3X2QE

X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3x2qE00
1V54E 2DYSE 3ABKE 5B1AE 5B3SE 5IY5E 5B1BE 3ABME 3AG3E 1OCCE 3ASNE 2EIME 2EILE 3AG1E 3ASOE 2DYRE 2EIKE 3X2QE 2Y69E 3AG4E 2EIJE 1OCRE 2EINE 2ZXWE 3ABLE 3AG2E 2OCCE 1V55E 1OCZE 1OCOE 3WG7E
chains in the Genus database with same CATH superfamily
4A1GA 3V31A 1U3CA 3Q78A 5AJLA 3PH0C 3NOCD 2DYRE 2CHZA 1K8KG 4BTBA 4GMJA 4CRWA 3EHNA 4J8DA 2AW6A 3F6QA 1RW2A 3IHYA 3FU6A 4I2WA 2ZGGA 1JUQA 4CDNA 3KEAA 4MLPA 1QYMA 3QAQA 4GTMA 2QZAA 3URZA 4GZ6A 2XPZA 2C0LA 3PE3A 5KNGA 3J5QB 4GA0A 3ABKE 1O1RA 2PZIA 3HXEA 4I1OB 5EKQD 1NZNA 4MBGA 3QWPA 3FP3A 2FEZA 3FDHA 1HG5A 3ZNGA 2EIJE 3OXLA 3ULEG 4G8KA 3NZSA 4UQXA 1IQRA 4BX9A 1E8ZA 4KBQA 2GRQB 3OXGA 3TWSA 2Y69E 3DXMG 1FVFA 3CHOA 4OYSA 3SGHA 3FUDA 1OCZE 4F1SA 4DLQA 2P9KG 3SBSA 3DSWA 4G1TA 5FZSA 1H2VC 3MKQB 3PNTB 4ILHB 3DEOA 1LD7A 1N4RA 3UUXA 3PUJA 4UWHA 4WWPA 3D9PA 3FUNA 5B1BE 3D9HA 2JEKA 3ABME 2VSNA 1KLXA 5JJ6A 2CG3A 3O4ZA 3C98A 3FFLA 2B6CA 3ML9A 1N94A 2XEHA 2QYJA 4B0ZA 3LCAA 5H7PA 2L0IA 3LY7A 4NURA 2WM9A 3G2TA 2J08A 3FTSA 4URKA 4N3AA 4CZ2D 1HZ4A 1EPUA 3Q9UC 3MZLB 2IOLA 2E0IA 2OVBA 4RQIA 3LJ3A 3TG4A 4KVMA 2WXHA 2B0OE 3DXKG 3ZXSA 5J08A 5ENPD 5M72A 5LCWJ 2ZXWE 1E7UA 4DJAA 5CBOA 5EDSA 3FUFA 2WMOA 2E2EA 2NSZA 3RJVA 1SQMA 3BG0B 1OWPA 2FO7A 3DSVA 4GYYA 3U9WA 2OVFA 3AJIA 3ZXPA 3UIOC 4FA6A 4ACKA 3ABLE 4XEIG 2LXMA 3B7BA 3L6AA 2XPYA 3C5RA 4FHKA 3CK8A 1AP7A 4Y6WA 4JD2G 1O1TA 4I1AA 2ETBA 4U7EB 1FCHA 5CEAA 5AN8A 3Q49B 4JA9A 3S7BA 3HVEB 4GZ3A 5G04C 1MHQA 1N4QA 2XZDG 3LS8A 3ZPJA 5AJDA 3ZGQA 2Y4TA 4U96D 3QDNA 2I1JA 4YVOA 5A23A 2DWZA 3C3RA 3JCKC 2VSXE 2XCBA 4GTQA 3DSSA 3JYSA 4M3OA 5EILA 1G3NB 3LXUX 4C48B 2NC9A 3HXFA 2XQ0A 4DX7D 4WWOA 1RZ4A 4HLEA 4HS2A 1JCQA 2P9IG 4I17A 3T8KA 3CQCB 1QQEA 1OCRE 1UJJA 1U3DA 3FWVA 5B3SE 4IRUA 1Y8MA 3D3MA 1HF8A 3ZYLA 2CG2A 5KCMA 4XIFA 2F8YA 4BX8A 4J6IA 3CVPA 3Q7AA 4A63B 5G05C 3CVQA 2PNNA 3U4TA 4G26A 4J0UA 2GROB 5J90A 2XHEA 4GCNA 4GMLA 1UJKA 3MYVA 3QWVA 1E7VA 1IYGA 2HR2A 1B89A 1NP7A 5FINA 1DC2A 4N3BA 3E30A 1MYOA 4A55A 5BXOA 5KJMA 4ME2A 2FBNA 2J4DA 2IEJA 4EQFA 4JA7A 3QC1A 4K0RA 1OWMA 2L9BA 4F1PA 4YDOA 2OCCE 3ZEFA 4BWRA 3B7UX 4P29A 1NA3A 2HYZA 3K9IA 2XEEA 1S64A 2ZU6B 1DCEA 5KNHD 2EIME 2YINA 3E34A 4ANWA 5HS0A 4JHKA 4RG6A 1NL4A 4GYOA 3FEYA 3RRNB 4F7AA 4KVOA 