3X26B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 5 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x26B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x26B02
2PU9B 3WVDB 2PVOB 3LW5E 2O01E 1AHJB 2DD5B 2PUKB 1PSEA 2CZ0B 2DPPB 2DXBA 1QP3A 4OB1B 3X26B 2PVGB 2PUOB 2DXCA 4OB3B 2PVDB 2AHJB 2ZCFB 3X24B 2DXBB 3QYHB 1PSFA 1IREB 3VYGA 1UGRB 2ZPFB 4XK8E 2ZPGB 1GXIE 4OB2B 2DXCB 1V29B 3QZ5B 2CZ1B 2ZPIB 3VYGB 3A8LB 2CZ6B 3X28B 1DJ7B 1UGPB 4KT0E 2CZ7B 3A8GB 1UGQB 2QDYB 2ZPBB 4L6V5 3A8MB 2DD4B 2WSCE 2ZZDA 1QP2A 3A8OB 3QXEB 1UGSB 4ZGJB 4FM4B 2DD4A 2ZZDB 2ZPEB 3WVEB 3VYHB 1JB0E 3X25B 4OB0B 3QYGB 2D0QB 3A8HB 4ZGEB 3HHTB 2ZPHB 5L8RE 2WSEE 3QZ9B 4RKUE 3X20B 2CYZB 4Y28E 2DD5A 2WSFE 4ZGDB
chains in the Genus database with same CATH superfamily
4EOMB 1TU0B 2L8DA 3CD6T 2CSQA 2F2WA 5GANd 1D0XA 1WLPB 1ZX6A 3LH5A 3PIPA 1AHJB 1WHGA 3DDQB 4FYYB 5IF1B 3MEUA 2F5KA 4MDWA 1QVFA 2MCNA 1RLQC 5CK9A 3J81E 4KGXB 2JM9A 4KGZB 2VGMA 2KY9A 4M75B 4J9HA 4EOLB 2DVEA 3MY5B 1OIYB 5GAN3 4E47A 7AT1B 2ZCFB 3VS0A 3JCMX 1B34A 2KK4A 1VQLT 2F5TX 2LVMA 4BCQB 4XK8E 2HBPA 2IIMA 2CUBA 1CSKA 2EWNA 1I0CA 3CMEA 1LPLA 3M03A 4DBHA 1D1BA 2C5NB 5GANj 2E1HA 1KQ2A 1MV0B 4M7DA 4A54A 4C8QF 4OF1A 5ICPB 3EH1A 1AWWA 4A4HA 4C8QD 3MIAB 2VVKA 1BI1A 2JMAA 1SRMA 5A0GA 5KE2A 1SSHA 3JCMV 3A8MB 1WXBA 3QBYA 3HFNA 5CKHA 5KCHA 1GY3B 2I53A 1VIFA 5AYFA 2J7IA 4OR5B 5GAMg 5FWBA 2GBQA 1GBRA 4VUBA 4RTYA 4MDXA 1FWZA 3EGDB 2M0OA 4QKUA 4CFUB 2A37A 4XU3A 4MZTA 1X6BA 3RNJA 3I56A 1H24B 1WX6A 4OMMA 2O4XB 2H3EB 5GMKm 3HHTB 1FXXA 2F2XA 3KBGA 4AKGA 2EKHA 2IG0A 4CFMB 2MWPA 2CUDA 2NLUA 2VASA 3M57A 3G33B 1M3AA 1TOVA 3JCMg 1WA7A 4BCND 2RQTA 1TWBA 4M77C 3H6ZA 2EQKA 1VQ4Q 1GCPA 2D8JA 4KGVB 3RKYA 4OMPA 4CC3A 4EOSB 2HDAA 3NTIA 1T3SA 2C5OB 1H1PB 4IIMA 3EGXB 1SRLA 2SRCA 1TFBA 4JJDA 2QI2A 2PUKB 4HT8A 1PKSA 3QJYA 4EOOB 3IQLA 2LP5A 2YRVA 4M4ZA 4HLQA 2PVGB 4J9CA 1W6XA 1WHKA 3CC7T 2BKZB 1WQWA 4F7SB 2JGZB 2DXBB 4EOQB 3MEVA 3I9QA 3OBYA 1F1BB 3CCLT 2BUDA 2QQAA 1TD6A 3CC7Q 2X51A 3QHSA 2RJCA 5LL6S 1YHQA 4M78A 3CCLQ 3M4GA 3NGPA 2DL3A 2R57A 3CXCA 3VRYA 1K8AC 2ENMA 1AVZC 2L3QA 4F6SB 1P92A 2DETA 4EMHA 2VGNA 3RUXA 2H8HA 2WPAB 5GAMf 4N0AA 4RCBA 2BZ8A 4ZN1A 4HCZA 4M7DE 3MP8A 5A2QE 4L6V5 3VUZA 4P5NA 1W2BA 3EFRA 2LC4A 2J6OA 1UNGD 2RJEA 3FDRA 4E7JA 3PE0A 1RAEB 1WZOA 3PVLA 1Y7XA 3S3OA 1QP2A 2RM4A 1VYTA 1VOLA 4QSHA 2ZGWA 3G4SA 1YJ9Q 1VIEA 2EQMA 3JCMf 5LJ3g 5GJWB 4AT1B 3X25B 5I21A 2DTHA 4OB0B 4HVWA 5IN1A 1XTDA 3P8HA 1M90C 2MI6A 1JO8A 2ZPHB 4M6VA 1WJQA 3H0HA 2IW9B 1VQOA 3CPFA 1X2QA 2L3SA 2WSEE 4JPBW 5EG2A 4M7DG 1BIBA 1RI0A 2RHYA 2CP0A 3JCMP 1KC8C 1AZEA 1R77A 4FSSA 2A0FB 3WVDB 4BI8B 4CC2A 2BTTA 2MK5A 4YOOA 5HY6A 4EOIB 4Y72B 4ZN3A 4J6XA 1Q7YR 5FWCA 4DOVA 2CP5A 2W96A 4HNTA 1M8VA 5KCOA 4QVDA 1N4MA 1EIFA 3TQ7P 1ZLMA 1IZ6A 3J80E 1Q82R 2HKQB 3TNWB 3N5BB 4AMCA 5GAOm 5CQXA 3TSZA 3HRTA 1O9SA 2KRSA 4NC6A 1BB9A 1Z9QA 2DXCA 3M0RA 1MNDA 2AHJB 2CH4A 2DRKA 1VQ6A 4M7AB 1JSUB 2B9RA 4CXAB 4BY7X 3OYLA 1GFCA 2XKOC 4LDYA 1KQSS 3UDCA 3M4YA 2I0NA 5KYWA 1N8RR 1B07A 3MEWA 3RBBB 9ATCB 4JRKA 1FINB 2E64A 2FHDA 2HAXA 3GBQA 1RAIB 1E7PA 3SB2A 4EC8B 4M78E 2PTKA 2E70A 4AFZC 3VS1A 1D0ZA 1Q7YU 3PIOA 1FX7A 3LYIA 4BCMB 5GAOr 1W1FA 1X75C 3EJ1B 4C8QA 4XTXA 5KYYA 5A0LA 1OEBA 4BACA 1KD1U 3F5XB 4EMKB 2DEQA 1U1SA 3QWXX 1UECA 2C6TB 3ASKA 3K7AM 2LCLA 4PLIA 2GNCA 2EIFA 2W10A 2OTJT 1OQKA 4F6UB 1YWPA 5KYXB 1ZP2A 2QQBA 3PNWC 4OMFB 2MYSA 2QAZA 2LMJA 2YUQA 1UTIA 2RJFA 2KT1A 3G1JA 3REBB 5L8RE 2UUEB 5CR2A 1G3YA 2YHTA 4QVZA 1SEMA 3S6WA 1BI2A 4AKHA 1B3QA 2L0AA 4Y28E 1GFDA 3P8BB 1H1RB 4F70B 2M51A 1QVGS 4M75F 4AI6A 3CCEA 4M78C 3TCJA 2LQWA 1T3LA 4CI0C 1FKMA 2HQXA 4C0FA 2OTLT 4Y91A 4BBRM 3JB9J 2DD5B 2DIGA 1QLYA 1BU1A 3BY7A 4CC4B 2HNIA 3EG1A 2LDMA 4N0AC 1UGVA 2JNGA 2OTLQ 3M0TA 4ELJA 4RTUA 2DNUA 3P8DA 4ESRA 4ZNXA 5IXFA 2DERA 4NL3A 2K5IA 3X26B 4BY1X 2KI7A 1E9HB 3RERA 2FG0A 3CC2A 1IXDA 1WJRA 2QQ9A 3CCJA 2BZXA 4EONB 2DIQA 1LJOA 4JDSA 4AKIA 4MZMA 5L2WB 3CQTA 2RK2A 5CKFA 2DL8A 3O5ZA 2O2OA 1M1KR 1KK7A 3TREA 3FEOA 3JCMb 1U06A 4FX3B 1I1JA 8ATCB 3OS1A 3GNFB 3S3NA 1S1NA 1NPRA 4A53A 3CMET 4HNVA 4OMOA 1Q86R 3RESA 1VQ5T 1TSFA 1KQSP 1AWJA 4QT7A 3NPFA 1IRXA 1OZ3A 1NYFA 2OJ2A 3CMEQ 2MAMA 4BXXX 1K0SA 1N6AA 4RODA 4AFSC 3Q1JA 1VQ5Q 3VS7A 1OL1B 3EOCB 2RH2A 1VYWB 1D3UB 1VOMA 4XU2A 4C8QE 3RMSA 4D6WA 3UWNA 1M1FA 4OMQA 1JB0E 1ZBXA 3L2UA 2UZEB 2D0QB 2IVWA 3TVTA 1GH6B 4GBQA 4N4IA 2QFZA 1OU9A 3VJPA 2X3XD 1AD5A 1Q81C 1ZHIA 4KRTA 1G3SA 3HO8A 1BU2A 3QZ9B 3G6EA 5GAOn 2PK2A 1YI2A 3I56T 1Q81R 4HCKA 1UFFA 2WSFE 4LDVA 4DEYA 1RI9A 2NYSA 1VQNA 3LGLA 4XTVA 1NLOC 1Y57A 3BLQB 3I56Q 2V8IA 2EQJA 2LQNA 4C8QG 3HRUA 2JJ9A 4QQGA 3EGUA 1FMVA 2BZYA 2XU8A 2KMTA 1KSWA 4KUIA 4PJJA 3SDZA 4A4EA 2QYZA 2YT6A 4N4HA 4F6WB 1VQ7A 5FU6B 5FRNA 3HKSA 3JB9D 2PK9B 1D3BB 2J6KA 2SEMA 5CVIA 1QVGP 1QP3A 1OKWB 5L23A 2NUPA 2MF2A 3DL1A 3BDUA 4CC7A 4IUUA 4FW2A 5LJ3d 3MO8A 4QQ6A 3NMZC 2ED1A 1ZA2B 1URCB 3O0GD 2AK5A 1V76A 2E3IA 1NYGA 1BBZA 5IHNA 4FYWB 1WGSA 4L59A 2XG8D 3CCQT 1H25B 2L2PA 3OB9A 1M2VA 3VS4A 1QLBA 2HL5C 3BFMA 2RI2A 4DQ2A 2DBMA 3C0CA 5GANh 3CCQQ 2K7AA 4KT0E 4RTZA 2EYXA 1EZZB 1VQ9A 1YHQT 3SWNA 2VXFA 4N4GA 2COWA 2RHXA 1H1SB 2A28A 2DMOA 2ZZDA 1AOJA 3JCMW 1YHQQ 3OQ5A 2WIPB 3A98A 3E19A 5LJ3j 3EFOA 1OL2B 2CCHB 3OMGA 3TW6A 3CCMA 2K5FA 1RUWA 2FPDA 5GAOq 5CQYA 2W2HA 3WVEB 1F5QB 2DTIA 4FT4A 4RMOA 1VQ8A 2GTJA 4QW2A 4CFNB 3OYBA 2W9FA 2DL4A 2KYBA 3C12A 2LX7A 3EIDB 5D6WA 3OA6A 2LRQA 3CBMA 3G4ST 2LCSA 3DLMA 4CRLB 4HVVA 2WEVB 1K1ZA 2WMBB 1QQJA 4OGEA 1X01A 2DRMA 3BLHB 1G8XA 3THKA 3M58A 4JZ3A 4AG1C 4BB7A 3CCRA 3REAB 2PU9B 5HCKA 1VQOT 3GOXA 2EYZA 3LH0A 4ELYC 4M7AF 2PZ1A 4J9BA 5I11A 1RL2A 3GTMS 1JKWA 3H0FA 4LDWA 4F7UB 4M7AD 1KG1A 5IHIA 4M75A 3CC4A 2MIOA 1K9MR 3OYEA 1JXMA 4M77B 5EC7A 3L42A 2AKLA 2CJMB 2WIHB 2KXDA 3G71A 2D9TA 2VXEA 2O88A 2QEXT 2JMCA 2UZBB 5FRMA 4JX5A 2A7YA 3AT1B 4DBFA 3DLLA 3JCMc 2LW4A 3T9NA 1IREB 3VUBA 2QEXQ 2H3JA 2YUOA 2R5AA 4BCMD 3CD6Q 1VQMA 1K0XA 1VQ6T 1VQKA 2AT1B 1BI0A 2X3WD 2C4GB 3SHWA 3F70A 2XDBA 1VQ6Q 2LJ1A 4LDUA 2X35A 4J9FA 2EFIA 1V1CA 1UUEA 4Z02A 4BE1A 1NM7A 3EGDA 3HFOA 1KXUA 1PWTA 2JZ2A 3JB9H 2NWMA 2ED0A 2FZGB 1QCNA 3VS3A 2FPEA 6AT1B 1VQLQ 1ZSZC 3PMTA 4B9WA 2CGHA 3HP9A 3QXEB 3WXMB 4A4KA 2O4XA 4ZGJB 4J9GA 4TTHA 4ELLA 4XAXB 5IDPB 1TG0A 2D0NA 1AWXA 3A8HB 2NUZA 4JJCA 3TU4K 5I2SA 1GRIA 4O5VA 5IAYA 2IVXA 4JLIA 1UNHD 2DL7A 4K11A 4GY5A 3QKJA 3EGXA 2KMGA 5GANe 2QGSA 4KRDB 2FB7A 2P4TA 2MPXC 2DZ9A 1UB4A 2L3PA 2QTVA 3HB9A 2LCCA 2UZLB 1D1AA 1BYMA 1Y71A 4IUQA 3CCET 3PVQA 1PHTA 2DXBA 3QWYA 4BCHB 4OB1B 3CBPA 4C0DC 4ROCA 4M75E 3M0SA 2RB6A 3L2VA 3CCEQ 4J6YA 1YITA 3I55A 2A08A 3CMAA 2OX7A 1R0BG 1WIEA 5LJ5g 3E9GA 3I35A 4ZTFA 2V1RA 1JBMA 4I3ZB 1QMCA 3BHUB 1AZGB 3CC2T 2I2LA 4UN0A 5C6SA 4RTVA 3MHXA 3H41A 1JOWA 2VV5A 3CCJT 1IHVA 3R6NA 2HSEB 4LD9K 3X28B 1BK2A 3CC2Q 3HPWA 1IGQA 3M0PA 4E7IA 4YOZA 3CCJQ 2JXBA 1YWOA 1D0YA 5IT9E 3L2ZA 1KHIA 1YJNA 1KQSA 4M75G 1UGQB 3ULRB 4F16A 4AG2C 4ZTJA 2DO3A 3ZL7C 1UHFA 2G9XB 1RABB 2GQIA 3O8VA 2BE7D 2CT4A 5CKBA 