3X26B

Crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 5 min
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVKYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
molecule tags Lyase
source organism Rhodococcus erythropolis
publication title Time-Resolved Crystallography of the Reaction Intermediate of Nitrile Hydratase: Revealing a Role for the Cysteinesulfenic Acid Ligand as a Catalytic Nucleophile.
pubmed doi rcsb
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3x26B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3x26B02
1GXIE 2ZPHB 1JB0E 2WSCE 3X26B 2DD5A 3A8LB 2PVOB 1DJ7B 4OB2B 2ZCFB 1QP2A 3X25B 1IREB 4Y28E 2DXBA 1UGSB 2PU9B 2DD4B 4XK8E 1PSEA 3A8MB 2PVGB 3VYHB 3A8OB 2ZZDB 2WSFE 4ZGJB 2ZPGB 4RKUE 1PSFA 2DD5B 3HHTB 3QZ9B 2PUOB 1UGPB 4OB3B 2CYZB 3QYGB 2D0QB 2DXCB 1V29B 2DXBB 4L6V5 3QXEB 2AHJB 2DXCA 2O01E 1AHJB 4OB1B 2ZZDA 2ZPFB 1QP3A 3LW5E 4OB0B 2DPPB 2PUKB 3A8GB 3QZ5B 3VYGA 2QDYB 3X28B 2ZPIB 2CZ1B 2CZ0B 4ZGEB 3A8HB 3QYHB 4ZGDB 2ZPBB 3X24B 2CZ7B 2CZ6B 1UGRB 3WVEB 1UGQB 2WSEE 4FM4B 3X20B 2ZPEB 2DD4A 3WVDB 2PVDB 5L8RE 4KT0E 3VYGB
chains in the Genus database with same CATH superfamily
3MEAA 2E6ZA 3VKGA 3UA7A 3PTAA 1GY3B 3EHRA 4JS4A 1Y57A 2LX7A 1ABOA 4A4HA 1OIYB 1T3LA 1X75C 1JSTB 2WIHB 3BHUB 1M30A 3QHRB 2CCHB 1VQ4T 4OGRB 5FRNA 3OW2S 1VQ6A 3NFCA 4C5HA 1Z9ZA 1YITQ 1PKDB 4F04B 4KUDK 1MV0B 4PFPA 1UGSB 2KYMA 4XK8E 3EH1A 2MYSA 1PSEA 4DOVA 2CP7A 2DJQA 1R0BG 3FJ5A 2WHBB 2QI2A 2L89A 2CT4A 2QDLA 5GANe 2IVXA 4M77D 4BI3A 2WXVB 1X6GA 4AT1B 4M7DD 3BG9A 2JXBA 3OW2A 1VQPT 1W98B 1NG2A 3M57A 2R57A 1H1PB 2G6FX 1WHGA 2F69A 5LJ3e 2EUFA 5ICPB 6AT1B 2LT1A 1QVFS 3CCEQ 3CPWS 2X4JA 2X4YA 4RMOA 1UGVA 2A28A 2VVKA 3OY9A 4UN0A 3M0TA 3LWHA 3RKYA 5C0MA 1IZ6A 3UPUA 2O88A 4F7NB 2DTIA 4M78G 4Z02A 4C92B 2VGMA 2ZZDA 1Q81U 1NPRA 3SWNA 4E7KA 5GMKm 3RUXA 1X01A 3H41A 1AOJA 2LCCA 1H4LD 1NEGA 1FMWA 2VXFA 3MY5B 1OQKA 4XTVA 3L2VA 4M77B 1OEBA 2M1HA 2LQ8A 4IUUA 4M7AC 2H8HA 3RKWA 3TU4K 2FHDA 5HK0A 4A4FA 1MUZA 2GBQA 1PM3A 5KCOA 4F7UB 2AKLA 1UGRB 2FRYA 5LJ5j 3VS4A 3MIAB 3EH2A 4J9GA 5GAMe 2EIFA 1X69A 1E7OA 1BCOA 1WXUA 2DYIA 3I5RA 4BDZA 3CCMQ 2HBWA 3CPWA 3CCST 2NUZA 1M5Q1 2XG8D 5LJ5d 1TSFA 1TG0A 5HK3A 3BLRB 2KAFA 4J9IA 2ZCFB 4F6SB 1QP2A 1VQ7T 1S72T 3JCMX 3GNGA 3G4ST 1M1KR 4FT2A 2DK3A 2Y4XA 3CC4T 3M4YA 3QJYA 1QCOA 3ULRB 3R6OA 2RI3A 1FYNA 3META 5KYWA 1SRLA 3OS0A 1WXTA 5M9OA 2DO3A 1OZ3A 1WFWA 3TSZA 3V8JA 3CC4Q 3CMEQ 3V8LA 2JMCA 3DL1A 4B9XA 1FWZA 4CFUD 1SF9A 4C92E 1RADB 2LZ6B 3CCSA 4JRIA 2EW3A 5D6XA 1T3SA 2QXFA 1OKVB 3I9QA 4O5VA 4JJBA 3OMGA 1WHLA 3TNIB 2RHYA 2JMAA 1JU5C 1VOMA 2RJEA 3RMSA 2SEMA 4IIOA 3THKA 3CCVQ 1VQOQ 4JX4A 1PCXA 5CKBA 1M3CA 3FC3A 2RQWA 4JJCA 5C6SA 3PT9A 2QA4Q 3RGFB 2YXYA 1FVVB 2EYZA 4XTZA 1H1SB 2EJGA 4ORZA 1PHTA 4YOOA 1R8OB 1VA7A 2XK0A 5LJ5e 1HYOA 2RM4A 1QLBA 2JM8A 3QWYA 3PMTA 3CMAQ 1EZZB 4J8OA 5FWCA 3JB9D 1ZSZC 2PQWA 3P8BB 3VRZA 5IXBA 4MZMA 1M1KU 2WIPB 1M9SA 2IN3A 3PIPA 5IAYA 3HB9A 2ZPEB 5KYYB 2CP3A 2OTLT 1QKXA 4HCBA 1JJ2P 2EYWA 3M0PA 3L1AA 2RHXA 5GAN7 5KYUB 4RUGA 3S3MA 3BW1A 3CC7Q 4JJDA 3REAB 2KRNA 4M7AD 1S1NA 2FO0A 4IURA 1ZLMA 2DERA 2M02A 1Q86R 1QMZB 1NJIC 3PMIA 1VQMA 2HKNA 1JB0E 3E2UA 4FYWB 2ED0A 1RUWA 2I0NA 2EYXA 3GOXA 3OYHA 4TTHA 2JS2A 1IRXA 2K9GA 1KIKA 1W2BP 1AWXA 1BK2A 4OF1A 1TWBA 4CFMB 3UATA 1YJ9T 2CH4A 5CK9A 3M55A 5FLXE 1MGQA 3HSBA 4KRCB 1X43A 4GY5A 2ZPGB 1VQLA 1CSKA 2C5NB 1VIEA 1KD1U 2VV5A 2K5LA 1M90R 1PSFA 3J7AF 4M7AB 3NTHA 2QGSA 5FGKB 4F70B 2GGRA 4C0DB 5LJ3d 1D0YA 3CCVA 2A36A 3CC2Q 4HCCA 1YJ9A 4EC8B 4NL3A 2QQ8A 1QMCA 3SDZA 2HEQA 1K9MR 1KQSS 3CCUQ 4A4KA 2W9ZA 4LDWA 3TW7A 2PHGA 3NGPA 3LQ5B 1YHQT 1NYGA 2A37A 2C6TB 1W1FA 3MKDA 4R0KA 4OB1B 5HY6A 2DNUA 2L3SA 5IF1B 2QK0A 2HAXA 4PJOC 4C8QE 2FVUA 4M7AE 4OB0B 4CXAB 4MZPA 5FU7B 2V8IA 5GAN6 4OP0A 3QZ5B 3VYGA 3I5SA 1VQ4Q 2W99A 1M1FA 4R56A 4BCQB 5GAMh 2WMAB 4E7JA 4C5IA 4NSTB 2IPOB 5CQXA 3S3NA 2P4RA 3M58A 1H641 2C4GB 1N4MA 1F1BB 4OMOA 4CFNB 1V76A 1D1AA 2FB7A 4BXXX 3WVEB 2DMEA 3SD4A 2AIRB 4DBRA 2AT1B 2P0KA 1KQSP 3TSWA 1XNIA 4C8QG 2D0NA 4ELJA 2EVRA 3VU3C 4D8DA 2YT6A 3OYAA 1M90U 3HRTA 3M03A 1WXBA 2WSCE 2RPNA 4HVWA 2X4XA 2DBMA 4C8QD 1H8KA 1NZ9A 2HL3A 3OS2A 2EQIA 2RQRA 3H9NA 1H28B 2OTLQ 5HBEB 1D1BA 2NYSA 1JSUB 4F7LB 2L0AA 2CKKA 4C92D 3VS5A 4M7DG 1NM7A 1VQ9Q 1W2BS 3OYIA 2PVGB 4Q5WA 1E9HB 2CP2A 4M75F 4HVVA 2J06A 1IHWA 3TREA 1WJSA 2LT4A 5D6YA 3PIOA 3EFOA 1T0JA 2NUTB 4J7FA 2EGCA 2KVQG 1AT1B 2YUQA 4C0ZA 3OMCA 1YI2Q 3QYGB 3OBYA 1B34A 4C8QB 4BCMB 4M6VA 2D0QB 5A0LA 2JOYA 5CO7A 4NL2A 2XDBA 1C9BA 4F7SB 2WMBB 2K3YA 1Q86C 2V22B 1NJIR 2QEXQ 2IIMA 1YJWT 2JJ9A 4C92C 8AT1B 3OYFA 4IKFA 2E41A 1KG1A 3TVTA 3CCRA 1QP3A 2EYQA 1GFDA 3JCMd 4J9EA 1C6VX 4C92F 3JCMc 1JXMA 4RG8A 1SEMA 1QVGP 1IXDA 3VKHA 3A98A 1SRMA 1VQMQ 4JRQA 5DLOA 5A0DA 3X28B 3EG1A 4G6LB 5HQ0B 3MEUA 4CC3A 2K79A 4DQ2A 4BY1X 1IGQA 4M75G 2E5KA 2UZBB 1UHFA 1G3SA 4M4ZA 3VJPA 2O9SA 3JB9I 2WSEE 4FM4B 3SWNB 2V1RA 1WHHA 1NEBA 2DZCA 1D3BB 1YHQA 1VQ5A 1Q81C 2XDDA 1WJRA 3QWLA 5FRMA 5GAN3 2VB6A 1H27B 2DAQA 3S6WA 2DETA 2E64A 1VQOT 2EYYA 2FG0A 1Q82U 2ENMA 4F14A 1TTHB 1SG5A 5GMKh 3GPLA 4RODA 4C5GA 5KE3A 2PZ1A 2COZA 4BCJB 2MMPA 1GRIA 3CPFA 2FRWA 4HA8A 1EFNA 4PJOB 1O9KA 4M78E 1NJIU 2RI2A 2LRQA 3J81E 2PU9B 1QKWA 2C5XB 4BCNB 2JT4A 2HQEA 3H0FA 4BDYA 4BY6C 2EQMA 3TNWB 4JRPA 2M0OA 1TD6A 5A0GA 4II1A 4EMKA 1W70A 1GBQA 1M3AA 1TS9A 4XTYA 4PL6A 4JJNK 5J26A 2X3WD 2ATCB 4E7ZA 4ZN3A 4EOSB 4XU3A 1UGPB 1TUCA 2DVJA 2G9XB 3OS5A 3TNHB 4RTTA 2MWPA 3BG3A 1Y07A 5FU7C 1KD1C 4ELYC 1RI9A 1B34B 2BZ8A 1I81A 3CCRT 2K3XA 3ASKA 3QXEB 3EFRA 3WXMB 1H3ZA 2DXCA 4AKIA 4GLKA 5LJ3j 2LQWA 5KYYA 1YJWA 3CCMT 2B86A 3LGFA 1MMDA 3M9QA 1O75A 1U1SA 1URCB 2W0ZA 2DYBA 4BY7X 2JTFA 1YI2T 1GH6B 3GP8A 2QQBA 4B9WA 2ROLA 1BB9A 1R0CB 1UJ0A 4C8QF 4OMPA 1HD3A 1HK9A 4M75E 3QYHB 1PD0A 4AG1C 2JZ2A 2CZ6B 2QGFB 2BIVA 4FL6A 1W6XA 4HLQA 2BZYA 3RKXA 2L3QA 3G7ZA 2XHCA 4X34A 3UA6A 2DD4A 4LDXA 3CCQQ 3CPWP 2A0FB 4EDUA 3G6EA 4JUVA 2QQSA 2LTOA 2YDLA 2JUFA 4F7UG 2OJ2A 4F7JB 2A7YA 2QTXA 1JOWA 3A8LB 2RHUA 2E70A 3QWXX 2F5TX 1RAIB 2QFZA 4QVCA 3TQ7P 2RO0A 3ZBDA 3CC7T 4M77C 2GNCA 4BCFB 4CI0C 2OTJA 2HDAA 3FRNA 3OS1A 5CKHA 4BCGB 1UNHD 2I40B 4OVAA 5LJ5g 1VIFA 4FYXB 3VYHB 3C4SA 3A8OB 5D6WA 1YCYA 2WSFE 3ZFJA 3QO3A 1AZEA 4YTLA 3BDUA 4AI6A 4LNPA 2JGZB 2IVWA 4M7DE 4XTUA 1ZSZB 3UDCA 2COWA 4PJOE 1Q86U 1VINA 4FIBA 4Z6YA 2LW4A 1UE9A 4X1VA 1KQ1A 1OI9B 2MAMA 1VQ9A 3M0QA 2QA4T 4BCOB 4RTYA 4RTXA 2RK1A 4EOLB 1X6BA 4F7UF 5GAN5 5LL6S 4EOMB 5GAMj 1VYVA 2O01E 1RAHB 2DL3A 2MWOA 3HL8A 1VQNA 1VQ5Q 1Z9QA 4HNVA 5GANj 1RLQC 3CD6A 2HZYA 1LPLA 1YJNA 4ESRA 4LDYA 3QSUA 1VUBA 1AWWA 1MNEA 3EGXB 1H26B 1YCSB 5GMKe 1Y7XA 1WIEA 4M78C 3L2ZA 2RJFA 1K4US 1N5ZA 3INZA 1N8RC 4HXJA 2IW9B 5KYXB 3J80E 1OGUB 2GQVA 3VS7A 1KFZA 1X2KA 3DTOA 3QJ6A 4EONB 2K6DA 3GIBA 5L8RE 3HKSA 3CMAT 4KGXB 2Z0WA 3M0SA 1JKWA 2P4TA 2X3XD 5A2QE 3X26B 4OGEA 2O31A 4PJJA 3CC7A 3EG3A 4PFZA 3VS1A 1YHQQ 1OX9A 3H0IA 5FROA 4B6MA 4YOZA 1H3HA 3FJPA 2CCIB 2IW8B 4M7DB 4JX6A 4E7SA 2XKOC 2QDJA 4JZ3A 1CKAA 4XTXA 4EMGA 1NLPC 2DF6A 1N9SA 3R6NA 