3X2QE

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3x2qE00
1OCRE 2DYRE 2Y69E 3AG3E 2EIME 5B3SE 1OCOE 3ASNE 2EILE 3WG7E 3ASOE 3AG2E 2EIKE 5B1BE 1V54E 5IY5E 3ABME 2EINE 3AG1E 3ABLE 2DYSE 2EIJE 1OCZE 1V55E 1OCCE 2OCCE 3ABKE 2ZXWE 5B1AE 3AG4E 3X2QE
chains in the Genus database with same CATH superfamily
2GGFA 2V5FA 3ZU7B 3CQCB 2VQ2A 2LSVA 3DXMG 1AWCB 5CRUA 3UKRG 1HS6A 3PH0C 2ONDA 3ZXSA 4K5AB 5ENPD 1ELWA 2PQNA 4AJWA 5BV0A 1JCSA 2DWZA 5LFAA 2EILE 4GYOA 4DUIA 4RQIA 4GTVA 4RVBA 1TNOA 2CFUA 3U9WA 3D3MA 3ASGA 4JW1A 1D8DA 4XKBA 3KSQA 5AQAA 3BUAA 1MX2A 4L23A 1FVHA 5FQ8A 3TWXA 4MKTA 2IJGX 3LEWA 5CEDB 4XE0A 3D9OA 3ZW3A 4Q96A 1N4RA 4ACLA 2V5QC 3AAAC 3LKUA 2KC7A 4TUUA 2PZIA 2XPIA 3TWVA 1TN7A 3Q9UC 3PUKA 3PS6A 1G3NB 4U0SA 5D0QD 2X6FA 3RRUA 4XZ4A 2Y1LE 3EDTB 3CK9A 2YNQA 1E8ZA 4JB8P 3S7JA 3G2WA 5C1DA 3U66A 2ZIRA 2P9KG 4U8VD 1UN8A 4TV3A 1K3ZD 2CG2A 2LO6A 1TN8A 3JXIA 3VLDA 3DSUA 1UOHA 3C3QA 4UWFA 1EDUA 3G2VA 4ANUA 3EIQC 2UY1B 5T4YA 1E96B 3HHMA 4I9EA 3C98A 4QFVA 2B0OE 4BX8A 4LERA 4JHKA 3LXUX 2KZTB 3CR3A 5FWQA 3ZYKA 3ASNE 4GA0A 2WMNA 3CVUA 1WM5A 2ETBA 4V3IA 4HS2A 3LPZA 4CGVA 5EILA 2OCCE 5A7DB 4YVOA 3FU6A 1NA3A 4E85A 1U3DA 1SZAA 1DNPA 2CHZA 4N2QA 1Y8MA 2ETCA 2VTBA 4G11A 4BX9A 4J8SA 5ENTD 4I43A 2FEZA 2FO1E 5AJDA 1N4QA 1OCRE 3QNKA 4F6RD 3B7SA 3WXXA 5DBKA 4WUYA 3NBNB 3LJ3A 3GYZA 4ATZD 1TYQG 4IULA 3U3WA 5G05J 3L08A 3IEGA 5LOZA 3R9MA 2AXVA 4LUNU 4Y6CA 3CK8A 4I1OB 1IHGA 1TEZA 4JPSA 4KVMA 2KCKA 3ESKA 5A6CA 1SA4A 4IYPA 3AU4A 2BF0X 3IKOB 1HU3A 4DLOA 4KT6B 1L5JA 2L0TB 4GMLA 1XGWA 3ZVVA 4ANWA 2KBXA 4LNUD 3FDHA 4NRHB 3PEVB 4UWGA 1N95A 1KT1A 5EIBE 2IOLA 2VSOE 3MA5A 5FZRA 4DX2A 3IXEA 4U07A 1OWPA 5FJYA 3QK0A 2XZDG 1S64A 4G8LA 3PNLB 4M3OA 2ILRA 5G04C 3ML8A 4CEMA 4BWRA 1NI1A 1RW2A 4N39A 1FPPA 2XPZA 4GTTA 2R17C 1XNFA 3G2SA 1A17A 5EYLA 3ABME 5G55A 1OWNA 4K0RA 2XHEA 2RKKA 4JEHA 4URKA 2VTBB 3CSFA 2WXFA 4OYSA 2ZGDA 3APFA 3NAWA 3HXBA 3BEEA 2J09A 5CBOA 3CVWA 3E34A 2GRMA 5H7PA 4AY5A 1W3BA 3Q7FA 5KJNA 2NC9A 1SVXA 5LX8A 1HZ4A 3UIOC 4IRUA 1MJ0A 3FH5A 4GCNA 2L6BA 3Q78A 5ENSD 2VSXE 5D2MC 2WXIA 2I1JA 1Z5SC 2F0YA 1MYOA 1PC2A 3TG4A 3EU5A 3LY9A 4B0ZA 3EU9A 2ZXWE 2LAHA 3S7BA 2J08A 2QFCA 4GCOA 4LCTA 2P9LG 1KPSB 2F8YA 4KXKB 4LRZA 4RLYA 5G05C 3FY4A 4R7LA 1ELKA 3DSVA 1H0AA 4U96D 1NFIE 4EHMA 3KS2A 4Y6WA 3QDNA 1YCSB 4HOUA 4UI9C 1MHQA 1ELRA 2HYZA 2MYOA 4ILGA 3ZGQA 1U3CA 4B89A 3UUXA 1BU9A 3DSXA 5LCWJ 4TUMA 4KBQA 3NOCD 5CHEE 1OCCE 3SHFA 4J6IA 5JJ7A 4P29A 4BESA 4HOTA 3NOGD 1IXVA 4UWKA 3EHRA 3FULA 1OUVA 1DVPA 2PL2A 3E4BA 4N3AA 3CKCA 2ZISA 2QYUA 5C2YA 4EZJA 2Y0BG 4OVUA 2XGMA 5B1AE 3P2BA 4A63B 5T3RA 5BPPA 5EKQD 4NACA 3F6QA 5HRYA 3DRAA 4WNGA 4YDEA 1SW6A 1AP7A 3FU0A 4F1SA 2PQRA 3T5XA 4WWNA 3Q73A 4UUCA 3SO8A 3Q9NC 2P9NG 3CV0A 2VGEA 3EHMA 3MX3A 2WQ6A 5KJKA 4NQ0A 1K1AA 1QYMA 3S7FA 2RD0A 4I6GA 3UM0A 2X38A 1E8WA 3ABLE 3SFZA 4HXIA 1SZ9A 4EBAG 1HE8A 4MBGA 3Q5MA 3MZLB 3CHSA 1E8YA 1H2VC 4TRQA 