF A;  1Q7Y R;  2LDM A;  4UN0 A;  2WMA B;  2UZE B;  2JS2 A;  1E9H B;  2FG0 A;  4FU6 A;  3TNI B;  1CSK A;  5IF1 B;  3GOX A;  4IUT A;  2KRN A;  2MOX A;  5EG2 A;  3MEW A;  2V8K A;  4LN2 A;  2M1H A;  3CD6 T;  2XMF A;  2G9X B;  1D09 B;  1B7T A;  5L2W B;  4HCC A;  3HPW A;  5HY6 A;  4BY7 X;  1OOT A;  1ENW A;  2RJF A;  2X9H A;  4OMF B;  4NL2 A;  3M53 A;  3GBQ A;  3O5Z A;  2GFA A;  3EG1 A;  2QQ8 A;  3QSU A;  1UHC A;  2WSC E;  4HNT A;  2RK2 A;  1UNG D;  2UZL B;  2CH4 A;  1WPY A;  3EG0 A;  1NYG A;  4BY1 X;  2WXV B;  2QAZ A;  3CME A;  2JJ9 A;  2HQE A;  4C92 E;  3VKH A;  4JPB W;  2WAC A;  5A2Q E;  5GAN g;  4BCG B;  3M9Q A;  4C92 F;  4B6M A;  3J7A F;  4IUV A;  4UC4 A;  2ZZD A;  3I35 A;  3UPU A;  3CCR T;  4LNP A;  2OAW A;  4EC9 B;  2G3R A;  2QGS A;  4F7U A;  4D6W A;  3M0R A;  1Q82 U;  4QQ6 A;  1FWZ A;  1P92 A;  2F2W A;  2QQA A;  1VQ7 A;  4EOJ B;  4J9G A;  1WHJ A;  2OTL A;  2DFU A;  4B9W A;  3PO3 S;  1VQ8 Q;  2M51 A;  2FB7 A;  4M7D G;  2QDL A;  4L5G A;  2F5K A;  4FYY B;  3OBY A;  1QLB A;  3NGP A;  1M1K C;  2VV5 A;  1WXU A;  4EOK B;  1G3T A;  2DVE A;  3SWN B;  5LMK B;  2HZY A;  2F1L A;  2KMT A;  2VYT A;  3POM A;  2CGH A;  5HCK A;  2W0Z A;  4C92 B;  4BCO B;  1FXX A;  2WJ9 A;  2RI2 A;  1PNJ A;  3PE0 A;  5LJ5 e;  1PKD B;  2K3B A;  2MMP A;  3VUZ A;  3BDU A;  1T3S A;  4BCQ B;  5CYI B;  2RQU A;  5LJ3 j;  1KC8 U;  5GMK e;  1G83 A;  2K7A A;  2XK0 A;  1Q95 G;  3MET A;  1UJ0 A;  2NUP A;  2AT1 B;  1ARK A;  3TNH B;  2DTO A;  3OW2 S;  3KXT A;  1H24 B;  4M75 G;  4MZP A;  4KH1 B;  1RLP C;  4DA4 A;  3HBL A;  4A4G A;  1NYF A;  1OX8 A;  2RA2 A;  1VIE A;  2KR6 A;  1G3Y A;  1Y57 A;  1RAI B;  3UT1 A;  1YIJ Q;  4BCJ B;  1T0H A;  4J9E A;  3TVT A;  3NTK A;  3QBY A;  1QVF P;  2QDY B;  1M4Z A;  4FCY A;  1GL5 A;  5KH6 A;  1VYT A;  4QVD A;  4CRL B;  2WMB B;  3M0U A;  3E9F A;  1M27 C;  3CEY A;  4RCB A;  2LQK A;  3CCQ T;  4PKC C;  2KAF A;  1C6V X;  4WTO B;  3VS1 A;  4AFZ C;  1RAB B;  4DEY A;  4D8D A;  3MCA B;  1SRL A;  3C94 A;  3G71 A;  1N8R R;  2KR3 A;  2CUB A;  2DXB B;  5FU6 B;  1VQ5 T;  2D0Q B;  2EIF A;  5GAN 4;  4ELJ A;  5FRO A;  2HBP A;  4PJO A;  5J26 A;  2LNV A;  3OYG A;  3HKS A;  3QII A;  3EFO A;  2F2X A;  4A53 A;  3CPW A;  4V2S A;  2ESW A;  3S6W A;  3BHV B;  1K73 U;  4M7A D;  2EUF A;  3B57 A;  4Y72 B;  2L8D A;  5GAM h;  4M77 E;  1YBY A;  6AT1 B;  2KY9 A;  2E12 A;  3FC3 A;  1AT1 B;  2O88 A;  5HBE B;  2RH2 A;  4EMH A;  3CCE T;  4KH0 B;  3O8V A;  3L1A A;  4IMY B;  2KEA A;  1GCQ A;  2PNI A;  4FYX B;  2X4X A;  2E64 A;  1O75 A;  2O01 E;  3BLH B;  1V1C A;  1YJW A;  3JCM Q;  4OGE A;  1Q7Y C;  3HRU A;  3RBB B;  4C0D B;  2P4T A;  1BYM A;  2MPX C;  2DXU A;  4EIK A;  4MMK A;  3I9Q A;  2DET A;  4AG1 C;  4FYW B;  1BK2 A;  1U3O A;  2NUT A;  1UG1 A;  3JCM g;  1H1S B;  3DDQ B;  4ATO A;  2DD4 A;  2DL5 A;  1VQ4 Q;  3HL8 A;  3CME Q;  2BE7 D;  2ED0 A;  1YJ9 Q;  2AHJ B;  4ROE A;  2EQM A;  3OYJ A;  1VQ7 Q;  2FPE A;  3CPF A;  1LJO A;  4M77 D;  5ECA A;  1WI7 A;  4BE0 A;  2NWM A;  5LJ3 d;  1VUB A;  5FU7 B;  3CCU A;  5LJ3 f;  4XTW A;  3V7S A;  1XO2 A;  1QVP A;  2EGE A;  5I22 A;  3OYE A;  4J6X A;  1K4U S;  1AWJ A;  1NEB A;  2ZPE B;  3JCM b;  1C0M A;  3ME9 A;  2JNG A;  2JM8 A;  2E1H A;  2E5Q A;  2WSE E;  4DBQ A;  3PT9 A;  1ZX6 A;  2JT4 A;  2RPN A;  3OYA A;  1QLY A;  4C8Q G;  2RQT A;  2BKZ B;  3KBG A;  2K79 A;  2CP5 A;  3CPW S;  1HK9 A;  2IN3 A;  2W9Z A;  1VQO A;  3DOG B;  3PMT A;  2PUO B;  2QG9 B;  3IQL A;  4M78 