2VC8A 4DEXA 2VYTA 4DBQA 4QQGA 2PK2A 2RQUA 1VYUA 3EFSA 4JX5A 3M56A 1YITT 2CDTA 4Y72B 1WDXA 2F2VA 1RI0A 3CQTA 4L59A 3EAEA 4MMKA 1UJYA 2FZGB 4PJOA 4E7HA 5CAIA 2UZEB 3JSCA 4M7DA 4LOCA 5GAOr 1OIUB 4C8QC 4BE1A 3QIIA 3P8HA 4ATOA 4K11A 1M8MA 4M78B 5KYWB 1QLYA 4BE0A 2A3LA 2NWMA 1J3TA 3M4GA 5GMKj 5GAN2 3TW6A 4AFQC 4EOQB 3SFMA 4PKCC 3DLLA 2FZCB 2QDYB 3BHTB 2E10A 3EG9B 3HP9A 4IMYB 4YOSA 4OMLA 4C8QA 3RESA 1UUEA 4M7DC 4ZGEB 3DJBA 4XU1A 1YP5A 5KYXA 5IHIA 2OAUA 2E3IA 5AT1B 1VQ5T 2QTVA 2CZ7B 1ZA1B 1H1RB 2W9FA 2RD1A 3JV3A 2DTOA 5IHKA 4A4EA 2DIGA 1K73U 3LLRA 1NYFA 4BD3A 2DVEA 2SRCA 3NTKA 1K8AR 3H6ZA 3M5AA 4AFZC 2EQJA 1I4K1 2XDPA 1MMAA 4IUQA 2C5VB 4KT0E 3FIFA 3PGGA 5GANg 1WHJA 4BE2A 2UZDB 2HSEB 5DM7R 3I56T 1M8VA 5GAOn 2KSSA 2KGTA 3POMA 4ROCA 1I5LA 3RERA 2LC4A 3MP1A 1OPKA 1TFBA 1I07A 5IHYA 1QVPA 3JCMW 1H1QB 2DXBA 1SPKA 1G8XA 2DD4B 4E2FB 2OTJT 4PLLA 1KSWA 1QCNA 4UC4A 3G1JA 2KMGA 2K2VA 4LUDA 2OTLA 4KULA 1ZUUA 1D3BA 4XU2A 2E12A 2PJQA 4HL4A 5EFQB 2KRMA 4JRKA 1OU9A 2V1QA 1M3BA 3VKIA 3KFVA 2OTJQ 4J6YA 3DKMA 1I1JA 2PK9B 2XI9A 1P5EB 1Q82C 3JB9J 2W96A 2J6FA 2PUOB 2RHZA 2CYZB 5DQVA 3QYEA 1K9AA 1TXQA 4M7DF 3CCUT 2LDMA 1K73C 3M54A 3V7SA 4EIKA 4J5YA 2CP6A 2COYA 4PJNA 1K8AU 4CC4B 1C0MA 3KXTA 2ZPFB 3CMET 1AVZC 3N5BB 2P84A 1HXDA 4C0FA 2XMFA 1KHIA 4L5GA 3K7AM 1GUXB 1XOVA 1M1KC 4M78D 1N8RU 1YJNT 2K2MA 2W2HA 1PG5B 3H4CA 2CZ1B 4KGZB 4A54A 7AT1B 3A8HB 5IH2A 1TUDA 2RH2A 2ZPBB 2XIDA 2KBTA 3FDRA 3X24B 3MO8A 3CC2T 5HCKA 2DKGA 2LX9A 3B57A 4O6JA 1RAEB 1OL2B 2DX1A 2WFYB 2KR6A 3MHXA 1PNJA 1PRMC 1M27C 4NOYA 1ZP2A 2DIQA 2MIOA 2QEXT 3I55A 2YLBA 2PVDB 5GANf 2C0OA 4OGCA 3MPUB 2ED1A 2E3HA 3RR6A 5CR2A 1BU2A 1FKMA 1BKBA 2KQWA 5GAOq 3OYKA 4QKUA 4D6WA 1ZBXA 4BUGA 4IUPA 5IDPB 1B07A 3CCMA 5EC7A 2OX7A 4M75D 3JCMb 1FMKA 3HFOA 4J7IA 1MV3A 1IREB 1BI2A 2LJ3A 1VQKQ 2CSQA 1OV3A 2HMAA 3V8KA 2DJZA 4JDSA 3BDLA 5GJVB 2EAYA 1VQ8A 3LH5A 2H3JA 4PLIA 1JQQA 3HTRA 4RTWA 1TOVA 2DLPA 1GBRA 1T0HA 3LH0A 2K5IA 4Y92A 2FYKA 2LCSA 3VUBA 1OYXA 5CVIA 3DOGB 4J9BA 4EOPB 5I5ZB 1I5OB 4AFUC 2MF2A 3DDQB 1H25B 4EOKB 3CCET 5I21A 2QF7A 3DDPB 1OOTA 3EGDB 2WPAB 1E7PA 2EGEA 3Q1JA 2KROA 4QT7A 1AWOA 3JAME 3VS3A 2DEQA 3LW5E 4CFXB 5GAOm 3KBGA 1KK7A 1BI3A 2EJ9A 2PUKB 2KEAA 1K0XA 5GAMd 3CCQT 3RBBB 5HNBB 2QAZA 3NMZC 1IHVA 3PE0A 4J6XA 2PMIB 2L3RA 4KRDB 4GLMA 4ZNXA 2CP5A 2MK5A 3OYBA 1ABQA 2QA4A 4LN2A 4KUIA 1MMNA 5KCHA 1VQ9T 1G2BA 3P8DA 2LMJA 4Z88A 5I11A 4N4GA 2QQAA 4DBHA 3BLHB 3JB9G 3NTIA 4F6WB 2CP0A 1ZA2B 2HNIA 1WYXA 4M77A 1FXXA 3T9NA 5I22A 2K3BA 4R55A 3CCUA 4FT4A 4LUEA 1RAAB 2PVOB 2RJDA 4HT9A 1OKWB 4OB2B 1YWOA 1FMVA 3BFMA 4J6WA 1VOLA 5AYFA 4J9DA 1M90C 1BBZA 1Y71A 3HFNA 4Y28E 1SHGA 5DLQE 1BIBA 2QGGA 4ELZC 1Q7YU 1JEGA 1K0SA 2W10A 1BU1A 1OULA 4WF2A 2QASA 4IUTA 3M0UA 3QDFA 3SEMA 5LQFB 1U3OA 1G83A 3CXCP 4J9CA 3CCJA 2AZVA 5GANd 1AD5A 1ARKA 3CCEA 2DD5B 4LD6A 2OAWA 1M1GA 1KC8U 3MY1B 4F6UB 1M2VB 4DEYA 1U1TA 4M7AF 1JXOA 1K9MU 2LNVA 5J3BA 2FPEA 4HNUA 4PJLA 2DXBB 4CRIA 1N8RR 1GCPA 2M51A 1QCFA 2RHIA 2GFUA 2F2WA 2NUPB 3CCQA 2AHJB 3QKJA 2GCXA 4QQ6A 2DRMA 2F5KA 4P5NA 2LQNA 4JPBW 1LCKA 2DPPB 4FSXA 2HKQB 5IXFA 2EWNA 2K5FA 4A4GA 1TH7A 3O8VA 2R5MA 4V2SA 3EOCB 1RAFB 4OMNA 3QPHA 5LJ5h 2C0TA 2AK5A 2RMOA 2NUPA 3HZJA 2M9UA 1UGQB 2E1HA 2BE9B 2DL4A 3X20B 1Q7YR 3QUIA 2VXEA 4LDUA 3I35A 3JCMQ 2QG9B 1H92A 4ZTJA 2BTTA 2LNHB 1N27A 1WLPB 2QEXA 2MPXC 5LMKB 2RQVA 4MDWA 3C0CA 5KE2A 5FU6B 3RMQA 4EMKB 1Q81R 3HO8A 2QYZA 4BCHB 1WI7A 3EG9A 5EJCA 1EX4A 9ATCB 1Q95G 3JCMV 3RDVA 2ROTA 3BE3A 1DJ7B 4Y91A 2B8AA 3G71Q 1FX7A 4II5B 2O2OA 2LP5A 1OI1A 4M77F 3CCJQ 1WNLA 2GQIA 2CSIA 1XJWB 3GBQA 2IG0A 5HBHB 2RNAA 1KXUA 2YSQA 2YUPA 1SKUB 1AZGB 2RI5A 4KGVB 3NHNA 4E47A 3G71T 3CMEA 4XU0A 3BLQB 2K4YA 1AWJA 2KNBB 4D8KA 4ZGJB 4C92G 2LCLA 2PNIA 3OA6A 3L2WA 1GL5A 5D7UA 2O9VA 2K7AA 2YRVA 3AT1B 5IHNA 3QDRB 2DE0X 3QZ9B 2DRKA 4MFEA 2D1XA 3OBWA 2H3EB 1UEBA 2CS7A 1QQJA 1OX8A 1VQ8Q 3VV0A 5LJ3h 2E5QA 1UB4A 2C06A 1B3QA 1E6HA 5CKFA 4X9DA 2KE9A 4C0DC 1F5QB 5I2SA 2IW6B 5IDNB 4BY6B 3QYBA 4LD9K 1VQKT 3NPFA 4BCND 2CT3A 5GANh 3MP8A 3VS6A 4M75A 2CUBA 5LJ5f 4MIMA 1RAGB 4ME7A 1KHCA 2DZ9A 2CZ0B 4RTUA 4C0GA 4A63B 2LJ0A 4ZGDB 1UG1A 2KT1A 4F7UE 2CH4W 3L2RA 1OU8A 2BUDA 2AKKA 1CKBA 1LVKA 2K57A 4JS5A 1W2BA 2J7IA 4IUVA 4FW2A 3C95A 1ENWA 1BYMA 3C12A 5FW9A 3SB2A 2G3RA 1LOJA 4KBMB 4BCPB 1SSFA 3M53A 3CCSQ 1PKSA 3DB4A 5CCAA 1ZUKA 2CJMB 3OYLA 2ZPHB 1XTDA 3EGXA 3UF4A 1KQSA 4XAXB 1YN8A 4JLGA 2R58A 1Q7YC 1JJ2A 1UNLD 1G3WA 4F7UA 3CBMA 3ER0A 3TEEA 2GTOA 3FB9A 2JTMA 4BI8B 2LVMA 3JCMg 1WHMA 4AG2C 4HNTA 3IQLA 1VQPA 2L8DA 4EC9B 4M78A 1BI0A 4PJMA 1VQLT 2ZZDB 2HQHA 4QVZA 4DOWA 1YIJQ 2B9RA 3LYIA 1NE8A 2O4XB 3OB9A 3JRZA 4NS5A 3GLXA 1MHNA 2J05A 4KH1B 4EOIB 1WPYA 2HD0A 3G6ET 4E7IA 3AHUA 1GCQA 2C5OB 3L2QA 1Y96B 1YITA 2FL7A 1KC8C 4IIMA 5GMKl 4EPCA 1Y0MA 1VQ7Q 5ACBA 1D0XA 4CC7A 1U8RA 5CKEA 4RCBA 2E4HA 1BCMA 2VWFA 2AZSA 3BY7A 2EFIA 3A8GB 2O4XA 4BB7A 2WJ9A 4HCZA 3OYEA 3C94A 2NLUA 4XTWA 4N4IA 3JB9F 1JBMA 4FYVB 3EIDB 2L3PA 3LX7A 2Y90A 1D3UB 2KR3A 3VS0A 4EMKC 3E1SA 3UT1A 2DL8A 1SHFA 1WA7A 4J83A 4M77G 2JTEA 5IN1A 2EBPA 4MFDA 1G3NC 5HVYB 3URGA 5BNJB 2ECZA 1PRLC 1U5SA 4RTVA 3VS2A 3FLGA 3E9GA 1YJ9Q 5HBJB 1ACMB 2M0YA 2RQTA 5GAMf 2X1NB 1IGUA 2KYBA 2P0PA 4MZTA 3CD6Q 5GAOl 3QHWB 1M2VA 2LQKA 5CKDA 3D7SB 4M7AG 2YUNA 1VQ4A 3HRSA 3LGLA 2XD0A 1HSQA 2DL5A 3RNJA 1ZSGA 3JB9H 3A8MB 1FINB 4FSSA 1A0NB 4KRTA 5EG2A 2X51A 4I3ZB 1WQWA 1QVGS 2YRDA 2HBPA 4RKUE 1K1ZA 3MI9B 2ESWA 3QHSA 1WZOA 2KT8A 2MCNA 2CREA 2EQKA 2F1LA 4OMQA 2NUTA 1O9KB 3U23A 1YNZA 2CGHA 2VASA 4L6V5 1PWTA 1NLOC 4LXCA 4DBFA 1WQ7A 2HQXA 3CEYA 5HKCA 1NBEB 4NC6A 4CRLB 4HKEA 1K73R 1VQNT 1N6AA 2BKDN 3CXCS 3OYJA 4XQ3A 4RG2A 4PJOF 3ZEHA 4EMHA 1VQMT 1KC8R 4ELLA 2JS0A 4N0AA 2EJFA 2RA2A 1UHCA 2BS3A 1M4ZA 1HJDA 3V7CA 1UNGD 4E7LA 3H0HA 3HPWA 4RTZA 2DILA 3PVLA 3BHVB 2XICA 5CQYA 1BIAA 3GF5A 1ZBJA 2FPFA 1KD1R 3H8ZA 4J9HA 1VQOA 3OYCA 4Z89A 3TCJA 2BE7D 5LJ3f 3VRYA 1WJQA 3E19A 2E6NA 4PFOA 5FWBA 3I55T 2GF7A 3EGUA 1MMGA 5CEIB 3O0GD 2DM1A 2EKOA 2BKZB 2RB6A 3RIRA 3CXCA 4VUBA 2VGNA 4WCIA 3CMAA 1K76A 1PD1A 3M0RA 2RN8A 3DB3A 1H24B 1YBYA 4AFSC 4CFVB 4EOJB 1JO8A 3F70A 3BG5A 3CCJT 4BCIB 1UFFA 3OSSC 1WX6A 3G4SQ 1YWPA 2RJCA 1XQHA 2YHTA 2R5AA 4BBSM 1RL2A 5GAMg 1V1CA 1QVGA 4TVRA 2JVVA 3I56A 2DXCB 2P0QA 4ANJA 1JJ2S 3LWIA 4BCKB 2J6KA 1G5VA 1IO6A 4JLIA 4CC2A 4QVDA 3HRUA 2E65A 1AHJB 3F5XB 2KK4A 2V8JA 5CYIB 3V7RA 1TUGB 3O5ZA 2GTJA 2HCKA 2EQUA 2F2XA 3SHWA 1R77A 1AISB 1QWEA 4ZTFA 1VQLQ 5L23A 2V26A 2QQ9A 2I53A 3MEWA 3SWNC 3OYDA 1VQ7A 4PJOD 1UDLA 2FPDA 4LDVA 3CCLA 5GAOp 2BZXA 2KXCA 2DBKA 2VKNA 4X9CA 3G6EQ 5GJWB 3S3OA 1MNDA 2MOXA 4C5EA 3CD6T 3G33B 3WVDB 1ZHIA 4M77E 4DA4A 1IB8A 5LJ3g 1VQ6Q 2DXUA 2UZLB 3VYGB 3CCLT 5DQWA 2CUDA 2V8KA 1KQ2A 4AKHA 4CFUB 1RLPC 3PFSA 2KRSA 2KY9A 1VQ6T 2BPMB 2D8JA 3ZL7C 4HVUA 2FEIA 1O9SA 2C0IA 3QBYA 2FZKB 5ECAA 4J9FA 2OI3A 4JZ4A 3HBLA 5KH6A 3MJXA 4F17A 3JCMP 2JNGA 2F2CA 4OR5B 4CFWB 3I56Q 1AEYA 2R7GA 1RABB 1S72Q 3L42A 3CC2A 4M7AA 3EJ1B 2DMOA 1TU0B 1ZX6A 2DFUA 4QSHA 3HHTB 4FX3B 3EG0A 2DEUA 4OB3B 1D1CA 1QWFA 3A1PA 5FU6C 1U06A 3CCVT 