3DEOA 3LVRE 3UMVA 1IQRA 2WXJA 2X6JA 1E8XA 4FU3A 3FTYA 1HG5A 4EBAA 4RSYA 2GW1A 4U04A 1O5MA 4L2LA 3RU0A 2BKKB 4U8HA 2X3MA 3TWTA 4BTBA 2WMOA 3QWPA 4G24A 2GROB 4F3VA 3HVEB 5CMYA 2J4DA 3B13A 3PUJA 2WXNA 3NB2A 4GAAA 1PY1A 4FLBA 4HI9A 3ZYMA 4HOQA 5AQ7A 2PNNA 3FUKA 4N2SA 3KD7A 3T5VA 4J8EA 5FZSA 2ZU6B 5LP0A 4L1BA 3V79K 2H6HA 3JYSA 2MHKA 3SD5A 3DWLG 3L54A 2A5UA 3ZNGA 2WVIA 4APOA 3J5PA 1TN6A 4A1GA 3MJWA 3CHOA 2DIWA 1GW6A 4H7XA 3UXGA 3W9FA 3KEZA 1TR4A 2JLBA 3DEPA 5JA4D 5CERB 3PNTB 2NSZA 4XEIG 3ZFWA 3RJVA 1HFAA 4I2ZA 3QOUA 2L0IA 3RKVA 5EX3A 3E37A 4KVOA 4FC8A 4G25A 1BLXB 2L6JA 4BT9A 4BT8A 1DC2A 3AS5A 4I6EA 1TNYA 2DVWA 2Y4TA 4FULA 3CVPA 1E7VA 4J8YA 5CCLA 4CDMA 2KCLA 2WM9A 2HM8A 3HRAA 1ZU2A 3CHMA 3PEUB 2MOWA 4OVVA 1UN9A 3JXJA 3FUEA 2AW6A 2C2LA 3TGOA 3PZ2A 2AVPA 3CGHA 2KZTA 4N5CA 2IFUA 4YNDA 4FHKA 3TJPA 4EZLA 2WQHA 1E7UA 3TWSA 2R03A 1QBQA 2H6GA 4HFGA 1H2TC 3NQPA 2YHEA 3RO3A 2P9IG 4ZFHA 3Q4AB 4N5QA 4NURA 2XCCA 4BEPA 3HXCA 2J07A 3ABKE 4LEUA 3GZSA 3C3RA 1IQUA 5G04J 4G8KA 3SBSA 4DX1A 2XRYA 4GTQA 3L16A 4FHJA 4JZYA 1N4SA 2WB2A 2EIJE 1MX6A 1OCZE 2WXGA 3UPVA 3KAEA 1TJCA 4C9BB 3S7DA 2IONA 1JCRA 2L9BA 2P2CP 3FUMA 4GZCA 2BTDA 4BSXA 1BI7B 2GRPB 4HORA 1INZA 1BI8B 2BKGA 2VGXB 5BUZA 3FEXA 3MEKA 1KZOA 5EX0A 3MV2B 1O1SA 3DSTA 3B95A 3Q15A 3LDZA 5FQ7A 3O4ZA 3RRNB 4DX5D 3ASOE 3UX4A 2V4LA 4DPRA 3NZSA 4CT4A 2QY7A 4GZ3A 2FF4A 2LXMA 4L2YA 2WXRA 4U0ZA 2V4HC 5IY5E 2WXOA 5EN5D 1E90A 2QZAA 5AQ9A 4YDYA 5G2NA 3CHQA 4JHJA 3CVVA 4DJAA 2XQ0A 3B7UX 3ZYLA 4K5CA 3FTUA 4DK5A 3ZPJA 3ONKA 3TWWA 1V55E 2IEJA 4CRWA 1LD7A 4B8AA 4ME2A 4AIFA 4HQDA 3AJIA 2CHXA 1RZ4A 3ZYQA 4U0UA 3FP3A 2ZGGA 3CKBA 2KATA 4YDOA 3HXEA 3QJZA 3MGBA 1S63A 1HG2A 5ENOD 5HI7A 4FLHA 5ENNA 3FHEA 3FH7A 3Q47B 3LVQE 2F8XK 1OWLA 3FWVA 3FTVA 4KZ0A 4GZ5A 4UI9K 1TNUA 5BXOA 3OXLA 1DCQA 2I6HA 5CECB 3JQ0A 3E32A 4AV7A 1PAQA 3MCXA 3SF4A 5ARGA 3D9KA 4GU5A 2FULA 4FP7A 1QQEA 2GRRB 2AXZA 4Q94A 3CVNA 3ZRHA 1N4PA 3I3NA 4I1MA 2H6FA 3BQOA 1Z3XA 2A4ZA 3AS4A 1SQMA 3BU8A 4M7CA 1S70B 3ULEG 4L7TA 4RG9A 4WWOA 3OAWA 2CFZA 1FVFA 3ISMC 2UY1A 3I5PA 4K5BA 1WG0A 4GTSA 3T9KA 4ANXA 4BTAA 5CBNA 4OAVB 3FFLA 3CK7A 3QB2A 3UKUG 5BNWA 4ILHB 1N11A 1B89A 4HRMB 2J8SD 1UG3A 4J0UA 3R7QA 4B93B 4AEZC 2P9PG 3VTXA 3ULYA 4B8CB 2JABA 3EHNA 5E75A 3V2XA 3KEAA 3DSSA 1QZ2A 3HYMB 3ZN3A 1H19A 4KYOB 3QC1A 3CVYA 2FBNA 4EQFA 4CDRA 3CQGB 4F1PA 5AIJA 3CVXA 5BT1A 5DIZA 4PS7A 5KJLA 1JCQA 3APCA 3ZIMA 3U4TA 3UIPC 3FUFA 2IOSA 5B3SE 3LJNA 4AXHA 1LTXA 4O60A 4ILIA 2BUGA 2WPVA 2R2LA 3FH8A 5BW8C 3URZA 3Q75A 2B6CA 3AG2E 3ML9A 4ANVA 2XS1A 5A23A 4O1PA 4JHRA 5D66A 3BG1B 5JMND 2Y4UA 2HO1A 3SGHA 3C72A 4HBDA 3VLFA 3SNXA 4JEUA 3IHVA 2GRQB 3L22A 4D10C 1ZB1A 3UQ3A 5ARFA 4LNGA 1N0QA 2YINA 4NIKA 3U64A 1X5BA 5HQ8A 3Q7AA 4TXPA 4GTOA 3P1UA 1Y6IA 2RFAA 1WAO1 3MV3B 3PZDA 2RG8A 3D9JA 3AU5A 1IHBA 1NL4A 3QAQA 5EDSA 3HIZA 3PREA 4U7EB 3G2UA 2V0PA 4I17A 4TXRA 1JUQA 2UWJG 3UINC 3SBTB 3DPDA 4U8YD 5CEAA 1H6PA 