3X2QE

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
b'HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3x2qE00
5B3SE 1OCOE 1OCCE 3ASOE 5B1AE 2EILE 3ABLE 2EIKE 3WG7E 3X2QE 3AG4E 1OCRE 2EIME 2Y69E 3ABME 3AG1E 1V55E 1V54E 2ZXWE 3ASNE 2DYRE 2EINE 1OCZE 5IY5E 5B1BE 3AG3E 2OCCE 3AG2E 3ABKE 2DYSE 2EIJE
chains in the Genus database with same CATH superfamily
3HXBA 5ENTD 4U63A 3BG1B 5FTPA 1OCRE 2JLBA 3QOUA 2ZXWE 4FJZA 4N2SA 4TUMA 4CDMA 3ZEFA 2VQ2A 2KBXA 3RK6A 5ENSD 1UOHA 3ZFWA 2WXMA 4AOFA 4GMLA 4M7CA 5FIOA 3JQ1A 3FUEA 2A4ZA 3D9PA 2J8SD 2I6HA 3JCKC 3JYSA 2FEZA 4BX8A 4ILHB 3KSQA 2LSVA 5AYWD 4A1SA 3OXFA 2NYJA 3PEVB 1Z3XA 1TNZA 2ZGGA 2CFUA 5FQ6A 3EU5A 4B89A 2I2OA 1A5EA 4UI9K 4WNEA 4FLHA 3RJVA 4GA2A 4A1GA 2CG2A 3IHVA 3ZYMA 4CYMD 4G26A 4B94A 5ARFA 5B3SE 3GW4A 4KZCA 3S7DA 4MLPA 3CLJA 1HXIA 4BWRA 4A3VA 3UT7A 4FHJA 1HE8A 1N9AA 3W9FA 2V5QC 4K03A 5JJ7A 5C2YA 5KJNA 3KEZA 2IEJA 2J4BA 4XI9A 2L9BA 3UM3A 3EHQA 4I43A 3U64A 3ZHEB 1OXJA 2C2LA 2V4HC 3CSTA 3TWTA 3VLDA 2NSZA 2J07A 2J09A 4WNFA 2HR2A 3R9MA 4EQFA 3LEWA 3ESKA 1OT8A 4F7AA 3LKUA 4ANWA 3CSFA 3X2QE 3C3OA 2KM4A 3HIZA 3Q9UC 3N71A 1FVHA 1H2TC 3Q9NC 2X6HA 4O1OA 2AVPA 2ONDA 4HOUA 3CVYA 2NXPA 4JHKA 1OCOE 1OCCE 5CHEE 4ACKA 3DSWA 4JL0A 4Q94A 4UWFA 2C0LA 4Q69A 5ENQD 4U07A 4XZ4A 3Q7AA 3FH8A 3ZXSA 4UI9C 4ILIA 1U3DA 4WNGA 4N3AA 3MA5A 5KJKA 3F6QA 3UI2A 4CT4A 1ZB1A 4R7LA 4NQ0A 3D3MA 1Y6IA 4EBAA 3ZPJA 4QFVA 2WQHA 1D8EA 4DX6D 3QARA 3D9OA 2LAHA 4PS8A 4F1SA 3RSEG 2Y0BG 5LX8A 1AWCB 2HM8A 4IYPA 5EX0A 3NZUA 4G8KA 3CVLA 4AXHA 5IY5E 4K0RA 5ENNA 1MYOA 5C1DA 2XZDG 1H6OA 2VSOE 1P5QA 4BTAA 2WXPA 4L7TA 2LXMA 4I6EA 4DX5D 1N4SA 2R17C 3HXEA 3CKCA 4U0UA 1LD7A 4U8HA 3BG0B 3ZNGA 2QYJA 2H6IA 1H6KA 3TG5A 3UKUG 3G2VA 4UQZA 4AP2A 2XEHA 3D9LA 3UINC 4J8SA 2VSYA 3PH0C 2GRRB 2LXLA 3QWWA 3FTVA 3S7BA 1IHBA 3B7SA 3HYMB 3TG4A 2FULA 2EQXA 2OCCE 4JZYA 2KCVA 3EIJA 5KJLA 5HKPA 4FC8A 3RO3A 1BI7B 2AWIA 3SD5A 4J8EA 2KZTA 3SF4A 3T9KA 1ZU2A 3IXEA 4U0ZA 3AU4A 4KVOA 3ASNE 3TWQA 5JHBA 3TWWA 4MRUA 5BT1A 1JCQA 1E90A 2IOLA 4G11A 2WMNA 3LVRE 1HF8A 4PS7A 3CHSA 3FU6A 1V54E 5AARA 5FQ4A 2XCCA 2WXLA 1K3ZD 1N54A 4I2WA 2P9LG 2XEVA 4LEUA 5B1BE 5FZQA 1INZA 4N39A 5CERB 4HB5A 3B7UX 2P9IG 4I17A 3ZUVB 2AXVA 3AS5A 4TV3A 2WQ6A 2QYUA 1EYHA 1HZ4A 1S70B 3FH5A 3SI5A 4X8QA 5LCWJ 4HNAD 5JMND 3Q47B 4XKBA 4HS2A 3DSXA 2KC7A 3MJWA 4AEZC 4Y6CA 5BXOA 3PE4A 4AIFA 3L82A 4PS3A 3C72A 3D9HA 4GTOA 3FU5A 1OCZE 4AV7A 1TN6A 1KT1A 2VYIA 1H2UA 5EKQD 4V3IA 2KXPC 4CEMA 3K9IA 2KATA 2J49A 5D2MC 3APFA 3FH7A 2LO6A 3RRNB 1DNPA 4IN3B 4PH4B 3ZYLA 4YVQC 4KXKB 4Q96A 3MKQA 2P2CP 3AG2E 4U7EB 4B93B 2PQRA 2VSNA 2J9QA 4GB9A 3SZ7A 2L6BA 3AJIA 3UIOC 4JD2G 5LOZA 4ME2A 3G2UA 1E8YA 5FINA 1HFAA 5BV0A 3RRUA 3U66A 1TNYA 1ELWA 4UWKA 3TWVA 5BW8C 4ZFHA 1TR4A 3OXLA 3ABLE 3SFYA 5T8IA 3Q78A 2EIME 3SFZA 1NL4A 5KNGA 3E30A 2PM7A 1JPLA 2WXGA 2OOEA 3ZGQA 5H7PA 4GA0A 3LXUX 3EHMA 3HRAA 4FU3A 3MEKA 3MZLB 2JABA 4N5QA 3UM0A 