3X2QE

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3x2qE00
1OCRE 1OCOE 3AG3E 5B3SE 3ABKE 5IY5E 3AG1E 3AG2E 3AG4E 2ZXWE 3ASNE 3ASOE 2EIKE 1OCZE 1OCCE 2EIME 2OCCE 5B1BE 1V55E 3ABLE 5B1AE 2DYRE 1V54E 3WG7E 2EILE 2EINE 2Y69E 3ABME 2DYSE 2EIJE 3X2QE
chains in the Genus database with same CATH superfamily
3DPYA 3RAUA 2F8YA 4DX1A 5A6CA 5LP0A 4O60A 4FADA 2J4DA 5E75A 2J8SD 1N11A 2LAHA 4EQFA 3FUDA 5EYLA 1LD8A 1LD7A 1HFAA 3QC1A 3Q75A 2ILRA 3C3QA 3CHSA 2PQRA 5CERB 3SI5A 2FO1E 5BXUA 4RLYA 3MKQB 4GZ5A 4R7LA 4WNGA 4LSZE 2LNIA 4YDOA 4U04A 4CT0A 2NXPA 4N5CA 1SA5A 4L9PA 1W3BA 2R59A 4N3BA 3UX4A 4G11A 3JYSA 3ZNGA 2LAIA 2HYZA 3HRAA 4LUNU 1NA0A 1K1AA 3TXNA 3ZN3A 1A5EA 2Y0BG 2F8XK 3FTUA 4BEPA 4U96D 3CIAA 3UQ3A 1U2VG 2LXLA 5CEDB 2B6CA 3VLFA 5FQ6A 3JXIA 1ELRA 1H6KA 3KEZA 4GZ6A 2BKKB 5ENTD 3AS4A 3E32A 2EIKE 4UQZA 4CRWA 3PUJA 1IQRA 1S0PA 3UT7A 3NBNB 1H0AA 3PZDA 4F3VA 1ZU2A 4YDWA 1G3NB 3X2QE 1SQMA 2J4BA 3ZYQA 4AP2A 1EPUA 2ZGDA 3J5PA 1MQSA 2XGSA 1YMPA 3I4RB 3U64A 4M7CA 3KAEA 4HXIA 1FCHA 4NURA 5JJ6A 3IBEA 2KXPC 3CGHA 3DRAA 2VSOE 4G8LA 3NQPA 3CSTA 5ENPD 1N94A 1MX4A 1BPOA 5AQBA 1N0RA 3HYMB 5BW8C 5J08A 4OVVA 1NI1A 4PUCA 4GTSA 2XQ0A 3CVYA 1N4SA 1HG5A 1KPSB 5AQ7A 3SY2A 2A4ZA 3CVNA 3L17A 4ME2A 3CQGB 3WXXA 4AOFA 3HXCA 1QQEA 3CVUA 2AXUA 3QWPA 2KCLA 2P9IG 4BTBA 1UOHA 5BV0A 2GW1A 3QAQA 4AEZC 4JL0A 3SFYA 3CK7A 2BTDA 4UI9C 4K03A 1XNFA 3E30A 4YVQC 3SZ7A 4JB8P 2P9UG 5B1BE 2X6HA 3T5XA 4BSXA 4DK5A 1E7UA 3NB2A 1FT2A 2V4LA 1UJKA 4I17A 3L54A 3ISMC 4U95D 4K0RA 4EBAA 3W9FA 2X38A 1D8DA 2GRPB 3FY4A 1MX2A 4U07A 4U63A 1DCEA 3PZ3A 5AJDA 3PUKA 3G2VA 2R03A 3Q49B 1TNBA 4A3VA 4ANVA 3PZ2A 2WXHA 5AJLA 3FWVA 5FZQA 4MS6A 3KS2A 5DIZA 4DLQA 3SFXA 1DCQA 4A55A 1NP7A 2Y4UA 3HIZA 4L2YA 1UJJA 3NOCD 4J0UA 1HE8A 1N54A 3KSQA 2RFMA 5J90A 2JABA 3MKRA 4TV3A 1KLXA 5LCWC 4IN3B 2IOLA 1ZB1A 3T8KA 3MEKA 2PNNA 3OXLA 2AVPA 3E33A 3MCXA 1NZNA 1V54E 2GROB 5CRUA 1H6OA 3P2BA 4UWHA 3FUNA 2LSVA 5IY5E 2AXZA 2E0IA 1ELKA 3S7DA 2DZOA 3S2AA 4TRQA 2GRRB 2CHZA 4E6HA 2CFZA 4TXQA 1YA0A 2EILE 4JD2G 4UWGA 1Y6IA 3PNLB 3ABME 2I2OA 2WPVA 3L6AA 2P9LG 3D3MA 2XHEA 3AU5A 2VSYA 4Q69A 3Q78A 3G2UA 2AWIA 5FZRA 5BV1A 2L9BA 2VGXB 1IHBA 3D9MA 1S63A 5ARGA 4I2ZA 1SVXA 4NACA 3S7BA 2GRNB 3UIOC 3GZ1A 4LEUA 3HXDA 1P5QA 3KSLA 2PM6A 4Q96A 1OXJA 5AYWD 3L13A 4I1AA 2XEEA 5CBNA 5EDSA 1N0QA 3LJNA 1OWMA 3R7QA 3QJZA 2WXKA 3EHQA 4GTMA 3B7TA 3LVQE 3ASNE 5BPPA 4HS2A 4DJAA 3UPVA 3F6QA 4JHKA 1IYGA 2J9QA 1LTXA 5FQ8A 3TWRA 4GMJA 3ML8A 3FTZA 4CDRA 2X6KA 4EZJA 4DI4A 4XI9A 4EZLA 4ACLA 2CHXA 1H2UA 4FA6A 2XGMA 4IRUA 1N52A 5HS0A 3KEAA 3DPDA 5AENA 2A5EA 3ASDA 4LERA 4UI9K 3LY7A 4LNGA 1Y8MA 1X81A 3LJ3A 3SFZA 4U0ZA 3FTXA 3DSTA 3ZIMA 3HVEB 2VTBA 3BUAA 4EECA 3ZHEB 3PS6A 1S70B 5T4YA 1NFIE 3VLDA 5JJ7A 1UN8A 2X6JA 3SBSA 2HO1A 3UXGA 2ETCA 3JQ0A 3K9IA 3ZKJA 1MYOA 3FP3A 3IHVA 4J8YA 4B0ZA 2XCCA 3CHMA 3U9WA 5LCWJ 3CVLA 4N2QA 3UUXA 4PH4B 5D2MC 1UW4B 3EIQC 3Q73A 2KBXA 