2KI7A 4E6RA 4N0AC 1V29B 5I2MA 1VQNQ 1RACB 1PC0A 3NDQA 3M59A 4N4HA 4OMMA 2ZGWA 5KYNA 2HSPA 4M75C 1OPLA 3DLMA 1GUXA 4YC3B 3TN8B 3GTMS 3CBPA 2RF0A 4ZN1A 4FCYA 4M78F 2JW4A 2YUOA 3VUZA 1Q82R 3EFOB 1VQKA 4EORB 3OYMA 2WEVB 1SSHA 1B7TA 1G3YA 3OQ5A 4HCKA 2ZPIB 4M75B 2DA9A 3G71A 4PK4A 1G3TA 3MEVA 1JRIA 2RK2A 1AD6A 3QG1A 2D8HA 2EGAA 4WTOB 3EHQA 4BCMD 1E6GA 3KHIA 1X27A 2UUEB 1GCQC 2DXTA 4Z8AA 3JCMh 1VQ8T 4BCQD 2KDSA 1PKTA 1W4SA 2D6FA 1OZ2A 1QVFA 1QW1A 1YIJT 4F16A 3CCRQ 1K8AC 1BI1A 4MDXA 2A08A 5J39A 1C1AA 2M16A 2HL5C 1GXIE 3I55Q 1UTIA 3EG2A 2L2PA 3REBB 2DD5A 4FYYB 4MMLA 2GFAA 3CBOA 4AKGA 4RCCA 1VYTA 3OSVA 1S72A 1YJNQ 2KMTA 2X4WA 1D09B 2X9HA 3X25B 3CC4A 1I0CA 4PNOA 1KJWA 3PO3S 2ZAEA 3JCMf 1UECA 2YWWA 3JCMe 2ABLA 2JM9A 3OW2P 2DTHA 1M2OA 2YRCA 2LJ1A 1YI2A 3MCAB 2G77A 1I8FA 4BACA 1VQPQ 5IT9E 2YLCA 4KH0B 2BS2A 1NPPA 4QQDA 4PJOG 2D9TA 2X35A 2EPDA 1X6OA 5L2WB 2J6OA 2PTKA 1ZSZA 3EGDA 3JCMJ 4FU6A 3A5ZB 2Y4YA 1WGSA 4C92A 5GAN4 3GNFB 1QVFP 8ATCB 4EOOB 4ROEA 4QW2A 2I2LA 4GBQA 1N9RA 1K9MC 3G4SA 1VYWB 1Y96A 2MI6A 1WHKA 3OYYA 5DY9A 2XU8A 1OL1B 3MP6A 2QQRA 3PNWC 1X2QA 3KUFA 2EKHA 2JN0A 4AMCA 2BS4A 2KXDA 1GFCA 2DL7A 3L2UA 2VUBA 5GMKi 1EIFA 1P92A 5GAN8 3OYGA 3OYNA 1XO2A 4OMFB 4BI4A 3UWNA 1LJOA 3ME9A 1YFNA 1LNXA 2L5QA 5KYUA 1D0ZA 3FEOA 1ZQ1A 4LE9A 4BBRM 2WACA 5CIUA 1YJWQ 3PVQA 3E9FA 3CCLQ 4A53A 1YIJA 4FW1A 1ZUYA 4HT8A
chains in the Genus database with same CATH topology
3MEAA 2E6ZA 3VKGA 5GAMf 1VQOT 1FKMA 1BKBA 2KQWA 5GAOq 3OYKA 3PTAA 4M7DA 4JS4A 1Q82U 4A4HA 4D6WA 1X75C 2P0PA 4MZTA 1ZBXA 4BUGA 4IUPA 5GAOl 5GMKh 3GPLA 4C5GA 2LQKA 5CKDA 1VQ4T 5KE3A 5FRNA 3CCMA 3OW2S 4M7AG 2MMPA 4HA8A 3CPFA 1VQ6A 4PJOB 1VQ4A 3HRSA 3NFCA 4M75D 3LGLA 4C5HA 4M78E 3JCMb 3HFOA 1NJIU 2RI2A 4J7IA 4KUDK 1IREB 1BI2A 2LRQA 3J81E 2XD0A 1UGSB 2PU9B 4XK8E 1PSEA 4DOVA 3JB9H 3V8KA 2DJZA 3A8MB 2HQEA 4JDSA 4BDYA 2QI2A 3BDLA 4BY6C 2EQMA 2L89A 5GANe 2EAYA 4JRPA 1VQ8A 5EG2A 2M0OA 2H3JA 4PLIA 5A0GA 4II1A 4M77D 4EMKA 1WQWA 4XTYA 4BI3A 1QVGS 2HBPA 4RKUE 4M7DD 4PL6A 3BG9A 4JJNK 5J26A 3LH0A 2K5IA 3OW2A 1VQPT 2FYKA 3QHSA 4ZN3A 3VUBA 3M57A 2R57A 1OYXA 2EQKA 5CVIA 4XU3A 1UGPB 2F69A 5LJ3e 3OS5A 2LT1A 2MWPA 1QVFS 2MF2A 3BG3A 3CPWS 1Y07A 2X4JA 2CGHA 2X4YA 5FU7C 4RMOA 1KD1C 4ELYC 3OY9A 3CCET 5I21A 2QF7A 1B34B 4L6V5 1I81A 3CCRT 2K3XA 3ASKA 1E7PA 3QXEB 3EFRA 3Q1JA 3WXMB 1H3ZA 2DXCA 4AKIA 1WQ7A 4GLKA 2HQXA 3CEYA 3RKYA 1IZ6A 5C0MA 5HKCA 3LWHA 4M78G 2DTIA 4Z02A 3UPUA 4C92B 2VGMA 2ZZDA 4NC6A 3JAME 1NPRA 3SWNA 1YJWA 4E7KA 2DEQA 5GMKm 3LW5E 5GAOm 4HKEA 3RUXA 3CCMT 1X01A 3KBGA 3LGFA 1BI3A 1O75A 3M9QA 1U1SA 1N6AA 2EJ9A 2BKDN 2JTFA 1YI2T 2LCCA 2PUKB 3CXCS 1M1KC 2VXFA 3GP8A 2QQBA 4B9WA 5GAMd 4XQ3A 4RG2A 4XTVA 4PJOF 3OYJA 3L2VA 3CCQT 4M77B 3ZEHA 4EMHA 1VQMT 2M1HA 2LQ8A 4IUUA 4C8QF 4M7AC 4J6XA 2L3RA 1HK9A 4N0AA 3RKWA 2EJFA 3TU4K 2FHDA 4M75E 3OYBA 3QYHB 5HK0A 2QA4A 4KUIA 4A4FA 2RA2A 5KCHA 4LD9K 2JZ2A 1VQ9T 2CZ6B 2BS3A 5KCOA 1M4ZA 3V7CA 4E7LA 3P8DA 4F7UB 1UGRB 2BIVA 4FL6A 3HPWA 4N4GA 5LJ5j 4HLQA 3RKXA 3G7ZA 2QQAA 2XHCA 4X34A 2DD4A 4LDXA 2XICA 5CQYA 1BIAA 1Q81U 3JB9G 3GF5A 3NTIA 5GAMe 2EIFA 3H8ZA 4EDUA 3G6EA 4JUVA 1VQOA 2QQSA 2HNIA 2LTOA 3OYCA 3TCJA 4M77A 1FXXA 5LJ3f 4BDZA 3T9NA 2JUFA 1WJQA 3E19A 4F7UG 2E6NA 2A7YA 3CPWA 3CCST 4R55A 3CCUA 4FT4A 1M5Q1 2XG8D 3I55T 2GF7A 2QTXA 3A8LB 2RHUA 2PVOB 2EKOA 2RJDA 2RB6A 2E70A 4HT9A 5LJ5d 5HK3A 2F5TX 3RIRA 4OB2B 2QFZA 4QVCA 4VUBA 3CXCA 3BFMA 2KAFA 2RO0A 2VGNA 2ZCFB 3ZBDA 1QP2A 3CMAA 4J6WA 4M77C 1S72T 5AYFA 1VQ7T 4CI0C 3JCMX 3GNGA 3G4ST 1M90C 2OTJA 1Y71A 3FRNA 3HFNA 4FT2A 2DK3A 4Y28E 3OS1A 5CKHA 2Y4XA 5DLQE 1BIBA 3DB3A 3CC4T 3M4YA 1YBYA 3QJYA 4ELZC 1Q7YU 3R6OA 2RI3A 4OVAA 5LJ5g 4WF2A 4IUTA 1VIFA 3VYHB 3C4SA 3F70A 3A8OB 3META 5D6WA 3BG5A 3OS0A 1YCYA 2WSFE 3ZFJA 3CCJT 3QO3A 4YTLA 3BDUA 5M9OA 2DO3A 3CCJA 1OZ3A 4AI6A 4M7DE 2IVWA 4XTUA 5GANd 3OSSC 3V8JA 3UDCA 4PJOE 1Q86U 3CCEA 2DD5B 4LD6A 3V8LA 1M1GA 4FIBA 1KC8U 4Z6YA 2RJCA 3DL1A 4B9XA 1FWZA 1XQHA 2YHTA 2R5AA 1U1TA 2MAMA 1KQ1A 4C92E 1VQ9A 4BBSM 1RL2A 5GAMg 4M7AF 1K9MU 2LNVA 5J3BA 3CCSA 1QVGA 4HNUA 4JRIA 4TVRA 2JVVA 3I56A 2QA4T 5D6XA 2DXCB 2P0QA 2QXFA 2DXBB 3LWIA 4CRIA 1JJ2S 1G5VA 2RK1A 4JLIA 2RHIA 4QVDA 4O5VA 2GFUA 2E65A 3HRUA 5LL6S 4F7UF 5GAN5 5GAMj 3CCQA 2AHJB 3OMGA 3QKJA 2O01E 1AHJB 2RHYA 2GCXA 2RJEA 2MWOA 3HL8A 4QQ6A 1VQNA 2KK4A 3RMSA 2F5KA 2V8JA 4HNVA 4P5NA 4JX4A 5GANj 2DPPB 5CKBA 3FC3A 3V7RA 3CD6A 2EQUA 4FSXA 5C6SA 3PT9A 2EWNA 2K5FA 1YJNA 4A4GA 1TH7A 3O8VA 4LDYA 4ZTFA 3QSUA 4XTZA 1VUBA 2EJGA 2R5MA 4V2SA 2QQ9A 3MEWA 1R8OB 3SWNC 2XK0A 5LJ5e 3OYDA 5GMKe 1VQ7A 4PJOD 1Y7XA 2RM4A 1QLBA 4LDVA 3CCLA 3QPHA 4M78C 3L2ZA 2RJFA 3PMTA 5GAOp 5LJ5h 4J8OA 3JB9D 2PQWA 3P8BB 4MZMA 1M1KU 3INZA 1N8RC 4X9CA 3HZJA 2M9UA 1M9SA 3S3OA 1UGQB 2E1HA 4C5EA 5IAYA 3J80E 3PIPA 3HB9A 3CD6T 3X20B 2ZPEB 2GQVA 2OTLT 3WVDB 1ZHIA 4M77E 4HCBA 3QUIA 2VXEA 4LDUA 4DA4A 5LJ3g 3JCMQ 4ZTJA 2DXUA 3L1AA 1N27A 2RHXA 5GAN7 2QEXA 3QJ6A 3GIBA 4MDWA 5L8RE 3S3MA 3VYGB 3BW1A 3HKSA 5KE2A 5FU6B 3RMQA 3CCLT 4EMKB 4M7AD 3HO8A 3CMAT 4IURA 1NJIC 5EJCA 3PMIA 1VQMA 2V8KA 1JB0E 2P4TA 1KQ2A 4AKHA 5A2QE 3X26B 4OGEA 3JCMV 3PFSA 3CC7A 1DJ7B 4Y91A 2KY9A 2B8AA 3GOXA 3OYHA 1VQ6T 1FX7A 1O9SA 3QBYA 1OI1A 4M77F 5FROA 1WNLA 3FJPA 4OF1A 3HBLA 4M7DB 4JX6A 5KH6A 2XKOC 3JCMP 2QDJA 2IG0A 2JNGA 1YJ9T 4XTXA 5CK9A 3M55A 5FLXE 2RI5A 1MGQA 4E47A 3G71T 4EMGA 3HSBA 3CMEA 4XU0A 1N9SA 2K4YA 2VC8A 4ZGJB 2VYTA 3L42A 4C92G 3CC2A 4QQGA 2LCLA 4M7AA 4GY5A 2ZPGB 3OA6A 3EFSA 1VQLA 4JX5A 3L2WA 1VIEA 3M56A 1KD1U 2VV5A 2K5LA 1PSFA 2YRVA 1YITT 3J7AF 5LJ3j 4M7AB 4QSHA 3NTHA 3HHTB 1RI0A 3QDRB 3QZ9B 4L59A 5LJ3d 4C0DB 3CCVA 4HCCA 4MFEA 3OBWA 3EAEA 4OB3B 1UEBA 2CS7A 4MMKA 1YJ9A 4NL3A 4PJOA 5FU6C 4E7HA 5CAIA 3CCVT 2QQ8A 3JSCA 3SDZA 3VV0A 4N0AC 4LOCA 1V29B 5LJ3h 5I2MA 2E5QA 4C8QC 5GAOr 1UB4A 4A4KA 4BE1A 3M59A 3P8HA 3QIIA 4N4HA 4LDWA 2C06A 4ATOA 3TW7A 1YHQT 5CKFA 4X9DA 4OB1B 2ZGWA 5HY6A 4C0DC 4M78B 4M75C 5I2SA 4BY6B 2HAXA 3QYBA 3DLMA 4BE0A 2A3LA 4ZN1A 4C8QE 2FVUA 3CBPA 3M4GA 1VQKT 4OB0B 5GMKj 4M7AE 5GAN2 3TW6A 4M78F 4MZPA 3VUZA 5FU7B 2V8IA 5GAN6 3SFMA 3MP8A 5GANh 1VQKA 4M75A 4OP0A 4PKCC 3DLLA 3QZ5B 3VYGA 5LJ5f 4MIMA 3OYMA 4ME7A 2QDYB 1M1FA 4R56A 5GAMh 2E10A 1G3YA 1KHCA 3HP9A 2ZPIB 3OQ5A 4M75B 4E7JA 2DZ9A 2CZ0B 4C5IA 4C8QA 3G71A 4C0GA 3RESA 4M7DC 4ZGEB 1G3TA 3MEVA 4XU1A 5CQXA 3S3NA 4ZGDB 1JRIA 2RK2A 2OAUA 3QG1A 4F7UE 3M58A 1H641 1VQ5T 2CZ7B 3L2RA 2BUDA 3KHIA 2RD1A 2DTOA 2FB7A 2K57A 3WVEB 2DIGA 4A4EA 4JS5A 1W2BA 3LLRA 1K73U 3CC7T 2DXTA 3SD4A 3JCMh 4BD3A 2DVEA 1VQ8T 4IUVA 2KDSA 3NTKA 1W4SA 2D6FA 1KQSS 1OZ2A 3C95A 2P0KA 1QVFA 1QW1A 3H6ZA 3M5AA 1YIJT 1XNIA 1BYMA 2EQJA 4C8QG 3C12A 1I4K1 2XDPA 1K8AC 3SB2A 2G3RA 1LOJA 1BI1A 4KBMB 4IUQA 4ELJA 4MDXA 4KT0E 3FIFA 3VU3C 5J39A 1SSFA 3M53A 3PGGA 2M16A 3DB4A 5CCAA 5GANg 3OYAA 3OYLA 1GXIE 2ZPHB 1XTDA 1M90U 4BE2A 3HRTA 5DM7R 4XAXB 1KQSA 3I56T 1M8VA 2WSCE 2X4XA 4JLGA 2DD5A 2R58A 1NZ9A 4C8QD 3OS2A 5GAOn 1Q7YC 4MMLA 2KSSA 2GFAA 3CBOA 4AKGA 4RCCA 3OSVA 1S72A 1JJ2A 1I5LA 3RERA 2KMTA 1G3WA 2LC4A 2X4WA 3MP1A 4F7UA 3CBMA 3ER0A 