3FTSA 3CVNA 3DWLG 2IJGX 2JEKA 4E85A 2AJAA 5FQ7A 3TWSA 4IULA 3ENEA 3ONKA 2DYSE 4ANVA 1FCHA 3DSUA 4HLLA 2I9CA 3P2BA 1S63A 3PZ4A 4RVBA 5EIBE 2J4DA 2IU1A 5FWQA 3AAAC 4GU5A 4XIFA 5AENA 3FTYA 3ZXPA 3FUJA 2IOSA 1XGWA 4EPZA 3JUEA 3VTYA 1ZBPA 3S7JA 3JXIA 1RZ4A 2ETCA 4DX2A 4BT9A 4LNGA 3LCAA 3DXMG 4DPRA 5CBOA 3GZ1A 4GA1A 3UTMA 3ASHA 4N5CA 3MCXA 4BETA 2VGEA 3FU0A 3UUXA 3FU3A 1QBQA 3C98A 3IHYA 2XPIA 4OAVB 2XRZA 4CDNA 1MX2A 2Y1LE 3ULYA 1TNUA 4RG6A 1Z5SC 3LPZA 3BEEA 1E96B 2MOWA 4TXQA 4CGVA 2WXOA 4GTRA 3PS6A 1OWOA 5A6CA 5ENOD 2FF4A 3KD7A 4L23A 4FADA 3AS4A 1O5MA 3ASDA 3EHNA 3SBSA 3S2AA 2R59A 1E8XA 4D10C 4GPMA 1FVFA 4EECA 3L6AA 3CHMA 2E2EA 1YMPA 3L13A 3PZ2A 4UI9J 4HFGA 2YNQA 3SO8A 4GZDA 3LJ3A 3Q15A 2R2LA 3C3QA 3C5RA 2AXUA 1JCSA 3CK9A 2P9PG 3IEGA 5FQ8A 3NOCD 4KYOB 3T8KA 1EDUA 5BXUA 1SQMA 1FPPA 5AIJA 3Q7FA 1KT0A 2LUHA 1N0RA 1TEZA 2XRYA 5FJYA 4URKA 3MGBA 1Z3YA 3TJPA 4HRMB 3E37A 1G3NB 2KZTB 5D0QD 2PQNA 4AY6A 4WWOA 2FO1E 5G2NA 1E7VA 2EIJE 2QC9A 4A3TA 3DEOA 1QZ2A 2X6IA 1TJFA 5HI7A 2ETBA 5AJLA 4L9PA 3ULEG 2DZOA 2MYOA 4ATGA 2WXQA 1SW6A 5LFAA 2VSXE 4N2QA 3HXDA 1FT2A 1L5JA 3ZRHA 3LY9A 4HXIA 2Y3AA 3B13A 2XCBA 1Q2ZA 3SFXA 2WM9A 3GZ2A 4ANUA 5AQAA 5JA4D 3FP3A 2RKKA 3I4GA 1NFIE 2P9NG 1S0PA 3HG0D 1KLXA 2H6FA 1Y8MA 1IKND 4GTMA 1MX4A 3L22A 4NRHB 4HOTA 4UQYA 5AQBA 5DBKA 5ANRA 3TL5A 1OY3D 1IQRA 4J6IA 4UWHA 1QNFA 2DVWA 4WUYA 2QY7A 4DRXE 4GTPA 3V2XA 2DIWA 1BI8B 3TXMA 2VGXB 4BFRA 1DC2A 2ZGDA 3Q79A 1UJKA 4F1PA 4GCNA 3HVEB 2F0YA 2RD0A 1FT1A 3CVQA 1OWMA 4RQIA 3D9NA 2IQCA 1EF1C 3FY4A 3QJZA 1N4PA 4ABNA 4KT6B 1GW6A 5KCMA 1WM5A 2QFCA 5CRUA 1NI1A 1N11A 4GYOA 4P29A 3ONLA 3R7RA 2XPYA 3QKYA 3MV2B 5HS0A 3NB2A 5CMWA 1NA3A 5CEAA 3PRZA 4K5AB 2ZU6B 3FUMA 1O1SA 3NF1A 2IO2C 4J7WA 4OVUA 4I6GA 3BU8A 3CV0A 5CRVA 2X6KA 1HX8A 2VTBB 2PZIA 2AW6A 4DLQA 2BKKB 3CVVA 3PZ1A 3R9AB 3DSVA 3NQPA 3QAQA 4JW1A 3KS2A 3CHOA 3V79K 4WWNA 1WG0A 3T5VA 2FO7A 3FTZA 2P9UG 1MJ0A 5ENRD 1NA0A 3FEXA 2P9KG 5G04J 1PC2A 3MYVA 3CGHA 1TYQG 3OTNA 3B7BA 3CHPA 2L6JA 3KAEA 3SNXA 3MX3A 2IONA 3WXXA 1D9SA 2WVIA 3D9IA 4MS6A 4ZHBA 3G2TA 2IY0C 3FEYA 4HORA 3T5XA 1OWLA 4U8YD 4U96D 3UXGA 5CECB 3ML8A 1MZCA 1TNOA 5CCMA 3FDHA 3PZ3A 1H6PA 1N95A 2HYZA 3L16A 3TGOA 5EIDA 4JEHA 4RSYA 2WQ7A 1UG3A 3QDNA 2XEEA 3J5PA 2YHEA 3Q5MA 2RG8A 2R02A 3UT4A 5AAOA 2RFMA 3APCA 4LERA 3I4RB 2KCLA 3E34A 2VJ8A 1N52A 5J08A 4C9BB 4I1MA 1N0QA 5EX3A 5JJ6A 3QK0A 4GZ3A 2YQ8A 4HI9A 2ZIRA 3CHQA 4PDXA 2PNNA 3AG4E 4U95D 3FUNA 4G8LA 5J90A 4JXTA 5G04C 3JQ0A 1N4RA 3BUAA 5AQ9A 3ZW3A 2I1JA 4OVVA 1Z6TA 4LUNU 4XE0A 3SHFA 2B0OE 1WY6A 2V5FA 1BU9A 1QQEA 3CIAA 4HVBA 5G05J 4L2LA 3ZN3A 2FBNA 2B6CA 4BEPA 4C0MA 1BPOA 2BUGA 3V2OA 4RG9A 4Z68A 4LNBA 1JUQA 3D9MA 4LNUD 2FI7A 1TNBA 5EN5D 2V4LA 4KMOA 4GYYA 3HHMA 1SZAA 3UQ3A 4JC8A 3FWVA 1OWNA 4EZKA 3G2WA 2L0TB 3NAWA 3FULA 4O60A 3EDTB 3PNTB 3PE3A 2V8SE 4XEIG 2GW1A 3CK7A 1QYMA 5T3RA 4CT0A 3CR3A 4EZJA 4BSXA 3TWUA 3QNKA 3BQOA 4GTSA 5KBAA 1KZPA 4DI4A 