5BXUA 4MRUA 3E33A 3GW4A 4JC8A 2P9UG 3TWRA 3D9LA 5JJ6A 4DRXE 2IQCA 1H6OA 2YHCA 1NZNA 1H6KA 3W9GA 2XEEA 3D9NA 3IBEA 3ZHEA 3NZUA 2DYSE 2LUHA 4G26A 2RFMA 4EZKA 3LY8A 2NYJA 3B7BA 4IN3B 1UJKA 4F53A 1D9SA 4GYYA 4HRNA 3L17A 4PDXA 4A3VA 3PZ4A 1H2UA 3UM2A 4DI4A 3LYAA 1EYHA 1EF1C 5M72A 2LSUA 3X2QE 3G2TA 3FU5A 3UT7A 4CCAA 4CT0A 3JUEA 3TXMA 3AG3E 3QWVA 3S2AA 4ABNA 3CHPA 3FUJA 5T8IA 1HH8A 5HKPA 4PS3A 3BG0B 3KSLA 2YQ8A 2R59A 2WXPA 3CLJA 2DZNA 3ZKJA 4BETA 3Q49B 1EPUA 4Z68A 1WY6A 3AG1E 5KBAA 3ASFA 3O48A 1LF8A 2IO3C 3T8MA 5FINA 2F37A 3AG4E 3SFYA 4ZHBA 2WQ7A 1HX8A 3MKQA 2CHWA 3LCAA 3RRMB 4A3TA 5FIOA 4RG6A 3TWUA 3ULQA 5KJMA 2XRZA 5ENRD 5AJLA 1Z3YA 4APFA 3CSTA 3CHRA 5FQ6A 3WG7E 1FCHA 5J90A 5EIDA 1MX4A 4G1TA 1O1RA 4JL0A 5KCMA 1N9AA 4E6HA 1Q2ZA 4DI3A 3FEYA 4UI9J 3RAUA 4XI9A 3E30A 4X8QA 4GMRA 4MS6A 2MRIA 3NF1A 2LNIA 4WNEA 4XKCA 4J7WA 1N94A 4MLPA 2H6IA 4GTRA 1FT2A 1K8KG 3L9TA 5KNHD 1KLXA 3PZ1A 3DBSA 4L9PA 3ZHEB 2R02A 4FADA 3JCKC 4C48B 2I9CA 3HXDA 5ANRA 3JUIA 4WNFA 4F7AA 2A5EA 2VSNA 1JWGA 2P9SG 1N0RA 3D9HA 2R5SA 2WXLA 1OXJA 2XCBA 2J49A 3SY2A 5AN8A 2IU1A 3HVEA 1TNBA 2OVFA 5AAOA 5AYWD 1N52A 3ENEA 2X6KA 4LNBA 2Y69E 1OWMA 2GRLA 2M63A 3J5QB 4DX6D 1V54E 3N71A 3OXGA 2WXMA 2Q7FA 3IHYA 3L6AA 2XGOA 1Z6TA 2WXHA 4LG6A 3VTYA 4AOFA 3FTZA 4HRLA 3C5RA 5FZQA 2DYRE 2IO2C 2V8SE 4N3BA 4UWLA 3LY7A 3FTSA 1OWOA 2OV8A 2EIKE 4GB9A 4JXTA 4G23A 3VLEA 3V2OA 3D9IA 1FT1A 4GTMA 4C0MA 2WXQA 4ATGA 3B7TA 3SI5A 3FUIA 2AWIA 5E76A 1YMPA 4J8DA 3CIAA 4I2WA 1NP7A 4U63A 4G2VA 4HB5A 4O1OA 2X6IA 5AQBA 4UQZA 2EQXA 1JWFA 2KM4A 5CRVA 1YA0A 2KCVA 2XS8A 2AXUA 1HXIA 5JHAA 3B7RL 1S0PA 1YYHA 4HLEA 2NXPA 3ONLA 3MKRA 4W9RA 1K1BA 4CGWA 3PE4A 2ETAA 5LCWC 4A1SA 3EJNA 4GYWA 2CG3A 3CVLA 3SFXA 2VSYA 2XPYA 4BY6A 5FT9A 4HNAD 1BPOA 3DPYA 1D8EA 1IYGA 3L82A 2P58C 3CVQA 4J8FA 3RO2A 4KZCA 4TXQA 5JHBA 3TXNA 4PS8A 2XEVA 2DCPA 3UT8A 1OY3D 3RIBA 4XX5A 4K03A 4FJYA 2GRNB 4OAUC 1MQSA 3FUNA 2QC9A 4YVQC 1WDYA 1LD8A 3UI2A 2EIME 4UQYA 4FJZA 4JA7A 1ZBPA 4HLLA 4XI0A 4CYMD 4QQIA 3ZUVB 2QYJA 4FA6A 2XGSA 5BV1A 1NA0A 3UM3A 4DX7D 2OOEA 2VGYA 1BD8A 3ASHA 2LXLA 1OCOE 3V30A 4AVXA 4GZ6A 5FQ4A 4AY6A 3HXFA 3MKQB 5EYPF 1U2VG 2AJAA 4AM9A 3OTNA 4EECA 2VYIA 2HE0A 4U95D 3FTXA 4UQXA 3FU3A 4GPKA 2PM7A 3PDNA 1KZPA 3I4RB 3HDXA 3GZ2A 5ITZF 3QARA 3T8KA 3RSEG 3OXFA 1TNZA 2J4BA 1VDYA 3PZ3A 1HO8A 3SQVA 3GZ1A 2OVBA 3C3OA 1HF8A 4H7YA 3FTWA 4JA9A 3PRZA 3DSWA 3EHQA 3HG0D 2WXKA 2BEDA 4JVSA 4UWHA 5B1BE 3UTMA 3TAXA 4JD2G 2EINE 4KMOA 5AARA 3Q79A 5CMWA 1IKND 2FI7A 5HS0A 4GTPA 3AS8A 3PE3A 4XIFA 4BSZB 4PUCA 1SA5A 1MZCA 3K9IA 2IY0C 4N3CA 3V31A 5KWDA 4LSZE 5KNGA 3UM1A 2E0IA 3SZ7A 3JQ1A 1DCEA 1KT0A 5FTPA 3LS8A 3TG5A 5JJTA 4C0EA 2I1KA 1N54A 5CCMA 2VGXA 2R05A 3ESLA 3UT4A 2LAIA 4YDWA 4B94A 4HOSA 3L13A 3RK6A 2XEHA 4WAFA 5D0OD 4I6JA 1UJJA 3APDA 2DZOA 3MYVA 4WNDA 3TWQA 4BERA 4GA1A 3D9PA 3ZXPA 3ZEFA 3EUVA 2Y3AA 4ACKA 3TL5A 4BFRA 5J08A 1O1TA 2I2OA 2J9QA 3R9AB 2OEVA 3PVLA 4DLQA 4I1AA 2C0LA 4O6FA 1JPLA 1TJFA 3QKYA 1QNFA 4CZ2D 1A5EA 2FO7A 4HVBA 3IV0A 3EIJA 3QWWA 2VJ8A 2HR2A 2DBAA 4Q69A 2IF4A 2JEKA 4AP2A 2E2EA 1X81A 5ENQD 1P5QA 4WWPA 2XENA 4EPZA 1UW4B 4GPMA 4HI8A 2XZTG 3DXKG 3CEQA 4GZDA 3FUHA 2C0MA 3R7RA 2PM6A 4A55A 4CDNA 4PH4B 5AENA 2OEWA 5ANLA 4GMJA 3I4GA 2X6HA 3D9MA 3FUDA 3ASDA 1OT8A 4GA2A 2KXPC 4I9CA