3X25B 3CC4A 1QVPA 3JCMW 4PNOA 2CKKA 2DXBA 3TEEA 3FB9A 4C92D 2DD4B 2JTMA 3JCMf 4PLLA 4BI8B 2OTJT 4UC4A 4M7DG 2KMGA 2K2VA 3JCMe 2OTLA 4KULA 2LVMA 3JCMg 1W2BS 3OYIA 1D3BA 2PVGB 4Q5WA 4XU2A 4HNTA 1VQPA 2L8DA 4M75F 4M78A 1BI0A 2DTHA 2E12A 1VQLT 4HL4A 2ZZDB 4QVZA 4DOWA 3TREA 1WJSA 2LT4A 4JRKA 5D6YA 1YI2A 3PIOA 3MCAB 2G77A 1NE8A 3LYIA 1I8FA 3VKIA 4J7FA 4BACA 2YLCA 5IT9E 2BS2A 1NPPA 4QQDA 2O4XB 3OB9A 4PJOG 4J6YA 3JRZA 4NS5A 2D9TA 2KVQG 2X35A 3DKMA 1MHNA 3GLXA 4C0ZA 2XI9A 1Q82C 1X6OA 3OMCA 3JB9J 2RHZA 2PUOB 2CYZB 1WPYA 3QYEA 3QYGB 1B34A 2HD0A 3OBYA 4C8QB 3G6ET 4M6VA 2D0QB 5A0LA 2JOYA 5CO7A 3CCUT 4E7IA 3JCMJ 4NL2A 3AHUA 2XDBA 4M7DF 2LDMA 2K3YA 3L2QA 1K73C 4FU6A 3A5ZB 2Y4YA 1Y96B 3M54A 1YITA 1WGSA 3V7SA 4C92A 5GAN4 1Q86C 2FL7A 3GNFB 1KC8C 4J5YA 1YJWT 4QW2A 2I2LA 4C92C 5GMKl 3OYFA 4EPCA 1N9RA 4PJOC 4IKFA 2E41A 1K9MC 3G4SA 1Y96A 1K8AU 2MI6A 1KG1A 3KXTA 3CCRA 2ZPFB 1QP3A 2EYQA 3CMET 1VQNT 1U8RA 3OYYA 5DY9A 2XU8A 3JCMd 5CKEA 3N5BB 4C92F 1HXDA 4RCBA 3JCMc 4RG8A 4C0FA 1KHIA 4L5GA 3MP6A 2QQRA 3BY7A 3VKHA 3PNWC 2EFIA 3A8GB 2O4XA 3KUFA 4BB7A 1XOVA 2WJ9A 2JN0A 4HCZA 2BS4A 3C94A 4M78D 5DLOA 2NLUA 3OYEA 4JRQA 5A0DA 3X28B 1YJNT 1N8RU 3H4CA 3L2UA 4XTWA 2CZ1B 4A54A 3MEUA 2VUBA 4DQ2A 5GMKi 1EIFA 3A8HB 1P92A 5GAN8 4M75G 4N4IA 3OYGA 1JBMA 2RH2A 2ZPBB 3JB9F 1G3SA 2XIDA 3LX7A 3FDRA 3X24B 3MO8A 2Y90A 4OMFB 3VJPA 4BI4A 3OYNA 3UWNA 3CC2T 1LJOA 2DKGA 3ME9A 2LX9A 4EMKC 4O6JA 3JB9I 2WSEE 1LNXA 3E1SA 3UT1A 4FM4B 2L5QA 4J83A 2KR6A 3MHXA 3SWNB 3FEOA 1ZQ1A 4NOYA 2DIQA 4BBRM 2QEXT 2WACA 5CIUA 4M77G 3I55A 2YLBA 5IN1A 2PVDB 5GANf 4OGCA 4MFDA 1D3BB 2DZCA 3E9FA 3URGA 2XDDA 1WJRA 1YHQA 3QWLA 1Q81C 1VQ5A 5FRMA 4A53A 5CR2A 5GAN3 1YIJA 2DAQA 3FLGA 3E9GA 3S6WA 2E64A 4HT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXI E;  2ZPH B;  1JB0 E;  2WSC E;  3X26 B;  2DD5 A;  3A8L B;  2PVO B;  1DJ7 B;  4OB2 B;  2ZCF B;  1QP2 A;  3X25 B;  1IRE B;  4Y28 E;  2DXB A;  1UGS B;  2PU9 B;  2DD4 B;  4XK8 E;  1PSE A;  3A8M B;  2PVG B;  3VYH B;  3A8O B;  2ZZD B;  2WSF E;  4ZGJ B;  2ZPG B;  4RKU E;  1PSF A;  2DD5 B;  3HHT B;  3QZ9 B;  2PUO B;  1UGP B;  4OB3 B;  2CYZ B;  3QYG B;  2D0Q B;  2DXC B;  1V29 B;  2DXB B;  4L6V 5;  3QXE B;  2AHJ B;  2DXC A;  2O01 E;  1AHJ B;  4OB1 B;  2ZZD A;  2ZPF B;  1QP3 A;  3LW5 E;  4OB0 B;  2DPP B;  2PUK B;  3A8G B;  3QZ5 B;  3VYG A;  2QDY B;  3X28 B;  2ZPI B;  2CZ1 B;  2CZ0 B;  4ZGE B;  3A8H B;  3QYH B;  4ZGD B;  2ZPB B;  3X24 B;  2CZ7 B;  2CZ6 B;  1UGR B;  3WVE B;  1UGQ B;  2WSE E;  4FM4 B;  3X20 B;  2ZPE B;  2DD4 A;  3WVD B;  2PVD B;  5L8R E;  4KT0 E;  3VYG B; 
#chains in the Genus database with same CATH topology
 3MEA A;  2E6Z A;  3VKG A;  3UA7 A;  3PTA A;  1GY3 B;  3EHR A;  4JS4 A;  1Y57 A;  2LX7 A;  1ABO A;  4A4H A;  1OIY B;  1T3L A;  1X75 C;  1JST B;  2WIH B;  3BHU B;  1M30 A;  3QHR B;  2CCH B;  1VQ4 T;  4OGR B;  5FRN A;  3OW2 S;  1VQ6 A;  3NFC A;  4C5H A;  1Z9Z A;  1YIT Q;  1PKD B;  4F04 B;  4KUD K;  1MV0 B;  4PFP A;  1UGS B;  2KYM A;  4XK8 E;  3EH1 A;  2MYS A;  1PSE A;  4DOV A;  2CP7 A;  2DJQ A;  1R0B G;  3FJ5 A;  2WHB B;  2QI2 A;  2L89 A;  2CT4 A;  2QDL A;  5GAN e;  2IVX A;  4M77 D;  4BI3 A;  2WXV B;  1X6G A;  4AT1 B;  4M7D D;  3BG9 A;  2JXB A;  3OW2 A;  1VQP T;  1W98 B;  1NG2 A;  3M57 A;  2R57 A;  1H1P B;  2G6F X;  1WHG A;  2F69 A;  5LJ3 e;  2EUF A;  5ICP B;  6AT1 B;  2LT1 A;  1QVF S;  3CCE Q;  3CPW S;  2X4J A;  2X4Y A;  4RMO A;  1UGV A;  2A28 A;  2VVK A;  3OY9 A;  4UN0 A;  3M0T A;  3LWH A;  3RKY A;  5C0M A;  1IZ6 A;  3UPU A;  2O88 A;  4F7N B;  2DTI A;  4M78 G;  4Z02 A;  4C92 B;  2VGM A;  2ZZD A;  1Q81 U;  1NPR A;  3SWN A;  4E7K A;  5GMK m;  3RUX A;  1X01 A;  3H41 A;  1AOJ A;  2LCC A;  1H4L D;  1NEG A;  1FMW A;  2VXF A;  3MY5 B;  1OQK A;  4XTV A;  3L2V A;  4M77 B;  1OEB A;  2M1H A;  2LQ8 A;  4IUU A;  4M7A C;  2H8H A;  3RKW A;  3TU4 K;  2FHD A;  5HK0 A;  4A4F A;  1MUZ A;  2GBQ A;  1PM3 A;  5KCO A;  4F7U B;  2AKL A;  1UGR B;  2FRY A;  5LJ5 j;  3VS4 A;  3MIA B;  3EH2 A;  4J9G A;  5GAM e;  2EIF A;  1X69 A;  1E7O A;  1BCO A;  1WXU A;  2DYI A;  3I5R A;  4BDZ A;  3CCM Q;  2HBW A;  3CPW A;  3CCS T;  2NUZ A;  1M5Q 1;  2XG8 D;  5LJ5 d;  1TSF A;  1TG0 A;  5HK3 A;  3BLR B;  2KAF A;  4J9I A;  2ZCF B;  4F6S B;  1QP2 A;  1VQ7 T;  1S72 T;  3JCM X;  3GNG A;  3G4S T;  1M1K R;  4FT2 A;  2DK3 A;  2Y4X A;  3CC4 T;  3M4Y A;  3QJY A;  1QCO A;  3ULR B;  3R6O A;  2RI3 A;  1FYN A;  3MET A;  5KYW A;  1SRL A;  3OS0 A;  1WXT A;  5M9O A;  2DO3 A;  1OZ3 A;  1WFW A;  3TSZ A;  3V8J A;  3CC4 Q;  3CME Q;  3V8L A;  2JMC A;  3DL1 A;  4B9X A;  1FWZ A;  4CFU D;  1SF9 A;  4C92 E;  1RAD B;  2LZ6 B;  3CCS A;  4JRI A;  2EW3 A;  5D6X A;  1T3S A;  2QXF A;  1OKV B;  3I9Q A;  4O5V A;  4JJB A;  3OMG A;  1WHL A;  3TNI B;  2RHY A;  2JMA A;  1JU5 C;  1VOM A;  2RJE A;  3RMS A;  2SEM A;  4IIO A;  3THK A;  3CCV Q;  1VQO Q;  4JX4 A;  1PCX A;  5CKB A;  1M3C A;  3FC3 A;  2RQW A;  4JJC A;  5C6S A;  3PT9 A;  2QA4 Q;  3RGF B;  2YXY A;  1FVV B;  2EYZ A;  4XTZ A;  1H1S B;  2EJG A;  4ORZ A;  1PHT A;  4YOO A;  1R8O B;  1VA7 A;  2XK0 A;  5LJ5 e;  1HYO A;  2RM4 A;  1QLB A;  2JM8 A;  3QWY A;  3PMT A;  3CMA Q;  1EZZ B;  4J8O A;  5FWC A;  3JB9 D;  1ZSZ C;  2PQW A;  3P8B B;  3VRZ A;  5IXB A;  4MZM A;  1M1K U;  2WIP B;  1M9S A;  2IN3 A;  3PIP A;  5IAY A;  3HB9 A;  2ZPE B;  5KYY B;  2CP3 A;  2OTL T;  1QKX A;  4HCB A;  1JJ2 P;  2EYW A;  3M0P A;  3L1A A;  2RHX A;  5GAN 7;  5KYU B;  4RUG A;  3S3M A;  3BW1 A;  3CC7 Q;  4JJD A;  3REA B;  2KRN A;  4M7A D;  1S1N A;  2FO0 A;  4IUR A;  1ZLM A;  2DER A;  2M02 A;  1Q86 R;  1QMZ B;  1NJI C;  3PMI A;  1VQM A;  2HKN A;  1JB0 E;  3E2U A;  4FYW B;  2ED0 A;  1RUW A;  2I0N A;  2EYX A;  3GOX A;  3OYH A;  4TTH A;  2JS2 A;  1IRX A;  2K9G A;  1KIK A;  1W2B P;  1AWX A;  1BK2 A;  4OF1 A;  1TWB A;  4CFM B;  3UAT A;  1YJ9 T;  2CH4 A;  5CK9 A;  3M55 A;  5FLX E;  1MGQ A;  3HSB A;  4KRC B;  1X43 A;  4GY5 A;  2ZPG B;  1VQL A;  1CSK A;  2C5N B;  1VIE A;  1KD1 U;  2VV5 A;  2K5L A;  1M90 R;  1PSF A;  3J7A F;  4M7A B;  3NTH A;  2QGS A;  5FGK B;  4F70 B;  2GGR A;  4C0D B;  5LJ3 d;  1D0Y A;  3CCV A;  2A36 A;  3CC2 Q;  4HCC A;  1YJ9 A;  4EC8 B;  4NL3 A;  2QQ8 A;  1QMC A;  3SDZ A;  2HEQ A;  1K9M R;  1KQS S;  3CCU Q;  4A4K A;  2W9Z A;  4LDW A;  3TW7 A;  2PHG A;  3NGP A;  3LQ5 B;  1YHQ T;  1NYG A;  2A37 A;  2C6T B;  1W1F A;  3MKD A;  4R0K A;  4OB1 B;  5HY6 A;  2DNU A;  2L3S A;  5IF1 B;  2QK0 A;  2HAX A;  4PJO C;  4C8Q E;  2FVU A;  4M7A E;  4OB0 B;  4CXA B;  4MZP A;  5FU7 B;  2V8I A;  5GAN 6;  4OP0 A;  3QZ5 B;  3VYG A;  3I5S A;  1VQ4 Q;  2W99 A;  1M1F A;  4R56 A;  4BCQ B;  5GAM h;  2WMA B;  4E7J A;  4C5I A;  4NST B;  2IPO B;  5CQX A;  3S3N A;  2P4R A;  3M58 A;  1H64 1;  2C4G B;  1N4M A;  1F1B B;  4OMO A;  4CFN B;  1V76 A;  1D1A A;  2FB7 A;  4BXX X;  3WVE B;  2DME A;  3SD4 A;  2AIR B;  4DBR A;  2AT1 B;  2P0K A;  1KQS P;  3TSW A;  1XNI A;  4C8Q G;  2D0N A;  4ELJ A;  2EVR A;  3VU3 C;  4D8D A;  2YT6 A;  3OYA A;  1M90 U;  3HRT