2YHCA 1PY1A 4YVOA 5HQ8A 2MRIA 4HLEA 2WXJA 4JHJA 3NOGD 4WAFA 2XENA 4NIKA 1YCSB 2XQ0A 1W3BA 2UY1A 3O48A 3FFLA 4AM9A 3CVWA 3PZDA 1IXVA 4UWGA 1NZNA 4G25A 4U8VD 2PL2A 4Y6WA 2HO1A 2LNIA 4G2VA 1LF8A 4TUUA 4F53A 2XS8A 5D0OD 1O1TA 3LJNA 3Q4AB 3UPVA 4EBAG 4GMRA 2P9SG 1E8ZA 3ZKJA 4HRLA 5G05C 2CG3A 4M3OA 5E76A 1N94A 3QWVA 4B8AA 3AS8A 3KEAA 3ULQA 4UUCA 1H2VC 4K5CA 3J5QB 5B1AE 1ELKA 2GRLA 2J08A 3ZYQA 3VLFA 4DI3A 1H0AA 2WPVA 4L2YA 4YDOA 1YA0A 5CMYA 3DSTA 3U4TA 4CRWA 1KPSB 2BTDA 1EPUA 2XZTG 3PEUB 3MKRA 1SA4A 3WG7E 2V0PA 2C0MA 2ZISA 4EHMA 4KVMA 3IKOB 4YDEA 2DWZA 4MBGA 5A23A 4GPKA 2XGSA 4WWPA 4G24A 3T8MA 2X6JA 5D66A 4FLBA 3ASOE 1TJCA 1K1AA 3TWRA 4GAAA 1A17A 3UX4A 3QC1A 4ANXA 4B0ZA 2IFUA 4H7XA 4C0EA 1HG5A 4GTVA 2CHZA 3OAWA 5M72A 4H7YA 4A63B 3V31A 3W9GA 5ARGA 3ESLA 1E8WA 2XPZA 4AJWA 4LSZE 1MX6A 2QZAA 2LSUA 2WXFA 4GTTA 4BY6A 3EUVA 5ITZF 2RFAA 2BKGA 3Q49B 2E0IA 3DRAA 4GCOA 1K1BA 2A5EA 3EU9A 3L08A 4IRUA 2X3MA 3NZSA 4DUIA 1X5BA 3JUIA 1LD8A 1E7UA 1K8KG 3LYAA 3O4ZA 3UM1A 2GRNB 4OAUC 2LAIA 4CDRA 4GTQA 5BV1A 5FT9A 5FZSA 2KCKA 2OEVA 2GGFA 2CHXA 3Q73A 4LCTA 3DXKG 1B89A 5KNHD 4FJYA 1RW2A 4DX7D 3DPYA 2DZNA 3CEQA 4XI0A 3CQGB 2PM6A 3TWXA 4APOA 2WXNA 3JXJA 3UMVA 4GYWA 4J8YA 2H6HA 5FZRA 4UQXA 2XGMA 3GYZA 3I5PA 4JPSA 4NURA 3FUFA 2R5SA 2DCPA 1HH8A 4TRQA 2MHKA 5G55A 3D9JA 4YDWA 4ATZD 1IYGA 2EILE 4PUCA 3IBEA 2Y4UA 3RKVA 3NBNB 3URZA 3RIBA 4TXRA 2VGYA 5LP0A 2GRQB 4ACLA 3R7QA 5AJDA 3DEPA 4GMJA 4XX5A 3TXNA 5HRYA 2XHEA 2HE0A 1PAQA 3ZYKA 4J8FA 1LTXA 2NC9A 3UM2A 4O6FA 1DCQA 2BEDA 4J8DA 4CZ2D 2YINA 2WXIA 3D9KA 5JJTA 3S7FA 5BNWA 4YNDA 4L1BA 4BESA 2R05A 2IF4A 1HS6A 3B95A 4EZLA 4HQDA 4C48B 2Q7FA 5AQ7A 2WMOA 1D8DA 3MKQB 1ELRA 1U2VG 4XKCA 3SGHA 1UN9A 5CEDB 2R03A 3ASFA 4DLOA 2CHWA 3C3RA 4WNDA 4A55A 3U9WA 2ETAA 3RO2A 2WXHA 2I1KA 2ILRA 3UIPC 3AG1E 5KJMA 4JA9A 3KSLA 4BX9A 4I9CA 3LVQE 2OVBA 4BTBA 4BT8A 1KZOA 3CKBA 1XNFA 3LS8A 4BSZB 4N3BA 4YDYA 3FUDA 4APFA 1YYHA 4AY5A 3EIQC 4HI8A 3E32A 4I9EA 3ZVVA 3Q75A 4I2ZA 4N3CA 3FTUA 1BLXB 2UY1B 4I1AA 3IV0A 1HG2A 1JWFA 4I6JA 5T4YA 3ZU7B 5BPPA 4UWLA 4U04A 3SBTB 3DPDA 1HO8A 2CFZA 3L54A 3B7RL 5KWDA 3PUKA 2F8XK 5EYLA 5EILA 2XGOA 2UWJG 4U0SA 2DBAA 3HDXA 2H6GA 5BUZA 3UKRG 3ZHEA 2F8YA 3RAUA 1X81A 1TN8A 1HU3A 3PNLB 3TAXA 5ENPD 1O1RA 1UW4B 1UN8A 1IHGA 2BF0X 1S64A 4HBDA 4JB8P 5E75A 4F3VA 1SA5A 4BERA 3ABKE 5EDSA 3QB2A 1DCEA 4AVXA 1OUVA 4RLYA 3AU5A 3L9TA 4J0UA 4FP7A 1IQUA 3HXFA 3U3WA 1V55E 4DJAA 3SQVA 1WDYA 4JEUA 4GZCA 4HOSA 3G2SA 3VTXA 3GZSA 3RRMB 3I3NA 3LY8A 3UT8A 3PUJA 1U3CA 4KZ0A 1AP7A 2EINE 4DK5A 3ISMC 4FA6A 3VLEA 3P1UA 3ASGA 4GZ6A 4NACA 3PVLA 1UJJA 3SY2A 5EYPF 3CK8A 5CBNA 2WB2A 1NP7A 4FULA 4GZ5A 4JA7A 4G23A 2M63A 1SVXA 2IO3C 5DIZA 3CVUA 3B7TA 4KBQA 2AXZA 4CCAA 3LDZA 3OXGA 3APDA 1SZ9A 4W9RA 4JHRA 2VGXA 4K5BA 3PDNA 3CHRA 1H19A 5ANLA 3HVEA 1DVPA 1OWPA 3L17A 3CVXA 1MQSA 1JCRA 3MV3B 4MKTA 3AG3E 3V30A 2XS1A 4F6RD 3QWPA 4E6HA 2Y69E 3ABME 3FUKA 2F37A 3E4BA 1BD8A 3FTXA 2GRPB 3ZIMA 2OEWA 2WXRA 3DBSA 1TN7A 3HXCA 3CVPA 4OYSA 4O1PA 2EIKE 3FUIA 3FUHA 5LCWC 2VTBA 2GROB 5AN8A 4JVSA 1N4QA 4HOQA 2DYRE 4TXPA 2L0IA 3DSSA 3E33A 2X6FA 5JHAA 4I1OB 1WAO1 1MHQA 4DX1A 3LY7A 4HRNA 4LRZA 2Y4TA 4ILGA 4LG6A 5CCLA 2GRMA 2X38A 1JWGA 3FHEA 4B8CB 3FTWA 3CQCB 5A7DB 3RU0A 4FHKA 3PREA 4QQIA 4CGWA 2P58C 2OVFA 2WXKA 1VDYA 4G1TA 3EHRA 2OV8A 2A5UA 3EJNA 3ML9A