1TJCA 2PL2A 4WAFA 3MGBA 2RD0A 3D9IA 3TJPA 4OAVB 4EBAG 4K5AB 4RVBA 1DVPA 3I4GA 2F37A 3CR3A 3TGOA 2IU1A 3EHMA 4GYWA 3FUIA 1UG3A 4CYMD 2VSNA 1YYHA 2OEWA 4HLEA 4AY6A 3ASGA 3VLEA 5AN8A 4WWOA 5BNWA 2RG8A 3LCAA 4KXKB 1HU3A 4G26A 5CECB 3PZ4A 1MZCA 1NL4A 1JUQA 3DEOA 5HRYA 2OV8A 2WXLA 3QARA 2DYSE 3J5QB 2LUHA 3L16A 5KNGA 5A23A 3MA5A 2QY7A 2J09A 3B7BA 4HOSA 4PDXA 3DSXA 2C0LA 3Q5MA 1BU9A 4GTPA 4GMLA 3BU8A 2XRYA 2MHKA 2PQNA 3FTWA 1N9AA 3ZGQA 5FQ4A 1QNFA 3ZUVB 4C0MA 3ML9A 4MRUA 3D9JA 3UIPC 4O6FA 3HXBA 2V0PA 2FEZA 1HZ4A 1IXVA 3FUJA 3V2XA 2GGFA 2KCVA 4EHMA 1EYHA 3U66A 3FEYA 2YHEA 3MZLB 3D9NA 4C9BB 3IKOB 2P9KG 3LS8A 2OOEA 3TWUA 1IKND 2EQXA 4APOA 1MX6A 2IY0C 4RQIA 4ATZD 1XGWA 3QWVA 2V4HC 2GRLA 2R05A 5AAOA 5CMWA 3B13A 4TXRA 1QBQA 2QFCA 2IEJA 3D9PA 3GW4A 2P9PG 2VQ2A 4ATGA 5HQ8A 3B7RL 5G04C 3QK0A 5KNHD 1O5MA 2QYUA 4AXHA 2FI7A 1H19A 4I2WA 4WWPA 2AW6A 3LY9A 3UI2A 2OVBA 2HM8A 3JQ1A 2UY1B 4CEMA 3PEVB 2Y1LE 3SNXA 4C0EA 4L1BA 4GU5A 3DXMG 4H7XA 5CCMA 1TEZA 2LO6A 3Q4AB 4PS7A 4BT8A 2DVWA 2C2LA 3TWQA 4JEUA 4FHKA 4D10C 2IO2C 3R7RA 5HI7A 3FTYA 4UI9J 3EJNA 3Q7AA 1MJ0A 4KYOB 4G8KA 3ASHA 2NYJA 4CGWA 4I9EA 3TAXA 4XKCA 3PREA 4HB5A 3APDA 4HFGA 5B1AE 3ZU7B 2FBNA 3ZPJA 4JA9A 5FZSA 4I1MA 3ZYMA 2ZISA 2NSZA 5D0OD 1BD8A 4J8FA 3JUEA 4GYYA 3V30A 4PS8A 1A17A 3UM1A 2DWZA 5EKQD 2EINE 4HI9A 2I9CA 3DWLG 5ENQD 1TR4A 4UWKA 2VYIA 2WXGA 3E4BA 1FPPA 3FUHA 3CHOA 3AG2E 4A3TA 3KD7A 3Q7FA 4J6IA 4DX7D 3HG0D 1E96B 5E76A 3G2TA 2VGEA 3V2OA 4U0SA 3IHYA 4I1OB 4U0UA 3ZXSA 2IFUA 3NZSA 1HH8A 3TWWA 5KBAA 1RZ4A 4ILGA 4TUUA 1HF8A 3FU5A 5DBKA 4WUYA 3EU9A 2V5QC 5EIBE 3BEEA 3PZ1A 5JHBA 3S7JA 3B7UX 4N3CA 3UT4A 4KVOA 3SQVA 3RJVA 4GAAA 1V55E 3I5PA 3EHRA 1WDYA 3GYZA 4UWLA 1GW6A 2WXQA 2CG2A 4U8YD 3G2SA 5CRVA 2WQ7A 4OYSA 4HOUA 4Y6CA 3VTYA 1KZPA 4HORA 3WG7E 2R17C 4FJZA 3FTSA 1JPLA 1SA4A 4CCAA 4E85A 3CQCB 5CEAA 2H6FA 2XEVA 3HXFA 1K3ZD 3CHPA 3AAAC 4M3OA 1PC2A 5A7DB 3OXFA 5AQ9A 2XRZA 4J7WA 1D9SA 2DZNA 2KM4A 3RRNB 2WXJA 1OT8A 4YVOA 4ANXA 1SZAA 3W9GA 1TYQG 3UM2A 3C3OA 4GPMA 3FTVA 1KT1A 3SBTB 4OAUC 5EIDA 3CV0A 5ARFA 4RG6A 3PEUB 5G05C 1WY6A 4LNBA 4N3AA 4XIFA 3QDNA 3I3NA 3AU4A 4K5CA 1HXIA 4G23A 2P9NG 3EUVA 4HRNA 3DSWA 2I6HA 3EU5A 2YNQA 5AIJA 4FULA 4KT6B 3UKUG 1O1SA 1Z3YA 4B8AA 5CHEE 2I1KA 5AQAA 4GTTA 5T3RA 1Z3XA 3LXUX 4GTVA 4B94A 3JCKC 3DEPA 4RSYA 3FEXA 5EN5D 1WAO1 4J8DA 4A1GA 1TNYA 3D9LA 3ABKE 3ULQA 3O4ZA 4LCTA 1LF8A 4MLPA 4TUMA 1HG2A 5FIOA 2J07A 3TXMA 4JVSA 5FWQA 2Y69E 4XKBA 5D0QD 2KC7A 3SHFA 2UWJG 4F7AA 4BETA 3ULEG 4CT4A 4RG9A 4FC8A 4I9CA 1N95A 3LY8A 2Q7FA 2MYOA 2R2LA 4GPKA 2GRMA 4G1TA 5LFAA 5FTPA 4XZ4A 1O1TA 3ZW3A 2LXMA 3CVPA 2RFAA 3RK6A 3FU0A 2E2EA 4G25A 1E8ZA 2CFUA 2KCKA 5HKPA 4HRLA 1KZOA 4UQXA 3T5VA 1IHGA 3FUEA 4W9RA 4GCNA 4GZCA 1NA3A 3FH8A 4EZKA 1EDUA 3IV0A 4P29A 4GA0A 4HOTA 4DPRA 2MRIA 3FH5A 4JHRA 5D66A 2A5UA 3QNKA 5G04J 2HR2A 2WXPA 4KMOA 1H6PA 4X8QA 3RIBA 4U8HA 3C3RA 4ILHB 4BX8A 2WQ6A 2VTBB 2L0IA 3HXEA 