5I2MA 3A5ZB 4C92D 2XD0A 2X4XA 2LQ8A 4PJOD 5J26A 3JAME 5KE3A 3GLXA 1K8AR 1X27A 4XU0A 2XDDA 1UEBA 2L3RA 1T0JA 3SFMA 2AZSA 2V22B 2E12A 2KROA 4JUVA 2DE0X 2Y4YA 3MI9B 5CKEA 2F2VA 2O9SA 3ER0A 4XTZA 2ESWA 1PD1A 3GNGA 3OYHA 4JRIA 3G6ET 1YI2T 1K9AA 2OAUA 3MCAB 2J06A 5HBJB 1AWOA 2CZ0B 5LJ5f 1VQNT 1H27B 3META 3LWHA 2HL3A 1QVGA 3OS2A 2HSPA 4DOWA 1M9SA 1M90R 1YI2Q 1Y96B 4M7AA 3JCMJ 4JX4A 1K76A 4PNOA 1VQNQ 2K9GA 4RTXA 3VKGA 2RNAA 4M78B 2CH4W 4CRIA 1KC8R 1VQ7T 2ZPFB 2YDLA 3H9NA 3OSSC 4M7DC 3V7SA 2F2CA 1OPLA 1W70A 4BE2A 3CCVA 2CREA 4BCPB 1OI9B 2IW8B 2HKNA 3A8LB 2A36A 1YBYA 4LOCA 1NPPA 4A4GA 4IUTA 2KSSA 1JU5C 2HQEA 4IUVA 3PFSA 4X34A 2ZPBB 1X69A 2HMAA 4EMKA 4PFPA 2R7GA 3H0IA 1M90U 1AEYA 1C1AA 3EG9B 5GAMh 1MHNA 1YJWA 1VQ9T 2I40B 2MWOA 4MMKA 1KC8U 2JUFA 1FMKA 1VQ9Q 4LN2A 1M1GA 2GTOA 3CCUA 2YUPA 1YCSB 1XNIA 5KH6A 1FMWA 2VWFA 5CYIB 2WHBB 1RAGB 3CCMT 3QYBA 3NFCA 2E10A 2QQSA 4F7UF 1TXQA 2EPDA 2LNHB 3JCMh 3MP6A 1Q82U 2FZKB 1QKWA 3OW2S 1CKAA 5LMKB 4M77F 1WHMA 2DD5A 4M77D 2QK0A 2EKOA 4ANJA 5D6YA 1UG1A 1C6VX 5BNJB 4B6MA 3BE3A 1X2KA 2JS2A 3LW5E 4XTUA 2CDTA 4R56A 5DM7R 1TS9A 2K2VA 2DKGA 5AT1B 1RADB 4RTTA 1N8RU 1HSQA 5CO7A 2W99A 1LOJA 2OI3A 2X9HA 4PFOA 2PNIA 2OTJQ 3JCMQ 2AKKA 1N5ZA 5HNBB 1ABQA 4YOSA 3E9FA 3LWIA 1IO6A 2FYKA 2WACA 4HNUA 3B57A 3FB9A 4E7SA 3CC4T 4M7AE 3GF5A 5FROA 1KFZA 1SG5A 2V8JA 1H26B 1ENWA 1QWFA 1PD0A 2FRYA 3G71T 5D6XA 3CC4Q 3KHIA 3BW1A 2QDLA 2KAFA 3BG9A 3JRZA 4RG8A 2ATCB 5DQWA 3J7AF 1WHHA 1VQ4A 8AT1B 2VC8A 3DB4A 5GAMd 4A4FA 2YUNA 1JQQA 2COYA 4F7LB 3BDLA 3RDVA 1YIJA 4LE9A 3M5AA 1TH7A 1VQMT 1UDLA 4NOYA 2WSCE 5GAN5 1VQKT 4Z88A 1D1CA 4M7AG 4MIMA 2C0TA 1BKBA 3JCMd 1K4US 3C94A 2DF6A 1RLPC 1GCQA 2RF0A 5LJ3h 2HBWA 2GCXA 2ZPEB 2DD4A 1GUXB 2C0IA 5I22A 4JJNK 1VINA 2DEUA 1WXTA 2EJFA 1OX9A 5C0MA 4II1A 2BIVA 1OKVB 2G6FX 3CC7A 5GAMj 1OI1A 3DOGB 1H641 3JV3A 1H92A 2K57A 1P5EB 1X6GA 2JS0A 4KRCB 1VUBA 2FVUA 1O75A 2DXTA 4ZGDB 3H8ZA 3QPHA 1WI7A 2JOYA 1JXOA 5IH2A 1UHCA 5M9OA 4RUGA 1D3BA 4J5YA 1W98B 2YSQA 3OS5A 1OULA 4BBSM 2LJ3A 1I81A 2KR3A 2EVRA 5GMKh 3OW2P 4B9XA 1M1KU 5GAMe 4M7DD 1KIKA 4DA4A 1JJ2S 2RMOA 4C92B 3OYFA 3OYDA 4LUDA 2QASA 4EMKC 4PJOB 1U5SA 1QCOA 2LT1A 2CP3A 1YJ9A 1MMAA 4BCOB 2PUOB 1UJ0A 1K73C 1Q86U 1XJWB 1G5VA 2KYMA 1H1QB 2L89A 1IB8A 3UA7A 1UGRB 1I8FA 1M30A 4E6RA 3JCMe 1YNZA 2ZPGB 2XI9A 2DK3A 2LX9A 4FT2A 4OVAA 1YITT 3I55T 3JB9F 1JSTB 1AD6A 2NUTB 1XO2A 3QDRB 5CIUA 1WFWA 4C8QC 1YITQ 2KRNA 4WTOB 1MMNA 4R55A 2DAQA 3OMCA 4J8OA 1M5Q1 5CEIB 1OU8A 4EMGA 5J39A 2O9VA 3L2RA 3RR6A 4IIOA 2J05A 3OYCA 4BY6C 1Q81U 2QTXA 3LX7A 3TN8B 3HL8A 4J7FA 3PO3S 1YJNT 1UGSB 2PHGA 4EOPB 1ZUUA 2K3YA 1VA7A 3VYHB 1RAHB 3C4SA 1OIUB 2COZA 5GMKl 4LDXA 3V7RA 3QUIA 2C0OA 1Q95G 4KH1B 1I5OB 4XQ3A 4FYVB 1WNLA 4PLLA 2JTMA 1ZSZB 3VS6A 2BKDN 1QWEA 4F7UA 1PCXA 2HD0A 1B7TA 1SKUB 4RCCA 4C5EA 3OS0A 1M27C 4JRQA 1NJIC 2D1XA 2JVVA 4HKEA 4M77A 4M78D 1NG2A 3RKXA 4EDUA 2NUPB 1RAFB 5CKDA 1NJIR 3S3MA 2IN3A 4JS5A 1NZ9A 3ZFJA 5CCAA 1WPYA 2VKNA 1M2OA 5LJ3e 3QYEA 2A3LA 1Y07A 3QWLA 4C92G 2GFAA 3G4SQ 5FU7C 2E5QA 2F1LA 2LJ0A 4PJOG 3OSVA 2FL7A 2X4YA 2DXUA 3X24B 1PSFA 2CSIA 5GMKj 5KYUB 2CT3A 2KXCA 3MP1A 4LUEA 4OB2B 3KFVA 1JJ2P 5FLXE 2RI5A 1VQOQ 4PJNA 3MY1B 2GQVA 1E6HA 2E65A 2M0YA 3DDPB 2CZ1B 2ZPIB 1VYVA 1H28B 3VYGB 1QVPA 2K3BA 3FJ5A 3QO3A 2CKKA 4OGRB 1NE8A 4C0DB 3EHRA 1DJ7B 2DJZA 1Y0MA 4IMYB 2FO0A 3QIIA 3R6OA 3M54A 1YN8A 2EQUA 2XDPA 5GMKe 4PJLA 2QGFB 2RQRA 1U1TA 2KRMA 5GAOp 4O6JA 4PL6A 4BDZA 1X6OA 4DBRA 1PG5B 4JLGA 3CPWS 3JB9I 4E7HA 1O9KB 3UT1A 3FJPA 2DILA 3CCSA 3I5SA 2M1HA 2G77A 4D8KA 1WXUA 1R8OB 2C5XB 1SF9A 4PK4A 1M3BA 2CS7A 2D8HA 4XTYA 1G3TA 4ZGEB 3V8LA 2RI3A 1PRLC 1YJWT 3V8JA 1K9MU 4E7ZA 1I4K1 1NEGA 2KGTA 4HCCA 5DLQE 3UATA 4JRPA 2QQRA 2K5LA 3PMIA 1YJWQ 5ECAA 2DL5A 3CCUT 4ELZC 5HK3A 1TUDA 2OAWA 2V26A 5IDNB 3CCUQ 4CFWB 2DMEA 1H3HA 2O01E 4E7KA 1PC0A 4F7UE 2EGCA 4HVUA 2ECZA 2R58A 1S72A 5IHYA 4M77E 5GJVB 1VQ5A 1ABOA 5GAOl 1WJSA 3KUFA 4EPCA 1I5LA 2RO0A 4G6LB 5CAIA 3I5RA 1ZSGA 4BCKB 3V7CA 4BI3A 3V8KA 3DJBA 1KQ1A 4OP0A 3SWNC 1B34B 4F7UG 1NBEB 2C06A 4RTWA 4JJBA 1JRIA 2V1QA 4M77G 2RJDA 5HK0A 2LZ6B 1VQ4T 2R5MA 4M7DB 1LCKA 2QQ8A 1RAAB 3QJ6A 5FGKB 4J9EA 5DY9A 5EFQB 3KXTA 1YIJT 3GIBA 4EC9B 3UA6A 1BCMA 4OGCA 4C0ZA 5DQVA 2VB6A 2KNBB 5J3BA 1TUGB 3VS2A 2YWWA 1YIJQ 3OYIA 1ZQ1A 2QA4A 4PFZA 4ME7A 3DKMA 2E5KA 4KH0B 2E3HA 2EW3A 2E41A 4BCFB 3CPWP 2QGGA 1TTHB 3TW7A 4C92F 2CP6A 4CFXB 2JT4A 3RKWA 3OYGA 1HK9A 4PJOF 4F14A 2QF7A 5EJCA 2FPFA 1QVFS 1UJYA 2M16A 4M75C 3CCQA 5A0DA 5IXBA 4F7NB 2PVOB 2O31A 3ME9A 3MJXA 3OYNA 1OPKA 3QHWB 4Q5WA 4XU1A 3SD4A 2VYTA 1C9BA 1Y96A 2F69A 3OW2A 4II5B 4JZ4A 2M9UA 3OYJA 2KQWA 5GAN6 2YRDA 2BS2A 2RQVA 2DJQA 1QCFA 1WYXA 1YCYA 2PVDB 1H8KA 4HL4A 2W9ZA 1PKTA 1E6GA 4JS4A 1M8MA 1WQ7A 1QMZB 1ARKA 4NSTB 1WHJA 2M02A 1OV3A 3CEYA 1YJ9T 2PMIB 2JN0A 2HZYA 3NDQA 3G6EQ 4NL2A 1SHGA 4GLKA 2J6FA 1K8AU 2GGRA 1UGPB 2CP2A 1FVVB 2B86A 3EG9A 1UNLD 2B8AA 3HZJA 2CZ7B 4EOKB 5GAN2 3A8GB 4HT9A 1D09B 4FL6A 1W4SA 3LLRA 4C5GA 2C5VB 2P4RA 4X9DA 1NLPC 1VQ7Q 3TEEA 4ROEA 4A63B 1OX8A 5GAN8 1VQPA 1HJDA 3A8OB 1BI3A 4TVRA 4Z6YA 4FM4B 1Q7YC 4X9CA 3HRSA 2Y90A 2DM1A 1HXDA 3HSBA 2QEXA 5LQFB 2EUFA 4LNPA 1AISB 1Q82C 4JX6A 2HEQA 3CD6A 4EIKA 1WDXA 3MKDA 3SEMA 3PTAA 2CYZB 1KD1C 4Z89A 3E2UA 5I5ZB 2RQWA 1YP5A 3QDFA 1G83A 3JB9G 2K4YA 5KYXA 1TUCA 2K79A 1KD1R 1MMDA 2IW6B 2WXVB 4AFUC 4BI4A 1GL5A 1N8RC 3RMQA 4KULA 2XK0A 1N9SA 2EGEA 3EG0A 5DLOA 1QVFP 1SHFA 1VQLA 2LNVA 1MV3A 1VQ8T 4YC3B 3CCMQ 1XQHA 3BHTB 2ABLA 4BCJB 2WFYB 3UF4A 2LTOA 3EFSA 3TNHB 3CXCS 4E7LA 5LJ5h 1VQ8Q 1OZ2A 1SSFA 1EX4A 2D6FA 2EQIA 4CFVB 3H4CA 4FIBA 5LJ3f 1JJ2A 2EGAA 1IHWA 3QHRB 2L5QA 1E7OA 1GXIE 2DXCB 1G3WA 1OYXA 2YRCA 1AT1B 3CCRT 1ACMB 1V29B 1W2BS 3URGA 3M0QA 4BCIB 5HQ0B 4FCYA 4KBMB 3FIFA 3QSUA 3CCRQ 2DA9A 4DBQA 2BPMB 2VUBA 2XIDA 1Z9ZA 2HQHA 4J7IA 5FW9A 5KYWB 5GANg 2QXFA 4J83A 3HTRA 3VKIA 4IURA 4HXJA 1G3NC 4M78G 1BIAA 5GAN4 1N27A 3DTOA 2KT8A 1GUXA 2PQWA 4KUDK 2X4WA 2AIRB 4UC4A 2G3RA 4FSXA 3G71Q 3OYAA 1C0MA 4C8QB 2K2MA 4BD3A 5KYYB 5HVYB 1VYUA 3HBLA 4M75D 2KBTA 3EG3A 3QYGB 2WMAB 2X1NB 1U8RA 1HYOA 2EAYA 3A1PA 2AZVA 1PM3A 4AFQC 4ORZA 4BCQD 3CCST 3VRZA 2JW4A 3G7ZA 4BY6B 1VQMQ 2FEIA 2P0QA 1LNXA 2DFUA 3FLGA 2X4JA 3UPUA 2K3XA 3CCSQ 1VQKQ 3M0UA 1M3CA 1MUZA 2MOXA 1SPKA 5KYNA 1ZUYA 2FZCB 4C92A 4M7AC 5LJ5d 4OMLA 1M1KC 4PJOA 1A0NB 3L1AA 4LD6A 1PRMC 4IUPA 3TNIB 4PJMA 4BCNB 3EG2A 1GBQA 4C0GA 3CCLA 1MNEA 4WF2A 3VU3C 3BG5A 4J6WA 4IKFA 4F04B 2RA2A 4E2FB 3C95A 2XHCA 5HBHB 1Q86C 1N9RA 4R0KA 3BG3A 5HKCA 4F17A 4CFUD 4C5HA 2ZAEA 1J3TA 2DLPA 2UZDB 1S72T 3QYHB 1FYNA 1M4ZA 2NUTA 4M7DF 3ZBDA 1BCOA 1OOTA 2RPNA 3EHQA 5GANf 1S72Q 1EFNA 4BE0A 3D7SB 1ZBJA 1G2BA 2KE9A 3QZ5B 4YTLA 5HBEB 4J9IA 3PT9A 2CZ6B 4MFEA 1H4LD 3CXCP 5LJ5j 2PJQA 2DVJA 4FYXB 3E1SA 5FU7B 4EOJB 5IHKA 1KHCA 3RGFB 2CP7A 2E6NA 1R0CB 3MPUB 3BLRB 2QDYB 2RHIA 4MZPA 2DD4B 2JTEA 3VKHA 4FU6A 1K73R 2BS3A 2K6DA 5GMKi 3FC3A 1W2BP 2EBPA 5ACBA 5D7UA 2DYIA 4D8DA 3M56A 2LQKA 3CMAT 4OMNA 1CKBA 3M9QA 1LVKA 5LJ5e 4BCGB 2BE9B 3I55Q 1IGUA 2LT4A 