chains in the Genus database with same CATH topology
1OCRE 2DYRE 2Y69E 3AG3E 2EIME 5B3SE 1OCOE 3ASNE 2EILE 3WG7E 3ASOE 3AG2E 2EIKE 5B1BE 1V54E 5IY5E 3ABME 2EINE 3AG1E 3ABLE 2DYSE 2EIJE 1OCZE 1V55E 1OCCE 2OCCE 3ABKE 2ZXWE 5B1AE 3AG4E 3X2QE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCR E;  2DYR E;  2Y69 E;  3AG3 E;  2EIM E;  5B3S E;  1OCO E;  3ASN E;  2EIL E;  3WG7 E;  3ASO E;  3AG2 E;  2EIK E;  5B1B E;  1V54 E;  5IY5 E;  3ABM E;  2EIN E;  3AG1 E;  3ABL E;  2DYS E;  2EIJ E;  1OCZ E;  1V55 E;  1OCC E;  2OCC E;  3ABK E;  2ZXW E;  5B1A E;  3AG4 E;  3X2Q E; 
#chains in the Genus database with same CATH topology
 2GGF A;  2V5F A;  3ZU7 B;  3CQC B;  2VQ2 A;  2LSV A;  3DXM G;  1AWC B;  5CRU A;  3UKR G;  1HS6 A;  3PH0 C;  2OND A;  3ZXS A;  4K5A B;  5ENP D;  1ELW A;  2PQN A;  4AJW A;  5BV0 A;  1JCS A;  2DWZ A;  5LFA A;  2EIL E;  4GYO A;  4DUI A;  4RQI A;  4GTV A;  4RVB A;  1TNO A;  2CFU A;  3U9W A;  3D3M A;  3ASG A;  4JW1 A;  1D8D A;  4XKB A;  3KSQ A;  5AQA A;  3BUA A;  1MX2 A;  4L23 A;  1FVH A;  5FQ8 A;  3TWX A;  4MKT A;  2IJG X;  3LEW A;  5CED B;  4XE0 A;  3D9O A;  3ZW3 A;  4Q96 A;  1N4R A;  4ACL A;  2V5Q C;  3AAA C;  3LKU A;  2KC7 A;  4TUU A;  2PZI A;  2XPI A;  3TWV A;  1TN7 A;  3Q9U C;  3PUK A;  3PS6 A;  1G3N B;  4U0S A;  5D0Q D;  2X6F A;  3RRU A;  4XZ4 A;  2Y1L E;  3EDT B;  3CK9 A;  2YNQ A;  1E8Z A;  4JB8 P;  3S7J A;  3G2W A;  5C1D A;  3U66 A;  2ZIR A;  2P9K G;  4U8V D;  1UN8 A;  4TV3 A;  1K3Z D;  2CG2 A;  2LO6 A;  1TN8 A;  3JXI A;  3VLD A;  3DSU A;  1UOH A;  3C3Q A;  4UWF A;  1EDU A;  3G2V A;  4ANU A;  3EIQ C;  2UY1 B;  5T4Y A;  1E96 B;  3HHM A;  4I9E A;  3C98 A;  4QFV A;  2B0O E;  4BX8 A;  4LER A;  4JHK A;  3LXU X;  2KZT B;  3CR3 A;  5FWQ A;  3ZYK A;  3ASN E;  4GA0 A;  2WMN A;  3CVU A;  1WM5 A;  2ETB A;  4V3I A;  4HS2 A;  3LPZ A;  4CGV A;  5EIL A;  2OCC E;  5A7D B;  4YVO A;  3FU6 A;  1NA3 A;  4E85 A;  1U3D A;  1SZA A;  1DNP A;  2CHZ A;  4N2Q A;  1Y8M A;  2ETC A;  2VTB A;  4G11 A;  4BX9 A;  4J8S A;  5ENT D;  4I43 A;  2FEZ A;  2FO1 E;  5AJD A;  1N4Q A;  1OCR E;  3QNK A;  4F6R D;  3B7S A;  3WXX A;  5DBK A;  4WUY A;  3NBN B;  3LJ3 A;  3GYZ A;  4ATZ D;  1TYQ G;  4IUL A;  3U3W A;  5G05 J;  3L08 A;  3IEG A;  5LOZ A;  3R9M A;  2AXV A;  4LUN U;  4Y6C A;  3CK8 A;  4I1O B;  1IHG A;  1TEZ A;  4JPS A;  4KVM A;  2KCK A;  3ESK A;  5A6C A;  1SA4 A;  4IYP A;  3AU4 A;  2BF0 X;  3IKO B;  1HU3 A;  4DLO A;  4KT6 B;  1L5J A;  2L0T B;  4GML A;  1XGW A;  3ZVV A;  4ANW A;  2KBX A;  4LNU D;  3FDH A;  4NRH B;  3PEV