5EILA 1ELWA 3IEGA 1WG0A 3AS5A 1VDYA 3E37A 4BX9A 1N4RA 3R9AB 2VJ8A 3RO2A 5M72A 3CLJA 1E8XA 2M63A 2Y4TA 4PS3A 5JHAA 2CHWA 4HQDA 5G05J 2X3MA 1UN9A 4J8EA 2WQHA 3FUFA 2WXFA 1K8KG 4HBDA 2WXOA 5ENOD 3UTMA 3ZEFA 4B93B 4DX5D 2JLBA 2WXNA 3Q47B 4URKA 1L5JA 2KATA 4ACKA 2BEDA 2H6GA 3MKQA 5EX0A 3TWXA 2L6JA 5ENSD 5EYPF 3MYVA 3ZRHA 2ZXWE 3Q9UC 4I6JA 3U4TA 3DBSA 4U7EB 3TG4A 3RSEG 2IQCA 2MOWA 4FP7A 3FFLA 3BQOA 3TG5A 3NZUA 2DIWA 4MKTA 1WM5A 4BT9A 4AV7A 3ABLE 4BWRA 1KT0A 4YDEA 4DRXE 4ABNA 4DLOA 5LOZA 5BXOA 5JJTA 1JCQA 3V31A 4QFVA 4N39A 3IXEA 3CVXA 4G24A 4B8CB 3HDXA 4FLBA 3DSVA 4NRHB 3URZA 2XCBA 2L6BA 1Z6TA 2PM7A 2V5FA 1TJFA 3ENEA 2WB2A 3UINC 4AVXA 3CK8A 1QZ2A 2EIME 1TNOA 4HOQA 5CMYA 3G2WA 1H2TC 2XENA 5FT9A 3QB2A 5ENRD 4UUCA 2ETBA 4JZYA 4XI0A 3EIJA 4GB9A 2ONDA 3FUMA 3TWTA 3N71A 3ASOE 3EHNA 3ASFA 1RW2A 2XZDG 3QKYA 3QOUA 4GCOA 4Q94A 2C0MA 5FJYA 1DC2A 1JWFA 4ILIA 1SW6A 2HE0A 3R9MA 1U3DA 3FULA 2ETAA 2KZTA 1TN6A 4ZFHA 5KJNA 4AM9A 3FHEA 2WXMA 1HS6A 2OCCE 2BUGA 4ANUA 2XEHA 2KZTB 2YHCA 3LPZA 1B89A 1PY1A 3SD5A 3NOGD 1TNUA 5KCMA 3LDZA 1X5BA 3AS8A 3L22A 3U3WA 1JCSA 1E8YA 1FVFA 3GZSA 4L7TA 4UQYA 1TNZA 4AJWA 2UY1A 4MBGA 2FO7A 4DUIA 1K1BA 2P58C 2H6IA 1U3CA 3AG4E 2QYJA 3PNTB 4XEIG 2ZGGA 3CHRA 4IYPA 3D9OA 1JCRA 4GA2A 4EPZA 3ESLA 3TWSA 1OCRE 4YNDA 1E90A 4A1SA 4BSZB 4BY6A 4ZHBA 3MX3A 4GTRA 2XPIA 3C98A 2WMOA 3BG1B 2P9SG 3MV2B 2I1JA 4U8VD 3LKUA 2AXVA 3CKBA 5FINA 3FDHA 3NAWA 1TN8A 4JW1A 5LX8A 1Q2ZA 2J49A 2X6FA 3TL5A 5CBOA 4WWNA 3P1UA 2DBAA 3ONLA 4QQIA 1H2VC 2XPZA 4JXTA 4HNAD 3T9KA 4H7YA 2YINA 1O1RA 4GMRA 3MJWA 2XS8A 1FT1A 5FQ7A 2WXIA 3ULYA 1BLXB 2YQ8A 2XGOA 3CKCA 1MHQA 4UWFA 3S7FA 3V79K 4B89A 4KZ0A 3FH7A 4NQ0A 4GTQA 2V8SE 3OTNA 3CK9A 4Z68A 2PZIA 2XPYA 2J08A 3ONKA 4V3IA 3UKRG 4GYOA 4GA1A 1N4PA 5KJKA 3HHMA 3FU6A 4J8SA 3RU0A 3JUIA 1D8EA 1E7VA 3PE3A 3PE4A 4FJYA 2DCPA 4WNEA 2VGYA 4CDMA 2FF4A 5T8IA 4F6RD 1OWNA 4APFA 3AJIA 3L08A 3PH0C 1OCZE 1OCCE 4BERA 4I6GA 4JA7A 4AY5A 2B0OE 3ZVVA 5KWDA 3T8MA 3ZXPA 2IOSA 1OWPA 3RRMB 3LEWA 3MV3B 3RKVA 4ANWA 2XS1A 4WNFA 2AJAA 1SZ9A 4DI3A 4NIKA 2QZAA 4K5BA 4LNUD 1HO8A 2IJGX 5AARA 4WNDA 2BF0X 3OAWA 1Z5SC 2VSXE 2WMNA 5C1DA 1PAQA 3APCA 3CSFA 5ANRA 5C2YA 4FU3A 3PVLA 4LG6A 2WVIA 4KVMA 2L0TB 4AIFA 4F53A 1N4QA 2BKGA 3UM0A 3ZYLA 3SO8A 2Y3AA 3ZYKA 4JC8A 4XE0A 4IULA 3AG1E 3SGHA 3L9TA 1S64A 3OXGA 4I6EA 2JEKA 3LYAA 3NF1A 1IQUA 1TN7A 4GZDA 3QWWA 5G2NA 3DXKG 2CG3A 4KZCA 5BT1A 3HVEA 3CVWA 5JMND 1ZBPA 5CCLA 3CHQA 4JPSA 3FUKA 3C72A 4L23A 5JA4D 4BESA 2OVFA 3B95A 3FU3A 4N5QA 4OVUA 3DSUA 2R02A 4DX2A 2VGXA 4O1OA 3TWVA 3D9KA 2ZIRA 2GRQB 4G2VA 1QYMA 4CDNA 5H7PA 1BI8B 4FHJA 4KBQA 3ZHEA 1DNPA 2LSUA 3DSSA 4HI8A 1INZA 3RRUA 4C48B 2DYRE 1HX8A 3CEQA 3PDNA 2IONA 2FULA 5EX3A 3CVVA 2XZTG 1OCOE 2F0YA 1FVHA 4BTAA 4LRZA 4F1PA 4CZ2D 3ZFWA 4HVBA 3UT8A 5ITZF 2P2CP 4DX6D 1YCSB 4JHJA 4N2SA 3Q9NC 4BFRA 1EF1C 5KJLA 4GZ3A 1AWCB 4HRMB 4JEHA 2ZU6B 4I43A 3UM3A 4Y6WA 5ANLA 4O1PA 4TXPA 1E8WA 3B7SA 3VTXA 1JWGA 4HLLA 4L2LA 3D9HA 4CGVA 1OUVA 2X6IA 3Q79A 2R5SA 4GTOA 4FLHA 5KJMA 1AP7A 4A63B 3EDTB 2EIJE 1OWOA 1OY3D 5B3SE 2WM9A 3L82A 3O48A 2OEVA 5ENNA 2IF4A 3SF4A 2WXRA 5G55A 3ESKA 4XX5A 3JXJA 5BUZA 3LVRE 3RO3A 3E34A 3AG3E 3APFA 3BG0B 2QC9A 3Q15A 4YDYA 1OWLA 3C5RA 2RKKA 2NC9A 3CVQA 3PRZA 2H6HA 4F1SA 3GZ2A 2IO3C 1BI7B 3UMVA