3CMAQ 3JSCA 2XICA 2FRWA 4V2SA 3OBWA 1QKXA 1NEBA 1ZSZA 3RIRA 2ROLA 2DBKA 2E4HA 3CPWA 3POMA 3OYYA 1WHLA 3GPLA 1OGUB 2IPOB 4FW1A 3EH2A 1MMGA 2XMFA 4WCIA 2EYQA 2JTFA 2KVQG 2QA4T 4ATOA 2RN8A 4EORB 4Z8AA 4BUGA 1H3ZA 4F7JB 1K73U 3OYMA 4NS5A 2QA4Q 1YJNQ 4HA8A 3CBOA 3LQ5B 3TSWA 1PSEA 3U23A 3ZEHA 3VS5A 4C92E 4RG2A 4PJOE 2DPPB 4C5IA 5KYUA 4PKCC 2WJ9A 2Y4XA 2HCKA 3NHNA 2E6ZA 1X43A 1YFNA 2GFUA 3L2WA 4OB3B 4Y92A 4XTWA 2DX1A 2EYWA 4M78F 2P0KA 4GLMA 3VYGA 3M53A 2RD1A 4X1VA 2P0PA 3VV0A 1KJWA 4QQDA 2RHZA 2QG9B 5GAN7 1XOVA 2EJGA 3QG1A 2RK1A 2DTOA 2YLBA 1HD3A 3INZA 3M55A 2JM8A 4QVCA 1MGQA 4J9DA 4MFDA 1M2VB 2GF7A 1PKDB 3AHUA 2YLCA 3M59A 3L2QA 2V8KA 1GCQC 1O9KA 2CCIB 3OYKA 4HCBA 2Z0WA 1QW1A 4LXCA 4C92C 2EJ9A 2OTJA 3MEAA 4PJOC 4BDYA 3SWNB 2YXYA 2EYYA 3EAEA 3PGGA 4DEXA 1UE9A 1PNJA 2BS4A 1ZA1B 2ZZDB 1T0HA 3BHVB 1JEGA 2RHUA 3CCVT 3EFOB 1K9MC 1U3OA 1NJIU 3FRNA 3OY9A 1VQPT 3NTKA 2ROTA 1RACB 3DB3A 3CCVQ 2KEAA 4L5GA 3LGFA 1I07A 2QDJA 5FU6C 2OTLA 2W0ZA 4RKUE 3X20B 2P84A 1VQPQ 4MMLA 2RQUA 2DZCA 1ZUKA 2KR6A 2DYBA 2MMPA 3GP8A 3NTHA 2KDSA
chains in the Genus database with same CATH topology
5D6YA 3CCQA 5A0DA 2L8DA 3CD6T 2PVOB 3ME9A 3OYNA 5GANd 2V8IA 2EQJA 4C8QG 3HRUA 3LW5E 4Q5WA 4QQGA 2VYTA 2F69A 1Y96A 4XTUA 4XU1A 3SD4A 1AHJB 2XU8A 5DM7R 4R56A 2K2VA 2DKGA 2KMTA 3OW2A 3MEUA 4KUIA 1N8RU 5CO7A 3SDZA 4A4EA 2F5KA 1LOJA 4MDWA 1QVFA 2M9UA 1Q86C 4N4HA 1VQ7A 5FU6B 3OYJA 3JCMQ 5FRNA 3HKSA 3JB9D 1D3BB 5CK9A 3J81E 5CVIA 1QP3A 2KQWA 5GAN6 2BS2A 2MF2A 3DL1A 2VGMA 3E9FA 3LWIA 3BDUA 2KY9A 2FYKA 4M75B 2WACA 4HNUA 4IUUA 1YCYA 2DVEA 2PVDB 5LJ3d 3FB9A 5GAN3 3MO8A 4E47A 4QQ6A 2ZCFB 3CC4T 4M7AE 3GF5A 4HL4A 5FROA 3JCMX 1B34A 2KK4A 4JS4A 1VQLT 2F5TX 2V8JA 2LVMA 1WQ7A 4XK8E 2HBPA 3G71T 5D6XA 3CEYA 2EWNA 3KHIA 3BW1A 3CMEA 1YJ9T 2JN0A 1WGSA 2KAFA 2XG8D 3BG9A 3JRZA 4L59A 3OB9A 3CCQT 4RG8A 3J7AF 1VQ4A 4NL2A 1QLBA 5GANj 2VC8A 2E1HA 3BFMA 2RI2A 1KQ2A 3DB4A 4GLKA 5GAMd 1K8AU 4M7DA 4DQ2A 4A54A 1UGPB 4A4FA 4C8QF 4OF1A 5GANh 4KT0E 4A4HA 4C8QD 1BI1A 3BDLA 5A0GA 2B8AA 3HZJA 2CZ7B 5KE2A 5GAN2 1YIJA 3JCMV 1YHQT 1VQ9A 3M5AA 3A8GB 2VXFA 4N4GA 3SWNA 1TH7A 4HT9A 1VQMT 2RHXA 3A8MB 3QBYA 3LGLA 4FL6A 4NOYA 2WSCE 1W4SA 3HFNA 3LLRA 5CKHA 5GAN5 4C5GA 5KCHA 1VQKT 2ZZDA 1VIFA 5AYFA 3JCMW 4M7AG 4X9DA 4MIMA 3OQ5A 1BKBA 3E19A 5LJ3j 3TEEA 5GAN8 3JCMd 5GAMg 3OMGA 1VQPA 3TW6A 3A8OB 1BI3A 2K5FA 3C94A 4TVRA 3CCMA 4VUBA 1VQPT 5LJ3h 4MDXA 4Z6YA 4FM4B 1FWZA 2GCXA 2ZPEB 2DD4A 2M0OA 5GAOq 5CQYA 4X9CA 3WVEB 2DTIA 4FT4A 4MZTA 4XU3A 4RMOA 4JJNK 1Q7YC 1VQ8A 3HRSA 4QW2A 2Y90A 3OYBA 3I56A 2EJFA 1HXDA 3C12A 5C0MA 3HSBA 4II1A 2O4XB 2BIVA 5GMKm 2QEXA 3HHTB 1FXXA 5D6WA 3CC7A 3KBGA 1Q82C 4JX6A 3OA6A 2LRQA 5GAMj 4AKGA 3CBMA 1OI1A 3G4ST 3CD6A 2IG0A 2MWPA 2NLUA 3DLMA 3M57A 1H641 3JCMg 2K57A 3PTAA 4M77C 2CYZB 1KD1C 4OGEA 1X01A 3H6ZA 2EQKA 1VUBA 2FVUA 1O75A 2DXTA 3M58A 3RKYA 3JB9G 2K4YA 4BB7A 3CCRA 4ZGDB 3H8ZA 3NTIA 3QPHA 2PU9B 2JOYA 1VQOT 3GOXA 4BI4A 3LH0A 5M9OA 4ELYC 4M7AF 1D3BA 4J5YA 1N8RC 3OS5A 1RL2A 4BBSM 3RMQA 1I81A 4KULA 5GMKh 2XK0A 4LDWA 4F7UB 1N9SA 4B9XA 2QI2A 2PUKB 1M1KU 4HT8A 5GAMe 4M7DD 1KG1A 4M75A 3QJYA 3CC4A 4DA4A 1JJ2S 5DLOA 3OYEA 4C92B 2YRVA 3OYDA 3OYFA 4M77B 1VQLA 2LNVA 3L42A 1VQ8T 4EMKC 4PJOB 1XQHA 2LT1A 2EKOA 3G71A 2D9TA 2VXEA 4HLQA 2PVGB 1YJ9A 2QEXT 2LTOA 3EFSA 2PUOB 3CXCS 4E7LA 5FRMA 4JX5A 2A7YA 5LJ5h 3CC7T 1WQWA 1K73C 1Q86U 3DLLA 1G5VA 3JCMc 2DXBB 1OZ2A 1SSFA 2D6FA 2L89A 3MEVA 3T9NA 1IREB 3OBYA 1UGRB 1I8FA 3VUBA 3H4CA 4FIBA 3CCLT 5LJ3f 1JJ2A 2H3JA 3JCMe 2BUDA 2L5QA 2QQAA 2ZPGB 2R5AA 1GXIE 2XI9A 2DK3A 2LX9A 2DXCB 1G3WA 1OYXA 4FT2A 4OVAA 1YITT 3I55T 3QHSA 2RJCA 3CCRT 1V29B 5LL6S 1YHQA 4M78A 3JB9F 3M4GA 1W2BS 1VQMA 3URGA 2R57A 1YITA 3CXCA 1K8AC 1VQ6T 3QDRB 5CIUA 1VQKA 1P92A 4KBMB 3FIFA 4C8QC 3QSUA 1BI0A 2VUBA 2XIDA 4EMHA 2VGNA 3F70A 4J7IA 3RUXA 4R55A 5GAMf 5GANg 4N0AA 2DAQA 4RCBA 2XDBA 4ZN1A 3OMCA 2QXFA 1M5Q1 4J8OA 4EMGA 5J39A 4J83A 4HCZA 4LDUA 2X35A 3MP8A 4IURA 4L6V5 3VKIA 5A2QE 4M7DE 2EFIA 3VUZA 3L2RA 4P5NA 4M78G 4Z02A 4BE1A 1BIAA 5GAN4 1W2BA 3EFRA 1N27A 2LC4A 3HFOA 2RJEA 3FDRA 2JZ2A 4E7JA 3JB9H 3OYCA 4BY6C 2PQWA 1Q81U 2X4WA 4UC4A 4KUDK 1Y7XA 2QTXA 3S3OA 1QP2A 2RM4A 3LX7A 2G3RA 3HL8A 3PMTA 4J7FA 2CGHA 3HP9A 3QXEB 3WXMB 4B9WA 4A4KA 2O4XA 1YJNT 1UGSB 4QSHA 4ZGJB 4FSXA 2ZGWA 3OYAA 3G4SA 4C8QB 1VIEA 2EQMA 2K3YA 3JCMf 4BD3A 5LJ3g 3VYHB 3HBLA 3C4SA 4M75D 3X25B 5I21A 2DTHA 4XAXB 4OB0B 3QYGB 5GMKl 4LDXA 1U8RA 5IN1A 3V7RA 3A8HB 3QUIA 2EAYA 1XTDA 3P8HA 3TU4K 5I2SA 1M90C 2MI6A 2ZPHB 4M6VA 1WJQA 4O5VA 3CCST 1VQOA 5IAYA 4XQ3A 3CPFA 3G7ZA 2WSEE 4BY6B 4JLIA 5EG2A 4M7DG 1WNLA 1BIBA 1RI0A 2RHYA 4PLLA 2JTMA 2P0QA 4GY5A 3QKJA 1LNXA 3JCMP 3FLGA 2X4JA 2KMGA 3UPUA 2K3XA 5GANe 1KC8C 2BKDN 4F7UA 2FB7A 2P4TA 2HD0A 3WVDB 2DZ9A 4RCCA 4C5EA 1UB4A 3OS0A 1KQSA 4BI8B 4JRQA 1NJIC 4C92A 2JVVA 5HY6A 4M7AC 4HKEA 4M77A 4M78D 5LJ5d 3RKXA 4EDUA 1M1KC 4PJOA 4ZN3A 4J6XA 3HB9A 3L1AA 2LCCA 4LD6A 4DOVA 4IUPA 4HNTA 5CKDA 1M8VA 5KCOA 3S3MA 1BYMA 4QVDA 1Y71A 1NZ9A 4IUQA 3ZFJA 5CCAA 4JS5A 1WPYA 3CCET 4C0GA 1EIFA 3CCLA 4WF2A 2DXBA 3VU3C 3BG5A 1IZ6A 5LJ3e 3J80E 3QYEA 3N5BB 4OB1B 4J6WA 4IKFA 2A3LA 3CBPA 4C0DC 5GAOm 1Y07A 2RA2A 3QWLA 4M75E 5CQXA 4C92G 2GFAA 2RB6A 2XHCA 3C95A 3HRTA 4J6YA 5FU7C 3L2VA 1O9SA 2E5QA 3I55A 4NC6A 1N9RA 3BG3A 2DXCA 3OSVA 2FL7A 2X4YA 4PJOG 5HKCA 3CMAA 2AHJB 4C5HA 5LJ5g 2DXUA 1S72T 3E9GA 3X24B 1PSFA 3QYHB 4ZTFA 1VQ6A 5GMKj 1JBMA 1M4ZA 4M7AB 3MP1A 4M7DF 3ZBDA 4OB2B 5FLXE 2RI5A 3OYLA 2XKOC 4LDYA 5GANf 1KQSS 3UDCA 3M4YA 4BE0A 2I2LA 2GQVA 3CC2T 5C6SA 3QZ5B 2E65A 4YTLA 3MHXA 2CZ1B 2ZPIB 3MEWA 3VYGB 2VV5A 3CCJT 1QVPA 3QO3A 4JRKA 2CKKA 3PT9A 2CZ6B 4MFEA 4LD9K 1NE8A 5LJ5j 3X28B 2E64A 2FHDA 4C0DB 2HAXA 1DJ7B 2DJZA 3E1SA 1E7PA 3HPWA 4M78E 5FU7B 3SB2A 4E7IA 2E70A 1KHCA 3QIIA 3R6OA 1Q7YU 3PIOA 3M54A 1FX7A 2E6NA 2EQUA 3LYIA 2XDPA 1KHIA 3L2ZA 5GMKe 5IT9E 4M75G 1UGQB 2QDYB 2RHIA 5GAOr 1YJNA 4MZPA 4ZTJA 2DO3A 1X75C 2DD4B 1U1TA 3VKHA 4FU6A 4C8QA 2BS3A 5GMKi 3FC3A 4XTXA 3O8VA 5GAOp 4O6JA 5A0LA 4PL6A 4BDZA 5CKBA 3M56A 2LQKA 1X6OA 3CMAT 5I2MA 4JLGA 3CPWS 3A5ZB 4BACA 4C92D 3JB9I 1KD1U 2X4XA 2XD0A 3M9QA 4E7HA 2LQ8A 3FJPA 3UT1A 2DEQA 1U1SA 4EMKB 5LJ5e 4PJOD 5J26A 3CCSA 2M1HA 2G77A 3ASKA 3JAME 5KE3A 1R8OB 3GLXA 2LCLA 2LT4A 4PLIA 4XU0A 3JSCA 2XICA 2CS7A 2EIFA 2OTJT 4V2SA 3OBWA 2XDDA 1UEBA 4XTYA 1G3TA 4ZGEB 2L3RA 2RI3A 3RIRA 3V8LA 3V8JA 2QQBA 3PNWC 4OMFB 1YJWT 1K9MU 1I4K1 2RJFA 3CPWA 4HCCA 5DLQE 3OYYA 5L8RE 5CR2A 1G3YA 2YHTA 3SFMA 3GPLA 4QVZA 4JRPA 2QQRA 3S6WA 1BI2A 2E12A 4AKHA 2K5LA 3PMIA 4JUVA 4Y28E 2Y4YA 3CCUT 5CKEA 2EYQA 2JTFA 3P8BB 4ELZC 2KVQG 3CCMT 2QA4T 5HK3A 1QVGS 4ATOA 3ER0A 4XTZA 4M75F 4AI6A 3CCEA 4BUGA 4M78C 3GNGA 3TCJA 1H3ZA 3OYHA 4CI0C 1FKMA 4JRIA 2HQXA 1K73U 4C0FA 2OTLT 3OYMA 4NS5A 4Y91A 4BBRM 3G6ET 2O01E 4HA8A 4E7KA 3JB9J 2DD5B 4F7UE 3CBOA 2DIGA 1YI2T 2OAUA 3MCAB 3BY7A 2HNIA 1PSEA 2R58A 2LDMA 2CZ0B 4N0AC 3ZEHA 5LJ5f 1S72A 1VQNT 2JNGA 3META 4C92E 3LWHA 4M77E 4RG2A 1QVGA 4ELJA 3OS2A 1VQ5A 4PJOE 4DOWA 2DPPB 3P8DA 1M9SA 