B;  4EDU A;  3FRN A;  3KUF A;  1MMA A;  2DL4 A;  4R55 A;  1VOM A;  5D6X A;  1KG1 A;  3OYM A;  4CI0 C;  1BB9 A;  2RHU A;  1NJI C;  1OU8 A;  1N27 A;  3EGX A;  5HNB B;  3S3O A;  3CCE Q;  2RJE A;  1RAH B;  2VXE A;  2K3Y A;  1YWO A;  1K8A U;  2QYZ A;  1KQS P;  1ZLM A;  1PG5 B;  1WHK A;  4CFM B;  4M75 E;  5LL6 S;  4J6W A;  3CPW P;  3E19 A;  3M03 A;  2KSS A;  5KCH A;  2NLU A;  2EYQ A;  3M54 A;  1VIF A;  2K5I A;  2EQU A;  5L23 A;  5LJ5 g;  2W9F A;  3DL1 A;  1PD1 A;  1D1B A;  1Z9Q A;  5DM7 R;  5BNJ B;  2IW8 B;  2CUD A;  4A63 B;  2K2V A;  1YHQ A;  1GFC A;  2A37 A;  3M57 A;  5I21 A;  3EFS A;  3MEA A;  2XHC A;  2DXC A;  2KBT A;  1NJI U;  3ER0 A;  3NTH A;  4Z89 A;  2QDJ A;  1ACM B;  4M77 B;  4MDW A;  4J5Y A;  5HBJ B;  5GAN d;  5CCA A;  2GTO A;  1AVZ C;  1EFN A;  1RLQ C;  4CFV B;  4LDV A;  4EOS B;  1XNI A;  1I07 A;  4ZGD B;  2RB6 A;  1Q81 C;  2RQR A;  5CAI A;  1Q86 U;  2EQK A;  1ZHI A;  4X1V A;  2LRQ A;  3OMG A;  2YHT A;  2DIL A;  4QW2 A;  1VQP T;  4WF2 A;  4QQG A;  2BZX A;  1E7O A;  2GQI A;  2PU9 B;  3URG A;  3CC2 T;  4EON B;  3BLQ B;  1SKU B;  3SD4 A;  4A4H A;  2X4Y A;  4AFU C;  4BI8 B;  4N0A A;  4F14 A;  2GNC A;  1BCO A;  1KJW A;  3OYY A;  4N0A C;  5CQX A;  3TSW A;  2DL7 A;  2QGG A;  4M75 F;  4J7I A;  4HCB A;  1YIT T;  3V7C A;  1UGQ B;  2B9R A;  4F7U F;  3I56 T;  2DPP B;  3VYH B;  1M5Q 1;  1H3H A;  2DRM A;  1M90 R;  4JZ4 A;  5GAO l;  1WA7 A;  4C0D C;  3E1S A;  1SF9 A;  2COZ A;  2LQ8 A;  2D9T A;  4I3Z B;  1VQP A;  4JLI A;  1W98 B;  3CCR Q;  3ASK A;  2X1N B;  1N8R C;  1AD6 A;  4M6V A;  5EJC A;  2PVG B;  1AEY A;  3LYI A;  3OB9 A;  3C4S A;  2A3L A;  2O4X A;  4MIM A;  1U8R A;  4YOO A;  3RDV A;  2OTL Q;  1XJW B;  1Y71 A;  3REA B;  3G6E A;  4F16 A;  2W96 A;  1W6X A;  2FRW A;  2VC8 A;  3CC2 Q;  2BS4 A;  1AOJ A;  1ZUU A;  2C5X B;  5AYF A;  1G5V A;  3CMA T;  5CKH A;  3TN8 B;  1RAD B;  3VS6 A;  4KRC B;  2YUO A;  5IHN A;  2E6N A;  2YDL A;  5CIU A;  1LOJ A;  3A8O B;  2BZY A;  2ZPF B;  1QW1 A;  1QWF A;  2DEU A;  1JRI A;  2DF6 A;  2V26 A;  4MML A;  1YFN A;  4AT1 B;  1C9B A;  3RKY A;  1X43 A;  4JJN K;  4PJO B;  1QCO A;  1JST B;  3DB4 A;  3CCV T;  2FO0 A;  1AZE A;  2IVW A;  3GPL A;  3QZ9 B;  3X26 B;  2D1X A;  4FSX A;  1I5L A;  2COY A;  5A0L A;  5LJ5 d;  4ZTF A;  2D8H A;  2QQB A;  2KRS A;  1CKB A;  1JJ2 S;  5HVY B;  3M58 A;  4E7K A;  2DMO A;  4Y91 A;  4C8Q C;  3UA6 A;  2I0N A;  3GP8 A;  2YRD A;  4C0Z A;  4C8Q A;  4ELZ C;  2RJD A;  2W10 A;  5I11 A;  2FPD A;  4BCF B;  4X9C A;  1RAA B;  4KGX B;  5HKC A;  3MPU B;  4DQ2 A;  4AG2 C;  1WDX A;  4C5G A;  4NL3 A;  1ZSZ B;  1FYN A;  3CC7 Q;  4OMM A;  2PHG A;  5FU7 C;  3EGX B;  3OSV A;  4OML A;  4ZN3 A;  2ZGW A;  2AZV A;  4BCN D;  1VQO T;  2RMO A;  3JCM h;  1W2B P;  3OYK A;  3OS0 A;  1Q7Y U;  3DDP B;  1X01 A;  2CDT A;  4XU1 A;  1S1N A;  1B34 B;  1EZZ B;  3MO8 A;  1G2B A;  4JJC A;  4XTV A;  2XG8 D;  4II1 A;  3CQT A;  4EMK C;  3Q1J A;  5J39 A;  3JRZ A;  1FMK A;  3M4G A;  2LT4 A;  2E41 A;  3CCU T;  1KHI A;  4OMO A;  3CC4 T;  3CCS Q;  1ABO A;  3I5S A;  1JKW A;  4RG2 A;  3VKG A;  3JV3 A;  4CC7 A;  5HQ0 B;  3CBM A;  2SRC A;  1YI2 T;  1JXM A;  2RI3 A;  2MWP A;  3JB9 J;  1YJ9 T;  2GQV A;  4M7D C;  3OYB A;  4BAC A;  2FZC B;  1HSQ A;  4M7A B;  2IW6 B;  5IT9 E;  4BCK B;  2BZ8 A;  4JRK A;  1WHL A;  2M16 A;  5GAN 3;  2KT8 A;  1BU2 A;  1QVF A;  4BI3 A;  4CC3 A;  2O2O A;  1FMW A;  3E9G A;  1OPK A;  2BS3 A;  2CSQ A;  2F2V A;  3QJ6 A;  3CCL T;  5LJ5 