chains in the Genus database with same CATH topology
1OCRE 1OCOE 3AG3E 5B3SE 3ABKE 5IY5E 3AG1E 3AG2E 3AG4E 2ZXWE 3ASNE 3ASOE 2EIKE 1OCZE 1OCCE 2EIME 2OCCE 5B1BE 1V55E 3ABLE 5B1AE 2DYRE 1V54E 3WG7E 2EILE 2EINE 2Y69E 3ABME 2DYSE 2EIJE 3X2QE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCR E;  1OCO E;  3AG3 E;  5B3S E;  3ABK E;  5IY5 E;  3AG1 E;  3AG2 E;  3AG4 E;  2ZXW E;  3ASN E;  3ASO E;  2EIK E;  1OCZ E;  1OCC E;  2EIM E;  2OCC E;  5B1B E;  1V55 E;  3ABL E;  5B1A E;  2DYR E;  1V54 E;  3WG7 E;  2EIL E;  2EIN E;  2Y69 E;  3ABM E;  2DYS E;  2EIJ E;  3X2Q E; 
#chains in the Genus database with same CATH topology
 3DPY A;  3RAU A;  2F8Y A;  4DX1 A;  5A6C A;  5LP0 A;  4O60 A;  4FAD A;  2J4D A;  5E75 A;  2J8S D;  1N11 A;  2LAH A;  4EQF A;  3FUD A;  5EYL A;  1LD8 A;  1LD7 A;  1HFA A;  3QC1 A;  3Q75 A;  2ILR A;  3C3Q A;  3CHS A;  2PQR A;  5CER B;  3SI5 A;  2FO1 E;  5BXU A;  4RLY A;  3MKQ B;  4GZ5 A;  4R7L A;  4WNG A;  4LSZ E;  2LNI A;  4YDO A;  4U04 A;  4CT0 A;  2NXP A;  4N5C A;  1SA5 A;  4L9P A;  1W3B A;  2R59 A;  4N3B A;  3UX4 A;  4G11 A;  3JYS A;  3ZNG A;  2LAI A;  2HYZ A;  3HRA A;  4LUN U;  1NA0 A;  1K1A A;  3TXN A;  3ZN3 A;  1A5E A;  2Y0B G;  2F8X K;  3FTU A;  4BEP A;  4U96 D;  3CIA A;  3UQ3 A;  1U2V G;  2LXL A;  5CED B;  2B6C A;  3VLF A;  5FQ6 A;  3JXI A;  1ELR A;  1H6K A;  3KEZ A;  4GZ6 A;  2BKK B;  5ENT D;  3AS4 A;  3E32 A;  2EIK E;  4UQZ A;  4CRW A;  3PUJ A;  1IQR A;  1S0P A;  3UT7 A;  3NBN B;  1H0A A;  3PZD A;  4F3V A;  1ZU2 A;  4YDW A;  1G3N B;  3X2Q E;  1SQM A;  2J4B A;  3ZYQ A;  4AP2 A;  1EPU A;  2ZGD A;  3J5P A;  1MQS A;  2XGS A;  1YMP A;  3I4R B;  3U64 A;  4M7C A;  3KAE A;  4HXI A;  1FCH A;  4NUR A;  5JJ6 A;  3IBE A;  2KXP C;  3CGH A;  3DRA A;  2VSO E;  4G8L A;  3NQP A;  3CST A;  5ENP D;  1N94 A;  1MX4 A;  1BPO A;  5AQB A;  1N0R A;  3HYM B;  5BW8 C;  5J08 A;  4OVV A;  1NI1 A;  4PUC A;  4GTS A;  2XQ0 A;  3CVY A;  1N4S A;  1HG5 A;  1KPS B;  5AQ7 A;  3SY2 A;  2A4Z A;  3CVN A;  3L17 A;  4ME2 A;  3CQG B;  3WXX A;  4AOF A;  3HXC A;  1QQE A;  3CVU A;  2AXU A;  3QWP A;  2KCL A;  2P9I G;  4BTB A;  1UOH A;  5BV0 A;  2GW1 A;  3QAQ A;  4AEZ C;  4JL0 A;  3SFY A;  3CK7 A;  2BTD A;  4UI9 C;  4K03 A;  1XNF A;  3E30 A;  4YVQ C;  3SZ7 A;  4JB8 P;  2P9U G;  5B1B E;  2X6H A;  3T5X A;  4BSX A;  4DK5 A;  1E7U A;  3NB2 A;  1FT2 A;  2V4L A;  1UJK A;  4I17 A;  3L54 A;  3ISM C;  4U95 D;  4K0R A;  4EBA A;  3W9F A;  2X38 A;  1D8D A;  2GRP B;  3FY4 A;  1MX2 A;  4U07 A;  4U63 A;  1DCE A;  3PZ3 A;  5AJD A;  3PUK