5GAOl 1WJSA 4C5IA 3KUFA 1Y96B 4EPCA 4NL3A 2K5IA 1I5LA 4M7AA 3X26B 4PKCC 3JCMJ 4M7AD 2RO0A 2WJ9A 2Y4XA 4JX4A 3RERA 4PNOA 2E6ZA 2GFUA 3CC2A 3L2WA 3VKGA 4OB3B 4M78B 1WJRA 4XTWA 4M78F 2QQ9A 3CCJA 5CAIA 4CRIA 2P0KA 2DIQA 1VQ7T 1LJOA 3VYGA 4JDSA 4AKIA 3M53A 2ZPFB 3OSSC 4MZMA 4M7DC 2RD1A 3V7SA 2P0PA 3VV0A 3V7CA 4QQDA 4BI3A 4BE2A 3CCVA 2RK2A 5CKFA 3V8KA 2RHZA 5GAN7 1XOVA 2EJGA 1KQ1A 4OP0A 3SWNC 3QG1A 2RK1A 3TREA 1B34B 2DTOA 3A8LB 3FEOA 4F7UG 3JCMb 1YBYA 2YLBA 2C06A 4LOCA 1NPPA 3INZA 4A4GA 3M55A 1JRIA 4IUTA 3OS1A 2KSSA 4QVCA 1MGQA 3GNFB 4M77G 3S3NA 2HQEA 4IUVA 3PFSA 4MFDA 4X34A 1NPRA 4A53A 3CMET 4HNVA 2GF7A 3AHUA 2RJDA 2YLCA 3M59A 3L2QA 5HK0A 2V8KA 2ZPBB 3RESA 1VQ5T 1VQ4T 2R5MA 4M7DB 4EMKA 1OZ3A 3OYKA 2QQ8A 4HCBA 1M90U 1QW1A 3QJ6A 2MAMA 4C92C 1N6AA 5DY9A 2EJ9A 2OTJA 5GAMh 3MEAA 1MHNA 3Q1JA 4PJOC 4BDYA 3SWNB 3EAEA 3KXTA 1YJWA 3PGGA 1VQ9T 1YIJT 2RH2A 4XU2A 4C8QE 3GIBA 4OGCA 2BS4A 2MWOA 4MMKA 3RMSA 3UWNA 4C0ZA 4D6WA 2ZZDB 1KC8U 1M1FA 1JB0E 1ZBXA 2JUFA 2RHUA 5J3BA 3CCVT 1M1GA 1ZQ1A 3OYIA 3L2UA 3CCUA 1K9MC 2D0QB 1XNIA 2IVWA 1NJIU 3FRNA 5KH6A 2QA4A 3OY9A 4N4IA 2QFZA 4ME7A 3DKMA 3QYBA 3NTKA 3NFCA 3VJPA 2E10A 3PIPA 2QQSA 4F7UF 3DB3A 3JCMh 3MP6A 2E41A 1ZHIA 4L5GA 3LGFA 1Q81C 1Q82U 1G3SA 2QDJA 3HO8A 5FU6C 3OW2S 2OTLA 3QZ9B 4RKUE 3TW7A 4C92F 3X20B 3RKWA 4M77F 3G6EA 5GAOn 3OYGA 1HK9A 4MMLA 4PJOF 2DZCA 1YI2A 2QF7A 5EJCA 1QVFS 3I56T 2KR6A 2MMPA 3GP8A 2DD5A 2M16A 2WSFE 3NTHA 4LDVA 4M77D 1VQNA 4M75C 2KDSA 4XTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PU9 B;  3WVD B;  2PVO B;  3LW5 E;  2O01 E;  1AHJ B;  2DD5 B;  2PUK B;  1PSE A;  2CZ0 B;  2DPP B;  2DXB A;  1QP3 A;  4OB1 B;  3X26 B;  2PVG B;  2PUO B;  2DXC A;  4OB3 B;  2PVD B;  2AHJ B;  2ZCF B;  3X24 B;  2DXB B;  3QYH B;  1PSF A;  1IRE B;  3VYG A;  1UGR B;  2ZPF B;  4XK8 E;  2ZPG B;  1GXI E;  4OB2 B;  2DXC B;  1V29 B;  3QZ5 B;  2CZ1 B;  2ZPI B;  3VYG B;  3A8L B;  2CZ6 B;  3X28 B;  1DJ7 B;  1UGP B;  4KT0 E;  2CZ7 B;  3A8G B;  1UGQ B;  2QDY B;  2ZPB B;  4L6V 5;  3A8M B;  2DD4 B;  2WSC E;  2ZZD A;  1QP2 A;  3A8O B;  3QXE B;  1UGS B;  4ZGJ B;  4FM4 B;  2DD4 A;  2ZZD B;  2ZPE B;  3WVE B;  3VYH B;  1JB0 E;  3X25 B;  4OB0 B;  3QYG B;  2D0Q B;  3A8H B;  4ZGE B;  3HHT B;  2ZPH B;  5L8R E;  2WSE E;  3QZ9 B;  4RKU E;  3X20 B;  2CYZ B;  4Y28 E;  2DD5 A;  2WSF E;  4ZGD B; 
#chains in the Genus database with same CATH topology
 4EOM B;  1TU0 B;  2L8D A;  3CD6 T;  2CSQ A;  2F2W A;  5GAN d;  1D0X A;  1WLP B;  1ZX6 A;  3LH5 A;  3PIP A;  1AHJ B;  1WHG A;  3DDQ B;  4FYY B;  5IF1 B;  3MEU A;  2F5K A;  4MDW A;  1QVF A;  2MCN A;  1RLQ C;  5CK9 A;  3J81 E;  4KGX B;  2JM9 A;  4KGZ B;  2VGM A;  2KY9 A;  4M75 B;  4J9H A;  4EOL B;  2DVE A;  3MY5 B;  1OIY B;  5GAN 3;  4E47 A;  7AT1 B;  2ZCF B;  3VS0 A;  3JCM X;  1B34 A;  2KK4 A;  1VQL T;  2F5T X;  2LVM A;  4BCQ B;  4XK8 E;  2HBP A;  2IIM A;  2CUB A;  1CSK A;  2EWN A;  1I0C A;  3CME A;  1LPL A;  3M03 A;  4DBH A;  1D1B A;  2C5N B;  5GAN j;  2E1H A;  1KQ2 A;  1MV0 B;  4M7D A;  4A54 A;  4C8Q F;  4OF1 A;  5ICP B;  3EH1 A;  1AWW A;  4A4H A;  4C8Q D;  3MIA B;  2VVK A;  1BI1 A;  2JMA A;  1SRM A;  5A0G A;  5KE2 A;  1SSH A;  3JCM V;  3A8M B;  1WXB A;  3QBY A;  3HFN A;  5CKH A;  5KCH A;  1GY3 B;  2I53 A;  1VIF A;  5AYF A;  2J7I A;  4OR5 B;  5GAM g;  5FWB A;  2GBQ A;  1GBR A;  4VUB A;  4RTY A;  4MDX A;  1FWZ A;  3EGD B;  2M0O A;  4QKU A;  4CFU B;  2A37 A;  4XU3 A;  4MZT A;  1X6B A;  3RNJ A;  3I56 A;  1H24 B;  1WX6 A;  4OMM A;  2O4X B;  2H3E B;  5GMK m;  3HHT B;  1FXX A;  2F2X A;  3KBG A;  4AKG A;  2EKH A;  2IG0 A;  4CFM B;  2MWP A;  2CUD A;  2NLU A;  2VAS A;  3M57 A;  3G33 B;  1M3A A;  1TOV A;  3JCM g;  1WA7 A;  4BCN D;  2RQT A;  1TWB A;  4M77 C;  3H6Z A;  2EQK A;  1VQ4 Q;  1GCP A;  2D8J A;  4KGV B;  3RKY A;  4OMP A;  4CC3 A;  4EOS B;  2HDA A;  3NTI A;  1T3S A;  2C5O B;  1H1P B;  4IIM A;  3EGX B;  1SRL A;  2SRC A;  1TFB A;  4JJD A;  2QI2 A;  2PUK B;  4HT8 A;  1PKS A;  3QJY A;  4EOO B;  3IQL A;  2LP5 A;  2YRV A;  4M4Z A;  4HLQ A;  2PVG B;  4J9C A;  1W6X A;  1WHK A;  3CC7 T;  2BKZ B;  1WQW A;  4F7S B;  2JGZ B;  2DXB B;  4EOQ B;  3MEV A;  3I9Q A;  3OBY A;  1F1B B;  3CCL T;  2BUD A;  2QQA A;  1TD6 A;  3CC7 Q;  2X51 A;  3QHS A;  2RJC A;  5LL6 S;  1YHQ A;  4M78 A;  3CCL Q;  3M4G A;  3NGP A;  2DL3 A;  2R57 A;  3CXC A;  3VRY A;  1K8A C;  2ENM A;  1AVZ C;  2L3Q A;  4F6S B;  1P92 A;  2DET A;  4EMH A;  2VGN A;  3RUX A;  2H8H A;  2WPA B;  5GAM f;  4N0A A;  4RCB A;  2BZ8 A;  4ZN1 A;  4HCZ A;  4M7D E;  3MP8 A;  5A2Q E;  4L6V 5;  3VUZ A;  4P5N A;  1W2B A;  3EFR A;  2LC4 A;  2J6O A;  1UNG D;  2RJE A;  3FDR A;  4E7J A;  3PE0 A;  1RAE B;  1WZO A;  3PVL A;  1Y7X A;  3S3O A;  1QP2 A;  2RM4 A;  1VYT A;  1VOL A;  4QSH A;  2ZGW A;  3G4S A;  1YJ9 Q;  1VIE A;  2EQM A;  3JCM f;  5LJ3 g;  5GJW B;  4AT1 B;  3X25 B;  5I21 A;  2DTH A;  4OB0 B;  4HVW A;  5IN1 A;  1XTD A;  3P8H A;  1M90 C;  2MI6 A;  1JO8 A;  2ZPH B;  4M6V A;  1WJQ A;  3H0H A;  2IW9 B;  1VQO A;  3CPF A;  1X2Q A;  2L3S A;  2WSE E;  4JPB W;  5EG2 A;  4M7D G;  1BIB A;  1RI0 A;  2RHY A;  2CP0 A;  3JCM P;  1KC8 C;  1AZE A;  1R77 A;  4FSS A;  2A0F B;  3WVD B;  4BI8 B;  4CC2 A;  2BTT A;  2MK5 A;  4YOO A;  5HY6 A;  4EOI B;  4Y72 B;  4ZN3 A;  4J6X A;  1Q7Y R;  5FWC A;  4DOV A;  2CP5 A;  2W96 A;  4HNT A;  1M8V A;  5KCO A;  4QVD A;  1N4M A;  1EIF A;  3TQ7 P;  1ZLM A;  1IZ6 A;  3J80 E;  1Q82 R;  2HKQ B;  3TNW B;  3N5B B;  4AMC A;  5GAO m;  5CQX A;  3TSZ A;  3HRT A;  1O9S A;  2KRS A;  4NC6 A;  1BB9 A;  1Z9Q A;  2DXC A;  3M0R A;  1MND A;  2AHJ B;  2CH4 A;  2DRK A;  1VQ6 A;  4M7A B;  1JSU B;  2B9R A;  4CXA B;  4BY7 X;  3OYL A;  1GFC A;  2XKO C;  4LDY A;  1KQS S;  3UDC A;  3M4Y A;  2I0N A;  5KYW A;  1N8R R;  1B07 A;  3MEW A;  3RBB B;  9ATC B;  4JRK A;  1FIN B;  2E64 A;  2FHD A;  2HAX A;  3GBQ A;  1RAI B;  1E7P A;  3SB2 A;  4EC8 B;  4M78 E;  2PTK A;  2E70 A;  4AFZ C;  3VS1 A;  1D0Z A;  1Q7Y U;  3PIO A;  1FX7 A;  3LYI A;  4BCM B;  5GAO r;  1W1F A;  1X75 C;  3EJ1 B;  4C8Q A;  4XTX A;  5KYY A;  5A0L A;  1OEB A;  4BAC A;  1KD1 U;  3F5X B;  4EMK B;  2DEQ A;  1U1S A;  3QWX X;  1UEC A;  2C6T B;  3ASK A;  3K7A M;  2LCL A;  4PLI A;  2GNC A;  2EIF A;  2W10 A;  2OTJ T;  1OQK A;  4F6U B;  1YWP A;  5KYX B;  1ZP2 A;  2QQB A;  3PNW C;  4OMF B;  2MYS A;  2QAZ A;  2LMJ A;  2YUQ A;  1UTI A;  2RJF A;  2KT1 A;  3G1J A;  3REB B;  5L8R E;  2UUE B;  5CR2 A;  1G3Y A;  2YHT A;  4QVZ A;  1SEM A;  3S6W A;  1BI2 A;  4AKH A;  1B3Q A;  2L0A A;  4Y28 E;  1GFD A;  3P8B B;  1H1R B;  4F70 B;  2M51 A;  1QVG S;  4M75 F;  4AI6 A;  3CCE A;  4M78 C;  3TCJ A;  2LQW A;  1T3L A;  4CI0 C;  1FKM A;  2HQX A;  4C0F A;  2OTL T;  4Y91 A;  4BBR M;  3JB9 J;  2DD5 B;  2DIG A;  1QLY A;  1BU1 A;  3BY7 A;  4CC4 B;  2HNI A;  3EG1 A;  2LDM A;  4N0A C;  1UGV A;  2JNG A;  2OTL Q;  3M0T A;  4ELJ A;  4RTU A;  2DNU A;  3P8D A;  4ESR A;  4ZNX A;  5IXF A;  2DER A;  4NL3 A;  2K5I A;  