A;  3M03 A;  1WXB A;  2WSC E;  2RPN A;  4HVW A;  2X4X A;  2DBM A;  4C8Q D;  1H8K A;  1NZ9 A;  2HL3 A;  3OS2 A;  2EQI A;  2RQR A;  3H9N A;  1H28 B;  2OTL Q;  5HBE B;  1D1B A;  2NYS A;  1JSU B;  4F7L B;  2L0A A;  2CKK A;  4C92 D;  3VS5 A;  4M7D G;  1NM7 A;  1VQ9 Q;  1W2B S;  3OYI A;  2PVG B;  4Q5W A;  1E9H B;  2CP2 A;  4M75 F;  4HVV A;  2J06 A;  1IHW A;  3TRE A;  1WJS A;  2LT4 A;  5D6Y A;  3PIO A;  3EFO A;  1T0J A;  2NUT B;  4J7F A;  2EGC A;  2KVQ G;  1AT1 B;  2YUQ A;  4C0Z A;  3OMC A;  1YI2 Q;  3QYG B;  3OBY A;  1B34 A;  4C8Q B;  4BCM B;  4M6V A;  2D0Q B;  5A0L A;  2JOY A;  5CO7 A;  4NL2 A;  2XDB A;  1C9B A;  4F7S B;  2WMB B;  2K3Y A;  1Q86 C;  2V22 B;  1NJI R;  2QEX Q;  2IIM A;  1YJW T;  2JJ9 A;  4C92 C;  8AT1 B;  3OYF A;  4IKF A;  2E41 A;  1KG1 A;  3TVT A;  3CCR A;  1QP3 A;  2EYQ A;  1GFD A;  3JCM d;  4J9E A;  1C6V X;  4C92 F;  3JCM c;  1JXM A;  4RG8 A;  1SEM A;  1QVG P;  1IXD A;  3VKH A;  3A98 A;  1SRM A;  1VQM Q;  4JRQ A;  5DLO A;  5A0D A;  3X28 B;  3EG1 A;  4G6L B;  5HQ0 B;  3MEU A;  4CC3 A;  2K79 A;  4DQ2 A;  4BY1 X;  1IGQ A;  4M75 G;  2E5K A;  2UZB B;  1UHF A;  1G3S A;  4M4Z A;  3VJP A;  2O9S A;  3JB9 I;  2WSE E;  4FM4 B;  3SWN B;  2V1R A;  1WHH A;  1NEB A;  2DZC A;  1D3B B;  1YHQ A;  1VQ5 A;  1Q81 C;  2XDD A;  1WJR A;  3QWL A;  5FRM A;  5GAN 3;  2VB6 A;  1H27 B;  2DAQ A;  3S6W A;  2DET A;  2E64 A;  1VQO T;  2EYY A;  2FG0 A;  1Q82 U;  2ENM A;  4F14 A;  1TTH B;  1SG5 A;  5GMK h;  3GPL A;  4ROD A;  4C5G A;  5KE3 A;  2PZ1 A;  2COZ A;  4BCJ B;  2MMP A;  1GRI A;  3CPF A;  2FRW A;  4HA8 A;  1EFN A;  4PJO B;  1O9K A;  4M78 E;  1NJI U;  2RI2 A;  2LRQ A;  3J81 E;  2PU9 B;  1QKW A;  2C5X B;  4BCN B;  2JT4 A;  2HQE A;  3H0F A;  4BDY A;  4BY6 C;  2EQM A;  3TNW B;  4JRP A;  2M0O A;  1TD6 A;  5A0G A;  4II1 A;  4EMK A;  1W70 A;  1GBQ A;  1M3A A;  1TS9 A;  4XTY A;  4PL6 A;  4JJN K;  5J26 A;  2X3W D;  2ATC B;  4E7Z A;  4ZN3 A;  4EOS B;  4XU3 A;  1UGP B;  1TUC A;  2DVJ A;  2G9X B;  3OS5 A;  3TNH B;  4RTT A;  2MWP A;  3BG3 A;  1Y07 A;  5FU7 C;  1KD1 C;  4ELY C;  1RI9 A;  1B34 B;  2BZ8 A;  1I81 A;  3CCR T;  2K3X A;  3ASK A;  3QXE B;  3EFR A;  3WXM B;  1H3Z A;  2DXC A;  4AKI A;  4GLK A;  5LJ3 j;  2LQW A;  5KYY A;  1YJW A;  3CCM T;  2B86 A;  3LGF A;  1MMD A;  3M9Q A;  1O75 A;  1U1S A;  1URC B;  2W0Z A;  2DYB A;  4BY7 X;  2JTF A;  1YI2 T;  1GH6 B;  3GP8 A;  2QQB A;  4B9W A;  2ROL A;  1BB9 A;  1R0C B;  1UJ0 A;  4C8Q F;  4OMP A;  1HD3 A;  1HK9 A;  4M75 E;  3QYH B;  1PD0 A;  4AG1 C;  2JZ2 A;  2CZ6 B;  2QGF B;  2BIV A;  4FL6 A;  1W6X A;  4HLQ A;  2BZY A;  3RKX A;  2L3Q A;  3G7Z A;  2XHC A;  4X34 A;  3UA6 A;  2DD4 A;  4LDX A;  3CCQ Q;  3CPW P;  2A0F B;  4EDU A;  3G6E A;  4JUV A;  2QQS A;  2LTO A;  2YDL A;  2JUF A;  4F7U G;  2OJ2 A;  4F7J B;  2A7Y A;  2QTX A;  1JOW A;  3A8L B;  2RHU A;  2E70 A;  3QWX X;  2F5T X;  1RAI B;  2QFZ A;  4QVC A;  3TQ7 P;  2RO0 A;  3ZBD A;  3CC7 T;  4M77 C;  2GNC A;  4BCF B;  4CI0 C;  2OTJ A;  2HDA A;  3FRN A;  3OS1 A;  5CKH A;  4BCG B;  1UNH D;  2I40 B;  4OVA A;  5LJ5 g;  1VIF A;  4FYX B;  3VYH B;  3C4S A;  3A8O B;  5D6W A;  1YCY A;  2WSF E;  3ZFJ A;  3QO3 A;  1AZE A;  4YTL A;  3BDU A;  4AI6 A;  4LNP A;  2JGZ B;  2IVW A;  4M7D E;  4XTU A;  1ZSZ B;  3UDC A;  2COW A;  4PJO E;  1Q86 U;  1VIN A;  4FIB A;  4Z6Y A;  2LW4 A;  1UE9 A;  4X1V A;  1KQ1 A;  1OI9 B;  2MAM A;  1VQ9 A;  3M0Q A;  2QA4 T;  4BCO B;  4RTY A;  4RTX A;  2RK1 A;  4EOL B;  1X6B A;  4F7U F;  5GAN 5;  5LL6 S;  4EOM B;  5GAM j;  1VYV A;  2O01 E;  1RAH B;  2DL3 A;  2MWO A;  3HL8 A;  1VQN A;  1VQ5 Q;  1Z9Q A;  4HNV A;  5GAN j;  1RLQ C;  3CD6 A;  2HZY A;  1LPL A;  1YJN A;  4ESR A;  4LDY A;  3QSU A;  1VUB A;  1AWW A;  1MNE A;  3EGX B;  1H26 B;  1YCS B;  5GMK e;  1Y7X A;  1WIE A;  4M78 C;  3L2Z A;  2RJF A;  1K4U S;  1N5Z A;  3INZ A;  1N8R C;  4HXJ A;  2IW9 B;  5KYX B;  3J80 E;  1OGU B;  2GQV A;  3VS7 A;  1KFZ A;  1X2K A;  3DTO A;  3QJ6 A;  4EON B;  2K6D A;  3GIB A;  5L8R E;  3HKS A;  3CMA T;  4KGX B;  2Z0W A;  3M0S A;  1JKW A;  2P4T A;  2X3X D;  5A2Q E;  3X26 B;  4OGE A;  2O31 A;  4PJJ A;  3CC7 A;  3EG3 A;  4PFZ A;  3VS1 A;  1YHQ Q;  1OX9 A;  3H0I A;  5FRO A;  4B6M A;  4YOZ A;  1H3H A;  3FJP A;  2CCI B;  2IW8 B;  4M7D B;  4JX6 A;  4E7S A;  2XKO C;  2QDJ A;  4JZ3 A;  1CKA A;  4XTX A;  4EMG A;  1NLP C;  2DF6 A;  1N9S A;  3R6N A;  2VC8 A;  4DEX A;  2VYT A;  4DBQ A;  4QQG A;  2PK2 A;  2RQU A;  1VYU A;  3EFS A;  4JX5 A;  3M56 A;  1YIT T;  2CDT A;  4Y72 B;  1WDX A;  2F2V A;  1RI0 A;  3CQT A;  4L59 A;  3EAE A;  4MMK A;  1UJY A;  2FZG B;  4PJO A;  4E7H A;  5CAI A;  2UZE B;  3JSC A;  4M7D A;  4LOC A;  5GAO r;  1OIU B;  4C8Q C;  4BE1 A;  3QII A;  3P8H A;  4ATO A;  4K11 A;  1M8M A;  4M78 B;  5KYW B;  1QLY A;  4BE0 A;  2A3L A;  2NWM A;  1J3T A;  3M4G A;  5GMK j;  5GAN 2;  3TW6 A;  4AFQ C;  4EOQ B;  3SFM A;  4PKC C;  3DLL A;  2FZC B;  2QDY B;  3BHT B;  2E10 A;  3EG9 B;  3HP9 A;  4IMY B;  4YOS A;  4OML A;  4C8Q A;  3RES A;  1UUE A;  4M7D C;  4ZGE B;  3DJB A;  4XU1 A;  1YP5 A;  5KYX A;  5IHI A;  2OAU A;  2E3I A;  5AT1 B;  1VQ5 T;  2QTV A;  2CZ7 B;  1ZA1 B;  1H1R B;  2W9F A;  2RD1 A;  3JV3 A;  2DTO A;  5IHK A;  4A4E A;  2DIG A;  1K73 U;  3LLR A;  1NYF A;  4BD3 A;  2DVE A;  2SRC A;  3NTK A;  1K8A R;  3H6Z A;  3M5A A;  4AFZ C;  2EQJ A;  1I4K 1;  2XDP A;  1MMA A;  4IUQ A;  2C5V B;  4KT0 E;  3FIF A;  3PGG A;  5GAN g;  1WHJ A;  4BE2 A;  2UZD B;  2HSE B;  5DM7 R;  3I56 T;  1M8V A;  5GAO n;  2KSS A;  2KGT A;  3POM A;  4ROC A;  1I5L A;  3RER A;  2LC4 A;  3MP1 A;  1OPK A;  1TFB A;  1I07 A;  5IHY A;  1QVP A;  3JCM W;  1H1Q B;  2DXB A;  1SPK A;  1G8X A;  2DD4 B;  4E2F B;  2OTJ T;  4PLL A;  1KSW A;  1QCN A;  4UC4 A;  3G1J A;  2KMG A;  2K2V A;  4LUD A;  2OTL A;  4KUL A;  1ZUU A;  1D3B A;  4XU2 A;  2E12 A;  2PJQ A;  4HL4 A;  5EFQ B;  2KRM A;  4JRK A;  1OU9 A;  2V1Q A;  1M3B A;  3VKI A;  3KFV A;  2OTJ Q;  4J6Y A;  3DKM A;  1I1J A;  2PK9 B;  2XI9 A;  1P5E B;  1Q82 C;  3JB9 J;  2W96 A;  2J6F A;  2PUO B;  2RHZ A;  2CYZ B;  5DQV A;  3QYE A;  1K9A A;  1TXQ A;  4M7D F;  3CCU T;  2LDM A;  1K73 C;  3M54 A;  3V7S A;  4EIK A;  4J5Y A;  2CP6 A;  2COY A;  4PJN A;  1K8A U;  4CC4 B;  1C0M A;  3KXT A;  2ZPF B;  3CME T;  1AVZ C;  3N5B B;  2P84 A;  1HXD A;  4C0F A;  2XMF A;  1KHI A;  4L5G A;  3K7A M;  1GUX B;  1XOV A;  1M1K C;  4M78 D;  1N8R U;  1YJN T;  2K2M A;  2W2H A;  1PG5 B;  3H4C A;  2CZ1 B;  4KGZ B;  4A54 A;  7AT1 B;  3A8H B;  5IH2 A;  1TUD A;  2RH2 A;  2ZPB B;  2XID A;  2KBT A;  3FDR A;  3X24 B;  3MO8 A;  3CC2 T;  5HCK A;  2DKG A;  2LX9 A;  3B57 A;  4O6J A;  1RAE B;  1OL2 B;  2DX1 A;  2WFY B;  2KR6 A;  3MHX A;  1PNJ A;  1PRM C;  1M27 C;  4NOY A;  1ZP2 A;  2DIQ A;  2MIO A;  2QEX T;  3I55 A;  2YLB A;  2PVD B;  5GAN f;  2C0O A;  4OGC A;  3MPU B;  2ED1 A;  2E3H A;  3RR6 A;  5CR2 A;  1BU2 A;  1FKM A;  1BKB A;  2KQW A;  5GAO q;  3OYK A;  4QKU A;  4D6W A;  1ZBX A;  4BUG A;  4IUP A;  5IDP B;  1B07 A;  3CCM A;  5EC7 A;  