A;  3G2V A;  2R03 A;  3Q49 B;  1TNB A;  4A3V A;  4ANV A;  3PZ2 A;  2WXH A;  5AJL A;  3FWV A;  5FZQ A;  4MS6 A;  3KS2 A;  5DIZ A;  4DLQ A;  3SFX A;  1DCQ A;  4A55 A;  1NP7 A;  2Y4U A;  3HIZ A;  4L2Y A;  1UJJ A;  3NOC D;  4J0U A;  1HE8 A;  1N54 A;  3KSQ A;  2RFM A;  5J90 A;  2JAB A;  3MKR A;  4TV3 A;  1KLX A;  5LCW C;  4IN3 B;  2IOL A;  1ZB1 A;  3T8K A;  3MEK A;  2PNN A;  3OXL A;  2AVP A;  3E33 A;  3MCX A;  1NZN A;  1V54 E;  2GRO B;  5CRU A;  1H6O A;  3P2B A;  4UWH A;  3FUN A;  2LSV A;  5IY5 E;  2AXZ A;  2E0I A;  1ELK A;  3S7D A;  2DZO A;  3S2A A;  4TRQ A;  2GRR B;  2CHZ A;  4E6H A;  2CFZ A;  4TXQ A;  1YA0 A;  2EIL E;  4JD2 G;  4UWG A;  1Y6I A;  3PNL B;  3ABM E;  2I2O A;  2WPV A;  3L6A A;  2P9L G;  3D3M A;  2XHE A;  3AU5 A;  2VSY A;  4Q69 A;  3Q78 A;  3G2U A;  2AWI A;  5FZR A;  5BV1 A;  2L9B A;  2VGX B;  1IHB A;  3D9M A;  1S63 A;  5ARG A;  4I2Z A;  1SVX A;  4NAC A;  3S7B A;  2GRN B;  3UIO C;  3GZ1 A;  4LEU A;  3HXD A;  1P5Q A;  3KSL A;  2PM6 A;  4Q96 A;  1OXJ A;  5AYW D;  3L13 A;  4I1A A;  2XEE A;  5CBN A;  5EDS A;  1N0Q A;  3LJN A;  1OWM A;  3R7Q A;  3QJZ A;  2WXK A;  3EHQ A;  4GTM A;  3B7T A;  3LVQ E;  3ASN E;  5BPP A;  4HS2 A;  4DJA A;  3UPV A;  3F6Q A;  4JHK A;  1IYG A;  2J9Q A;  1LTX A;  5FQ8 A;  3TWR A;  4GMJ A;  3ML8 A;  3FTZ A;  4CDR A;  2X6K A;  4EZJ A;  4DI4 A;  4XI9 A;  4EZL A;  4ACL A;  2CHX A;  1H2U A;  4FA6 A;  2XGM A;  4IRU A;  1N52 A;  5HS0 A;  3KEA A;  3DPD A;  5AEN A;  2A5E A;  3ASD A;  4LER A;  4UI9 K;  3LY7 A;  4LNG A;  1Y8M A;  1X81 A;  3LJ3 A;  3SFZ A;  4U0Z A;  3FTX A;  3DST A;  3ZIM A;  3HVE B;  2VTB A;  3BUA A;  4EEC A;  3ZHE B;  3PS6 A;  1S70 B;  5T4Y A;  1NFI E;  3VLD A;  5JJ7 A;  1UN8 A;  2X6J A;  3SBS A;  2HO1 A;  3UXG A;  2ETC A;  3JQ0 A;  3K9I A;  3ZKJ A;  1MYO A;  3FP3 A;  3IHV A;  4J8Y A;  4B0Z A;  2XCC A;  3CHM A;  3U9W A;  5LCW J;  3CVL A;  4N2Q A;  3UUX A;  4PH4 B;  5D2M C;  1UW4 B;  3EIQ C;  3Q73 A;  2KBX A;  1TJC A;  2PL2 A;  4WAF A;  3MGB A;  2RD0 A;  3D9I A;  3TJP A;  4OAV B;  4EBA G;  4K5A B;  4RVB A;  1DVP A;  3I4G A;  2F37 A;  3CR3 A;  3TGO A;  2IU1 A;  3EHM A;  4GYW A;  3FUI A;  1UG3 A;  4CYM D;  2VSN A;  1YYH A;  2OEW A;  4HLE A;  4AY6 A;  3ASG A;  3VLE A;  5AN8 A;  4WWO A;  5BNW A;  2RG8 A;  3LCA A;  4KXK B;  1HU3 A;  4G26 A;  5CEC B;  3PZ4 A;  1MZC A;  1NL4 A;  1JUQ A;  3DEO A;  5HRY A;  2OV8 A;  2WXL A;  3QAR A;  2DYS E;  3J5Q B;  2LUH A;  3L16 A;  5KNG A;  5A23 A;  3MA5 A;  2QY7 A;  2J09 A;  3B7B A;  4HOS A;  4PDX A;  3DSX A;  2C0L A;  3Q5M A;  1BU9 A;  4GTP A;  4GML A;  3BU8 A;  2XRY A;  2MHK A;  2PQN A;  3FTW A;  1N9A A;  3ZGQ A;  5FQ4 A;  1QNF A;  3ZUV B;  4C0M A;  3ML9 A;  4MRU A;  3D9J A;  3UIP C;  4O6F A;  3HXB A;  2V0P A;  2FEZ A;  1HZ4 A;  1IXV A;  3FUJ A;  3V2X A;  2GGF A;  2KCV A;  4EHM A;  1EYH A;  3U66 A;  3FEY A;  2YHE A;  3MZL B;  3D9N A;  4C9B B;  3IKO B;  