3X26 B;  4BY1 X;  2KI7 A;  1E9H B;  3RER A;  2FG0 A;  3CC2 A;  1IXD A;  1WJR A;  2QQ9 A;  3CCJ A;  2BZX A;  4EON B;  2DIQ A;  1LJO A;  4JDS A;  4AKI A;  4MZM A;  5L2W B;  3CQT A;  2RK2 A;  5CKF A;  2DL8 A;  3O5Z A;  2O2O A;  1M1K R;  1KK7 A;  3TRE A;  3FEO A;  3JCM b;  1U06 A;  4FX3 B;  1I1J A;  8ATC B;  3OS1 A;  3GNF B;  3S3N A;  1S1N A;  1NPR A;  4A53 A;  3CME T;  4HNV A;  4OMO A;  1Q86 R;  3RES A;  1VQ5 T;  1TSF A;  1KQS P;  1AWJ A;  4QT7 A;  3NPF A;  1IRX A;  1OZ3 A;  1NYF A;  2OJ2 A;  3CME Q;  2MAM A;  4BXX X;  1K0S A;  1N6A A;  4ROD A;  4AFS C;  3Q1J A;  1VQ5 Q;  3VS7 A;  1OL1 B;  3EOC B;  2RH2 A;  1VYW B;  1D3U B;  1VOM A;  4XU2 A;  4C8Q E;  3RMS A;  4D6W A;  3UWN A;  1M1F A;  4OMQ A;  1JB0 E;  1ZBX A;  3L2U A;  2UZE B;  2D0Q B;  2IVW A;  3TVT A;  1GH6 B;  4GBQ A;  4N4I A;  2QFZ A;  1OU9 A;  3VJP A;  2X3X D;  1AD5 A;  1Q81 C;  1ZHI A;  4KRT A;  1G3S A;  3HO8 A;  1BU2 A;  3QZ9 B;  3G6E A;  5GAO n;  2PK2 A;  1YI2 A;  3I56 T;  1Q81 R;  4HCK A;  1UFF A;  2WSF E;  4LDV A;  4DEY A;  1RI9 A;  2NYS A;  1VQN A;  3LGL A;  4XTV A;  1NLO C;  1Y57 A;  3BLQ B;  3I56 Q;  2V8I A;  2EQJ A;  2LQN A;  4C8Q G;  3HRU A;  2JJ9 A;  4QQG A;  3EGU A;  1FMV A;  2BZY A;  2XU8 A;  2KMT A;  1KSW A;  4KUI A;  4PJJ A;  3SDZ A;  4A4E A;  2QYZ A;  2YT6 A;  4N4H A;  4F6W B;  1VQ7 A;  5FU6 B;  5FRN A;  3HKS A;  3JB9 D;  2PK9 B;  1D3B B;  2J6K A;  2SEM A;  5CVI A;  1QVG P;  1QP3 A;  1OKW B;  5L23 A;  2NUP A;  2MF2 A;  3DL1 A;  3BDU A;  4CC7 A;  4IUU A;  4FW2 A;  5LJ3 d;  3MO8 A;  4QQ6 A;  3NMZ C;  2ED1 A;  1ZA2 B;  1URC B;  3O0G D;  2AK5 A;  1V76 A;  2E3I A;  1NYG A;  1BBZ A;  5IHN A;  4FYW B;  1WGS A;  4L59 A;  2XG8 D;  3CCQ T;  1H25 B;  2L2P A;  3OB9 A;  1M2V A;  3VS4 A;  1QLB A;  2HL5 C;  3BFM A;  2RI2 A;  4DQ2 A;  2DBM A;  3C0C A;  5GAN h;  3CCQ Q;  2K7A A;  4KT0 E;  4RTZ A;  2EYX A;  1EZZ B;  1VQ9 A;  1YHQ T;  3SWN A;  2VXF A;  4N4G A;  2COW A;  2RHX A;  1H1S B;  2A28 A;  2DMO A;  2ZZD A;  1AOJ A;  3JCM W;  1YHQ Q;  3OQ5 A;  2WIP B;  3A98 A;  3E19 A;  5LJ3 j;  3EFO A;  1OL2 B;  2CCH B;  3OMG A;  3TW6 A;  3CCM A;  2K5F A;  1RUW A;  2FPD A;  5GAO q;  5CQY A;  2W2H A;  3WVE B;  1F5Q B;  2DTI A;  4FT4 A;  4RMO A;  1VQ8 A;  2GTJ A;  4QW2 A;  4CFN B;  3OYB A;  2W9F A;  2DL4 A;  2KYB A;  3C12 A;  2LX7 A;  3EID B;  5D6W A;  3OA6 A;  2LRQ A;  3CBM A;  3G4S T;  2LCS A;  3DLM A;  4CRL B;  4HVV A;  2WEV B;  1K1Z A;  2WMB B;  1QQJ A;  4OGE A;  1X01 A;  2DRM A;  3BLH B;  1G8X A;  3THK A;  3M58 A;  4JZ3 A;  4AG1 C;  4BB7 A;  3CCR A;  3REA B;  2PU9 B;  5HCK A;  1VQO T;  3GOX A;  2EYZ A;  3LH0 A;  4ELY C;  4M7A F;  2PZ1 A;  4J9B A;  5I11 A;  1RL2 A;  3GTM S;  1JKW A;  3H0F A;  4LDW A;  4F7U B;  4M7A D;  1KG1 A;  5IHI A;  4M75 A;  3CC4 A;  2MIO A;  1K9M R;  3OYE A;  1JXM A;  4M77 B;  5EC7 A;  3L42 A;  2AKL A;  2CJM B;  2WIH B;  2KXD A;  3G71 A;  2D9T A;  2VXE A;  2O88 A;  2QEX T;  2JMC A;  2UZB B;  5FRM A;  4JX5 A;  2A7Y A;  3AT1 B;  4DBF A;  3DLL A;  3JCM c;  2LW4 A;  3T9N A;  1IRE B;  3VUB A;  2QEX Q;  2H3J A;  2YUO A;  2R5A A;  4BCM D;  3CD6 Q;  1VQM A;  1K0X A;  1VQ6 T;  1VQK A;  2AT1 B;  1BI0 A;  2X3W D;  2C4G B;  3SHW A;  3F70 A;  2XDB A;  1VQ6 Q;  2LJ1 A;  4LDU A;  2X35 A;  4J9F A;  2EFI A;  1V1C A;  1UUE A;  4Z02 A;  4BE1 A;  1NM7 A;  3EGD A;  3HFO A;  1KXU A;  1PWT A;  2JZ2 A;  3JB9 H;  2NWM A;  2ED0 A;  2FZG B;  1QCN A;  3VS3 A;  2FPE A;  6AT1 B;  1VQL Q;  1ZSZ C;  3PMT A;  4B9W A;  2CGH A;  3HP9 A;  3QXE B;  3WXM B;  4A4K A;  2O4X A;  4ZGJ B;  4J9G A;  4TTH A;  4ELL A;  4XAX B;  5IDP B;  1TG0 A;  2D0N A;  1AWX A;  3A8H B;  2NUZ A;  4JJC A;  3TU4 K;  5I2S A;  1GRI A;  4O5V A;  5IAY A;  2IVX A;  4JLI A;  1UNH D;  2DL7 A;  4K11 A;  4GY5 A;  3QKJ A;  3EGX A;  2KMG A;  5GAN e;  2QGS A;  4KRD B;  2FB7 A;  2P4T A;  2MPX C;  2DZ9 A;  1UB4 A;  2L3P A;  2QTV A;  3HB9 A;  2LCC A;  2UZL B;  1D1A A;  1BYM A;  1Y71 A;  4IUQ A;  3CCE T;  3PVQ A;  1PHT A;  2DXB A;  3QWY A;  4BCH B;  4OB1 B;  3CBP A;  4C0D C;  4ROC A;  4M75 E;  3M0S A;  2RB6 A;  3L2V A;  3CCE Q;  4J6Y A;  1YIT A;  3I55 A;  2A08 A;  3CMA A;  2OX7 A;  1R0B G;  1WIE A;  5LJ5 g;  3E9G A;  3I35 A;  4ZTF A;  2V1R A;  1JBM A;  4I3Z B;  1QMC A;  3BHU B;  1AZG B;  3CC2 T;  2I2L A;  4UN0 A;  5C6S A;  4RTV A;  3MHX A;  3H41 A;  1JOW A;  2VV5 A;  3CCJ T;  1IHV A;  3R6N A;  2HSE B;  4LD9 K;  3X28 B;  1BK2 A;  3CC2 Q;  3HPW A;  1IGQ A;  3M0P A;  4E7I A;  4YOZ A;  3CCJ Q;  2JXB A;  1YWO A;  1D0Y A;  5IT9 E;  3L2Z A;  1KHI A;  1YJN A;  1KQS A;  4M75 G;  1UGQ B;  3ULR B;  4F16 A;  4AG2 C;  4ZTJ A;  2DO3 A;  3ZL7 C;  1UHF A;  2G9X B;  1RAB B;  2GQI A;  3O8V A;  2BE7 D;  2CT4 A;  5CKB A;  5I2M A;  3A5Z B;  4C92 D;  2XD0 A;  2X4X A;  2LQ8 A;  4PJO D;  5J26 A;  3JAM E;  5KE3 A;  3GLX A;  1K8A R;  1X27 A;  4XU0 A;  2XDD A;  1UEB A;  2L3R A;  1T0J A;  3SFM A;  2AZS A;  2V22 B;  2E12 A;  2KRO A;  4JUV A;  2DE0 X;  2Y4Y A;  3MI9 B;  5CKE A;  2F2V A;  2O9S A;  3ER0 A;  4XTZ A;  2ESW A;  1PD1 A;  3GNG A;  3OYH A;  4JRI A;  3G6E T;  1YI2 T;  1K9A A;  2OAU A;  3MCA B;  2J06 A;  5HBJ B;  1AWO A;  2CZ0 B;  5LJ5 f;  1VQN T;  1H27 B;  3MET A;  3LWH A;  2HL3 A;  1QVG A;  3OS2 A;  2HSP A;  4DOW A;  1M9S A;  1M90 R;  1YI2 Q;  1Y96 B;  4M7A A;  3JCM J;  4JX4 A;  1K76 A;  4PNO A;  1VQN Q;  2K9G A;  4RTX A;  3VKG A;  2RNA A;  4M78 B;  2CH4 W;  4CRI A;  1KC8 R;  1VQ7 T;  2ZPF B;  2YDL A;  3H9N A;  3OSS C;  4M7D C;  3V7S A;  2F2C A;  1OPL A;  1W70 A;  4BE2 A;  3CCV A;  2CRE A;  4BCP B;  1OI9 B;  2IW8 B;  2HKN A;  3A8L B;  2A36 A;  1YBY A;  4LOC A;  1NPP A;  4A4G A;  4IUT A;  2KSS A;  1JU5 C;  2HQE A;  4IUV A;  3PFS A;  4X34 A;  2ZPB B;  1X69 A;  2HMA A;  4EMK A;  4PFP A;  2R7G A;  3H0I A;  1M90 U;  1AEY A;  1C1A A;  3EG9 B;  5GAM h;  1MHN A;  1YJW A;  1VQ9 T;  2I40 B;  2MWO A;  4MMK A;  1KC8 U;  2JUF A;  1FMK A;  1VQ9 Q;  4LN2 A;  1M1G A;  2GTO A;  3CCU A;  2YUP A;  1YCS B;  1XNI A;  5KH6 A;  1FMW A;  2VWF A;  5CYI B;  2WHB B;  1RAG B;  3CCM T;  3QYB A;  3NFC A;  2E10 A;  2QQS A;  4F7U F;  1TXQ A;  2EPD A;  2LNH B;  3JCM h;  3MP6 A;  1Q82 U;  2FZK B;  1QKW A;  3OW2 S;  1CKA A;  5LMK B;  4M77 F;  1WHM A;  2DD5 A;  4M77 D;  2QK0 A;  2EKO A;  4ANJ A;  5D6Y A;  1UG1 A;  1C6V X;  5BNJ B;  4B6M A;  3BE3 A;  1X2K A;  2JS2 A;  3LW5 E;  4XTU A;  2CDT A;  4R56 A;  5DM7 R;  1TS9 A;  2K2V A;  2DKG A;  5AT1 B;  1RAD B;  4RTT A;  1N8R U;  1HSQ A;  5CO7 A;  2W99 A;  1LOJ A;  2OI3 A;  2X9H A;  4PFO A;  2PNI A;  2OTJ Q;  3JCM Q;  2AKK A;  1N5Z A;  5HNB B;  1ABQ A;  4YOS A;  3E9F A;  3LWI A;  1IO6 A;  2FYK A;  2WAC A;  4HNU A;  3B57 A;  3FB9 A;  4E7S A;  3CC4 T;  4M7A E;  3GF5 A;  5FRO A;  1KFZ A;  1SG5 A;  2V8J A;  1H26 B;  1ENW A;  1QWF A;  1PD0 A;  2FRY A;  3G71 T;  5D6X A;  3CC4 Q;  3KHI A;  3BW1 A;  2QDL A;  2KAF A;  3BG9 A;  3JRZ A;  4RG8 A;  2ATC B;  5DQW A;  3J7A F;  1WHH A;  1VQ4 A;  8AT1 B;  2VC8 A;  3DB4 A;  5GAM d;  