2OX7 A;  4M75 D;  3JCM b;  1FMK A;  3HFO A;  4J7I A;  1MV3 A;  1IRE B;  1BI2 A;  2LJ3 A;  1VQK Q;  2CSQ A;  1OV3 A;  2HMA A;  3V8K A;  2DJZ A;  4JDS A;  3BDL A;  5GJV B;  2EAY A;  1VQ8 A;  3LH5 A;  2H3J A;  4PLI A;  1JQQ A;  3HTR A;  4RTW A;  1TOV A;  2DLP A;  1GBR A;  1T0H A;  3LH0 A;  2K5I A;  4Y92 A;  2FYK A;  2LCS A;  3VUB A;  1OYX A;  5CVI A;  3DOG B;  4J9B A;  4EOP B;  5I5Z B;  1I5O B;  4AFU C;  2MF2 A;  3DDQ B;  1H25 B;  4EOK B;  3CCE T;  5I21 A;  2QF7 A;  3DDP B;  1OOT A;  3EGD B;  2WPA B;  1E7P A;  2EGE A;  3Q1J A;  2KRO A;  4QT7 A;  1AWO A;  3JAM E;  3VS3 A;  2DEQ A;  3LW5 E;  4CFX B;  5GAO m;  3KBG A;  1KK7 A;  1BI3 A;  2EJ9 A;  2PUK B;  2KEA A;  1K0X A;  5GAM d;  3CCQ T;  3RBB B;  5HNB B;  2QAZ A;  3NMZ C;  1IHV A;  3PE0 A;  4J6X A;  2PMI B;  2L3R A;  4KRD B;  4GLM A;  4ZNX A;  2CP5 A;  2MK5 A;  3OYB A;  1ABQ A;  2QA4 A;  4LN2 A;  4KUI A;  1MMN A;  5KCH A;  1VQ9 T;  1G2B A;  3P8D A;  2LMJ A;  4Z88 A;  5I11 A;  4N4G A;  2QQA A;  4DBH A;  3BLH B;  3JB9 G;  3NTI A;  4F6W B;  2CP0 A;  1ZA2 B;  2HNI A;  1WYX A;  4M77 A;  1FXX A;  3T9N A;  5I22 A;  2K3B A;  4R55 A;  3CCU A;  4FT4 A;  4LUE A;  1RAA B;  2PVO B;  2RJD A;  4HT9 A;  1OKW B;  4OB2 B;  1YWO A;  1FMV A;  3BFM A;  4J6W A;  1VOL A;  5AYF A;  4J9D A;  1M90 C;  1BBZ A;  1Y71 A;  3HFN A;  4Y28 E;  1SHG A;  5DLQ E;  1BIB A;  2QGG A;  4ELZ C;  1Q7Y U;  1JEG A;  1K0S A;  2W10 A;  1BU1 A;  1OUL A;  4WF2 A;  2QAS A;  4IUT A;  3M0U A;  3QDF A;  3SEM A;  5LQF B;  1U3O A;  1G83 A;  3CXC P;  4J9C A;  3CCJ A;  2AZV A;  5GAN d;  1AD5 A;  1ARK A;  3CCE A;  2DD5 B;  4LD6 A;  2OAW A;  1M1G A;  1KC8 U;  3MY1 B;  4F6U B;  1M2V B;  4DEY A;  1U1T A;  4M7A F;  1JXO A;  1K9M U;  2LNV A;  5J3B A;  2FPE A;  4HNU A;  4PJL A;  2DXB B;  4CRI A;  1N8R R;  1GCP A;  2M51 A;  1QCF A;  2RHI A;  2GFU A;  2F2W A;  2NUP B;  3CCQ A;  2AHJ B;  3QKJ A;  2GCX A;  4QQ6 A;  2DRM A;  2F5K A;  4P5N A;  2LQN A;  4JPB W;  1LCK A;  2DPP B;  4FSX A;  2HKQ B;  5IXF A;  2EWN A;  2K5F A;  4A4G A;  1TH7 A;  3O8V A;  2R5M A;  4V2S A;  3EOC B;  1RAF B;  4OMN A;  3QPH A;  5LJ5 h;  2C0T A;  2AK5 A;  2RMO A;  2NUP A;  3HZJ A;  2M9U A;  1UGQ B;  2E1H A;  2BE9 B;  2DL4 A;  3X20 B;  1Q7Y R;  3QUI A;  2VXE A;  4LDU A;  3I35 A;  3JCM Q;  2QG9 B;  1H92 A;  4ZTJ A;  2BTT A;  2LNH B;  1N27 A;  1WLP B;  2QEX A;  2MPX C;  5LMK B;  2RQV A;  4MDW A;  3C0C A;  5KE2 A;  5FU6 B;  3RMQ A;  4EMK B;  1Q81 R;  3HO8 A;  2QYZ A;  4BCH B;  1WI7 A;  3EG9 A;  5EJC A;  1EX4 A;  9ATC B;  1Q95 G;  3JCM V;  3RDV A;  2ROT A;  3BE3 A;  1DJ7 B;  4Y91 A;  2B8A A;  3G71 Q;  1FX7 A;  4II5 B;  2O2O A;  2LP5 A;  1OI1 A;  4M77 F;  3CCJ Q;  1WNL A;  2GQI A;  2CSI A;  1XJW B;  3GBQ A;  2IG0 A;  5HBH B;  2RNA A;  1KXU A;  2YSQ A;  2YUP A;  1SKU B;  1AZG B;  2RI5 A;  4KGV B;  3NHN A;  4E47 A;  3G71 T;  3CME A;  4XU0 A;  3BLQ B;  2K4Y A;  1AWJ A;  2KNB B;  4D8K A;  4ZGJ B;  4C92 G;  2LCL A;  2PNI A;  3OA6 A;  3L2W A;  1GL5 A;  5D7U A;  2O9V A;  2K7A A;  2YRV A;  3AT1 B;  5IHN A;  3QDR B;  2DE0 X;  3QZ9 B;  2DRK A;  4MFE A;  2D1X A;  3OBW A;  2H3E B;  1UEB A;  2CS7 A;  1QQJ A;  1OX8 A;  1VQ8 Q;  3VV0 A;  5LJ3 h;  2E5Q A;  1UB4 A;  2C06 A;  1B3Q A;  1E6H A;  5CKF A;  4X9D A;  2KE9 A;  4C0D C;  1F5Q B;  5I2S A;  2IW6 B;  5IDN B;  4BY6 B;  3QYB A;  4LD9 K;  1VQK T;  3NPF A;  4BCN D;  2CT3 A;  5GAN h;  3MP8 A;  3VS6 A;  4M75 A;  2CUB A;  5LJ5 f;  4MIM A;  1RAG B;  4ME7 A;  1KHC A;  2DZ9 A;  2CZ0 B;  4RTU A;  4C0G A;  4A63 B;  2LJ0 A;  4ZGD B;  1UG1 A;  2KT1 A;  4F7U E;  2CH4 W;  3L2R A;  1OU8 A;  2BUD A;  2AKK A;  1CKB A;  1LVK A;  2K57 A;  4JS5 A;  1W2B A;  2J7I A;  4IUV A;  4FW2 A;  3C95 A;  1ENW A;  1BYM A;  3C12 A;  5FW9 A;  3SB2 A;  2G3R A;  1LOJ A;  4KBM B;  4BCP B;  1SSF A;  3M53 A;  3CCS Q;  1PKS A;  3DB4 A;  5CCA A;  1ZUK A;  2CJM B;  3OYL A;  2ZPH B;  1XTD A;  3EGX A;  3UF4 A;  1KQS A;  4XAX B;  1YN8 A;  4JLG A;  2R58 A;  1Q7Y C;  1JJ2 A;  1UNL D;  1G3W A;  4F7U A;  3CBM A;  3ER0 A;  3TEE A;  2GTO A;  3FB9 A;  2JTM A;  4BI8 B;  2LVM A;  3JCM g;  1WHM A;  4AG2 C;  4HNT A;  3IQL A;  1VQP A;  2L8D A;  4EC9 B;  4M78 A;  1BI0 A;  4PJM A;  1VQL T;  2ZZD B;  2HQH A;  4QVZ A;  4DOW A;  1YIJ Q;  2B9R A;  3LYI A;  1NE8 A;  2O4X B;  3OB9 A;  3JRZ A;  4NS5 A;  3GLX A;  1MHN A;  2J05 A;  4KH1 B;  4EOI B;  1WPY A;  2HD0 A;  3G6E T;  4E7I A;  3AHU A;  1GCQ A;  2C5O B;  3L2Q A;  1Y96 B;  1YIT A;  2FL7 A;  1KC8 C;  4IIM A;  5GMK l;  4EPC A;  1Y0M A;  1VQ7 Q;  5ACB A;  1D0X A;  4CC7 A;  1U8R A;  5CKE A;  4RCB A;  2E4H A;  1BCM A;  2VWF A;  2AZS A;  3BY7 A;  2EFI A;  3A8G B;  2O4X A;  4BB7 A;  2WJ9 A;  4HCZ A;  3OYE A;  3C94 A;  2NLU A;  4XTW A;  4N4I A;  3JB9 F;  1JBM A;  4FYV B;  3EID B;  2L3P A;  3LX7 A;  2Y90 A;  1D3U B;  2KR3 A;  3VS0 A;  4EMK C;  3E1S A;  3UT1 A;  2DL8 A;  1SHF A;  1WA7 A;  4J83 A;  4M77 G;  2JTE A;  5IN1 A;  2EBP A;  4MFD A;  1G3N C;  5HVY B;  3URG A;  5BNJ B;  2ECZ A;  1PRL C;  1U5S A;  4RTV A;  3VS2 A;  3FLG A;  3E9G A;  1YJ9 Q;  5HBJ B;  1ACM B;  2M0Y A;  2RQT A;  5GAM f;  2X1N B;  1IGU A;  2KYB A;  2P0P A;  4MZT A;  3CD6 Q;  5GAO l;  3QHW B;  1M2V A;  2LQK A;  5CKD A;  3D7S B;  4M7A G;  2YUN A;  1VQ4 A;  3HRS A;  3LGL A;  2XD0 A;  1HSQ A;  2DL5 A;  3RNJ A;  1ZSG A;  3JB9 H;  3A8M B;  1FIN B;  4FSS A;  1A0N B;  4KRT A;  5EG2 A;  2X51 A;  4I3Z B;  1WQW A;  1QVG S;  2YRD A;  2HBP A;  4RKU E;  1K1Z A;  3MI9 B;  2ESW A;  3QHS A;  1WZO A;  2KT8 A;  2MCN A;  2CRE A;  2EQK A;  2F1L A;  4OMQ A;  2NUT A;  1O9K B;  3U23 A;  1YNZ A;  2CGH A;  2VAS A;  4L6V 5;  1PWT A;  1NLO C;  4LXC A;  4DBF A;  1WQ7 A;  2HQX A;  3CEY A;  5HKC A;  1NBE B;  4NC6 A;  4CRL B;  4HKE A;  1K73 R;  1VQN T;  1N6A A;  2BKD N;  3CXC S;  3OYJ A;  4XQ3 A;  4RG2 A;  4PJO F;  3ZEH A;  4EMH A;  1VQM T;  1KC8 R;  4ELL A;  2JS0 A;  4N0A A;  2EJF A;  2RA2 A;  1UHC A;  2BS3 A;  1M4Z A;  1HJD A;  3V7C A;  1UNG D;  4E7L A;  3H0H A;  3HPW A;  4RTZ A;  2DIL A;  3PVL A;  3BHV B;  2XIC A;  5CQY A;  1BIA A;  3GF5 A;  1ZBJ A;  2FPF A;  1KD1 R;  3H8Z A;  4J9H A;  1VQO A;  3OYC A;  4Z89 A;  3TCJ A;  2BE7 D;  5LJ3 f;  3VRY A;  1WJQ A;  3E19 A;  2E6N A;  4PFO A;  5FWB A;  3I55 T;  2GF7 A;  3EGU A;  1MMG A;  5CEI B;  3O0G D;  2DM1 A;  2EKO A;  2BKZ B;  2RB6 A;  3RIR A;  3CXC A;  4VUB A;  2VGN A;  4WCI A;  3CMA A;  1K76 A;  1PD1 A;  3M0R A;  2RN8 A;  3DB3 A;  1H24 B;  1YBY A;  4AFS C;  4CFV B;  4EOJ B;  1JO8 A;  3F70 A;  3BG5 A;  3CCJ T;  4BCI B;  1UFF A;  3OSS C;  1WX6 A;  3G4S Q;  1YWP A;  2RJC A;  1XQH A;  2YHT A;  2R5A A;  4BBS M;  1RL2 A;  5GAM g;  1V1C A;  1QVG A;  4TVR A;  2JVV A;  3I56 A;  2DXC B;  2P0Q A;  4ANJ A;  1JJ2 S;  3LWI A;  4BCK B;  2J6K A;  1G5V A;  1IO6 A;  4JLI A;  4CC2 A;  4QVD A;  3HRU A;  2E65 A;  1AHJ B;  3F5X B;  2KK4 A;  2V8J A;  5CYI B;  3V7R A;  1TUG B;  3O5Z A;  2GTJ A;  2HCK A;  2EQU A;  2F2X A;  3SHW A;  1R77 A;  1AIS B;  1QWE A;  4ZTF A;  1VQL Q;  5L23 A;  2V26 A;  2QQ9 A;  2I53 A;  