B;  4UWG A;  1N95 A;  1KT1 A;  5EIB E;  2IOL A;  2VSO E;  3MA5 A;  5FZR A;  4DX2 A;  3IXE A;  4U07 A;  1OWP A;  5FJY A;  3QK0 A;  2XZD G;  1S64 A;  4G8L A;  3PNL B;  4M3O A;  2ILR A;  5G04 C;  3ML8 A;  4CEM A;  4BWR A;  1NI1 A;  1RW2 A;  4N39 A;  1FPP A;  2XPZ A;  4GTT A;  2R17 C;  1XNF A;  3G2S A;  1A17 A;  5EYL A;  3ABM E;  5G55 A;  1OWN A;  4K0R A;  2XHE A;  2RKK A;  4JEH A;  4URK A;  2VTB B;  3CSF A;  2WXF A;  4OYS A;  2ZGD A;  3APF A;  3NAW A;  3HXB A;  3BEE A;  2J09 A;  5CBO A;  3CVW A;  3E34 A;  2GRM A;  5H7P A;  4AY5 A;  1W3B A;  3Q7F A;  5KJN A;  2NC9 A;  1SVX A;  5LX8 A;  1HZ4 A;  3UIO C;  4IRU A;  1MJ0 A;  3FH5 A;  4GCN A;  2L6B A;  3Q78 A;  5ENS D;  2VSX E;  5D2M C;  2WXI A;  2I1J A;  1Z5S C;  2F0Y A;  1MYO A;  1PC2 A;  3TG4 A;  3EU5 A;  3LY9 A;  4B0Z A;  3EU9 A;  2ZXW E;  2LAH A;  3S7B A;  2J08 A;  2QFC A;  4GCO A;  4LCT A;  2P9L G;  1KPS B;  2F8Y A;  4KXK B;  4LRZ A;  4RLY A;  5G05 C;  3FY4 A;  4R7L A;  1ELK A;  3DSV A;  1H0A A;  4U96 D;  1NFI E;  4EHM A;  3KS2 A;  4Y6W A;  3QDN A;  1YCS B;  4HOU A;  4UI9 C;  1MHQ A;  1ELR A;  2HYZ A;  2MYO A;  4ILG A;  3ZGQ A;  1U3C A;  4B89 A;  3UUX A;  1BU9 A;  3DSX A;  5LCW J;  4TUM A;  4KBQ A;  3NOC D;  5CHE E;  1OCC E;  3SHF A;  4J6I A;  5JJ7 A;  4P29 A;  4BES A;  4HOT A;  3NOG D;  1IXV A;  4UWK A;  3EHR A;  3FUL A;  1OUV A;  1DVP A;  2PL2 A;  3E4B A;  4N3A A;  3CKC A;  2ZIS A;  2QYU A;  5C2Y A;  4EZJ A;  2Y0B G;  4OVU A;  2XGM A;  5B1A E;  3P2B A;  4A63 B;  5T3R A;  5BPP A;  5EKQ D;  4NAC A;  3F6Q A;  5HRY A;  3DRA A;  4WNG A;  4YDE A;  1SW6 A;  1AP7 A;  3FU0 A;  4F1S A;  2PQR A;  3T5X A;  4WWN A;  3Q73 A;  4UUC A;  3SO8 A;  3Q9N C;  2P9N G;  3CV0 A;  2VGE A;  3EHM A;  3MX3 A;  2WQ6 A;  5KJK A;  4NQ0 A;  1K1A A;  1QYM A;  3S7F A;  2RD0 A;  4I6G A;  3UM0 A;  2X38 A;  1E8W A;  3ABL E;  3SFZ A;  4HXI A;  1SZ9 A;  4EBA G;  1HE8 A;  4MBG A;  3Q5M A;  3MZL B;  3CHS A;  1E8Y A;  1H2V C;  4TRQ A;  3DEO A;  3LVR E;  3UMV A;  1IQR A;  2WXJ A;  2X6J A;  1E8X A;  4FU3 A;  3FTY A;  1HG5 A;  4EBA A;  4RSY A;  2GW1 A;  4U04 A;  1O5M A;  4L2L A;  3RU0 A;  2BKK B;  4U8H A;  2X3M A;  3TWT A;  4BTB A;  2WMO A;  3QWP A;  4G24 A;  2GRO B;  4F3V A;  3HVE B;  5CMY A;  2J4D A;  3B13 A;  3PUJ A;  2WXN A;  3NB2 A;  4GAA A;  1PY1 A;  4FLB A;  4HI9 A;  3ZYM A;  4HOQ A;  5AQ7 A;  2PNN A;  3FUK A;  4N2S A;  3KD7 A;  3T5V A;  4J8E A;  5FZS A;  2ZU6 B;  5LP0 A;  4L1B A;  3V79 K;  2H6H A;  3JYS A;  2MHK A;  3SD5 A;  3DWL G;  3L54 A;  2A5U A;  3ZNG A;  2WVI A;  4APO A;  3J5P A;  1TN6 A;  4A1G A;  3MJW A;  3CHO A;  2DIW A;  1GW6 A;  4H7X A;  3UXG A;  3W9F A;  3KEZ A;  1TR4 A;  2JLB A;  3DEP A;  5JA4 D;  5CER B;  3PNT B;  2NSZ A;  4XEI G;  3ZFW A;  3RJV A;  1HFA A;  4I2Z A;  3QOU A;  2L0I A;  3RKV A;  5EX3 A;  3E37 A;  4KVO A;  4FC8 A;  4G25 A;  1BLX B;  2L6J A;  4BT9 A;  4BT8 A;  1DC2 A;  3AS5 A;  