chains in the Genus database with same CATH topology
5B3SE 1OCOE 1OCCE 3ASOE 5B1AE 2EILE 3ABLE 2EIKE 3WG7E 3X2QE 3AG4E 1OCRE 2EIME 2Y69E 3ABME 3AG1E 1V55E 1V54E 2ZXWE 3ASNE 2DYRE 2EINE 1OCZE 5IY5E 5B1BE 3AG3E 2OCCE 3AG2E 3ABKE 2DYSE 2EIJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B3S E;  1OCO E;  1OCC E;  3ASO E;  5B1A E;  2EIL E;  3ABL E;  2EIK E;  3WG7 E;  3X2Q E;  3AG4 E;  1OCR E;  2EIM E;  2Y69 E;  3ABM E;  3AG1 E;  1V55 E;  1V54 E;  2ZXW E;  3ASN E;  2DYR E;  2EIN E;  1OCZ E;  5IY5 E;  5B1B E;  3AG3 E;  2OCC E;  3AG2 E;  3ABK E;  2DYS E;  2EIJ E; 
#chains in the Genus database with same CATH topology
 3HXB A;  5ENT D;  4U63 A;  3BG1 B;  5FTP A;  1OCR E;  2JLB A;  3QOU A;  2ZXW E;  4FJZ A;  4N2S A;  4TUM A;  4CDM A;  3ZEF A;  2VQ2 A;  2KBX A;  3RK6 A;  5ENS D;  1UOH A;  3ZFW A;  2WXM A;  4AOF A;  4GML A;  4M7C A;  5FIO A;  3JQ1 A;  3FUE A;  2A4Z A;  3D9P A;  2J8S D;  2I6H A;  3JCK C;  3JYS A;  2FEZ A;  4BX8 A;  4ILH B;  3KSQ A;  2LSV A;  5AYW D;  4A1S A;  3OXF A;  2NYJ A;  3PEV B;  1Z3X A;  1TNZ A;  2ZGG A;  2CFU A;  5FQ6 A;  3EU5 A;  4B89 A;  2I2O A;  1A5E A;  4UI9 K;  4WNE A;  4FLH A;  3RJV A;  4GA2 A;  4A1G A;  2CG2 A;  3IHV A;  3ZYM A;  4CYM D;  4G26 A;  4B94 A;  5ARF A;  5B3S E;  3GW4 A;  4KZC A;  3S7D A;  4MLP A;  3CLJ A;  1HXI A;  4BWR A;  4A3V A;  3UT7 A;  4FHJ A;  1HE8 A;  1N9A A;  3W9F A;  2V5Q C;  4K03 A;  5JJ7 A;  5C2Y A;  5KJN A;  3KEZ A;  2IEJ A;  2J4B A;  4XI9 A;  2L9B A;  3UM3 A;  3EHQ A;  4I43 A;  3U64 A;  3ZHE B;  1OXJ A;  2C2L A;  2V4H C;  3CST A;  3TWT A;  3VLD A;  2NSZ A;  2J07 A;  2J09 A;  4WNF A;  2HR2 A;  3R9M A;  4EQF A;  3LEW A;  3ESK A;  1OT8 A;  4F7A A;  3LKU A;  4ANW A;  3CSF A;  3X2Q E;  3C3O A;  2KM4 A;  3HIZ A;  3Q9U C;  3N71 A;  1FVH A;  1H2T C;  3Q9N C;  2X6H A;  4O1O A;  2AVP A;  2OND A;  4HOU A;  3CVY A;  2NXP A;  4JHK A;  1OCO E;  1OCC E;  5CHE E;  4ACK A;  3DSW A;  4JL0 A;  4Q94 A;  4UWF A;  2C0L A;  4Q69 A;  5ENQ D;  4U07 A;  4XZ4 A;  3Q7A A;  3FH8 A;  3ZXS A;  4UI9 C;  4ILI A;  1U3D A;  4WNG A;  4N3A A;  3MA5 A;  5KJK A;  3F6Q A;  3UI2 A;  4CT4 A;  1ZB1 A;  4R7L A;  4NQ0 A;  3D3M A;  1Y6I A;  4EBA A;  3ZPJ A;  4QFV A;  2WQH A;  1D8E A;  4DX6 D;  3QAR A;  3D9O A;  2LAH A;  4PS8 A;  4F1S A;  3RSE G;  2Y0B G;  5LX8 A;  1AWC B;  2HM8 A;  4IYP A;  5EX0 A;  3NZU A;  4G8K A;  3CVL A;  4AXH A;  5IY5 E;  4K0R A;  5ENN A;  1MYO A;  5C1D A;  2XZD G;  1H6O A;  2VSO E;  1P5Q A;  4BTA A;  2WXP A;  4L7T A;  2LXM A;  4I6E A;  