j;  2SEM A;  5KYU A;  2RHI A;  3X20 B;  1TUD A;  1UNH D;  4A54 A;  2GGR A;  2VKN A;  3QYB A;  2K5L A;  4L6V 5;  2LNH B;  3BG5 A;  1OI1 A;  2DD5 A;  3G33 B;  2DM1 A;  2RJC A;  1QWE A;  4IIO A;  3MY5 B;  1F5Q B;  2DD5 B;  3QJY A;  4PNO A;  2O31 A;  2FYK A;  1UEC A;  1M3A A;  2Z0W A;  1WHG A;  3PVL A;  3JCM f;  4TTH A;  2DBM A;  4M7D E;  4M77 A;  2IVX A;  1M1G A;  1W2B A;  4XTX A;  4PJL A;  5KE2 A;  2C5V B;  4M77 C;  4LDW A;  3QYG B;  4J6Y A;  3V8J A;  1ZSG A;  4TVR A;  1K0S A;  1TFB A;  1VQ9 T;  1GUX A;  4EMK A;  4E7Z A;  2CP3 A;  4IUQ A;  2CH4 W;  4OMP A;  3JCM J;  1IB8 A;  1S72 A;  1UFF A;  2CCH B;  1SG5 A;  1OYX A;  3MKD A;  1MMD A;  2ZPH B;  3OA6 A;  3PIO A;  3FEO A;  1VYU A;  2AKK A;  4O6J A;  1YI2 Q;  2QQ9 A;  1H3Z A;  3REB B;  2XDB A;  1WYX A;  3M0T A;  3LW5 E;  3X25 B;  4LDU A;  2L3P A;  4J9D A;  4PFP A;  5KYY B;  1N4M A;  3VU3 C;  3CCU Q;  4JLG A;  1VQ6 A;  3SDZ A;  4ZGE B;  3CCJ T;  1PWT A;  1WQ7 A;  1PKT A;  3RNJ A;  3GLX A;  1YJN T;  1QCF A;  1JB0 E;  4RTV A;  4X9D A;  3O0G D;  1N6A A;  2KI7 A;  1YJ9 A;  3ULR B;  2OJ2 A;  4XU0 A;  1YI2 A;  3L2W A;  4IIM A;  2FZK B;  1Q86 R;  3OBW A;  3OS1 A;  3CC4 A;  4FW1 A;  2F69 A;  2R57 A;  3M0P A;  2QAS A;  1M90 U;  1ABQ A;  5GAN j;  1BIA A;  4M78 D;  4M7A A;  2X3X D;  1IRX A;  3EHR A;  1YCS B;  2XD0 A;  4XU3 A;  4YTL A;  4JJB A;  2LTO A;  1M1K R;  1QVF S;  3QWL A;  2BUD A;  4MZM A;  3LWI A;  2OTJ T;  5GJV B;  3LH0 A;  3JB9 I;  2X51 A;  2V1Q A;  4BUG A;  2JOY A;  3M4Y A;  4KRT A;  2DBK A;  3INZ A;  1WJQ A;  8AT1 B;  3TSZ A;  1K8A C;  4PJM A;  1VOL A;  2QTX A;  1RI9 A;  2C5N B;  2VXF A;  2HQX A;  2L3Q A;  4EOI B;  2C5O B;  1WZO A;  1H25 B;  1KK7 A;  2LZ6 B;  1NPR A;  3LQ5 B;  1UGV A;  4CFN B;  5GAM j;  2R58 A;  1ZSZ C;  2BPM B;  4IKF A;  1QP2 A;  1IHV A;  2CCI B;  2PUK B;  3UA7 A;  3G1J A;  4C8Q D;  4IUU A;  1CKA A;  1ZSZ A;  1YJN A;  2CZ6 B;  4FX3 B;  1N8R U;  4QSH A;  1VQ6 T;  1WQW A;  4E47 A;  4HA8 A;  1H1Q B;  3NFC A;  2YUQ A;  3OYI A;  2MWO A;  1HD3 A;  1D1C A;  2DVJ A;  3L2U A;  4OB3 B;  2DK3 A;  4M75 B;  3FB9 A;  4BB7 A;  1V76 A;  5HK0 A;  1S72 T;  4JRP A;  2IW9 B;  3P8B B;  4F7U B;  2KVQ G;  1VQ9 A;  2O9S A;  4YOZ A;  5IXF A;  5KYU B;  1Q82 C;  3QXE B;  1IRE B;  4C5H A;  1FKM A;  3VRZ A;  1KQS S;  2YUN A;  5KYY A;  3RGF B;  1KFZ A;  2EGA A;  1WXT A;  3OW2 P;  1SHF A;  3CCV A;  4J9C A;  4RUG A;  2LVM A;  2LX7 A;  1RAG B;  1M1F A;  4M78 E;  2IIM A;  2COW A;  1UTI A;  2ZCF B;  1VQ9 Q;  3OW2 A;  2RHX A;  3CMA A;  2QGF B;  2K3X A;  2KXC A;  3D7S B;  3BFM A;  1M2O A;  2EJG A;  2PZ1 A;  5J3B A;  2BKD N;  4Z88 A;  3CCL A;  2YLC A;  2XI9 A;  3GTM S;  4HNU A;  1UEB A;  4NS5 A;  3CCL Q;  3LX7 A;  1W1F A;  5GAN 7;  2YUP A;  3OYF A;  3UWN A;  1GCP A;  4Y92 A;  1G3N C;  1IZ6 A;  1RAE B;  4XK8 E;  5CK9 A;  3OSS C;  2V8I A;  3H6Z A;  4RCC A;  2CZ7 B;  1M30 A;  2NUP B;  3I56 Q;  3FDR A;  3SWN C;  4J9H A;  5IAY A;  4DEX A;  4M7A G;  1PD0 A;  3I56 A;  5FGK B;  2KDS A;  3OYH A;  2PTK A;  2E10 A;  2DL8 A;  2MAM A;  2YRV A;  5KYX A;  4N4H A;  4C92 C;  2JVV A;  3EG9 B;  4E6R A;  1TOV A;  2PVO B;  3EG3 A;  1BI3 A;  5GAM d;  1UGR B;  4EC8 B;  1ZBJ A;  2LMJ A;  3CD6 Q;  3HSB A;  4IUR A;  1VYW B;  3CC2 A;  1WNL A;  2QQR A;  1QCN A;  3VS0 A;  1OZ2 A;  3PVQ A;  3MY1 B;  1G3W A;  3I55 Q;  3PGG A;  1AHJ B;  2RD1 A;  2FEI A;  4HT9 A;  4XTZ A;  3BDL A;  1VIN A;  2EYX A;  3RIR A;  3FIF A;  3UF4 A;  5DY9 A;  3G6E Q;  1GY3 B;  