4I6E A;  1TNY A;  2DVW A;  2Y4T A;  4FUL A;  3CVP A;  1E7V A;  4J8Y A;  5CCL A;  4CDM A;  2KCL A;  2WM9 A;  2HM8 A;  3HRA A;  1ZU2 A;  3CHM A;  3PEU B;  2MOW A;  4OVV A;  1UN9 A;  3JXJ A;  3FUE A;  2AW6 A;  2C2L A;  3TGO A;  3PZ2 A;  2AVP A;  3CGH A;  2KZT A;  4N5C A;  2IFU A;  4YND A;  4FHK A;  3TJP A;  4EZL A;  2WQH A;  1E7U A;  3TWS A;  2R03 A;  1QBQ A;  2H6G A;  4HFG A;  1H2T C;  3NQP A;  2YHE A;  3RO3 A;  2P9I G;  4ZFH A;  3Q4A B;  4N5Q A;  4NUR A;  2XCC A;  4BEP A;  3HXC A;  2J07 A;  3ABK E;  4LEU A;  3GZS A;  3C3R A;  1IQU A;  5G04 J;  4G8K A;  3SBS A;  4DX1 A;  2XRY A;  4GTQ A;  3L16 A;  4FHJ A;  4JZY A;  1N4S A;  2WB2 A;  2EIJ E;  1MX6 A;  1OCZ E;  2WXG A;  3UPV A;  3KAE A;  1TJC A;  4C9B B;  3S7D A;  2ION A;  1JCR A;  2L9B A;  2P2C P;  3FUM A;  4GZC A;  2BTD A;  4BSX A;  1BI7 B;  2GRP B;  4HOR A;  1INZ A;  1BI8 B;  2BKG A;  2VGX B;  5BUZ A;  3FEX A;  3MEK A;  1KZO A;  5EX0 A;  3MV2 B;  1O1S A;  3DST A;  3B95 A;  3Q15 A;  3LDZ A;  5FQ7 A;  3O4Z A;  3RRN B;  4DX5 D;  3ASO E;  3UX4 A;  2V4L A;  4DPR A;  3NZS A;  4CT4 A;  2QY7 A;  4GZ3 A;  2FF4 A;  2LXM A;  4L2Y A;  2WXR A;  4U0Z A;  2V4H C;  5IY5 E;  2WXO A;  5EN5 D;  1E90 A;  2QZA A;  5AQ9 A;  4YDY A;  5G2N A;  3CHQ A;  4JHJ A;  3CVV A;  4DJA A;  2XQ0 A;  3B7U X;  3ZYL A;  4K5C A;  3FTU A;  4DK5 A;  3ZPJ A;  3ONK A;  3TWW A;  1V55 E;  2IEJ A;  4CRW A;  1LD7 A;  4B8A A;  4ME2 A;  4AIF A;  4HQD A;  3AJI A;  2CHX A;  1RZ4 A;  3ZYQ A;  4U0U A;  3FP3 A;  2ZGG A;  3CKB A;  2KAT A;  4YDO A;  3HXE A;  3QJZ A;  3MGB A;  1S63 A;  1HG2 A;  5ENO D;  5HI7 A;  4FLH A;  5ENN A;  3FHE A;  3FH7 A;  3Q47 B;  3LVQ E;  2F8X K;  1OWL A;  3FWV A;  3FTV A;  4KZ0 A;  4GZ5 A;  4UI9 K;  1TNU A;  5BXO A;  3OXL A;  1DCQ A;  2I6H A;  5CEC B;  3JQ0 A;  3E32 A;  4AV7 A;  1PAQ A;  3MCX A;  3SF4 A;  5ARG A;  3D9K A;  4GU5 A;  2FUL A;  4FP7 A;  1QQE A;  2GRR B;  2AXZ A;  4Q94 A;  3CVN A;  3ZRH A;  1N4P A;  3I3N A;  4I1M A;  2H6F A;  3BQO A;  1Z3X A;  2A4Z A;  3AS4 A;  1SQM A;  3BU8 A;  4M7C A;  1S70 B;  3ULE G;  4L7T A;  4RG9 A;  4WWO A;  3OAW A;  2CFZ A;  1FVF A;  3ISM C;  2UY1 A;  3I5P A;  4K5B A;  1WG0 A;  4GTS A;  3T9K A;  4ANX A;  4BTA A;  5CBN A;  4OAV B;  3FFL A;  3CK7 A;  3QB2 A;  3UKU G;  5BNW A;  4ILH B;  1N11 A;  1B89 A;  4HRM B;  2J8S D;  1UG3 A;  4J0U A;  3R7Q A;  4B93 B;  4AEZ C;  2P9P G;  3VTX A;  3ULY A;  4B8C B;  2JAB A;  3EHN A;  5E75 A;  3V2X A;  3KEA A;  3DSS A;  1QZ2 A;  3HYM B;  3ZN3 A;  1H19 A;  4KYO B;  3QC1 A;  3CVY A;  2FBN A;  4EQF A;  4CDR A;  3CQG B;  4F1P A;  5AIJ A;  3CVX A;  5BT1 A;  5DIZ A;  4PS7 A;  5KJL A;  1JCQ A;  3APC A;  3ZIM A;  3U4T A;  3UIP C;  3FUF A;  2IOS A;  5B3S E;  3LJN A;  4AXH A;  1LTX A;  4O60 A;  4ILI A;  2BUG A;  2WPV A;  2R2L A;  3FH8 A;  5BW8 C;  3URZ A;  3Q75 A;  2B6C A;  3AG2 E;  3ML9 A;  4ANV A;  2XS1 A;  5A23 A;  4O1P A;  4JHR A;  5D66 A;  