4DX5 D;  1N4S A;  2R17 C;  3HXE A;  3CKC A;  4U0U A;  1LD7 A;  4U8H A;  3BG0 B;  3ZNG A;  2QYJ A;  2H6I A;  1H6K A;  3TG5 A;  3UKU G;  3G2V A;  4UQZ A;  4AP2 A;  2XEH A;  3D9L A;  3UIN C;  4J8S A;  2VSY A;  3PH0 C;  2GRR B;  2LXL A;  3QWW A;  3FTV A;  3S7B A;  1IHB A;  3B7S A;  3HYM B;  3TG4 A;  2FUL A;  2EQX A;  2OCC E;  4JZY A;  2KCV A;  3EIJ A;  5KJL A;  5HKP A;  4FC8 A;  3RO3 A;  1BI7 B;  2AWI A;  3SD5 A;  4J8E A;  2KZT A;  3SF4 A;  3T9K A;  1ZU2 A;  3IXE A;  4U0Z A;  3AU4 A;  4KVO A;  3ASN E;  3TWQ A;  5JHB A;  3TWW A;  4MRU A;  5BT1 A;  1JCQ A;  1E90 A;  2IOL A;  4G11 A;  2WMN A;  3LVR E;  1HF8 A;  4PS7 A;  3CHS A;  3FU6 A;  1V54 E;  5AAR A;  5FQ4 A;  2XCC A;  2WXL A;  1K3Z D;  1N54 A;  4I2W A;  2P9L G;  2XEV A;  4LEU A;  5B1B E;  5FZQ A;  1INZ A;  4N39 A;  5CER B;  4HB5 A;  3B7U X;  2P9I G;  4I17 A;  3ZUV B;  2AXV A;  3AS5 A;  4TV3 A;  2WQ6 A;  2QYU A;  1EYH A;  1HZ4 A;  1S70 B;  3FH5 A;  3SI5 A;  4X8Q A;  5LCW J;  4HNA D;  5JMN D;  3Q47 B;  4XKB A;  4HS2 A;  3DSX A;  2KC7 A;  3MJW A;  4AEZ C;  4Y6C A;  5BXO A;  3PE4 A;  4AIF A;  3L82 A;  4PS3 A;  3C72 A;  3D9H A;  4GTO A;  3FU5 A;  1OCZ E;  4AV7 A;  1TN6 A;  1KT1 A;  2VYI A;  1H2U A;  5EKQ D;  4V3I A;  2KXP C;  4CEM A;  3K9I A;  2KAT A;  2J49 A;  5D2M C;  3APF A;  3FH7 A;  2LO6 A;  3RRN B;  1DNP A;  4IN3 B;  4PH4 B;  3ZYL A;  4YVQ C;  4KXK B;  4Q96 A;  3MKQ A;  2P2C P;  3AG2 E;  4U7E B;  4B93 B;  2PQR A;  2VSN A;  2J9Q A;  4GB9 A;  3SZ7 A;  2L6B A;  3AJI A;  3UIO C;  4JD2 G;  5LOZ A;  4ME2 A;  3G2U A;  1E8Y A;  5FIN A;  1HFA A;  5BV0 A;  3RRU A;  3U66 A;  1TNY A;  1ELW A;  4UWK A;  3TWV A;  5BW8 C;  4ZFH A;  1TR4 A;  3OXL A;  3ABL E;  3SFY A;  5T8I A;  3Q78 A;  2EIM E;  3SFZ A;  1NL4 A;  5KNG A;  3E30 A;  2PM7 A;  1JPL A;  2WXG A;  2OOE A;  3ZGQ A;  5H7P A;  4GA0 A;  3LXU X;  3EHM A;  3HRA A;  4FU3 A;  3MEK A;  3MZL B;  2JAB A;  4N5Q A;  3UM0 A;  3FTS A;  3CVN A;  3DWL G;  2IJG X;  2JEK A;  4E85 A;  2AJA A;  5FQ7 A;  3TWS A;  4IUL A;  3ENE A;  3ONK A;  2DYS E;  4ANV A;  1FCH A;  3DSU A;  4HLL A;  2I9C A;  3P2B A;  1S63 A;  3PZ4 A;  4RVB A;  5EIB E;  2J4D A;  2IU1 A;  5FWQ A;  3AAA C;  4GU5 A;  4XIF A;  5AEN A;  3FTY A;  3ZXP A;  3FUJ A;  2IOS A;  1XGW A;  4EPZ A;  3JUE A;  3VTY A;  1ZBP A;  3S7J A;  3JXI A;  1RZ4 A;  2ETC A;  4DX2 A;  4BT9 A;  4LNG A;  3LCA A;  3DXM G;  4DPR A;  5CBO A;  3GZ1 A;  4GA1 A;  3UTM A;  3ASH A;  4N5C A;  3MCX A;  4BET A;  2VGE A;  3FU0 A;  3UUX A;  3FU3 A;  1QBQ A;  3C98 A;  3IHY A;  2XPI A;  4OAV B;  2XRZ A;  4CDN A;  1MX2 A;  2Y1L E;  3ULY A;  1TNU A;  4RG6 A;  1Z5S C;  3LPZ A;  3BEE A;  1E96 B;  2MOW A;  4TXQ A;  4CGV A;  2WXO A;  4GTR A;  3PS6 A;  1OWO A;  5A6C A;  5ENO D;  2FF4 A;  3KD7 A;  4L23 A;  4FAD A;  3AS4 A;  1O5M A;  3ASD A;  3EHN A;  3SBS A;  3S2A A;  2R59 A;  1E8X A;  4D10 C;  4GPM A;  1FVF A;  4EEC A;  3L6A A;  3CHM A;  2E2E