2P9K G;  3LS8 A;  2OOE A;  3TWU A;  1IKN D;  2EQX A;  4APO A;  1MX6 A;  2IY0 C;  4RQI A;  4ATZ D;  1XGW A;  3QWV A;  2V4H C;  2GRL A;  2R05 A;  5AAO A;  5CMW A;  3B13 A;  4TXR A;  1QBQ A;  2QFC A;  2IEJ A;  3D9P A;  3GW4 A;  2P9P G;  2VQ2 A;  4ATG A;  5HQ8 A;  3B7R L;  5G04 C;  3QK0 A;  5KNH D;  1O5M A;  2QYU A;  4AXH A;  2FI7 A;  1H19 A;  4I2W A;  4WWP A;  2AW6 A;  3LY9 A;  3UI2 A;  2OVB A;  2HM8 A;  3JQ1 A;  2UY1 B;  4CEM A;  3PEV B;  2Y1L E;  3SNX A;  4C0E A;  4L1B A;  4GU5 A;  3DXM G;  4H7X A;  5CCM A;  1TEZ A;  2LO6 A;  3Q4A B;  4PS7 A;  4BT8 A;  2DVW A;  2C2L A;  3TWQ A;  4JEU A;  4FHK A;  4D10 C;  2IO2 C;  3R7R A;  5HI7 A;  3FTY A;  4UI9 J;  3EJN A;  3Q7A A;  1MJ0 A;  4KYO B;  4G8K A;  3ASH A;  2NYJ A;  4CGW A;  4I9E A;  3TAX A;  4XKC A;  3PRE A;  4HB5 A;  3APD A;  4HFG A;  5B1A E;  3ZU7 B;  2FBN A;  3ZPJ A;  4JA9 A;  5FZS A;  4I1M A;  3ZYM A;  2ZIS A;  2NSZ A;  5D0O D;  1BD8 A;  4J8F A;  3JUE A;  4GYY A;  3V30 A;  4PS8 A;  1A17 A;  3UM1 A;  2DWZ A;  5EKQ D;  2EIN E;  4HI9 A;  2I9C A;  3DWL G;  5ENQ D;  1TR4 A;  4UWK A;  2VYI A;  2WXG A;  3E4B A;  1FPP A;  3FUH A;  3CHO A;  3AG2 E;  4A3T A;  3KD7 A;  3Q7F A;  4J6I A;  4DX7 D;  3HG0 D;  1E96 B;  5E76 A;  3G2T A;  2VGE A;  3V2O A;  4U0S A;  3IHY A;  4I1O B;  4U0U A;  3ZXS A;  2IFU A;  3NZS A;  1HH8 A;  3TWW A;  5KBA A;  1RZ4 A;  4ILG A;  4TUU A;  1HF8 A;  3FU5 A;  5DBK A;  4WUY A;  3EU9 A;  2V5Q C;  5EIB E;  3BEE A;  3PZ1 A;  5JHB A;  3S7J A;  3B7U X;  4N3C A;  3UT4 A;  4KVO A;  3SQV A;  3RJV A;  4GAA A;  1V55 E;  3I5P A;  3EHR A;  1WDY A;  3GYZ A;  4UWL A;  1GW6 A;  2WXQ A;  2CG2 A;  4U8Y D;  3G2S A;  5CRV A;  2WQ7 A;  4OYS A;  4HOU A;  4Y6C A;  3VTY A;  1KZP A;  4HOR A;  3WG7 E;  2R17 C;  4FJZ A;  3FTS A;  1JPL A;  1SA4 A;  4CCA A;  4E85 A;  3CQC B;  5CEA A;  2H6F A;  2XEV A;  3HXF A;  1K3Z D;  3CHP A;  3AAA C;  4M3O A;  1PC2 A;  5A7D B;  3OXF A;  5AQ9 A;  2XRZ A;  4J7W A;  1D9S A;  2DZN A;  2KM4 A;  3RRN B;  2WXJ A;  1OT8 A;  4YVO A;  4ANX A;  1SZA A;  3W9G A;  1TYQ G;  3UM2 A;  3C3O A;  4GPM A;  3FTV A;  1KT1 A;  3SBT B;  4OAU C;  5EID A;  3CV0 A;  5ARF A;  4RG6 A;  3PEU B;  5G05 C;  1WY6 A;  4LNB A;  4N3A A;  4XIF A;  3QDN A;  3I3N A;  3AU4 A;  4K5C A;  1HXI A;  4G23 A;  2P9N G;  3EUV A;  4HRN A;  3DSW A;  2I6H A;  3EU5 A;  2YNQ A;  5AIJ A;  4FUL A;  4KT6 B;  3UKU G;  1O1S A;  1Z3Y A;  4B8A A;  5CHE E;  2I1K A;  5AQA A;  4GTT A;  5T3R A;  1Z3X A;  3LXU X;  4GTV A;  4B94 A;  3JCK C;  3DEP A;  4RSY A;  3FEX A;  5EN5 D;  1WAO 1;  4J8D A;  4A1G A;  1TNY A;  3D9L A;  3ABK E;  3ULQ A;  3O4Z A;  4LCT A;  1LF8 A;  4MLP A;  4TUM A;  1HG2 A;  5FIO A;  2J07 A;  3TXM A;  4JVS A;  5FWQ A;  2Y69 E;  4XKB A;  5D0Q D;  2KC7 A;  3SHF A;  2UWJ G;  4F7A A;  4BET A;  3ULE G;  4CT4 A;  4RG9 A;  4FC8 A;  4I9C A;  1N95 A;  3LY8 A;  2Q7F A;  2MYO A;  2R2L A;  4GPK A;  2GRM A;  4G1T A;  