4A4F A;  2YUN A;  1JQQ A;  2COY A;  4F7L B;  3BDL A;  3RDV A;  1YIJ A;  4LE9 A;  3M5A A;  1TH7 A;  1VQM T;  1UDL A;  4NOY A;  2WSC E;  5GAN 5;  1VQK T;  4Z88 A;  1D1C A;  4M7A G;  4MIM A;  2C0T A;  1BKB A;  3JCM d;  1K4U S;  3C94 A;  2DF6 A;  1RLP C;  1GCQ A;  2RF0 A;  5LJ3 h;  2HBW A;  2GCX A;  2ZPE B;  2DD4 A;  1GUX B;  2C0I A;  5I22 A;  4JJN K;  1VIN A;  2DEU A;  1WXT A;  2EJF A;  1OX9 A;  5C0M A;  4II1 A;  2BIV A;  1OKV B;  2G6F X;  3CC7 A;  5GAM j;  1OI1 A;  3DOG B;  1H64 1;  3JV3 A;  1H92 A;  2K57 A;  1P5E B;  1X6G A;  2JS0 A;  4KRC B;  1VUB A;  2FVU A;  1O75 A;  2DXT A;  4ZGD B;  3H8Z A;  3QPH A;  1WI7 A;  2JOY A;  1JXO A;  5IH2 A;  1UHC A;  5M9O A;  4RUG A;  1D3B A;  4J5Y A;  1W98 B;  2YSQ A;  3OS5 A;  1OUL A;  4BBS M;  2LJ3 A;  1I81 A;  2KR3 A;  2EVR A;  5GMK h;  3OW2 P;  4B9X A;  1M1K U;  5GAM e;  4M7D D;  1KIK A;  4DA4 A;  1JJ2 S;  2RMO A;  4C92 B;  3OYF A;  3OYD A;  4LUD A;  2QAS A;  4EMK C;  4PJO B;  1U5S A;  1QCO A;  2LT1 A;  2CP3 A;  1YJ9 A;  1MMA A;  4BCO B;  2PUO B;  1UJ0 A;  1K73 C;  1Q86 U;  1XJW B;  1G5V A;  2KYM A;  1H1Q B;  2L89 A;  1IB8 A;  3UA7 A;  1UGR B;  1I8F A;  1M30 A;  4E6R A;  3JCM e;  1YNZ A;  2ZPG B;  2XI9 A;  2DK3 A;  2LX9 A;  4FT2 A;  4OVA A;  1YIT T;  3I55 T;  3JB9 F;  1JST B;  1AD6 A;  2NUT B;  1XO2 A;  3QDR B;  5CIU A;  1WFW A;  4C8Q C;  1YIT Q;  2KRN A;  4WTO B;  1MMN A;  4R55 A;  2DAQ A;  3OMC A;  4J8O A;  1M5Q 1;  5CEI B;  1OU8 A;  4EMG A;  5J39 A;  2O9V A;  3L2R A;  3RR6 A;  4IIO A;  2J05 A;  3OYC A;  4BY6 C;  1Q81 U;  2QTX A;  3LX7 A;  3TN8 B;  3HL8 A;  4J7F A;  3PO3 S;  1YJN T;  1UGS B;  2PHG A;  4EOP B;  1ZUU A;  2K3Y A;  1VA7 A;  3VYH B;  1RAH B;  3C4S A;  1OIU B;  2COZ A;  5GMK l;  4LDX A;  3V7R A;  3QUI A;  2C0O A;  1Q95 G;  4KH1 B;  1I5O B;  4XQ3 A;  4FYV B;  1WNL A;  4PLL A;  2JTM A;  1ZSZ B;  3VS6 A;  2BKD N;  1QWE A;  4F7U A;  1PCX A;  2HD0 A;  1B7T A;  1SKU B;  4RCC A;  4C5E A;  3OS0 A;  1M27 C;  4JRQ A;  1NJI C;  2D1X A;  2JVV A;  4HKE A;  4M77 A;  4M78 D;  1NG2 A;  3RKX A;  4EDU A;  2NUP B;  1RAF B;  5CKD A;  1NJI R;  3S3M A;  2IN3 A;  4JS5 A;  1NZ9 A;  3ZFJ A;  5CCA A;  1WPY A;  2VKN A;  1M2O A;  5LJ3 e;  3QYE A;  2A3L A;  1Y07 A;  3QWL A;  4C92 G;  2GFA A;  3G4S Q;  5FU7 C;  2E5Q A;  2F1L A;  2LJ0 A;  4PJO G;  3OSV A;  2FL7 A;  2X4Y A;  2DXU A;  3X24 B;  1PSF A;  2CSI A;  5GMK j;  5KYU B;  2CT3 A;  2KXC A;  3MP1 A;  4LUE A;  4OB2 B;  3KFV A;  1JJ2 P;  5FLX E;  2RI5 A;  1VQO Q;  4PJN A;  3MY1 B;  2GQV A;  1E6H A;  2E65 A;  2M0Y A;  3DDP B;  2CZ1 B;  2ZPI B;  1VYV A;  1H28 B;  3VYG B;  1QVP A;  2K3B A;  3FJ5 A;  3QO3 A;  2CKK A;  4OGR B;  1NE8 A;  4C0D B;  3EHR A;  1DJ7 B;  2DJZ A;  1Y0M A;  4IMY B;  2FO0 A;  3QII A;  3R6O A;  3M54 A;  1YN8 A;  2EQU A;  2XDP A;  5GMK e;  4PJL A;  2QGF B;  2RQR A;  1U1T A;  2KRM A;  5GAO p;  4O6J A;  4PL6 A;  4BDZ A;  1X6O A;  4DBR A;  1PG5 B;  4JLG A;  3CPW S;  3JB9 I;  4E7H A;  1O9K B;  3UT1 A;  3FJP A;  2DIL A;  3CCS A;  3I5S A;  2M1H A;  2G77 A;  4D8K A;  1WXU A;  1R8O B;  2C5X B;  1SF9 A;  4PK4 A;  1M3B A;  2CS7 A;  2D8H A;  4XTY A;  1G3T A;  4ZGE B;  3V8L A;  2RI3 A;  1PRL C;  1YJW T;  3V8J A;  1K9M U;  4E7Z A;  1I4K 1;  1NEG A;  2KGT A;  4HCC A;  5DLQ E;  3UAT A;  4JRP A;  2QQR A;  2K5L A;  3PMI A;  1YJW Q;  5ECA A;  2DL5 A;  3CCU T;  4ELZ C;  5HK3 A;  1TUD A;  2OAW A;  2V26 A;  5IDN B;  3CCU Q;  4CFW B;  2DME A;  1H3H A;  2O01 E;  4E7K A;  1PC0 A;  4F7U E;  2EGC A;  4HVU A;  2ECZ A;  2R58 A;  1S72 A;  5IHY A;  4M77 E;  5GJV B;  1VQ5 A;  1ABO A;  5GAO l;  1WJS A;  3KUF A;  4EPC A;  1I5L A;  2RO0 A;  4G6L B;  5CAI A;  3I5R A;  1ZSG A;  4BCK B;  3V7C A;  4BI3 A;  3V8K A;  3DJB A;  1KQ1 A;  4OP0 A;  3SWN C;  1B34 B;  4F7U G;  1NBE B;  2C06 A;  4RTW A;  4JJB A;  1JRI A;  2V1Q A;  4M77 G;  2RJD A;  5HK0 A;  2LZ6 B;  1VQ4 T;  2R5M A;  4M7D B;  1LCK A;  2QQ8 A;  1RAA B;  3QJ6 A;  5FGK B;  4J9E A;  5DY9 A;  5EFQ B;  3KXT A;  1YIJ T;  3GIB A;  4EC9 B;  3UA6 A;  1BCM A;  4OGC A;  4C0Z A;  5DQV A;  2VB6 A;  2KNB B;  5J3B A;  1TUG B;  3VS2 A;  2YWW A;  1YIJ Q;  3OYI A;  1ZQ1 A;  2QA4 A;  4PFZ A;  4ME7 A;  3DKM A;  2E5K A;  4KH0 B;  2E3H A;  2EW3 A;  2E41 A;  4BCF B;  3CPW P;  2QGG A;  1TTH B;  3TW7 A;  4C92 F;  2CP6 A;  4CFX B;  2JT4 A;  3RKW A;  3OYG A;  1HK9 A;  4PJO F;  4F14 A;  2QF7 A;  5EJC A;  2FPF A;  1QVF S;  1UJY A;  2M16 A;  4M75 C;  3CCQ A;  5A0D A;  5IXB A;  4F7N B;  2PVO B;  2O31 A;  3ME9 A;  3MJX A;  3OYN A;  1OPK A;  3QHW B;  4Q5W A;  4XU1 A;  3SD4 A;  2VYT A;  1C9B A;  1Y96 A;  2F69 A;  3OW2 A;  4II5 B;  4JZ4 A;  2M9U A;  3OYJ A;  2KQW A;  5GAN 6;  2YRD A;  2BS2 A;  2RQV A;  2DJQ A;  1QCF A;  1WYX A;  1YCY A;  2PVD B;  1H8K A;  4HL4 A;  2W9Z A;  1PKT A;  1E6G A;  4JS4 A;  1M8M A;  1WQ7 A;  1QMZ B;  1ARK A;  4NST B;  1WHJ A;  2M02 A;  1OV3 A;  3CEY A;  1YJ9 T;  2PMI B;  2JN0 A;  2HZY A;  3NDQ A;  3G6E Q;  4NL2 A;  1SHG A;  4GLK A;  2J6F A;  1K8A U;  2GGR A;  1UGP B;  2CP2 A;  1FVV B;  2B86 A;  3EG9 A;  1UNL D;  2B8A A;  3HZJ A;  2CZ7 B;  4EOK B;  5GAN 2;  3A8G B;  4HT9 A;  1D09 B;  4FL6 A;  1W4S A;  3LLR A;  4C5G A;  2C5V B;  2P4R A;  4X9D A;  1NLP C;  1VQ7 Q;  3TEE A;  4ROE A;  4A63 B;  1OX8 A;  5GAN 8;  1VQP A;  1HJD A;  3A8O B;  1BI3 A;  4TVR A;  4Z6Y A;  4FM4 B;  1Q7Y C;  4X9C A;  3HRS A;  2Y90 A;  2DM1 A;  1HXD A;  3HSB A;  2QEX A;  5LQF B;  2EUF A;  4LNP A;  1AIS B;  1Q82 C;  4JX6 A;  2HEQ A;  3CD6 A;  4EIK A;  1WDX A;  3MKD A;  3SEM A;  3PTA A;  2CYZ B;  1KD1 C;  4Z89 A;  3E2U A;  5I5Z B;  2RQW A;  1YP5 A;  3QDF A;  1G83 A;  3JB9 G;  2K4Y A;  5KYX A;  1TUC A;  2K79 A;  1KD1 R;  1MMD A;  2IW6 B;  2WXV B;  4AFU C;  4BI4 A;  1GL5 A;  1N8R C;  3RMQ A;  4KUL A;  2XK0 A;  1N9S A;  2EGE A;  3EG0 A;  5DLO A;  1QVF P;  1SHF A;  1VQL A;  2LNV A;  1MV3 A;  1VQ8 T;  4YC3 B;  3CCM Q;  1XQH A;  3BHT B;  2ABL A;  4BCJ B;  2WFY B;  3UF4 A;  2LTO A;  3EFS A;  3TNH B;  3CXC S;  4E7L A;  5LJ5 h;  1VQ8 Q;  1OZ2 A;  1SSF A;  1EX4 A;  2D6F A;  2EQI A;  4CFV B;  3H4C A;  4FIB A;  5LJ3 f;  1JJ2 A;  2EGA A;  1IHW A;  3QHR B;  2L5Q A;  1E7O A;  1GXI E;  2DXC B;  1G3W A;  1OYX A;  2YRC A;  1AT1 B;  3CCR T;  1ACM B;  1V29 B;  1W2B S;  3URG A;  3M0Q A;  4BCI B;  5HQ0 B;  4FCY A;  4KBM B;  3FIF A;  3QSU A;  3CCR Q;  2DA9 A;  4DBQ A;  2BPM B;  2VUB A;  2XID A;  1Z9Z A;  2HQH A;  4J7I A;  5FW9 A;  5KYW B;  5GAN g;  2QXF A;  4J83 A;  3HTR A;  3VKI A;  4IUR A;  4HXJ A;  1G3N C;  4M78 G;  1BIA A;  5GAN 4;  1N27 A;  3DTO A;  2KT8 A;  1GUX A;  2PQW A;  4KUD K;  2X4W A;  2AIR B;  4UC4 A;  2G3R A;  4FSX A;  3G71 Q;  3OYA A;  1C0M A;  4C8Q B;  2K2M A;  4BD3 A;  5KYY B;  5HVY B;  1VYU A;  3HBL A;  4M75 D;  2KBT A;  3EG3 A;  3QYG B;  2WMA B;  2X1N B;  1U8R A;  1HYO A;  2EAY A;  3A1P A;  2AZV A;  1PM3 A;  4AFQ C;  4ORZ A;  4BCQ D;  3CCS T;  3VRZ A;  2JW4 A;  3G7Z A;  4BY6 B;  1VQM Q;  2FEI A;  2P0Q A;  1LNX A;  2DFU A;  3FLG