3BG1 B;  5JMN D;  2Y4U A;  2HO1 A;  3SGH A;  3C72 A;  4HBD A;  3VLF A;  3SNX A;  4JEU A;  3IHV A;  2GRQ B;  3L22 A;  4D10 C;  1ZB1 A;  3UQ3 A;  5ARF A;  4LNG A;  1N0Q A;  2YIN A;  4NIK A;  3U64 A;  1X5B A;  5HQ8 A;  3Q7A A;  4TXP A;  4GTO A;  3P1U A;  1Y6I A;  2RFA A;  1WAO 1;  3MV3 B;  3PZD A;  2RG8 A;  3D9J A;  3AU5 A;  1IHB A;  1NL4 A;  3QAQ A;  5EDS A;  3HIZ A;  3PRE A;  4U7E B;  3G2U A;  2V0P A;  4I17 A;  4TXR A;  1JUQ A;  2UWJ G;  3UIN C;  3SBT B;  3DPD A;  4U8Y D;  5CEA A;  1H6P A;  5BXU A;  4MRU A;  3E33 A;  3GW4 A;  4JC8 A;  2P9U G;  3TWR A;  3D9L A;  5JJ6 A;  4DRX E;  2IQC A;  1H6O A;  2YHC A;  1NZN A;  1H6K A;  3W9G A;  2XEE A;  3D9N A;  3IBE A;  3ZHE A;  3NZU A;  2DYS E;  2LUH A;  4G26 A;  2RFM A;  4EZK A;  3LY8 A;  2NYJ A;  3B7B A;  4IN3 B;  1UJK A;  4F53 A;  1D9S A;  4GYY A;  4HRN A;  3L17 A;  4PDX A;  4A3V A;  3PZ4 A;  1H2U A;  3UM2 A;  4DI4 A;  3LYA A;  1EYH A;  1EF1 C;  5M72 A;  2LSU A;  3X2Q E;  3G2T A;  3FU5 A;  3UT7 A;  4CCA A;  4CT0 A;  3JUE A;  3TXM A;  3AG3 E;  3QWV A;  3S2A A;  4ABN A;  3CHP A;  3FUJ A;  5T8I A;  1HH8 A;  5HKP A;  4PS3 A;  3BG0 B;  3KSL A;  2YQ8 A;  2R59 A;  2WXP A;  3CLJ A;  2DZN A;  3ZKJ A;  4BET A;  3Q49 B;  1EPU A;  4Z68 A;  1WY6 A;  3AG1 E;  5KBA A;  3ASF A;  3O48 A;  1LF8 A;  2IO3 C;  3T8M A;  5FIN A;  2F37 A;  3AG4 E;  3SFY A;  4ZHB A;  2WQ7 A;  1HX8 A;  3MKQ A;  2CHW A;  3LCA A;  3RRM B;  4A3T A;  5FIO A;  4RG6 A;  3TWU A;  3ULQ A;  5KJM A;  2XRZ A;  5ENR D;  5AJL A;  1Z3Y A;  4APF A;  3CST A;  3CHR A;  5FQ6 A;  3WG7 E;  1FCH A;  5J90 A;  5EID A;  1MX4 A;  4G1T A;  1O1R A;  4JL0 A;  5KCM A;  1N9A A;  4E6H A;  1Q2Z A;  4DI3 A;  3FEY A;  4UI9 J;  3RAU A;  4XI9 A;  3E30 A;  4X8Q A;  4GMR A;  4MS6 A;  2MRI A;  3NF1 A;  2LNI A;  4WNE A;  4XKC A;  4J7W A;  1N94 A;  4MLP A;  2H6I A;  4GTR A;  1FT2 A;  1K8K G;  3L9T A;  5KNH D;  1KLX A;  3PZ1 A;  3DBS A;  4L9P A;  3ZHE B;  2R02 A;  4FAD A;  3JCK C;  4C48 B;  2I9C A;  3HXD A;  5ANR A;  3JUI A;  4WNF A;  4F7A A;  2A5E A;  2VSN A;  1JWG A;  2P9S G;  1N0R A;  3D9H A;  2R5S A;  2WXL A;  1OXJ A;  2XCB A;  2J49 A;  3SY2 A;  5AN8 A;  2IU1 A;  3HVE A;  1TNB A;  2OVF A;  5AAO A;  5AYW D;  1N52 A;  3ENE A;  2X6K A;  4LNB A;  2Y69 E;  1OWM A;  2GRL A;  2M63 A;  3J5Q B;  4DX6 D;  1V54 E;  3N71 A;  3OXG A;  2WXM A;  2Q7F A;  3IHY A;  3L6A A;  2XGO A;  1Z6T A;  2WXH A;  4LG6 A;  3VTY A;  4AOF A;  3FTZ A;  4HRL A;  3C5R A;  5FZQ A;  2DYR E;  2IO2 C;  2V8S E;  4N3B A;  4UWL A;  3LY7 A;  3FTS A;  1OWO A;  2OV8 A;  2EIK E;  4GB9 A;  4JXT A;  4G23 A;  3VLE A;  3V2O A;  3D9I A;  1FT1 A;  4GTM A;  4C0M A;  2WXQ A;  4ATG A;  3B7T A;  3SI5 A;  3FUI A;  2AWI A;  5E76 A;  1YMP A;  4J8D A;  3CIA A;  4I2W A;  1NP7 A;  4U63 A;  4G2V A;  4HB5 A;  4O1O A;  2X6I A;  5AQB A;  4UQZ A;  2EQX A;  1JWF A;  2KM4 A;  5CRV A;  1YA0 A;  2KCV A;  2XS8 A;  2AXU A;  1HXI A;  