3MEW A;  3SWN C;  3OYD A;  1VQ7 A;  4PJO D;  1UDL A;  2FPD A;  4LDV A;  3CCL A;  5GAO p;  2BZX A;  2KXC A;  2DBK A;  2VKN A;  4X9C A;  3G6E Q;  5GJW B;  3S3O A;  1MND A;  2MOX A;  4C5E A;  3CD6 T;  3G33 B;  3WVD B;  1ZHI A;  4M77 E;  4DA4 A;  1IB8 A;  5LJ3 g;  1VQ6 Q;  2DXU A;  2UZL B;  3VYG B;  3CCL T;  5DQW A;  2CUD A;  2V8K A;  1KQ2 A;  4AKH A;  4CFU B;  1RLP C;  3PFS A;  2KRS A;  2KY9 A;  1VQ6 T;  2BPM B;  2D8J A;  3ZL7 C;  4HVU A;  2FEI A;  1O9S A;  2C0I A;  3QBY A;  2FZK B;  5ECA A;  4J9F A;  2OI3 A;  4JZ4 A;  3HBL A;  5KH6 A;  3MJX A;  4F17 A;  3JCM P;  2JNG A;  2F2C A;  4OR5 B;  4CFW B;  3I56 Q;  1AEY A;  2R7G A;  1RAB B;  1S72 Q;  3L42 A;  3CC2 A;  4M7A A;  3EJ1 B;  2DMO A;  1TU0 B;  1ZX6 A;  2DFU A;  4QSH A;  3HHT B;  4FX3 B;  3EG0 A;  2DEU A;  4OB3 B;  1D1C A;  1QWF A;  3A1P A;  5FU6 C;  1U06 A;  3CCV T;  2KI7 A;  4E6R A;  4N0A C;  1V29 B;  5I2M A;  1VQN Q;  1RAC B;  1PC0 A;  3NDQ A;  3M59 A;  4N4H A;  4OMM A;  2ZGW A;  5KYN A;  2HSP A;  4M75 C;  1OPL A;  3DLM A;  1GUX A;  4YC3 B;  3TN8 B;  3GTM S;  3CBP A;  2RF0 A;  4ZN1 A;  4FCY A;  4M78 F;  2JW4 A;  2YUO A;  3VUZ A;  1Q82 R;  3EFO B;  1VQK A;  4EOR B;  3OYM A;  2WEV B;  1SSH A;  1B7T A;  1G3Y A;  3OQ5 A;  4HCK A;  2ZPI B;  4M75 B;  2DA9 A;  3G71 A;  4PK4 A;  1G3T A;  3MEV A;  1JRI A;  2RK2 A;  1AD6 A;  3QG1 A;  2D8H A;  2EGA A;  4WTO B;  3EHQ A;  4BCM D;  1E6G A;  3KHI A;  1X27 A;  2UUE B;  1GCQ C;  2DXT A;  4Z8A A;  3JCM h;  1VQ8 T;  4BCQ D;  2KDS A;  1PKT A;  1W4S A;  2D6F A;  1OZ2 A;  1QVF A;  1QW1 A;  1YIJ T;  4F16 A;  3CCR Q;  1K8A C;  1BI1 A;  4MDX A;  2A08 A;  5J39 A;  1C1A A;  2M16 A;  2HL5 C;  1GXI E;  3I55 Q;  1UTI A;  3EG2 A;  2L2P A;  3REB B;  2DD5 A;  4FYY B;  4MML A;  2GFA A;  3CBO A;  4AKG A;  4RCC A;  1VYT A;  3OSV A;  1S72 A;  1YJN Q;  2KMT A;  2X4W A;  1D09 B;  2X9H A;  3X25 B;  3CC4 A;  1I0C A;  4PNO A;  1KJW A;  3PO3 S;  2ZAE A;  3JCM f;  1UEC A;  2YWW A;  3JCM e;  2ABL A;  2JM9 A;  3OW2 P;  2DTH A;  1M2O A;  2YRC A;  2LJ1 A;  1YI2 A;  3MCA B;  2G77 A;  1I8F A;  4BAC A;  1VQP Q;  5IT9 E;  2YLC A;  4KH0 B;  2BS2 A;  1NPP A;  4QQD A;  4PJO G;  2D9T A;  2X35 A;  2EPD A;  1X6O A;  5L2W B;  2J6O A;  2PTK A;  1ZSZ A;  3EGD A;  3JCM J;  4FU6 A;  3A5Z B;  2Y4Y A;  1WGS A;  4C92 A;  5GAN 4;  3GNF B;  1QVF P;  8ATC B;  4EOO B;  4ROE A;  4QW2 A;  2I2L A;  4GBQ A;  1N9R A;  1K9M C;  3G4S A;  1VYW B;  1Y96 A;  2MI6 A;  1WHK A;  3OYY A;  5DY9 A;  2XU8 A;  1OL1 B;  3MP6 A;  2QQR A;  3PNW C;  1X2Q A;  3KUF A;  2EKH A;  2JN0 A;  4AMC A;  2BS4 A;  2KXD A;  1GFC A;  2DL7 A;  3L2U A;  2VUB A;  5GMK i;  1EIF A;  1P92 A;  5GAN 8;  3OYG A;  3OYN A;  1XO2 A;  4OMF B;  4BI4 A;  3UWN A;  1LJO A;  3ME9 A;  1YFN A;  1LNX A;  2L5Q A;  5KYU A;  1D0Z A;  3FEO A;  1ZQ1 A;  4LE9 A;  4BBR M;  2WAC A;  5CIU A;  1YJW Q;  3PVQ A;  3E9F A;  3CCL Q;  4A53 A;  1YIJ A;  4FW1 A;  1ZUY A;  4HT8 A; 
#chains in the Genus database with same CATH homology
 3MEA A;  2E6Z A;  3VKG A;  5GAM f;  1VQO T;  1FKM A;  1BKB A;  2KQW A;  5GAO q;  3OYK A;  3PTA A;  4M7D A;  4JS4 A;  1Q82 U;  4A4H A;  4D6W A;  1X75 C;  2P0P A;  4MZT A;  1ZBX A;  4BUG A;  4IUP A;  5GAO l;  5GMK h;  3GPL A;  4C5G A;  2LQK A;  5CKD A;  1VQ4 T;  5KE3 A;  5FRN A;  3CCM A;  3OW2 S;  4M7A G;  2MMP A;  4HA8 A;  3CPF A;  1VQ6 A;  4PJO B;  1VQ4 A;  3HRS A;  3NFC A;  4M75 D;  3LGL A;  4C5H A;  4M78 E;  3JCM b;  3HFO A;  1NJI U;  2RI2 A;  4J7I A;  4KUD K;  1IRE B;  1BI2 A;  2LRQ A;  3J81 E;  2XD0 A;  1UGS B;  2PU9 B;  4XK8 E;  1PSE A;  4DOV A;  3JB9 H;  3V8K A;  2DJZ A;  3A8M B;  2HQE A;  4JDS A;  4BDY A;  2QI2 A;  3BDL A;  4BY6 C;  2EQM A;  2L89 A;  5GAN e;  2EAY A;  4JRP A;  1VQ8 A;  5EG2 A;  2M0O A;  2H3J A;  4PLI A;  5A0G A;  4II1 A;  4M77 D;  4EMK A;  1WQW A;  4XTY A;  4BI3 A;  1QVG S;  2HBP A;  4RKU E;  4M7D D;  4PL6 A;  3BG9 A;  4JJN K;  5J26 A;  3LH0 A;  2K5I A;  3OW2 A;  1VQP T;  2FYK A;  3QHS A;  4ZN3 A;  3VUB A;  3M57 A;  2R57 A;  1OYX A;  2EQK A;  5CVI A;  4XU3 A;  1UGP B;  2F69 A;  5LJ3 e;  3OS5 A;  2LT1 A;  2MWP A;  1QVF S;  2MF2 A;  3BG3 A;  3CPW S;  1Y07 A;  2X4J A;  2CGH A;  2X4Y A;  5FU7 C;  4RMO A;  1KD1 C;  4ELY C;  3OY9 A;  3CCE T;  5I21 A;  2QF7 A;  1B34 B;  4L6V 5;  1I81 A;  3CCR T;  2K3X A;  3ASK A;  1E7P A;  3QXE B;  3EFR A;  3Q1J A;  3WXM B;  1H3Z A;  2DXC A;  4AKI A;  1WQ7 A;  4GLK A;  2HQX A;  3CEY A;  3RKY A;  1IZ6 A;  5C0M A;  5HKC A;  3LWH A;  4M78 G;  2DTI A;  4Z02 A;  3UPU A;  4C92 B;  2VGM A;  2ZZD A;  4NC6 A;  3JAM E;  1NPR A;  3SWN A;  1YJW A;  4E7K A;  2DEQ A;  5GMK m;  3LW5 E;  5GAO m;  4HKE A;  3RUX A;  3CCM T;  1X01 A;  3KBG A;  3LGF A;  1BI3 A;  1O75 A;  3M9Q A;  1U1S A;  1N6A A;  2EJ9 A;  2BKD N;  2JTF A;  1YI2 T;  2LCC A;  2PUK B;  3CXC S;  1M1K C;  2VXF A;  3GP8 A;  2QQB A;  4B9W A;  5GAM d;  4XQ3 A;  4RG2 A;  4XTV A;  4PJO F;  3OYJ A;  3L2V A;  3CCQ T;  4M77 B;  3ZEH A;  4EMH A;  1VQM T;  2M1H A;  2LQ8 A;  4IUU A;  4C8Q F;  4M7A C;  4J6X A;  2L3R A;  1HK9 A;  4N0A A;  3RKW A;  2EJF A;  3TU4 K;  2FHD A;  4M75 E;  3OYB A;  3QYH B;  5HK0 A;  2QA4 A;  4KUI A;  4A4F A;  2RA2 A;  5KCH A;  4LD9 K;  2JZ2 A;  1VQ9 T;  2CZ6 B;  2BS3 A;  5KCO A;  1M4Z A;  3V7C A;  4E7L A;  3P8D A;  4F7U B;  1UGR B;  2BIV A;  4FL6 A;  3HPW A;  4N4G A;  5LJ5 j;  4HLQ A;  3RKX A;  3G7Z A;  2QQA A;  2XHC A;  4X34 A;  2DD4 A;  4LDX A;  2XIC A;  5CQY A;  1BIA A;  1Q81 U;  3JB9 G;  3GF5 A;  3NTI A;  5GAM e;  2EIF A;  3H8Z A;  4EDU A;  3G6E A;  4JUV A;  1VQO A;  2QQS A;  2HNI A;  2LTO A;  3OYC A;  3TCJ A;  4M77 A;  1FXX A;  5LJ3 f;  4BDZ A;  3T9N A;  2JUF A;  1WJQ A;  3E19 A;  4F7U G;  2E6N A;  2A7Y A;  3CPW A;  3CCS T;  4R55 A;  3CCU A;  4FT4 A;  1M5Q 1;  2XG8 D;  3I55 T;  2GF7 A;  2QTX A;  3A8L B;  2RHU A;  2PVO B;  2EKO A;  2RJD A;  2RB6 A;  2E70 A;  4HT9 A;  5LJ5 d;  5HK3 A;  2F5T X;  3RIR A;  4OB2 B;  2QFZ A;  4QVC A;  4VUB A;  3CXC A;  3BFM A;  2KAF A;  2RO0 A;  2VGN A;  2ZCF B;  3ZBD A;  1QP2 A;  3CMA A;  4J6W A;  4M77 C;  1S72 T;  5AYF A;  1VQ7 T;  4CI0 C;  3JCM X;  3GNG A;  3G4S T;  1M90 C;  2OTJ A;  1Y71 A;  3FRN A;  3HFN A;  4FT2 A;  2DK3 A;  4Y28 E;  3OS1 A;  5CKH A;  2Y4X A;  5DLQ E;  1BIB A;  3DB3 A;  3CC4 T;  3M4Y A;  1YBY A;  3QJY A;  4ELZ C;  1Q7Y U;  3R6O A;  2RI3 A;  4OVA A;  5LJ5 g;  4WF2 A;  4IUT A;  1VIF A;  3VYH B;  3C4S A;  3F70 A;  3A8O B;  3MET A;  5D6W A;  3BG5 A;  3OS0 A;  1YCY A;  2WSF E;  3ZFJ A;  3CCJ T;  3QO3 A;  4YTL A;  3BDU A;  5M9O A;  2DO3 A;  3CCJ A;  1OZ3 A;  4AI6 A;  4M7D E;  2IVW A;  4XTU A;  5GAN d;  3OSS C;  3V8J A;  3UDC A;  4PJO E;  1Q86 U;  3CCE A;  2DD5 B;  4LD6 A;  3V8L A;  1M1G A;  4FIB A;  1KC8 U;  4Z6Y A;  2RJC A;  3DL1 A;  4B9X A;  1FWZ A;  1XQH A;  2YHT A;  2R5A A;  1U1T A;  2MAM A;  1KQ1 A;  4C92 E;  1VQ9 A;  4BBS M;  1RL2 A;  5GAM g;  4M7A F;  1K9M U;  2LNV A;  5J3B A;  3CCS A;  1QVG A;  4HNU A;  4JRI A;  4TVR A;  2JVV A;  3I56 A;  2QA4 T;  5D6X A;  2DXC B;  2P0Q A;  2QXF