4HVW A;  1GH6 B;  1GRI A;  4JRQ A;  1OGU B;  2QA4 T;  1VQM Q;  2WIP B;  3EG9 A;  1MUZ A;  3JCM X;  1GBQ A;  1WXB A;  5GAO m;  4FT4 A;  2P0Q A;  2HL5 C;  4D8K A;  2F5T X;  2CS7 A;  4ZN1 A;  1JEG A;  2KYB A;  3VV0 A;  4ELL A;  4AMC A;  4OP0 A;  2LW4 A;  2RM4 A;  1UJY A;  2V22 B;  1R77 A;  1KD1 U;  3F5X B;  1IGU A;  4JDS A;  4PLL A;  4BBR M;  5KYW B;  2G77 A;  2JTM A;  2LJ0 A;  5AT1 B;  4F6U B;  2LX9 A;  1NBE B;  1VQN T;  4DBF A;  1I81 A;  1U1T A;  3QPH A;  1ZUK A;  5DLO A;  4RTU A;  1SRM A;  4C8Q E;  3EGD A;  4M7A F;  1JXO A;  2LC4 A;  3DJB A;  1M90 C;  2KYM A;  4KBM B;  2RNA A;  2J05 A;  4C8Q B;  2UUE B;  1MND A;  3TW7 A;  2P84 A;  3JCM P;  1AWX A;  3MHX A;  2DLP A;  2E5K A;  3QZ5 B;  2QXF A;  3MJX A;  2DAQ A;  2P4R A;  4M78 G;  1FIN B;  1Y7X A;  4GY5 A;  2LJ1 A;  4E7H A;  3FLG A;  3G6E T;  1IO6 A;  8ATC B;  2HKN A;  1OUL A;  2VUB A;  1I1J A;  4BI4 A;  3THK A;  3PTA A;  2ZZD B;  3LH5 A;  3E2U A;  4LDY A;  3MI9 B;  1SSH A;  1TSF A;  1M3C A;  2EBP A;  2DRK A;  2LCL A;  4LE9 A;  2DD4 B;  4OGR B;  4PFO A;  4FIB A;  3A8L B;  4KUI A;  3N5B B;  5GAM g;  1IGQ A;  2YSQ A;  3BW1 A;  4F7U G;  3HHT B;  2KRM A;  1VA7 A;  4C92 D;  3H41 A;  2E3I A;  2F2C A;  4M7A E;  2DIQ A;  3OYN A;  4C8Q F;  1NZ9 A;  4PJO F;  4RTZ A;  5D6W A;  1X27 A;  4YOS A;  1NLP C;  4XU2 A;  4F7S B;  1VQ4 T;  2JGZ B;  4RKU E;  4JZ3 A;  2C6T B;  4CFU B;  3CMA Q;  3H9N A;  2OI3 A;  1QVG A;  3OYC A;  2PK9 B;  2QQS A;  2X3W D;  1I4K 1;  3RUX A;  5DQV A;  4X34 A;  2EQJ A;  3HP9 A;  2PK2 A;  5ICP B;  1E7P A;  2FZG B;  4LDX A;  1TD6 A;  3GNF B;  3M56 A;  4KUD K;  4FSS A;  1TUC A;  1T0J A;  4OMQ A;  1W2B S;  2GBQ A;  2CKK A;  5GAM f;  3JSC A;  1JU5 C;  1KC8 C;  1JQQ A;  3HO8 A;  3RES A;  4L59 A;  1X2Q A;  1TG0 A;  2WFY B;  4BBS M;  1ZA2 B;  5IHY A;  1W4S A;  2QTV A;  4OB0 B;  4QVZ A;  2CP0 A;  2WEV B;  3ZL7 C;  5D7U A;  1TH7 A;  3V7R A;  3OYL A;  4F7N B;  2L0A A;  1NJI R;  2CP7 A;  3LGF A;  4BE2 A;  3CCE A;  2AIR B;  1OKW B;  1D3U B;  1MMN A;  1PKS A;  5IXB A;  3DTO A;  4M4Z A;  5GAO q;  1H8K A;  4E7L A;  5GAM e;  2DZ9 A;  1M2V B;  3LWH A;  4Z02 A;  3CBP A;  3M0Q A;  2HKQ B;  2RHY A;  2ZPI B;  1WLP B;  1GCQ C;  2KQW A;  4QQD A;  1URC B;  2DYI A;  3RMQ A;  4ZNX A;  3KFV A;  3BG9 A;  2L3S A;  3CCQ Q;  1K9M R;  4F7J B;  5KYW A;  3BG3 A;  3JCM d;  1N9S A;  3M59 A;  4M78 A;  1VQ5 A;  2DX1 A;  2HMA A;  2RQV A;  3VS2 A;  2Y90 A;  3R6O A;  4MZT A;  5IDN B;  4GLM A;  7AT1 B;  4XTU A;  3MP1 A;  2RN8 A;  4LD9 K;  4R56 A;  3A1P A;  3OQ5 A;  3RER A;  3L2Q A;  4LUD A;  2K9G A;  5FRM A;  1XOV A;  2OTJ Q;  3J80 E;  3CCQ A;  2DKG A;  2GFU A;  1RAF B;  4BDY A;  4JX4 A;  3A5Z B;  4KGZ B;  4F6W B;  4KGV B;  1YNZ A;  2DXT A;  2MYS A;  5A0G A;  1M3B A;  2C0I A;  3JB9 D;  4HVU A;  4PJO G;  2XID A;  4EOO B;  1X6B A;  4LOC A;  1WHM A;  1KIK A;  4BCM D;  4PLI A;  1FVV B;  3VS3 A;  2OTJ A;  3TW6 A;  1LCK A;  4Z8A A;  3QYE A;  4OMN A;  3G4S Q;  5LJ5 h;  3G7Z A;  4PJN A;  1YWP A;  1K0X A;  2EKH A;  4JS5 A;  4E2F B;  5DQW A;  3A8M B;  4Y28 E;  1QKX A;  4CXA B;  3NHN A;  1ZUY A;  1WX6 A;  3JCM V;  4ROC A;  1ZBX A;  2M9U A;  2J6O A;  5A0D A;  4HCK A;  1UGS B;  2X4J A;  2ROT A;  1BI2 A;  2MCN A;  2E6Z A;  3CCJ A;  1KXU A;  4J9F A;  4E7S A;  2H3J A;  4FT2 A;  4ANJ A;  3DB3 A;  3ZEH A;  3GNG A;  2EGC A;  2OX7 A;  3EH1 A;  1YIT Q;  3VS4 A;  3SWN A;  4JS4 A;  3SEM A;  1JJ2 A;  3H0H A;  1NE8 A;  1TWB A;  4C0F A;  2JMC A;  1VQM A;  