A;  1YMP A;  3L13 A;  3PZ2 A;  4UI9 J;  4HFG A;  2YNQ A;  3SO8 A;  4GZD A;  3LJ3 A;  3Q15 A;  2R2L A;  3C3Q A;  3C5R A;  2AXU A;  1JCS A;  3CK9 A;  2P9P G;  3IEG A;  5FQ8 A;  3NOC D;  4KYO B;  3T8K A;  1EDU A;  5BXU A;  1SQM A;  1FPP A;  5AIJ A;  3Q7F A;  1KT0 A;  2LUH A;  1N0R A;  1TEZ A;  2XRY A;  5FJY A;  4URK A;  3MGB A;  1Z3Y A;  3TJP A;  4HRM B;  3E37 A;  1G3N B;  2KZT B;  5D0Q D;  2PQN A;  4AY6 A;  4WWO A;  2FO1 E;  5G2N A;  1E7V A;  2EIJ E;  2QC9 A;  4A3T A;  3DEO A;  1QZ2 A;  2X6I A;  1TJF A;  5HI7 A;  2ETB A;  5AJL A;  4L9P A;  3ULE G;  2DZO A;  2MYO A;  4ATG A;  2WXQ A;  1SW6 A;  5LFA A;  2VSX E;  4N2Q A;  3HXD A;  1FT2 A;  1L5J A;  3ZRH A;  3LY9 A;  4HXI A;  2Y3A A;  3B13 A;  2XCB A;  1Q2Z A;  3SFX A;  2WM9 A;  3GZ2 A;  4ANU A;  5AQA A;  5JA4 D;  3FP3 A;  2RKK A;  3I4G A;  1NFI E;  2P9N G;  1S0P A;  3HG0 D;  1KLX A;  2H6F A;  1Y8M A;  1IKN D;  4GTM A;  1MX4 A;  3L22 A;  4NRH B;  4HOT A;  4UQY A;  5AQB A;  5DBK A;  5ANR A;  3TL5 A;  1OY3 D;  1IQR A;  4J6I A;  4UWH A;  1QNF A;  2DVW A;  4WUY A;  2QY7 A;  4DRX E;  4GTP A;  3V2X A;  2DIW A;  1BI8 B;  3TXM A;  2VGX B;  4BFR A;  1DC2 A;  2ZGD A;  3Q79 A;  1UJK A;  4F1P A;  4GCN A;  3HVE B;  2F0Y A;  2RD0 A;  1FT1 A;  3CVQ A;  1OWM A;  4RQI A;  3D9N A;  2IQC A;  1EF1 C;  3FY4 A;  3QJZ A;  1N4P A;  4ABN A;  4KT6 B;  1GW6 A;  5KCM A;  1WM5 A;  2QFC A;  5CRU A;  1NI1 A;  1N11 A;  4GYO A;  4P29 A;  3ONL A;  3R7R A;  2XPY A;  3QKY A;  3MV2 B;  5HS0 A;  3NB2 A;  5CMW A;  1NA3 A;  5CEA A;  3PRZ A;  4K5A B;  2ZU6 B;  3FUM A;  1O1S A;  3NF1 A;  2IO2 C;  4J7W A;  4OVU A;  4I6G A;  3BU8 A;  3CV0 A;  5CRV A;  2X6K A;  1HX8 A;  2VTB B;  2PZI A;  2AW6 A;  4DLQ A;  2BKK B;  3CVV A;  3PZ1 A;  3R9A B;  3DSV A;  3NQP A;  3QAQ A;  4JW1 A;  3KS2 A;  3CHO A;  3V79 K;  4WWN A;  1WG0 A;  3T5V A;  2FO7 A;  3FTZ A;  2P9U G;  1MJ0 A;  5ENR D;  1NA0 A;  3FEX A;  2P9K G;  5G04 J;  1PC2 A;  3MYV A;  3CGH A;  1TYQ G;  3OTN A;  3B7B A;  3CHP A;  2L6J A;  3KAE A;  3SNX A;  3MX3 A;  2ION A;  3WXX A;  1D9S A;  2WVI A;  3D9I A;  4MS6 A;  4ZHB A;  3G2T A;  2IY0 C;  3FEY A;  4HOR A;  3T5X A;  1OWL A;  4U8Y D;  4U96 D;  3UXG A;  5CEC B;  3ML8 A;  1MZC A;  1TNO A;  5CCM A;  3FDH A;  3PZ3 A;  1H6P A;  1N95 A;  2HYZ A;  3L16 A;  3TGO A;  5EID A;  4JEH A;  4RSY A;  2WQ7 A;  1UG3 A;  3QDN A;  2XEE A;  3J5P A;  2YHE A;  3Q5M A;  2RG8 A;  2R02 A;  3UT4 A;  5AAO A;  2RFM A;  3APC A;  4LER A;  3I4R B;  2KCL A;  3E34 A;  2VJ8 A;  1N52 A;  5J08 A;  4C9B B;  4I1M A;  1N0Q A;  5EX3 A;  5JJ6 A;  3QK0 A;  4GZ3 A;  2YQ8 A;  4HI9 A;  2ZIR A;  3CHQ A;  4PDX A;  2PNN A;  3AG4 E;  4U95 D;  3FUN A;  4G8L A;  5J90 A;  4JXT A;  5G04 C;  3JQ0 A;  1N4R A;  3BUA A;  5AQ9 A;  3ZW3 A;  2I1J A;  4OVV A;  1Z6T A;  4LUN U;  4XE0 A;  3SHF A;  2B0O E;  1WY6 A;  2V5F A;  1BU9 A;  1QQE A;  3CIA A;  4HVB A;  5G05 J;  4L2L A;  3ZN3 A;  2FBN A;  2B6C