A;  2X4J A;  3UPU A;  2K3X A;  3CCS Q;  1VQK Q;  3M0U A;  1M3C A;  1MUZ A;  2MOX A;  1SPK A;  5KYN A;  1ZUY A;  2FZC B;  4C92 A;  4M7A C;  5LJ5 d;  4OML A;  1M1K C;  4PJO A;  1A0N B;  3L1A A;  4LD6 A;  1PRM C;  4IUP A;  3TNI B;  4PJM A;  4BCN B;  3EG2 A;  1GBQ A;  4C0G A;  3CCL A;  1MNE A;  4WF2 A;  3VU3 C;  3BG5 A;  4J6W A;  4IKF A;  4F04 B;  2RA2 A;  4E2F B;  3C95 A;  2XHC A;  5HBH B;  1Q86 C;  1N9R A;  4R0K A;  3BG3 A;  5HKC A;  4F17 A;  4CFU D;  4C5H A;  2ZAE A;  1J3T A;  2DLP A;  2UZD B;  1S72 T;  3QYH B;  1FYN A;  1M4Z A;  2NUT A;  4M7D F;  3ZBD A;  1BCO A;  1OOT A;  2RPN A;  3EHQ A;  5GAN f;  1S72 Q;  1EFN A;  4BE0 A;  3D7S B;  1ZBJ A;  1G2B A;  2KE9 A;  3QZ5 B;  4YTL A;  5HBE B;  4J9I A;  3PT9 A;  2CZ6 B;  4MFE A;  1H4L D;  3CXC P;  5LJ5 j;  2PJQ A;  2DVJ A;  4FYX B;  3E1S A;  5FU7 B;  4EOJ B;  5IHK A;  1KHC A;  3RGF B;  2CP7 A;  2E6N A;  1R0C B;  3MPU B;  3BLR B;  2QDY B;  2RHI A;  4MZP A;  2DD4 B;  2JTE A;  3VKH A;  4FU6 A;  1K73 R;  2BS3 A;  2K6D A;  5GMK i;  3FC3 A;  1W2B P;  2EBP A;  5ACB A;  5D7U A;  2DYI A;  4D8D A;  3M56 A;  2LQK A;  3CMA T;  4OMN A;  1CKB A;  3M9Q A;  1LVK A;  5LJ5 e;  4BCG B;  2BE9 B;  3I55 Q;  1IGU A;  2LT4 A;  3CMA Q;  3JSC A;  2XIC A;  2FRW A;  4V2S A;  3OBW A;  1QKX A;  1NEB A;  1ZSZ A;  3RIR A;  2ROL A;  2DBK A;  2E4H A;  3CPW A;  3POM A;  3OYY A;  1WHL A;  3GPL A;  1OGU B;  2IPO B;  4FW1 A;  3EH2 A;  1MMG A;  2XMF A;  4WCI A;  2EYQ A;  2JTF A;  2KVQ G;  2QA4 T;  4ATO A;  2RN8 A;  4EOR B;  4Z8A A;  4BUG A;  1H3Z A;  4F7J B;  1K73 U;  3OYM A;  4NS5 A;  2QA4 Q;  1YJN Q;  4HA8 A;  3CBO A;  3LQ5 B;  3TSW A;  1PSE A;  3U23 A;  3ZEH A;  3VS5 A;  4C92 E;  4RG2 A;  4PJO E;  2DPP B;  4C5I A;  5KYU A;  4PKC C;  2WJ9 A;  2Y4X A;  2HCK A;  3NHN A;  2E6Z A;  1X43 A;  1YFN A;  2GFU A;  3L2W A;  4OB3 B;  4Y92 A;  4XTW A;  2DX1 A;  2EYW A;  4M78 F;  2P0K A;  4GLM A;  3VYG A;  3M53 A;  2RD1 A;  4X1V A;  2P0P A;  3VV0 A;  1KJW A;  4QQD A;  2RHZ A;  2QG9 B;  5GAN 7;  1XOV A;  2EJG A;  3QG1 A;  2RK1 A;  2DTO A;  2YLB A;  1HD3 A;  3INZ A;  3M55 A;  2JM8 A;  4QVC A;  1MGQ A;  4J9D A;  4MFD A;  1M2V B;  2GF7 A;  1PKD B;  3AHU A;  2YLC A;  3M59 A;  3L2Q A;  2V8K A;  1GCQ C;  1O9K A;  2CCI B;  3OYK A;  4HCB A;  2Z0W A;  1QW1 A;  4LXC A;  4C92 C;  2EJ9 A;  2OTJ A;  3MEA A;  4PJO C;  4BDY A;  3SWN B;  2YXY A;  2EYY A;  3EAE A;  3PGG A;  4DEX A;  1UE9 A;  1PNJ A;  2BS4 A;  1ZA1 B;  2ZZD B;  1T0H A;  3BHV B;  1JEG A;  2RHU A;  3CCV T;  3EFO B;  1K9M C;  1U3O A;  1NJI U;  3FRN A;  3OY9 A;  1VQP T;  3NTK A;  2ROT A;  1RAC B;  3DB3 A;  3CCV Q;  2KEA A;  4L5G A;  3LGF A;  1I07 A;  2QDJ A;  5FU6 C;  2OTL A;  2W0Z A;  4RKU E;  3X20 B;  2P84 A;  1VQP Q;  4MML A;  2RQU A;  2DZC A;  1ZUK A;  2KR6 A;  2DYB A;  2MMP A;  3GP8 A;  3NTH A;  2KDS A; 
#chains in the Genus database with same CATH homology
 5D6Y A;  3CCQ A;  5A0D A;  2L8D A;  3CD6 T;  2PVO B;  3ME9 A;  3OYN A;  5GAN d;  2V8I A;  2EQJ A;  4C8Q G;  3HRU A;  3LW5 E;  4Q5W A;  4QQG A;  2VYT A;  2F69 A;  1Y96 A;  4XTU A;  4XU1 A;  3SD4 A;  1AHJ B;  2XU8 A;  5DM7 R;  4R56 A;  2K2V A;  2DKG A;  2KMT A;  3OW2 A;  3MEU A;  4KUI A;  1N8R U;  5CO7 A;  3SDZ A;  4A4E A;  2F5K A;  1LOJ A;  4MDW A;  1QVF A;  2M9U A;  1Q86 C;  4N4H A;  1VQ7 A;  5FU6 B;  3OYJ A;  3JCM Q;  5FRN A;  3HKS A;  3JB9 D;  1D3B B;  5CK9 A;  3J81 E;  5CVI A;  1QP3 A;  2KQW A;  5GAN 6;  2BS2 A;  2MF2 A;  3DL1 A;  2VGM A;  3E9F A;  3LWI A;  3BDU A;  2KY9 A;  2FYK A;  4M75 B;  2WAC A;  4HNU A;  4IUU A;  1YCY A;  2DVE A;  2PVD B;  5LJ3 d;  3FB9 A;  5GAN 3;  3MO8 A;  4E47 A;  4QQ6 A;  2ZCF B;  3CC4 T;  4M7A E;  3GF5 A;  4HL4 A;  5FRO A;  3JCM X;  1B34 A;  2KK4 A;  4JS4 A;  1VQL T;  2F5T X;  2V8J A;  2LVM A;  1WQ7 A;  4XK8 E;  2HBP A;  3G71 T;  5D6X A;  3CEY A;  2EWN A;  3KHI A;  3BW1 A;  3CME A;  1YJ9 T;  2JN0 A;  1WGS A;  2KAF A;  2XG8 D;  3BG9 A;  3JRZ A;  4L59 A;  3OB9 A;  3CCQ T;  4RG8 A;  3J7A F;  1VQ4 A;  4NL2 A;  1QLB A;  5GAN j;  2VC8 A;  2E1H A;  3BFM A;  2RI2 A;  1KQ2 A;  3DB4 A;  4GLK A;  5GAM d;  1K8A U;  4M7D A;  4DQ2 A;  4A54 A;  1UGP B;  4A4F A;  4C8Q F;  4OF1 A;  5GAN h;  4KT0 E;  4A4H A;  4C8Q D;  1BI1 A;  3BDL A;  5A0G A;  2B8A A;  3HZJ A;  2CZ7 B;  5KE2 A;  5GAN 2;  1YIJ A;  3JCM V;  1YHQ T;  1VQ9 A;  3M5A A;  3A8G B;  2VXF A;  4N4G A;  3SWN A;  1TH7 A;  4HT9 A;  1VQM T;  2RHX A;  3A8M B;  3QBY A;  3LGL A;  4FL6 A;  4NOY A;  2WSC E;  1W4S A;  3HFN A;  3LLR A;  5CKH A;  5GAN 5;  4C5G A;  5KCH A;  1VQK T;  2ZZD A;  1VIF A;  5AYF A;  3JCM W;  4M7A G;  4X9D A;  4MIM A;  3OQ5 A;  1BKB A;  3E19 A;  5LJ3 j;  3TEE A;  5GAN 8;  3JCM d;  5GAM g;  3OMG A;  1VQP A;  3TW6 A;  3A8O B;  1BI3 A;  2K5F A;  3C94 A;  4TVR A;  3CCM A;  4VUB A;  1VQP T;  5LJ3 h;  4MDX A;  4Z6Y A;  4FM4 B;  1FWZ A;  2GCX A;  2ZPE B;  2DD4 A;  2M0O A;  5GAO q;  5CQY A;  4X9C A;  3WVE B;  2DTI A;  4FT4 A;  4MZT A;  4XU3 A;  4RMO A;  4JJN K;  1Q7Y C;  1VQ8 A;  3HRS A;  4QW2 A;  2Y90 A;  3OYB A;  3I56 A;  2EJF A;  1HXD A;  3C12 A;  5C0M A;  3HSB A;  4II1 A;  2O4X B;  2BIV A;  5GMK m;  2QEX A;  3HHT B;  1FXX A;  5D6W A;  3CC7 A;  3KBG A;  1Q82 C;  4JX6 A;  3OA6 A;  2LRQ A;  5GAM j;  4AKG A;  3CBM A;  1OI1 A;  3G4S T;  3CD6 A;  2IG0 A;  2MWP A;  2NLU A;  3DLM A;  3M57 A;  1H64 1;  3JCM g;  2K57 A;  3PTA A;  4M77 C;  2CYZ B;  1KD1 C;  4OGE A;  1X01 A;  3H6Z A;  2EQK A;  1VUB A;  2FVU A;  1O75 A;  2DXT A;  3M58 A;  3RKY A;  3JB9 G;  2K4Y A;  4BB7 A;  3CCR A;  4ZGD B;  3H8Z A;  3NTI A;  3QPH A;  2PU9 B;  2JOY A;  1VQO T;  3GOX A;  4BI4 A;  3LH0 A;  5M9O A;  4ELY C;  4M7A F;  1D3B A;  4J5Y A;  1N8R C;  3OS5 A;  1RL2 A;  4BBS M;  3RMQ A;  1I81 A;  4KUL A;  5GMK h;  2XK0 A;  4LDW A;  4F7U B;  1N9S A;  4B9X A;  2QI2 A;  2PUK B;  1M1K U;  4HT8 A;  5GAM e;  4M7D D;  1KG1 A;  4M75 A;  3QJY A;  3CC4 A;  4DA4 A;  1JJ2 S;  5DLO A;  3OYE A;  4C92 B;  2YRV A;  3OYD A;  3OYF A;  4M77 B;  1VQL A;  2LNV A;  3L42 A;  1VQ8 T;  4EMK C;  4PJO B;  1XQH A;  2LT1 A;  2EKO A;  3G71 A;  2D9T A;  2VXE A;  4HLQ A;  2PVG B;  1YJ9 A;  2QEX T;  2LTO A;  3EFS A;  2PUO B;  3CXC S;  4E7L A;  5FRM A;  4JX5 A;  2A7Y A;  5LJ5 h;  3CC7 T;  1WQW A;  1K73 C;  1Q86 U;  3DLL A;  1G5V A;  3JCM c;  2DXB B;  1OZ2 A;  1SSF A;  2D6F A;  2L89 A;  3MEV A;  3T9N A;  1IRE B;  3OBY A;  1UGR B;  1I8F A;  3VUB A;  3H4C A;  4FIB A;  3CCL T;  5LJ3 f;  1JJ2 A;  2H3J A;  3JCM e;  2BUD A;  2L5Q A;  2QQA A;  2ZPG B;  2R5A A;  1GXI E;  2XI9 A;  2DK3 A;  2LX9 A;  2DXC B;  1G3W A;  1OYX A;  4FT2 A;  4OVA A;  1YIT T;  3I55 T;  3QHS A;  2RJC A;  3CCR T;  1V29 B;  5LL6 S;  1YHQ A;  4M78 A;  3JB9 F;  3M4G A;  1W2B S;  1VQM A;  3URG A;  2R57 A;  1YIT A;  3CXC A;  1K8A C;  1VQ6 T;  3QDR B;  5CIU A;  1VQK A;  1P92 A;  4KBM B;  3FIF A;  4C8Q C;  3QSU A;  1BI0 A;  2VUB A;  2XID A;  4EMH A;  2VGN A;  3F70 A;  4J7I A;  3RUX A;  4R55 A;  5GAM f;  5GAN g;  4N0A A;  2DAQ A;  