5LFA A;  5FTP A;  4XZ4 A;  1O1T A;  3ZW3 A;  2LXM A;  3CVP A;  2RFA A;  3RK6 A;  3FU0 A;  2E2E A;  4G25 A;  1E8Z A;  2CFU A;  2KCK A;  5HKP A;  4HRL A;  1KZO A;  4UQX A;  3T5V A;  1IHG A;  3FUE A;  4W9R A;  4GCN A;  4GZC A;  1NA3 A;  3FH8 A;  4EZK A;  1EDU A;  3IV0 A;  4P29 A;  4GA0 A;  4HOT A;  4DPR A;  2MRI A;  3FH5 A;  4JHR A;  5D66 A;  2A5U A;  3QNK A;  5G04 J;  2HR2 A;  2WXP A;  4KMO A;  1H6P A;  4X8Q A;  3RIB A;  4U8H A;  3C3R A;  4ILH B;  4BX8 A;  2WQ6 A;  2VTB B;  2L0I A;  3HXE A;  5EIL A;  1ELW A;  3IEG A;  1WG0 A;  3AS5 A;  1VDY A;  3E37 A;  4BX9 A;  1N4R A;  3R9A B;  2VJ8 A;  3RO2 A;  5M72 A;  3CLJ A;  1E8X A;  2M63 A;  2Y4T A;  4PS3 A;  5JHA A;  2CHW A;  4HQD A;  5G05 J;  2X3M A;  1UN9 A;  4J8E A;  2WQH A;  3FUF A;  2WXF A;  1K8K G;  4HBD A;  2WXO A;  5ENO D;  3UTM A;  3ZEF A;  4B93 B;  4DX5 D;  2JLB A;  2WXN A;  3Q47 B;  4URK A;  1L5J A;  2KAT A;  4ACK A;  2BED A;  2H6G A;  3MKQ A;  5EX0 A;  3TWX A;  2L6J A;  5ENS D;  5EYP F;  3MYV A;  3ZRH A;  2ZXW E;  3Q9U C;  4I6J A;  3U4T A;  3DBS A;  4U7E B;  3TG4 A;  3RSE G;  2IQC A;  2MOW A;  4FP7 A;  3FFL A;  3BQO A;  3TG5 A;  3NZU A;  2DIW A;  4MKT A;  1WM5 A;  4BT9 A;  4AV7 A;  3ABL E;  4BWR A;  1KT0 A;  4YDE A;  4DRX E;  4ABN A;  4DLO A;  5LOZ A;  5BXO A;  5JJT A;  1JCQ A;  3V31 A;  4QFV A;  4N39 A;  3IXE A;  3CVX A;  4G24 A;  4B8C B;  3HDX A;  4FLB A;  3DSV A;  4NRH B;  3URZ A;  2XCB A;  2L6B A;  1Z6T A;  2PM7 A;  2V5F A;  1TJF A;  3ENE A;  2WB2 A;  3UIN C;  4AVX A;  3CK8 A;  1QZ2 A;  2EIM E;  1TNO A;  4HOQ A;  5CMY A;  3G2W A;  1H2T C;  2XEN A;  5FT9 A;  3QB2 A;  5ENR D;  4UUC A;  2ETB A;  4JZY A;  4XI0 A;  3EIJ A;  4GB9 A;  2OND A;  3FUM A;  3TWT A;  3N71 A;  3ASO E;  3EHN A;  3ASF A;  1RW2 A;  2XZD G;  3QKY A;  3QOU A;  4GCO A;  4Q94 A;  2C0M A;  5FJY A;  1DC2 A;  1JWF A;  4ILI A;  1SW6 A;  2HE0 A;  3R9M A;  1U3D A;  3FUL A;  2ETA A;  2KZT A;  1TN6 A;  4ZFH A;  5KJN A;  4AM9 A;  3FHE A;  2WXM A;  1HS6 A;  2OCC E;  2BUG A;  4ANU A;  2XEH A;  2KZT B;  2YHC A;  3LPZ A;  1B89 A;  1PY1 A;  3SD5 A;  3NOG D;  1TNU A;  5KCM A;  3LDZ A;  1X5B A;  3AS8 A;  3L22 A;  3U3W A;  1JCS A;  1E8Y A;  1FVF A;  3GZS A;  4L7T A;  4UQY A;  1TNZ A;  4AJW A;  2UY1 A;  4MBG A;  2FO7 A;  4DUI A;  1K1B A;  2P58 C;  2H6I A;  1U3C A;  3AG4 E;  2QYJ A;  3PNT B;  4XEI G;  2ZGG A;  3CHR A;  4IYP A;  3D9O A;  1JCR A;  4GA2 A;  4EPZ A;  3ESL A;  3TWS A;  1OCR E;  4YND A;  1E90 A;  4A1S A;  4BSZ B;  4BY6 A;  4ZHB A;  3MX3 A;  4GTR A;  2XPI A;  3C98 A;  2WMO A;  3BG1 B;  2P9S G;  3MV2 B;  2I1J A;  4U8V D;  3LKU A;  2AXV A;  3CKB A;  5FIN A;  3FDH A;  3NAW A;  1TN8 A;  4JW1 A;  5LX8 A;  1Q2Z A;  2J49 A;  2X6F A;  3TL5 A;  5CBO A;  4WWN A;  3P1U A;  2DBA A;  3ONL A;  4QQI A;  1H2V C;  2XPZ A;  4JXT A;  4HNA D;  3T9K A;  4H7Y A;  2YIN A;  1O1R A;  4GMR A;  3MJW A;  2XS8 A;  1FT1 A;  5FQ7 A;  2WXI A;  