A;  4BEP A;  4C0M A;  1BPO A;  2BUG A;  3V2O A;  4RG9 A;  4Z68 A;  4LNB A;  1JUQ A;  3D9M A;  4LNU D;  2FI7 A;  1TNB A;  5EN5 D;  2V4L A;  4KMO A;  4GYY A;  3HHM A;  1SZA A;  3UQ3 A;  4JC8 A;  3FWV A;  1OWN A;  4EZK A;  3G2W A;  2L0T B;  3NAW A;  3FUL A;  4O60 A;  3EDT B;  3PNT B;  3PE3 A;  2V8S E;  4XEI G;  2GW1 A;  3CK7 A;  1QYM A;  5T3R A;  4CT0 A;  3CR3 A;  4EZJ A;  4BSX A;  3TWU A;  3QNK A;  3BQO A;  4GTS A;  5KBA A;  1KZP A;  4DI4 A;  2YHC A;  1PY1 A;  4YVO A;  5HQ8 A;  2MRI A;  4HLE A;  2WXJ A;  4JHJ A;  3NOG D;  4WAF A;  2XEN A;  4NIK A;  1YCS B;  2XQ0 A;  1W3B A;  2UY1 A;  3O48 A;  3FFL A;  4AM9 A;  3CVW A;  3PZD A;  1IXV A;  4UWG A;  1NZN A;  4G25 A;  4U8V D;  2PL2 A;  4Y6W A;  2HO1 A;  2LNI A;  4G2V A;  1LF8 A;  4TUU A;  4F53 A;  2XS8 A;  5D0O D;  1O1T A;  3LJN A;  3Q4A B;  3UPV A;  4EBA G;  4GMR A;  2P9S G;  1E8Z A;  3ZKJ A;  4HRL A;  5G05 C;  2CG3 A;  4M3O A;  5E76 A;  1N94 A;  3QWV A;  4B8A A;  3AS8 A;  3KEA A;  3ULQ A;  4UUC A;  1H2V C;  4K5C A;  3J5Q B;  5B1A E;  1ELK A;  2GRL A;  2J08 A;  3ZYQ A;  3VLF A;  4DI3 A;  1H0A A;  2WPV A;  4L2Y A;  4YDO A;  1YA0 A;  5CMY A;  3DST A;  3U4T A;  4CRW A;  1KPS B;  2BTD A;  1EPU A;  2XZT G;  3PEU B;  3MKR A;  1SA4 A;  3WG7 E;  2V0P A;  2C0M A;  2ZIS A;  4EHM A;  4KVM A;  3IKO B;  4YDE A;  2DWZ A;  4MBG A;  5A23 A;  4GPK A;  2XGS A;  4WWP A;  4G24 A;  3T8M A;  2X6J A;  5D66 A;  4FLB A;  3ASO E;  1TJC A;  1K1A A;  3TWR A;  4GAA A;  1A17 A;  3UX4 A;  3QC1 A;  4ANX A;  4B0Z A;  2IFU A;  4H7X A;  4C0E A;  1HG5 A;  4GTV A;  2CHZ A;  3OAW A;  5M72 A;  4H7Y A;  4A63 B;  3V31 A;  3W9G A;  5ARG A;  3ESL A;  1E8W A;  2XPZ A;  4AJW A;  4LSZ E;  1MX6 A;  2QZA A;  2LSU A;  2WXF A;  4GTT A;  4BY6 A;  3EUV A;  5ITZ F;  2RFA A;  2BKG A;  3Q49 B;  2E0I A;  3DRA A;  4GCO A;  1K1B A;  2A5E A;  3EU9 A;  3L08 A;  4IRU A;  2X3M A;  3NZS A;  4DUI A;  1X5B A;  3JUI A;  1LD8 A;  1E7U A;  1K8K G;  3LYA A;  3O4Z A;  3UM1 A;  2GRN B;  4OAU C;  2LAI A;  4CDR A;  4GTQ A;  5BV1 A;  5FT9 A;  5FZS A;  2KCK A;  2OEV A;  2GGF A;  2CHX A;  3Q73 A;  4LCT A;  3DXK G;  1B89 A;  5KNH D;  4FJY A;  1RW2 A;  4DX7 D;  3DPY A;  2DZN A;  3CEQ A;  4XI0 A;  3CQG B;  2PM6 A;  3TWX A;  4APO A;  2WXN A;  3JXJ A;  3UMV A;  4GYW A;  4J8Y A;  2H6H A;  5FZR A;  4UQX A;  2XGM A;  3GYZ A;  3I5P A;  4JPS A;  4NUR A;  3FUF A;  2R5S A;  2DCP A;  1HH8 A;  4TRQ A;  2MHK A;  5G55 A;  3D9J A;  4YDW A;  4ATZ D;  1IYG A;  2EIL E;  4PUC A;  3IBE A;  2Y4U A;  3RKV A;  3NBN B;  3URZ A;  3RIB A;  4TXR A;  2VGY A;  5LP0 A;  2GRQ B;  4ACL A;  3R7Q A;  5AJD A;  3DEP A;  4GMJ A;  4XX5 A;  3TXN A;  5HRY A;  2XHE A;  2HE0 A;  1PAQ A;  3ZYK A;  4J8F A;  1LTX A;  2NC9 A;  3UM2 A;  4O6F A;  1DCQ A;  2BED A;  4J8D A;  4CZ2 D;  2YIN A;  2WXI A;  3D9K A;  5JJT A;  3S7F A;  5BNW A;  4YND A;  4L1B A;  4BES A;  2R05 A;  2IF4 A;  1HS6 A;  3B95 A;  4EZL A;  