A;  2DXB B;  3LWI A;  4CRI A;  1JJ2 S;  1G5V A;  2RK1 A;  4JLI A;  2RHI A;  4QVD A;  4O5V A;  2GFU A;  2E65 A;  3HRU A;  5LL6 S;  4F7U F;  5GAN 5;  5GAM j;  3CCQ A;  2AHJ B;  3OMG A;  3QKJ A;  2O01 E;  1AHJ B;  2RHY A;  2GCX A;  2RJE A;  2MWO A;  3HL8 A;  4QQ6 A;  1VQN A;  2KK4 A;  3RMS A;  2F5K A;  2V8J A;  4HNV A;  4P5N A;  4JX4 A;  5GAN j;  2DPP B;  5CKB A;  3FC3 A;  3V7R A;  3CD6 A;  2EQU A;  4FSX A;  5C6S A;  3PT9 A;  2EWN A;  2K5F A;  1YJN A;  4A4G A;  1TH7 A;  3O8V A;  4LDY A;  4ZTF A;  3QSU A;  4XTZ A;  1VUB A;  2EJG A;  2R5M A;  4V2S A;  2QQ9 A;  3MEW A;  1R8O B;  3SWN C;  2XK0 A;  5LJ5 e;  3OYD A;  5GMK e;  1VQ7 A;  4PJO D;  1Y7X A;  2RM4 A;  1QLB A;  4LDV A;  3CCL A;  3QPH A;  4M78 C;  3L2Z A;  2RJF A;  3PMT A;  5GAO p;  5LJ5 h;  4J8O A;  3JB9 D;  2PQW A;  3P8B B;  4MZM A;  1M1K U;  3INZ A;  1N8R C;  4X9C A;  3HZJ A;  2M9U A;  1M9S A;  3S3O A;  1UGQ B;  2E1H A;  4C5E A;  5IAY A;  3J80 E;  3PIP A;  3HB9 A;  3CD6 T;  3X20 B;  2ZPE B;  2GQV A;  2OTL T;  3WVD B;  1ZHI A;  4M77 E;  4HCB A;  3QUI A;  2VXE A;  4LDU A;  4DA4 A;  5LJ3 g;  3JCM Q;  4ZTJ A;  2DXU A;  3L1A A;  1N27 A;  2RHX A;  5GAN 7;  2QEX A;  3QJ6 A;  3GIB A;  4MDW A;  5L8R E;  3S3M A;  3VYG B;  3BW1 A;  3HKS A;  5KE2 A;  5FU6 B;  3RMQ A;  3CCL T;  4EMK B;  4M7A D;  3HO8 A;  3CMA T;  4IUR A;  1NJI C;  5EJC A;  3PMI A;  1VQM A;  2V8K A;  1JB0 E;  2P4T A;  1KQ2 A;  4AKH A;  5A2Q E;  3X26 B;  4OGE A;  3JCM V;  3PFS A;  3CC7 A;  1DJ7 B;  4Y91 A;  2KY9 A;  2B8A A;  3GOX A;  3OYH A;  1VQ6 T;  1FX7 A;  1O9S A;  3QBY A;  1OI1 A;  4M77 F;  5FRO A;  1WNL A;  3FJP A;  4OF1 A;  3HBL A;  4M7D B;  4JX6 A;  5KH6 A;  2XKO C;  3JCM P;  2QDJ A;  2IG0 A;  2JNG A;  1YJ9 T;  4XTX A;  5CK9 A;  3M55 A;  5FLX E;  2RI5 A;  1MGQ A;  4E47 A;  3G71 T;  4EMG A;  3HSB A;  3CME A;  4XU0 A;  1N9S A;  2K4Y A;  2VC8 A;  4ZGJ B;  2VYT A;  3L42 A;  4C92 G;  3CC2 A;  4QQG A;  2LCL A;  4M7A A;  4GY5 A;  2ZPG B;  3OA6 A;  3EFS A;  1VQL A;  4JX5 A;  3L2W A;  1VIE A;  3M56 A;  1KD1 U;  2VV5 A;  2K5L A;  1PSF A;  2YRV A;  1YIT T;  3J7A F;  5LJ3 j;  4M7A B;  4QSH A;  3NTH A;  3HHT B;  1RI0 A;  3QDR B;  3QZ9 B;  4L59 A;  5LJ3 d;  4C0D B;  3CCV A;  4HCC A;  4MFE A;  3OBW A;  3EAE A;  4OB3 B;  1UEB A;  2CS7 A;  4MMK A;  1YJ9 A;  4NL3 A;  4PJO A;  5FU6 C;  4E7H A;  5CAI A;  3CCV T;  2QQ8 A;  3JSC A;  3SDZ A;  3VV0 A;  4N0A C;  4LOC A;  1V29 B;  5LJ3 h;  5I2M A;  2E5Q A;  4C8Q C;  5GAO r;  1UB4 A;  4A4K A;  4BE1 A;  3M59 A;  3P8H A;  3QII A;  4N4H A;  4LDW A;  2C06 A;  4ATO A;  3TW7 A;  1YHQ T;  5CKF A;  4X9D A;  4OB1 B;  2ZGW A;  5HY6 A;  4C0D C;  4M78 B;  4M75 C;  5I2S A;  4BY6 B;  2HAX A;  3QYB A;  3DLM A;  4BE0 A;  2A3L A;  4ZN1 A;  4C8Q E;  2FVU A;  3CBP A;  3M4G A;  1VQK T;  4OB0 B;  5GMK j;  4M7A E;  5GAN 2;  3TW6 A;  4M78 F;  4MZP A;  3VUZ A;  5FU7 B;  2V8I A;  5GAN 6;  3SFM A;  3MP8 A;  5GAN h;  1VQK A;  4M75 A;  4OP0 A;  4PKC C;  3DLL A;  3QZ5 B;  3VYG A;  5LJ5 f;  4MIM A;  3OYM A;  4ME7 A;  2QDY B;  1M1F A;  4R56 A;  5GAM h;  2E10 A;  1G3Y A;  1KHC A;  3HP9 A;  2ZPI B;  3OQ5 A;  4M75 B;  4E7J A;  2DZ9 A;  2CZ0 B;  4C5I A;  4C8Q A;  3G71 A;  4C0G A;  3RES A;  4M7D C;  4ZGE B;  1G3T A;  3MEV A;  4XU1 A;  5CQX A;  3S3N A;  4ZGD B;  1JRI A;  2RK2 A;  2OAU A;  3QG1 A;  4F7U E;  3M58 A;  1H64 1;  1VQ5 T;  2CZ7 B;  3L2R A;  2BUD A;  3KHI A;  2RD1 A;  2DTO A;  2FB7 A;  2K57 A;  3WVE B;  2DIG A;  4A4E A;  4JS5 A;  1W2B A;  3LLR A;  1K73 U;  3CC7 T;  2DXT A;  3SD4 A;  3JCM h;  4BD3 A;  2DVE A;  1VQ8 T;  4IUV A;  2KDS A;  3NTK A;  1W4S A;  2D6F A;  1KQS S;  1OZ2 A;  3C95 A;  2P0K A;  1QVF A;  1QW1 A;  3H6Z A;  3M5A A;  1YIJ T;  1XNI A;  1BYM A;  2EQJ A;  4C8Q G;  3C12 A;  1I4K 1;  2XDP A;  1K8A C;  3SB2 A;  2G3R A;  1LOJ A;  1BI1 A;  4KBM B;  4IUQ A;  4ELJ A;  4MDX A;  4KT0 E;  3FIF A;  3VU3 C;  5J39 A;  1SSF A;  3M53 A;  3PGG A;  2M16 A;  3DB4 A;  5CCA A;  5GAN g;  3OYA A;  3OYL A;  1GXI E;  2ZPH B;  1XTD A;  1M90 U;  4BE2 A;  3HRT A;  5DM7 R;  4XAX B;  1KQS A;  3I56 T;  1M8V A;  2WSC E;  2X4X A;  4JLG A;  2DD5 A;  2R58 A;  1NZ9 A;  4C8Q D;  3OS2 A;  5GAO n;  1Q7Y C;  4MML A;  2KSS A;  2GFA A;  3CBO A;  4AKG A;  4RCC A;  3OSV A;  1S72 A;  1JJ2 A;  1I5L A;  3RER A;  2KMT A;  1G3W A;  2LC4 A;  2X4W A;  3MP1 A;  4F7U A;  3CBM A;  3ER0 A;  3X25 B;  3CC4 A;  1QVP A;  3JCM W;  4PNO A;  2CKK A;  2DXB A;  3TEE A;  3FB9 A;  4C92 D;  2DD4 B;  2JTM A;  3JCM f;  4PLL A;  4BI8 B;  2OTJ T;  4UC4 A;  4M7D G;  2KMG A;  2K2V A;  3JCM e;  2OTL A;  4KUL A;  2LVM A;  3JCM g;  1W2B S;  3OYI A;  1D3B A;  2PVG B;  4Q5W A;  4XU2 A;  4HNT A;  1VQP A;  2L8D A;  4M75 F;  4M78 A;  1BI0 A;  2DTH A;  2E12 A;  1VQL T;  4HL4 A;  2ZZD B;  4QVZ A;  4DOW A;  3TRE A;  1WJS A;  2LT4 A;  4JRK A;  5D6Y A;  1YI2 A;  3PIO A;  3MCA B;  2G77 A;  1NE8 A;  3LYI A;  1I8F A;  3VKI A;  4J7F A;  4BAC A;  2YLC A;  5IT9 E;  2BS2 A;  1NPP A;  4QQD A;  2O4X B;  3OB9 A;  4PJO G;  4J6Y A;  3JRZ A;  4NS5 A;  2D9T A;  2KVQ G;  2X35 A;  3DKM A;  1MHN A;  3GLX A;  4C0Z A;  2XI9 A;  1Q82 C;  1X6O A;  3OMC A;  3JB9 J;  2RHZ A;  2PUO B;  2CYZ B;  1WPY A;  3QYE A;  3QYG B;  1B34 A;  2HD0 A;  3OBY A;  4C8Q B;  3G6E T;  4M6V A;  2D0Q B;  5A0L A;  2JOY A;  5CO7 A;  3CCU T;  4E7I A;  3JCM J;  4NL2 A;  3AHU A;  2XDB A;  4M7D F;  2LDM A;  2K3Y A;  3L2Q A;  1K73 C;  4FU6 A;  3A5Z B;  2Y4Y A;  1Y96 B;  3M54 A;  1YIT A;  1WGS A;  3V7S A;  4C92 A;  5GAN 4;  1Q86 C;  2FL7 A;  3GNF B;  1KC8 C;  4J5Y A;  1YJW T;  4QW2 A;  2I2L A;  4C92 C;  5GMK l;  3OYF A;  4EPC A;  1N9R A;  4PJO C;  4IKF A;  2E41 A;  1K9M C;  3G4S A;  1Y96 A;  1K8A U;  2MI6 A;  1KG1 A;  3KXT A;  3CCR A;  2ZPF B;  1QP3 A;  2EYQ A;  3CME T;  1VQN T;  1U8R A;  3OYY A;  5DY9 A;  2XU8 A;  3JCM d;  5CKE A;  3N5B B;  4C92 F;  1HXD A;  4RCB A;  3JCM c;  4RG8 A;  4C0F A;  1KHI A;  4L5G A;  3MP6 A;  2QQR A;  3BY7 A;  3VKH A;  3PNW C;  2EFI A;  3A8G B;  2O4X A;  3KUF A;  4BB7 A;  1XOV A;  2WJ9 A;  2JN0 A;  4HCZ A;  2BS4 A;  3C94 A;  4M78 D;  5DLO A;  2NLU A;  3OYE A;  4JRQ A;  5A0D A;  3X28 B;  1YJN T;  1N8R U;  3H4C A;  3L2U A;  4XTW A;  2CZ1 B;  4A54 A;  3MEU A;  2VUB A;  4DQ2 A;  5GMK i;  1EIF A;  3A8H B;  1P92 A;  5GAN 8;  4M75 G;  4N4I A;  3OYG A;  1JBM A;  2RH2 A;  2ZPB B;  3JB9 F;  1G3S A;  2XID A;  3LX7 A;  3FDR A;  3X24 B;  3MO8 A;  2Y90 A;  4OMF B;  3VJP A;  4BI4 A;  3OYN A;  3UWN A;  3CC2 T;  1LJO A;  2DKG A;  3ME9 A;  2LX9 A;  4EMK C;  4O6J A;  3JB9 I;  2WSE E;  1LNX A;  3E1S A;  3UT1 A;  4FM4 B;  2L5Q A;  4J83 A;  2KR6 A;  3MHX A;  3SWN B;  3FEO A;  1ZQ1 A;  4NOY A;  2DIQ A;  4BBR M;  2QEX T;  2WAC A;  5CIU A;  4M77 G;  3I55 A;  2YLB A;  5IN1 A;  2PVD B;  5GAN f;  4OGC A;  4MFD A;  1D3B B;  2DZC A;  3E9F A;  3URG A;  2XDD A;  1WJR A;  1YHQ A;  3QWL A;  1Q81 C;  1VQ5 A;  5FRM A;  4A53 A;  5CR2 A;  5GAN 3;  1YIJ A;  2DAQ A;  3FLG A;  3E9G A;  3S6W A;  2E64 A;  4HT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...