1E6H A;  1YJW T;  3AT1 B;  4J8O A;  4FM4 B;  1B07 A;  3HRT A;  3TCJ A;  2ZPG B;  2I2L A;  5CKB A;  1O9K B;  2YRC A;  3K7A M;  3EGU A;  4BDZ A;  5IH2 A;  1PRL C;  3VS7 A;  2VAS A;  3PNW C;  3CC4 Q;  3CCS T;  3QYH B;  3OY9 A;  1KD1 C;  3PIP A;  1VQ7 T;  4RG8 A;  1QKW A;  5GAN e;  4DOV A;  4O5V A;  3A8G B;  4VUB A;  1U5S A;  4OVA A;  2XU8 A;  2O4X B;  2KNB B;  4XAX B;  2HCK A;  1RUW A;  1RI0 A;  1K8A R;  1P5E B;  5CR2 A;  1AD5 A;  4II5 B;  1M2V A;  5CKD A;  4C5I A;  4M75 A;  1ZQ1 A;  2DO3 A;  4GLK A;  3MEU A;  3T9N A;  1G8X A;  2ATC B;  2C0O A;  2DZC A;  4RTY A;  5GAN f;  1SEM A;  1I5O B;  5GAN h;  1Q86 C;  4OB2 B;  2EYZ A;  3C12 A;  1QQJ A;  2XDD A;  5GMK m;  3M0S A;  2HAX A;  4BXX X;  2LJ3 A;  1W70 A;  1V29 B;  5FRN A;  1UE9 A;  3H4C A;  1OI9 B;  4RTW A;  5C0M A;  3ZBD A;  4JJD A;  2L2P A;  1BI0 A;  1UHF A;  3CC7 T;  3DLM A;  3I5R A;  5I2S A;  2ENM A;  2DXB A;  3CD6 A;  1YCY A;  2XDP A;  4NOY A;  2JS0 A;  3VJP A;  2P0K A;  2EJ9 A;  1VQL T;  5CQY A;  2DNU A;  3SB2 A;  4MFD A;  3JAM E;  3OYD A;  1TTH B;  2RI5 A;  3P8H A;  4HVV A;  1KQ2 A;  4M7D F;  1TU0 B;  1M9S A;  3CXC S;  1OPL A;  2B8A A;  4C0G A;  3MP6 A;  1PCX A;  2GCX A;  4JUV A;  4F04 B;  1VQ6 Q;  3WVD B;  5KYX B;  2K6D A;  2E70 A;  3BLR B;  2BIV A;  3LGL A;  3QWY A;  3I55 T;  4EOQ B;  2MI6 A;  4JRI A;  3UAT A;  1Q81 U;  1AWO A;  1WFW A;  5CEI B;  1AZG B;  3G4S A;  2M0O A;  2D8J A;  5IDP B;  5GAN 8;  1WJR A;  1GUX B;  1OIU B;  4EMK B;  3H8Z A;  5CKF A;  1QMZ B;  2R5A A;  1R8O B;  1D3B A;  1H1P B;  5FW9 A;  4ORZ A;  3V8L A;  1OZ3 A;  2VWF A;  2DXC B;  2QFZ A;  2CRE A;  2KMG A;  5EC7 A;  1WHH A;  1H26 B;  2LQW A;  1HJD A;  1KHC A;  2ABL A;  2JTF A;  4AFS C;  1YJW Q;  2YLB A;  1T3L A;  4J9I A;  3R6N A;  2E3H A;  5CKE A;  4A4E A;  5LJ3 h;  3HB9 A;  1UB4 A;  2OTL T;  1YP5 A;  3VRY A;  1MV3 A;  2JW4 A;  1OEB A;  5GAO p;  3M5A A;  1EX4 A;  3U23 A;  4F17 A;  3VKI A;  2L5Q A;  1OU9 A;  2AKL A;  3EJ1 B;  1H92 A;  3OS5 A;  1F1B B;  2X35 A;  5FWB A;  3CCJ Q;  4XTY A;  1U06 A;  4NST B;  2VVK A;  2HD0 A;  4AFQ C;  3EH2 A;  2FVU A;  3OMC A;  3NPF A;  2V1R A;  2LP5 A;  1K1Z A;  2CJM B;  2CP6 A;  2YT6 A;  3CME T;  1DJ7 B;  3BY7 A;  3JCM W;  2M0Y A;  1VQP Q;  2C4G B;  4CFU D;  2K57 A;  5L8R E;  2EAY A;  1Y07 A;  3G71 Q;  1SPK A;  1A0N B;  1QVG S;  4XQ3 A;  2KGT A;  3MP8 A;  3JB9 F;  2KRO A;  1PSF A;  3NMZ C;  3WVE B;  1PC0 A;  2QI2 A;  2H3E B;  1YIT A;  2KT1 A;  1WIE A;  4E7I A;  3CXC P;  2UZB B;  1U1S A;  3TQ7 P;  1Y0M A;  2CT4 A;  2LQN A;  3PFS A;  1VQL A;  1VQO Q;  1J3T A;  2G6F X;  2O9V A;  2ZAE A;  3RKX A;  2D0N A;  1ZP2 A;  3BHU B;  3KHI A;  1KD1 R;  2DA9 A;  2VGM A;  5I5Z B;  1NG2 A;  1JBM A;  3QDR B;  4FL6 A;  3CC7 A;  1UUE A;  1M8V A;  1PM3 A;  3GIB A;  3DKM A;  3EID B;  2QK0 A;  5ACB A;  3GF5 A; 
#chains in the Genus database with same CATH homology
 4F7U A;  4D6W A;  3A8L B;  3M55 A;  1Q82 U;  5D6Y A;  4KUI A;  4QQ6 A;  1FWZ A;  4X9C A;  1P92 A;  3N5B B;  2KK4 A;  4ME7 A;  5GAM g;  5HKC A;  3BW1 A;  2QQA A;  2EKO A;  4F7U G;  4DQ2 A;  3HHT B;  1VQ7 A;  4BE1 A;  4C92 D;  2OTL A;  3HZJ A;  4C5G A;  2LCC A;  1MHN A;  4B9W A;  4NL3 A;  3CCM T;  5GAN 2;  4M7A E;  2DIQ A;  3OYN A;  4C8Q F;  1NZ9 A;  4PJO F;  1I8F A;  2FB7 A;  3X24 B;  5LJ3 e;  4M7D G;  2CZ0 B;  4L5G A;  2F5K A;  3OBY A;  5FU7 C;  1QLB A;  5D6W A;  2WSF E;  4XU2 A;  1M1K C;  2VV5 A;  3OSV A;  4ZN3 A;  2XIC A;  1VQ4 T;  2ZGW A;  4OGC A;  