3ULY A;  1BLX B;  2YQ8 A;  2XGO A;  3CKC A;  1MHQ A;  4UWF A;  3S7F A;  3V79 K;  4B89 A;  4KZ0 A;  3FH7 A;  4NQ0 A;  4GTQ A;  2V8S E;  3OTN A;  3CK9 A;  4Z68 A;  2PZI A;  2XPY A;  2J08 A;  3ONK A;  4V3I A;  3UKR G;  4GYO A;  4GA1 A;  1N4P A;  5KJK A;  3HHM A;  3FU6 A;  4J8S A;  3RU0 A;  3JUI A;  1D8E A;  1E7V A;  3PE3 A;  3PE4 A;  4FJY A;  2DCP A;  4WNE A;  2VGY A;  4CDM A;  2FF4 A;  5T8I A;  4F6R D;  1OWN A;  4APF A;  3AJI A;  3L08 A;  3PH0 C;  1OCZ E;  1OCC E;  4BER A;  4I6G A;  4JA7 A;  4AY5 A;  2B0O E;  3ZVV A;  5KWD A;  3T8M A;  3ZXP A;  2IOS A;  1OWP A;  3RRM B;  3LEW A;  3MV3 B;  3RKV A;  4ANW A;  2XS1 A;  4WNF A;  2AJA A;  1SZ9 A;  4DI3 A;  4NIK A;  2QZA A;  4K5B A;  4LNU D;  1HO8 A;  2IJG X;  5AAR A;  4WND A;  2BF0 X;  3OAW A;  1Z5S C;  2VSX E;  2WMN A;  5C1D A;  1PAQ A;  3APC A;  3CSF A;  5ANR A;  5C2Y A;  4FU3 A;  3PVL A;  4LG6 A;  2WVI A;  4KVM A;  2L0T B;  4AIF A;  4F53 A;  1N4Q A;  2BKG A;  3UM0 A;  3ZYL A;  3SO8 A;  2Y3A A;  3ZYK A;  4JC8 A;  4XE0 A;  4IUL A;  3AG1 E;  3SGH A;  3L9T A;  1S64 A;  3OXG A;  4I6E A;  2JEK A;  3LYA A;  3NF1 A;  1IQU A;  1TN7 A;  4GZD A;  3QWW A;  5G2N A;  3DXK G;  2CG3 A;  4KZC A;  5BT1 A;  3HVE A;  3CVW A;  5JMN D;  1ZBP A;  5CCL A;  3CHQ A;  4JPS A;  3FUK A;  3C72 A;  4L23 A;  5JA4 D;  4BES A;  2OVF A;  3B95 A;  3FU3 A;  4N5Q A;  4OVU A;  3DSU A;  2R02 A;  4DX2 A;  2VGX A;  4O1O A;  3TWV A;  3D9K A;  2ZIR A;  2GRQ B;  4G2V A;  1QYM A;  4CDN A;  5H7P A;  1BI8 B;  4FHJ A;  4KBQ A;  3ZHE A;  1DNP A;  2LSU A;  3DSS A;  4HI8 A;  1INZ A;  3RRU A;  4C48 B;  2DYR E;  1HX8 A;  3CEQ A;  3PDN A;  2ION A;  2FUL A;  5EX3 A;  3CVV A;  2XZT G;  1OCO E;  2F0Y A;  1FVH A;  4BTA A;  4LRZ A;  4F1P A;  4CZ2 D;  3ZFW A;  4HVB A;  3UT8 A;  5ITZ F;  2P2C P;  4DX6 D;  1YCS B;  4JHJ A;  4N2S A;  3Q9N C;  4BFR A;  1EF1 C;  5KJL A;  4GZ3 A;  1AWC B;  4HRM B;  4JEH A;  2ZU6 B;  4I43 A;  3UM3 A;  4Y6W A;  5ANL A;  4O1P A;  4TXP A;  1E8W A;  3B7S A;  3VTX A;  1JWG A;  4HLL A;  4L2L A;  3D9H A;  4CGV A;  1OUV A;  2X6I A;  3Q79 A;  2R5S A;  4GTO A;  4FLH A;  5KJM A;  1AP7 A;  4A63 B;  3EDT B;  2EIJ E;  1OWO A;  1OY3 D;  5B3S E;  2WM9 A;  3L82 A;  3O48 A;  2OEV A;  5ENN A;  2IF4 A;  3SF4 A;  2WXR A;  5G55 A;  3ESK A;  4XX5 A;  3JXJ A;  5BUZ A;  3LVR E;  3RO3 A;  3E34 A;  3AG3 E;  3APF A;  3BG0 B;  2QC9 A;  3Q15 A;  4YDY A;  1OWL A;  3C5R A;  2RKK A;  2NC9 A;  3CVQ A;  3PRZ A;  2H6H A;  4F1S A;  3GZ2 A;  2IO3 C;  1BI7 B;  3UMV A; 
#chains in the Genus database with same CATH homology
 1OCR E;  1OCO E;  3AG3 E;  5B3S E;  3ABK E;  5IY5 E;  3AG1 E;  3AG2 E;  3AG4 E;  2ZXW E;  3ASN E;  3ASO E;  2EIK E;  1OCZ E;  1OCC E;  2EIM E;  2OCC E;  5B1B E;  1V55 E;  3ABL E;  5B1A E;  2DYR E;  1V54 E;  3WG7 E;  2EIL E;  2EIN E;  2Y69 E;  3ABM E;  2DYS E;  2EIJ E;  3X2Q E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...