4HQD A;  4C48 B;  2Q7F A;  5AQ7 A;  2WMO A;  1D8D A;  3MKQ B;  1ELR A;  1U2V G;  4XKC A;  3SGH A;  1UN9 A;  5CED B;  2R03 A;  3ASF A;  4DLO A;  2CHW A;  3C3R A;  4WND A;  4A55 A;  3U9W A;  2ETA A;  3RO2 A;  2WXH A;  2I1K A;  2ILR A;  3UIP C;  3AG1 E;  5KJM A;  4JA9 A;  3KSL A;  4BX9 A;  4I9C A;  3LVQ E;  2OVB A;  4BTB A;  4BT8 A;  1KZO A;  3CKB A;  1XNF A;  3LS8 A;  4BSZ B;  4N3B A;  4YDY A;  3FUD A;  4APF A;  1YYH A;  4AY5 A;  3EIQ C;  4HI8 A;  3E32 A;  4I9E A;  3ZVV A;  3Q75 A;  4I2Z A;  4N3C A;  3FTU A;  1BLX B;  2UY1 B;  4I1A A;  3IV0 A;  1HG2 A;  1JWF A;  4I6J A;  5T4Y A;  3ZU7 B;  5BPP A;  4UWL A;  4U04 A;  3SBT B;  3DPD A;  1HO8 A;  2CFZ A;  3L54 A;  3B7R L;  5KWD A;  3PUK A;  2F8X K;  5EYL A;  5EIL A;  2XGO A;  2UWJ G;  4U0S A;  2DBA A;  3HDX A;  2H6G A;  5BUZ A;  3UKR G;  3ZHE A;  2F8Y A;  3RAU A;  1X81 A;  1TN8 A;  1HU3 A;  3PNL B;  3TAX A;  5ENP D;  1O1R A;  1UW4 B;  1UN8 A;  1IHG A;  2BF0 X;  1S64 A;  4HBD A;  4JB8 P;  5E75 A;  4F3V A;  1SA5 A;  4BER A;  3ABK E;  5EDS A;  3QB2 A;  1DCE A;  4AVX A;  1OUV A;  4RLY A;  3AU5 A;  3L9T A;  4J0U A;  4FP7 A;  1IQU A;  3HXF A;  3U3W A;  1V55 E;  4DJA A;  3SQV A;  1WDY A;  4JEU A;  4GZC A;  4HOS A;  3G2S A;  3VTX A;  3GZS A;  3RRM B;  3I3N A;  3LY8 A;  3UT8 A;  3PUJ A;  1U3C A;  4KZ0 A;  1AP7 A;  2EIN E;  4DK5 A;  3ISM C;  4FA6 A;  3VLE A;  3P1U A;  3ASG A;  4GZ6 A;  4NAC A;  3PVL A;  1UJJ A;  3SY2 A;  5EYP F;  3CK8 A;  5CBN A;  2WB2 A;  1NP7 A;  4FUL A;  4GZ5 A;  4JA7 A;  4G23 A;  2M63 A;  1SVX A;  2IO3 C;  5DIZ A;  3CVU A;  3B7T A;  4KBQ A;  2AXZ A;  4CCA A;  3LDZ A;  3OXG A;  3APD A;  1SZ9 A;  4W9R A;  4JHR A;  2VGX A;  4K5B A;  3PDN A;  3CHR A;  1H19 A;  5ANL A;  3HVE A;  1DVP A;  1OWP A;  3L17 A;  3CVX A;  1MQS A;  1JCR A;  3MV3 B;  4MKT A;  3AG3 E;  3V30 A;  2XS1 A;  4F6R D;  3QWP A;  4E6H A;  2Y69 E;  3ABM E;  3FUK A;  2F37 A;  3E4B A;  1BD8 A;  3FTX A;  2GRP B;  3ZIM A;  2OEW A;  2WXR A;  3DBS A;  1TN7 A;  3HXC A;  3CVP A;  4OYS A;  4O1P A;  2EIK E;  3FUI A;  3FUH A;  5LCW C;  2VTB A;  2GRO B;  5AN8 A;  4JVS A;  1N4Q A;  4HOQ A;  2DYR E;  4TXP A;  2L0I A;  3DSS A;  3E33 A;  2X6F A;  5JHA A;  4I1O B;  1WAO 1;  1MHQ A;  4DX1 A;  3LY7 A;  4HRN A;  4LRZ A;  2Y4T A;  4ILG A;  4LG6 A;  5CCL A;  2GRM A;  2X38 A;  1JWG A;  3FHE A;  4B8C B;  3FTW A;  3CQC B;  5A7D B;  3RU0 A;  4FHK A;  3PRE A;  4QQI A;  4CGW A;  2P58 C;  2OVF A;  2WXK A;  1VDY A;  4G1T A;  3EHR A;  2OV8 A;  2A5U A;  3EJN A;  3ML9 A; 
#chains in the Genus database with same CATH homology
 5B3S E;  1OCO E;  1OCC E;  3ASO E;  5B1A E;  2EIL E;  3ABL E;  2EIK E;  3WG7 E;  3X2Q E;  3AG4 E;  1OCR E;  2EIM E;  2Y69 E;  3ABM E;  3AG1 E;  1V55 E;  1V54 E;  2ZXW E;  3ASN E;  2DYR E;  2EIN E;  1OCZ E;  5IY5 E;  5B1B E;  3AG3 E;  2OCC E;  3AG2 E;  3ABK E;  2DYS E;  2EIJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...