3EFR A;  4RKU E;  1VQO T;  4RMO A;  1G3T A;  2DVE A;  3SWN B;  3JCM h;  3HFN A;  1QVG A;  1BI1 A;  3OYC A;  2QQS A;  3OYK A;  3RUX A;  1I4K 1;  3OS0 A;  1Q7Y U;  3FJP A;  1XQH A;  4X34 A;  1YHQ T;  1X01 A;  2EQJ A;  2KMT A;  3HP9 A;  2VYT A;  4XU1 A;  2CGH A;  1E7P A;  4IUP A;  4LD6 A;  1B34 B;  4C92 B;  3WXM B;  5KE3 A;  4LDX A;  3GNF B;  3M56 A;  3MO8 A;  4KUD K;  4N4I A;  3L2R A;  1FXX A;  4XTV A;  4QVC A;  2XG8 D;  1W2B S;  2WJ9 A;  2RI2 A;  2CKK A;  5GAM f;  4II1 A;  3JSC A;  4EMK C;  4F7U E;  5LJ5 e;  1KC8 C;  3Q1J A;  5J39 A;  3HO8 A;  3JRZ A;  1K73 C;  2MMP A;  3M4G A;  3VUZ A;  3RES A;  3BDU A;  2LT4 A;  3CCS A;  4L59 A;  2E41 A;  1O9S A;  5LJ3 j;  1KC8 U;  3CCU T;  1KHI A;  3CC4 T;  4BBS M;  5GMK e;  1SSF A;  1FX7 A;  4M7D F;  1W4S A;  2XK0 A;  1VQ8 A;  4OB0 B;  3MET A;  4QVZ A;  4RG2 A;  4ZTJ A;  1HXD A;  3VKG A;  4P5N A;  1TH7 A;  3V7R A;  3OYL A;  3CBO A;  3CBM A;  3TU4 K;  1YI2 T;  2DTO A;  3LGF A;  2RI3 A;  3OW2 S;  4BE2 A;  3CCE A;  2MWP A;  3JB9 J;  1YJ9 T;  3KXT A;  4OF1 A;  2GQV A;  4M7D C;  3OYB A;  4M75 G;  4M7A B;  4BAC A;  1VQM T;  4MZP A;  2OAU A;  2Y4X A;  3JCM e;  5IT9 E;  3VUB A;  1K9M C;  4JRK A;  4DA4 A;  4M75 D;  2RK1 A;  3HBL A;  5GAO q;  4E7L A;  5CO7 A;  4A4G A;  2M16 A;  5GAN 3;  5GAM e;  2DZ9 A;  2RA2 A;  4JX6 A;  4BI3 A;  1QVF A;  1VIE A;  4BD3 A;  2KR6 A;  3LWH A;  4Z02 A;  3CBP A;  3E9G A;  2L89 A;  1G3Y A;  2BS3 A;  2RHY A;  2XKO C;  4KUL A;  2ZPI B;  3QJ6 A;  3CCL T;  4JX5 A;  5GAN 5;  5LJ5 j;  2QEX T;  3UT1 A;  2KQW A;  2RHI A;  4QQD A;  3X20 B;  4N4G A;  1D3B B;  4A54 A;  3RMQ A;  3NTK A;  3QBY A;  3QYB A;  2K5L A;  2QDY B;  1M4Z A;  3BG5 A;  1OI1 A;  4L6V 5;  2K5F A;  2DD5 A;  3BG9 A;  2RJC A;  5KH6 A;  4QVD A;  3BG3 A;  3JCM d;  2DD5 B;  1N9S A;  1VQK T;  3M59 A;  3QJY A;  4M78 A;  4PNO A;  3E9F A;  4M77 G;  2FYK A;  1VQ5 A;  2Y90 A;  3R6O A;  3CEY A;  4MZT A;  4RCB A;  4AKG A;  2LQK A;  2X4W A;  3JCM f;  1GXI E;  3CCQ T;  4XTU A;  4M7D E;  4PKC C;  4M77 A;  2KAF A;  3MP1 A;  1M1G A;  1MGQ A;  4LD9 K;  1W2B A;  4XTX A;  2RO0 A;  4R56 A;  3MCA B;  5KE2 A;  3C94 A;  3G71 A;  4M77 C;  3OQ5 A;  2DTH A;  4A4K A;  3RER A;  4LDW A;  3L2Q A;  3QYG B;  4HCZ A;  4J6Y A;  3V8J A;  3QKJ A;  5GMK l;  3EAE A;  5FRM A;  1XOV A;  3J80 E;  3CCQ A;  2DXB B;  4TVR A;  2K4Y A;  2DKG A;  2GFU A;  5FU6 B;  5DLQ E;  1VQ9 T;  4BDY A;  4EMK A;  4JX4 A;  3A5Z B;  1VQ5 T;  4IUQ A;  2D0Q B;  2EIF A;  4M75 C;  4ELJ A;  5FRO A;  2MF2 A;  5GAN 4;  2HBP A;  2DXT A;  3JCM J;  1VQK A;  5A0G A;  4PJO A;  5J26 A;  2LNV A;  1S72 A;  3OYG A;  3HFO A;  4M7D D;  1OYX A;  3JB9 D;  4CRI A;  3HKS A;  3QII A;  4PJO G;  2XID A;  4MDX A;  4LOC A;  2ZPH B;  2EWN A;  4M78 C;  3PIO A;  3OA6 A;  2JZ2 A;  4A53 A;  3L2V A;  3FEO A;  4PLI A;  3CPW A;  3S3M A;  4O6J A;  4V2S A;  2QQ9 A;  1H3Z A;  1QP3 A;  3S6W A;  2XDB A;  3RMS A;  2IG0 A;  1K73 U;  2OTJ A;  3TW6 A;  3LW5 E;  4M7A D;  3X25 B;  4LDU A;  3QYE A;  2L8D A;  5GAM h;  4M77 E;  5LJ5 h;  3G7Z A;  4A4F A;  1X6O A;  3VU3 C;  4JLG A;  4PJO D;  1VQ6 A;  3SDZ A;  4ZGE B;  1YBY A;  2KY9 A;  5FU6 C;  4JS5 A;  1YIJ A;  1G3S A;  2E12 A;  3QHS A;  3FC3 A;  3CCJ T;  1WQ7 A;  1YJN T;  3A8M B;  3GLX A;  4Y28 E;  1JB0 E;  4X9D A;  2PVD B;  2RH2 A;  1N6A A;  3JCM V;  1WJS A;  1YJ9 A;  4EMH A;  3CCE T;  5GAO r;  4XU0 A;  3O8V A;  1ZBX A;  2M9U A;  1YI2 A;  2C06 A;  2HNI A;  3L1A A;  3L2W A;  5A0D A;  4Z6Y A;  