4RCB A;  2XDB A;  4ZN1 A;  3OMC A;  2QXF A;  1M5Q 1;  4J8O A;  4EMG A;  5J39 A;  4J83 A;  4HCZ A;  4LDU A;  2X35 A;  3MP8 A;  4IUR A;  4L6V 5;  3VKI A;  5A2Q E;  4M7D E;  2EFI A;  3VUZ A;  3L2R A;  4P5N A;  4M78 G;  4Z02 A;  4BE1 A;  1BIA A;  5GAN 4;  1W2B A;  3EFR A;  1N27 A;  2LC4 A;  3HFO A;  2RJE A;  3FDR A;  2JZ2 A;  4E7J A;  3JB9 H;  3OYC A;  4BY6 C;  2PQW A;  1Q81 U;  2X4W A;  4UC4 A;  4KUD K;  1Y7X A;  2QTX A;  3S3O A;  1QP2 A;  2RM4 A;  3LX7 A;  2G3R A;  3HL8 A;  3PMT A;  4J7F A;  2CGH A;  3HP9 A;  3QXE B;  3WXM B;  4B9W A;  4A4K A;  2O4X A;  1YJN T;  1UGS B;  4QSH A;  4ZGJ B;  4FSX A;  2ZGW A;  3OYA A;  3G4S A;  4C8Q B;  1VIE A;  2EQM A;  2K3Y A;  3JCM f;  4BD3 A;  5LJ3 g;  3VYH B;  3HBL A;  3C4S A;  4M75 D;  3X25 B;  5I21 A;  2DTH A;  4XAX B;  4OB0 B;  3QYG B;  5GMK l;  4LDX A;  1U8R A;  5IN1 A;  3V7R A;  3A8H B;  3QUI A;  2EAY A;  1XTD A;  3P8H A;  3TU4 K;  5I2S A;  1M90 C;  2MI6 A;  2ZPH B;  4M6V A;  1WJQ A;  4O5V A;  3CCS T;  1VQO A;  5IAY A;  4XQ3 A;  3CPF A;  3G7Z A;  2WSE E;  4BY6 B;  4JLI A;  5EG2 A;  4M7D G;  1WNL A;  1BIB A;  1RI0 A;  2RHY A;  4PLL A;  2JTM A;  2P0Q A;  4GY5 A;  3QKJ A;  1LNX A;  3JCM P;  3FLG A;  2X4J A;  2KMG A;  3UPU A;  2K3X A;  5GAN e;  1KC8 C;  2BKD N;  4F7U A;  2FB7 A;  2P4T A;  2HD0 A;  3WVD B;  2DZ9 A;  4RCC A;  4C5E A;  1UB4 A;  3OS0 A;  1KQS A;  4BI8 B;  4JRQ A;  1NJI C;  4C92 A;  2JVV A;  5HY6 A;  4M7A C;  4HKE A;  4M77 A;  4M78 D;  5LJ5 d;  3RKX A;  4EDU A;  1M1K C;  4PJO A;  4ZN3 A;  4J6X A;  3HB9 A;  3L1A A;  2LCC A;  4LD6 A;  4DOV A;  4IUP A;  4HNT A;  5CKD A;  1M8V A;  5KCO A;  3S3M A;  1BYM A;  4QVD A;  1Y71 A;  1NZ9 A;  4IUQ A;  3ZFJ A;  5CCA A;  4JS5 A;  1WPY A;  3CCE T;  4C0G A;  1EIF A;  3CCL A;  4WF2 A;  2DXB A;  3VU3 C;  3BG5 A;  1IZ6 A;  5LJ3 e;  3J80 E;  3QYE A;  3N5B B;  4OB1 B;  4J6W A;  4IKF A;  2A3L A;  3CBP A;  4C0D C;  5GAO m;  1Y07 A;  2RA2 A;  3QWL A;  4M75 E;  5CQX A;  4C92 G;  2GFA A;  2RB6 A;  2XHC A;  3C95 A;  3HRT A;  4J6Y A;  5FU7 C;  3L2V A;  1O9S A;  2E5Q A;  3I55 A;  4NC6 A;  1N9R A;  3BG3 A;  2DXC A;  3OSV A;  2FL7 A;  2X4Y A;  4PJO G;  5HKC A;  3CMA A;  2AHJ B;  4C5H A;  5LJ5 g;  2DXU A;  1S72 T;  3E9G A;  3X24 B;  1PSF A;  3QYH B;  4ZTF A;  1VQ6 A;  5GMK j;  1JBM A;  1M4Z A;  4M7A B;  3MP1 A;  4M7D F;  3ZBD A;  4OB2 B;  5FLX E;  2RI5 A;  3OYL A;  2XKO C;  4LDY A;  5GAN f;  1KQS S;  3UDC A;  3M4Y A;  4BE0 A;  2I2L A;  2GQV A;  3CC2 T;  5C6S A;  3QZ5 B;  2E65 A;  4YTL A;  3MHX A;  2CZ1 B;  2ZPI B;  3MEW A;  3VYG B;  2VV5 A;  3CCJ T;  1QVP A;  3QO3 A;  4JRK A;  2CKK A;  3PT9 A;  2CZ6 B;  4MFE A;  4LD9 K;  1NE8 A;  5LJ5 j;  3X28 B;  2E64 A;  2FHD A;  4C0D B;  2HAX A;  1DJ7 B;  2DJZ A;  3E1S A;  1E7P A;  3HPW A;  4M78 E;  5FU7 B;  3SB2 A;  4E7I A;  2E70 A;  1KHC A;  3QII A;  3R6O A;  1Q7Y U;  3PIO A;  3M54 A;  1FX7 A;  2E6N A;  2EQU A;  3LYI A;  2XDP A;  1KHI A;  3L2Z A;  5GMK e;  5IT9 E;  4M75 G;  1UGQ B;  2QDY B;  2RHI A;  5GAO r;  1YJN A;  4MZP A;  4ZTJ A;  2DO3 A;  1X75 C;  2DD4 B;  1U1T A;  3VKH A;  4FU6 A;  4C8Q A;  2BS3 A;  5GMK i;  3FC3 A;  4XTX A;  3O8V A;  5GAO p;  4O6J A;  5A0L A;  4PL6 A;  4BDZ A;  5CKB A;  3M56 A;  2LQK A;  1X6O A;  3CMA T;  5I2M A;  4JLG A;  3CPW S;  3A5Z B;  4BAC A;  4C92 D;  3JB9 I;  1KD1 U;  2X4X A;  2XD0 A;  3M9Q A;  4E7H A;  2LQ8 A;  3FJP A;  3UT1 A;  2DEQ A;  1U1S A;  4EMK B;  5LJ5 e;  4PJO D;  5J26 A;  3CCS A;  2M1H A;  2G77 A;  3ASK A;  3JAM E;  5KE3 A;  1R8O B;  3GLX A;  2LCL A;  2LT4 A;  4PLI A;  4XU0 A;  3JSC A;  2XIC A;  2CS7 A;  2EIF A;  2OTJ T;  4V2S A;  3OBW A;  2XDD A;  1UEB A;  4XTY A;  1G3T A;  4ZGE B;  2L3R A;  2RI3 A;  3RIR A;  3V8L A;  3V8J A;  2QQB A;  3PNW C;  4OMF B;  1YJW T;  1K9M U;  1I4K 1;  2RJF A;  3CPW A;  4HCC A;  5DLQ E;  3OYY A;  5L8R E;  5CR2 A;  1G3Y A;  2YHT A;  3SFM A;  3GPL A;  4QVZ A;  4JRP A;  2QQR A;  3S6W A;  1BI2 A;  2E12 A;  4AKH A;  2K5L A;  3PMI A;  4JUV A;  4Y28 E;  2Y4Y A;  3CCU T;  5CKE A;  2EYQ A;  2JTF A;  3P8B B;  4ELZ C;  2KVQ G;  3CCM T;  2QA4 T;  5HK3 A;  1QVG S;  4ATO A;  3ER0 A;  4XTZ A;  4M75 F;  4AI6 A;  3CCE A;  4BUG A;  4M78 C;  3GNG A;  3TCJ A;  1H3Z A;  3OYH A;  4CI0 C;  1FKM A;  4JRI A;  2HQX A;  1K73 U;  4C0F A;  2OTL T;  3OYM A;  4NS5 A;  4Y91 A;  4BBR M;  3G6E T;  2O01 E;  4HA8 A;  4E7K A;  3JB9 J;  2DD5 B;  4F7U E;  3CBO A;  2DIG A;  1YI2 T;  2OAU A;  3MCA B;  3BY7 A;  2HNI A;  1PSE A;  2R58 A;  2LDM A;  2CZ0 B;  4N0A C;  3ZEH A;  5LJ5 f;  1S72 A;  1VQN T;  2JNG A;  3MET A;  4C92 E;  3LWH A;  4M77 E;  4RG2 A;  1QVG A;  4ELJ A;  3OS2 A;  1VQ5 A;  4PJO E;  4DOW A;  2DPP B;  3P8D A;  1M9S A;  5GAO l;  1WJS A;  4C5I A;  3KUF A;  1Y96 B;  4EPC A;  4NL3 A;  2K5I A;  1I5L A;  4M7A A;  3X26 B;  4PKC C;  3JCM J;  4M7A D;  2RO0 A;  2WJ9 A;  2Y4X A;  4JX4 A;  3RER A;  4PNO A;  2E6Z A;  2GFU A;  3CC2 A;  3L2W A;  3VKG A;  4OB3 B;  4M78 B;  1WJR A;  4XTW A;  4M78 F;  2QQ9 A;  3CCJ A;  5CAI A;  4CRI A;  2P0K A;  2DIQ A;  1VQ7 T;  1LJO A;  3VYG A;  4JDS A;  4AKI A;  3M53 A;  2ZPF B;  3OSS C;  4MZM A;  4M7D C;  2RD1 A;  3V7S A;  2P0P A;  3VV0 A;  3V7C A;  4QQD A;  4BI3 A;  4BE2 A;  3CCV A;  2RK2 A;  5CKF A;  3V8K A;  2RHZ A;  5GAN 7;  1XOV A;  2EJG A;  1KQ1 A;  4OP0 A;  3SWN C;  3QG1 A;  2RK1 A;  3TRE A;  1B34 B;  2DTO A;  3A8L B;  3FEO A;  4F7U G;  3JCM b;  1YBY A;  2YLB A;  2C06 A;  4LOC A;  1NPP A;  3INZ A;  4A4G A;  3M55 A;  1JRI A;  4IUT A;  3OS1 A;  2KSS A;  4QVC A;  1MGQ A;  3GNF B;  4M77 G;  3S3N A;  2HQE A;  4IUV A;  3PFS A;  4MFD A;  4X34 A;  1NPR A;  4A53 A;  3CME T;  4HNV A;  2GF7 A;  3AHU A;  2RJD A;  2YLC A;  3M59 A;  3L2Q A;  5HK0 A;  2V8K A;  2ZPB B;  3RES A;  1VQ5 T;  1VQ4 T;  2R5M A;  4M7D B;  4EMK A;  1OZ3 A;  3OYK A;  2QQ8 A;  4HCB A;  1M90 U;  1QW1 A;  3QJ6 A;  2MAM A;  4C92 C;  1N6A A;  5DY9 A;  2EJ9 A;  2OTJ A;  5GAM h;  3MEA A;  1MHN A;  3Q1J A;  4PJO C;  4BDY A;  3SWN B;  3EAE A;  3KXT A;  1YJW A;  3PGG A;  1VQ9 T;  1YIJ T;  2RH2 A;  4XU2 A;  4C8Q E;  3GIB A;  4OGC A;  2BS4 A;  2MWO A;  4MMK A;  3RMS A;  3UWN A;  4C0Z A;  4D6W A;  2ZZD B;  1KC8 U;  1M1F A;  1JB0 E;  1ZBX A;  2JUF A;  2RHU A;  5J3B A;  3CCV T;  1M1G A;  1ZQ1 A;  3OYI A;  3L2U A;  3CCU A;  1K9M C;  2D0Q B;  1XNI A;  2IVW A;  1NJI U;  3FRN A;  5KH6 A;  2QA4 A;  3OY9 A;  4N4I A;  2QFZ A;  4ME7 A;  3DKM A;  3QYB A;  3NTK A;  3NFC A;  3VJP A;  2E10 A;  3PIP A;  2QQS A;  4F7U F;  3DB3 A;  3JCM h;  3MP6 A;  2E41 A;  1ZHI A;  4L5G A;  3LGF A;  1Q81 C;  1Q82 U;  1G3S A;  2QDJ A;  3HO8 A;  5FU6 C;  3OW2 S;  2OTL A;  3QZ9 B;  4RKU E;  3TW7 A;  4C92 F;  3X20 B;  3RKW A;  4M77 F;  3G6E A;  5GAO n;  3OYG A;  1HK9 A;  4MML A;  4PJO F;  2DZC A;  1YI2 A;  2QF7 A;  5EJC A;  1QVF S;  3I56 T;  2KR6 A;  2MMP A;  3GP8 A;  2DD5 A;  2M16 A;  2WSF E;  3NTH A;  4LDV A;  4M77 D;  1VQN A;  4M75 C;  2KDS A;  4XTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...