5JHA A;  3B7R L;  1S0P A;  1YYH A;  4HLE A;  2NXP A;  3ONL A;  3MKR A;  4W9R A;  1K1B A;  4CGW A;  3PE4 A;  2ETA A;  5LCW C;  4A1S A;  3EJN A;  4GYW A;  2CG3 A;  3CVL A;  3SFX A;  2VSY A;  2XPY A;  4BY6 A;  5FT9 A;  4HNA D;  1BPO A;  3DPY A;  1D8E A;  1IYG A;  3L82 A;  2P58 C;  3CVQ A;  4J8F A;  3RO2 A;  4KZC A;  4TXQ A;  5JHB A;  3TXN A;  4PS8 A;  2XEV A;  2DCP A;  3UT8 A;  1OY3 D;  3RIB A;  4XX5 A;  4K03 A;  4FJY A;  2GRN B;  4OAU C;  1MQS A;  3FUN A;  2QC9 A;  4YVQ C;  1WDY A;  1LD8 A;  3UI2 A;  2EIM E;  4UQY A;  4FJZ A;  4JA7 A;  1ZBP A;  4HLL A;  4XI0 A;  4CYM D;  4QQI A;  3ZUV B;  2QYJ A;  4FA6 A;  2XGS A;  5BV1 A;  1NA0 A;  3UM3 A;  4DX7 D;  2OOE A;  2VGY A;  1BD8 A;  3ASH A;  2LXL A;  1OCO E;  3V30 A;  4AVX A;  4GZ6 A;  5FQ4 A;  4AY6 A;  3HXF A;  3MKQ B;  5EYP F;  1U2V G;  2AJA A;  4AM9 A;  3OTN A;  4EEC A;  2VYI A;  2HE0 A;  4U95 D;  3FTX A;  4UQX A;  3FU3 A;  4GPK A;  2PM7 A;  3PDN A;  1KZP A;  3I4R B;  3HDX A;  3GZ2 A;  5ITZ F;  3QAR A;  3T8K A;  3RSE G;  3OXF A;  1TNZ A;  2J4B A;  1VDY A;  3PZ3 A;  1HO8 A;  3SQV A;  3GZ1 A;  2OVB A;  3C3O A;  1HF8 A;  4H7Y A;  3FTW A;  4JA9 A;  3PRZ A;  3DSW A;  3EHQ A;  3HG0 D;  2WXK A;  2BED A;  4JVS A;  4UWH A;  5B1B E;  3UTM A;  3TAX A;  4JD2 G;  2EIN E;  4KMO A;  5AAR A;  3Q79 A;  5CMW A;  1IKN D;  2FI7 A;  5HS0 A;  4GTP A;  3AS8 A;  3PE3 A;  4XIF A;  4BSZ B;  4PUC A;  1SA5 A;  1MZC A;  3K9I A;  2IY0 C;  4N3C A;  3V31 A;  5KWD A;  4LSZ E;  5KNG A;  3UM1 A;  2E0I A;  3SZ7 A;  3JQ1 A;  1DCE A;  1KT0 A;  5FTP A;  3LS8 A;  3TG5 A;  5JJT A;  4C0E A;  2I1K A;  1N54 A;  5CCM A;  2VGX A;  2R05 A;  3ESL A;  3UT4 A;  2LAI A;  4YDW A;  4B94 A;  4HOS A;  3L13 A;  3RK6 A;  2XEH A;  4WAF A;  5D0O D;  4I6J A;  1UJJ A;  3APD A;  2DZO A;  3MYV A;  4WND A;  3TWQ A;  4BER A;  4GA1 A;  3D9P A;  3ZXP A;  3ZEF A;  3EUV A;  2Y3A A;  4ACK A;  3TL5 A;  4BFR A;  5J08 A;  1O1T A;  2I2O A;  2J9Q A;  3R9A B;  2OEV A;  3PVL A;  4DLQ A;  4I1A A;  2C0L A;  4O6F A;  1JPL A;  1TJF A;  3QKY A;  1QNF A;  4CZ2 D;  1A5E A;  2FO7 A;  4HVB A;  3IV0 A;  3EIJ A;  3QWW A;  2VJ8 A;  2HR2 A;  2DBA A;  4Q69 A;  2IF4 A;  2JEK A;  4AP2 A;  2E2E A;  1X81 A;  5ENQ D;  1P5Q A;  4WWP A;  2XEN A;  4EPZ A;  1UW4 B;  4GPM A;  4HI8 A;  2XZT G;  3DXK G;  3CEQ A;  4GZD A;  3FUH A;  2C0M A;  3R7R A;  2PM6 A;  4A55 A;  4CDN A;  4PH4 B;  5AEN A;  2OEW A;  5ANL A;  4GMJ A;  3I4G A;  2X6H A;  3D9M A;  3FUD A;  3ASD A;  1OT8 A;  4GA2 A;  2KXP C;  4I9C A; 
#chains in the Genus database with same CATH homology
 1OCR E;  2DYR E;  2Y69 E;  3AG3 E;  2EIM E;  5B3S E;  1OCO E;  3ASN E;  2EIL E;  3WG7 E;  3ASO E;  3AG2 E;  2EIK E;  5B1B E;  1V54 E;  5IY5 E;  3ABM E;  2EIN E;  3AG1 E;  3ABL E;  2DYS E;  2EIJ E;  1OCZ E;  1V55 E;  1OCC E;  2OCC E;  3ABK E;  2ZXW E;  5B1A E;  3AG4 E;  3X2Q E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...