2X4X A;  1UGS B;  2E64 A;  1KQ2 A;  1O75 A;  2EFI A;  2X4J A;  2O01 E;  1YJW A;  2DJZ A;  3JCM Q;  3OBW A;  1BI2 A;  2CZ1 B;  3OS1 A;  2E6Z A;  4OGE A;  3CC4 A;  2F69 A;  2R57 A;  3HRU A;  3ZFJ A;  4E7J A;  4C0D B;  1Q7Y C;  3CCJ A;  2DEQ A;  1M90 U;  4PJO E;  5GAN j;  1BIA A;  2P4T A;  4M78 D;  4M7A A;  1BYM A;  2H3J A;  4FT2 A;  3V8K A;  2XD0 A;  2DXU A;  4XU3 A;  4YTL A;  3DB3 A;  3ZEH A;  2LTO A;  3L42 A;  1QVF S;  3QWL A;  4M7D B;  3GNG A;  2BUD A;  4M7A C;  4AI6 A;  3QO3 A;  4MZM A;  5GMK j;  3LWI A;  2OTJ T;  4PL6 A;  3LH0 A;  4MMK A;  3JB9 I;  3SWN A;  1PSE A;  4BUG A;  2JOY A;  3M4Y A;  4JS4 A;  1JJ2 A;  3VYG B;  3INZ A;  1WJQ A;  1NE8 A;  3SFM A;  1K8A C;  3MEV A;  4C0F A;  2QTX A;  3JCM g;  2VXF A;  2HQX A;  1VQM A;  3P8D A;  4ATO A;  2DD4 A;  1KQ1 A;  3TEE A;  1YJW T;  2V8J A;  3HL8 A;  4J8O A;  4FM4 B;  4HNV A;  2Y4Y A;  1NPR A;  2AHJ B;  3HRT A;  3TCJ A;  2ZPG B;  2EQM A;  2I2L A;  5GAM j;  5CKB A;  3OYJ A;  2R58 A;  4IKF A;  1QP2 A;  4BDZ A;  2PUK B;  1EIF A;  3JB9 H;  3CPF A;  2FL7 A;  4MFE A;  1LJO A;  4M77 D;  4C8Q D;  4IUU A;  4BE0 A;  5LJ3 d;  1NPP A;  1VUB A;  3PNW C;  5FU7 B;  3G71 T;  3CCU A;  4HKE A;  3CCM A;  5LJ3 f;  1YJN A;  4XTW A;  3V7S A;  1QVP A;  3CCS T;  3QYH B;  2CZ6 B;  3OY9 A;  1YIJ T;  1N8R U;  4QSH A;  3PIP A;  4NC6 A;  3OYE A;  4RG8 A;  1KD1 C;  1VQ7 T;  1WQW A;  1VQ6 T;  5GAN e;  4J6X A;  4DOV A;  4O5V A;  4E47 A;  5M9O A;  4EMG A;  3A8G B;  4HA8 A;  2ZPE B;  4VUB A;  4OVA A;  2XU8 A;  2O4X B;  3JCM b;  3NFC A;  3OYI A;  3ME9 A;  4XAX B;  4DOW A;  2JNG A;  4ZGJ B;  2VGN A;  1RI0 A;  2MWO A;  2E1H A;  2P0P A;  2E5Q A;  5CR2 A;  3L2U A;  2WSE E;  3PT9 A;  3CXC A;  4OB3 B;  2DK3 A;  3OYA A;  4Q5W A;  4C8Q G;  4M75 B;  3FB9 A;  3KBG A;  2PQW A;  4BB7 A;  1B34 A;  5HK0 A;  3CPW S;  1S72 T;  1HK9 A;  4J7F A;  4JRP A;  1UGP B;  5CKD A;  3P8B B;  4C5I A;  4F7U B;  2KVQ G;  4M75 A;  1ZQ1 A;  2DO3 A;  3PMT A;  4GLK A;  2PUO B;  3PMI A;  3MEU A;  1VQ4 A;  1VQO A;  3QUI A;  5GMK i;  3T9N A;  1X75 C;  1VQ9 A;  4PJO C;  4M78 B;  4EDU A;  2L3R A;  1Q82 C;  3QXE B;  4B9X A;  5HK3 A;  3FRN A;  3KUF A;  2DZC A;  3HRS A;  1IRE B;  4C5H A;  1FKM A;  2ZPB B;  1XTD A;  5GAN f;  1KQS S;  5LJ3 g;  4R55 A;  5D6X A;  5GAN h;  1Q86 C;  1KG1 A;  2DTI A;  2D6F A;  4OB2 B;  3LLR A;  4CI0 C;  3OYM A;  3CCV A;  2DIG A;  2RHU A;  3C12 A;  1NJI C;  1BKB A;  1N27 A;  2LVM A;  3RKW A;  2XDD A;  1LNX A;  5GMK m;  1M1F A;  1WGS A;  4M77 F;  2HAX A;  3S3O A;  4M78 E;  2RJE A;  3UDC A;  2VXE A;  2K3Y A;  1K8A U;  2ZCF B;  1V29 B;  5FRN A;  2A7Y A;  3JCM c;  2JUF A;  3H4C A;  3OW2 A;  2RHX A;  5C0M A;  3CMA A;  4C92 G;  3ZBD A;  2K3X A;  4M75 E;  5I2M A;  5LL6 S;  5GAO n;  2FHD A;  4J6W A;  3BFM A;  3E19 A;  1BI0 A;  2CYZ B;  5GAN 6;  2KSS A;  3NTI A;  5KCH A;  3DLL A;  4HL4 A;  2NLU A;  3CC7 T;  3DLM A;  2EYQ A;  2EJG A;  5I2S A;  2DXB A;  3CD6 A;  3M54 A;  1YCY A;  2XDP A;  1VIF A;  2K5I A;  2EQU A;  4NOY A;  5J3B A;  2BKD N;  2QEX A;  3CCL A;  2YLC A;  1KQS A;  4OB1 B;  2XI9 A;  5CVI A;  3VJP A;  5LJ5 g;  3A8H B;  4HNU A;  1UEB A;  4NS5 A;  3DL1 A;  2P0K A;  2EJ9 A;  2LT1 A;  3LX7 A;  5GAN 7;  3X28 B;  4BY6 B;  5DM7 R;  3OYF A;  3UWN A;  1VQL T;  5CQY A;  2K2V A;  3SB2 A;  4MFD A;  3JAM E;  3OYD A;  1YHQ A;  1IZ6 A;  1RL2 A;  3C95 A;  3VYG A;  4XK8 E;  2RI5 A;  5CK9 A;  3OSS C;  4J83 A;  2V8I A;  3F70 A;  3P8H A;  3H6Z A;  3M57 A;  4C5E A;  3EFS A;  5I21 A;  4RCC A;  3MEA A;  1M9S A;  2XHC A;  1K9M U;  3CXC S;  2DXC A;  2B8A A;  2CZ7 B;  4C0G A;  3MP6 A;  1NJI U;  4HT8 A;  2GCX A;  3FDR A;  5KCO A;  3ER0 A;  4JUV A;  3SWN C;  5IAY A;  3NTH A;  3OS2 A;  3S3N A;  3J81 E;  4M7A G;  3WVD B;  3I56 A;  2QDJ A;  2E70 A;  4C92 A;  4M77 B;  4MDW A;  3I55 T;  2BIV A;  3LGL A;  1VQ8 T;  2KDS A;  3OYH A;  4J5Y A;  2E10 A;  5GAN d;  2MI6 A;  4JRI A;  2MAM A;  2YRV A;  5CCA A;  4N4H A;  4C92 C;  3JB9 G;  4BY6 C;  2JVV A;  2GF7 A;  1Q81 U;  2PVO B;  4LDV A;  1XNI A;  1VQN A;  1BI3 A;  4ZGD B;  3G4S A;  1M1K U;  2M0O A;  5GAN 8;  1Y96 A;  2RB6 A;  5GAM d;  1UGR B;  1WJR A;  4EMK B;  3HSB A;  1Q81 C;  5CAI A;  4HLQ A;  4IUR A;  3H8Z A;  2BS2 A;  5IN1 A;  1N9R A;  5CKF A;  3CC2 A;  1Y96 B;  4AKI A;  1R8O B;  4AKH A;  2QF7 A;  1D3B A;  1WNL A;  2QQR A;  2EQK A;  2R5A A;  1ZHI A;  3CCR A;  1Q86 U;  1OZ2 A;  2JN0 A;  5FLX E;  3AHU A;  2LRQ A;  3OMG A;  1G3W A;  3V8L A;  2YHT A;  1OZ3 A;  3PGG A;  4QW2 A;  1AHJ B;  2DXC B;  2QFZ A;  2RD1 A;  4QQG A;  4WF2 A;  1VQP T;  4HT9 A;  2KMG A;  2PU9 B;  4KT0 E;  1H64 1;  3URG A;  4XTZ A;  3BDL A;  3CC2 T;  3RIR A;  5C6S A;  1KHC A;  3FIF A;  3SD4 A;  2JTF A;  4A4H A;  2X4Y A;  5DY9 A;  5GMK h;  2E65 A;  4BI8 B;  4N0A A;  3G4S T;  2YLB A;  4JRQ A;  2QA4 T;  3OYY A;  4N0A C;  5CQX A;  5CKE A;  4M75 F;  4A4E A;  5LJ3 h;  3HB9 A;  1UB4 A;  4J7I A;  5LJ5 f;  3JCM X;  5GAO m;  2OTL T;  4FT4 A;  1YIT T;  3I55 A;  4HCB A;  1BIB A;  2QA4 A;  3V7C A;  2P0Q A;  1UGQ B;  4F7U F;  5GAO p;  3M5A A;  3I56 T;  2DPP B;  4EPC A;  3VYH B;  2R5M A;  1M5Q 1;  4ELY C;  3VKI A;  3QG1 A;  3L2Z A;  4M78 F;  3TRE A;  5GAO l;  2L5Q A;  2F5T X;  2CS7 A;  4C0D C;  3E1S A;  3OS5 A;  2RHZ A;  2LQ8 A;  2D9T A;  2EJF A;  2X35 A;  4XTY A;  3VV0 A;  4ZN1 A;  1VQP A;  4JLI A;  2LDM A;  2HD0 A;  4OP0 A;  2RM4 A;  3ASK A;  1N8R C;  1KD1 U;  4FU6 A;  4M6V A;  2FVU A;  3OMC A;  5EJC A;  2PVG B;  3LYI A;  4IUT A;  4JDS A;  4PLL A;  3GOX A;  4BBR M;  3OB9 A;  3C4S A;  5EG2 A;  2G77 A;  2JTM A;  2A3L A;  2O4X A;  4MIM A;  3MEW A;  2V8K A;  1U8R A;  2LX9 A;  2M1H A;  3CD6 T;  1Y71 A;  3G6E A;  1VQN T;  1I81 A;  3CME T;  1U1T A;  3QPH A;  5DLO A;  2VC8 A;  1DJ7 B;  3BY7 A;  3JCM W;  2BS4 A;  4C8Q E;  4HCC A;  4M7A F;  3HPW A;  5AYF A;  5HY6 A;  1G5V A;  2K57 A;  2LC4 A;  5CKH A;  5L8R E;  3CMA T;  2RJF A;  2E6N A;  2EAY A;  1Y07 A;  5CIU A;  1LOJ A;  4OMF B;  1M90 C;  3A8O B;  4KBM B;  2ZPF B;  1QW1 A;  4NL2 A;  4XQ3 A;  3M53 A;  3MP8 A;  4C8Q B;  1JRI A;  4MML A;  1QVG S;  3JB9 F;  1PSF A;  3TW7 A;  2GFA A;  3WVE B;  3RKY A;  2QQ8 A;  4JJN K;  2QI2 A;  3JCM P;  3MHX A;  3QSU A;  4PJO B;  3QZ5 B;  2QXF A;  2WSC E;  3DB4 A;  3CCV T;  1YIT A;  2DAQ A;  4HNT A;  2RK2 A;  4M78 G;  4E7I A;  2IVW A;  1U1S A;  1WPY A;  3GPL A;  3QZ9 B;  3X26 B;  1Y7X A;  4FSX A;  4GY5 A;  4E7H A;  1I5L A;  3FLG A;  3PFS A;  1VQL A;  5A0L A;  3CME A;  3G6E T;  2HQE A;  4C92 E;  5LJ5 d;  3VKH A;  2WAC A;  5A2Q E;  3RKX A;  5GAN g;  2VUB A;  3M9Q A;  4ZTF A;  4C92 F;  2QQB A;  3KHI A;  2VGM A;  4BI4 A;  1JJ2 S;  3M58 A;  4E7K A;  1JBM A;  3QDR B;  4FL6 A;  3PTA A;  3J7A F;  3CC7 A;  1M8V A;  4IUV A;  4Y91 A;  4C8Q C;  2ZZD B;  3GIB A;  4LDY A;  4UC4 A;  3DKM A;  3GP8 A;  2LCL A;  4C0Z A;  2DD4 B;  2ZZD A;  3UPU A;  4C8Q A;  3CCR T;  4M7D A;  4ELZ C;  4FIB A;  2RJD A;  2G3R A;  3GF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...