2IQCA 3ASHA 5AARA 3ASNE 3LY9A 1A17A 3IKOB 3PZ4A 4JEHA 5AENA 4E6HA 3D9LA 3LY8A 1EYHA 2JLBA 4GTSA 3EJNA 4F53A 2XS1A 2VGXA 2WXQA 2EINE 5LP0A 2X6FA 5AYWD 1QZ2A 5ANRA 2LO6A 3B7TA 4Z68A 2IO3C 4GTOA 4L7TA 4AY6A 4CGWA 3IV0A 1Z5SC 2MHKA 1V54E 5B1AE 4AEZC 4DX6D 3LYAA 4RVBA 4BSXA 4WAFA 1Z3XA 3KEZA 2XRZA 4DRXE 5JA4D 3HHMA 1HFAA 3L16A 1OT8A 2GW1A 2KCVA 1YYHA 2WVIA 2DIWA 4K5AB 3T9KA 1FVHA 1TNBA 2M63A 4U0ZA 3ASFA 4HOUA 3CVVA 4PS3A 4AXHA 2I9CA 3UPVA 3DRAA 2QY7A 5AAOA 3LKUA 3RSEG 4GPKA 5T8IA 1GW6A 4YDYA 4GTTA 4B94A 3FTWA 4TRQA 2BTDA 3FH8A 3APCA 3HXBA 4HI9A 2QYUA 2Y0BG 4AJWA 3SY2A 4LNGA 3SBTB 5E75A 5D0OD 3U64A 4TXQA 3HIZA 2IFUA 4G25A 4B93B 4HRMB 1TNOA 4J8YA 4AY5A 2RG8A 2EIKE 3ZU7B 3NBNB 3AG4E 1TJFA 1JWGA 3EUVA 5KJKA 3LVQE 3NQPA 4FJYA 2LAHA 4U8VD 1KZOA 1ZU2A 4BESA 5EN5D 2LSVA 1N52A 1SVXA 2YQ8A 4O60A 3V30A 4PH4B 1PY1A 3D9JA 4GTPA 1MX6A 1KZPA 4I2ZA 5D2MC 1HE8A 4CGVA 4EBAA 3SO8A 2X6JA 4C0EA 3ZKJA 1H2TC 2V4LA 3NF1A 3R7QA 3ZIMA 1S63A 2QFCA 3FTVA 2MOWA 4DPRA 3DSTA 3PREA 2YHEA 4FLBA 1N4PA 2DVWA 2V4HC 3UKRG 3DWLG 4GTRA 2VGYA 5BV1A 4U04A 1LD8A 4ZHBA 3UMVA 1VDYA 3R7RA 3CSFA 4HNAD 3MCXA 4XKBA 1FPPA 5CCMA 1DNPA 1IKND 5JJTA 3QOUA 1NFIE 1IHBA 1D9SA 4HFGA 2WXIA 2BEDA 3PZDA 1N54A 1SA4A 3L13A 5FQ8A 2VYIA 1K1AA 2ZGDA 2WQ7A 4DUIA 3FH7A 2H6IA 4N2SA 4WNFA 4FHJA 1L5JA 4K03A 4UI9J 1D8EA 3RIBA 5KJNA 3IXEA 1QBQA 4XKCA 1IQUA 4G2VA 2EILE 4CDMA 1IHGA 5FIOA 3CHMA 2WQHA 4H7XA 3HYMB 3VLEA 5BXUA 5HRYA 4B8CB 3ZN3A 4KZCA 3Q79A 4UWFA 4RLYA 3C72A 5JMND 5LFAA 5BW8C 1TN8A 4HLLA 3ZFWA 4MKTA 4UUCA 2GRLA 4JC8A 3X2QE 3RRMB 2FULA 4A1SA 3DEPA 3PRZA 1S0PA 5FZRA 3W9FA 1P5QA 2LUHA 5FT9A 2XEVA 2J07A 4C0MA 2XGSA 3UINC 3QKYA 3UM1A 4B89A 1BPOA 5FWQA 2C0MA 2BF0X 4Y6CA 2H6HA 3Q15A 4WNGA 3EU5A 2IOSA 3U3WA 4U95D 1ZB1A 3Q73A 4Q94A 3RKVA 5FQ7A 5LCWC 2KZTB 4APOA 5AQBA 4TXPA 3AG3E 4L23A 2VSOE 4O6FA 4GAAA 5D0QD 3UM3A 3PS6A 3FUHA 5CMYA 4NIKA 4BSZB 4CYMD 1JWFA 1HX8A 2AJAA 2VSYA 3B7SA 5KWDA 4HRLA 4L9PA 5BUZA 2PQRA 4JXTA 4GA1A 3MEKA 4D10C 2KM4A 4EBAG 3I4GA 1XGWA 3ESLA 3WXXA 2FO1E 3Q75A 3E37A 3RO3A 3DSUA 2WXGA 4GMRA 1BLXB 3UI2A 3TWUA 2OEWA 2V5FA 5CEDB 3KAEA 4PDXA 3FUEA 1N0QA 4CT4A 2P9UG 4JPSA 4AP2A 2I6HA 3UT8A 2WXJA 4ZFHA 3ML8A 2V8SE 2QC9A 1WG0A 3QWWA 3EIQC 1PC2A 2R2LA 1E8YA 2XRYA 1YCSB 4TXRA 5G2NA 3UT7A 3UM2A 4W9RA 1N9AA 1E8WA 3ESKA 5ENQD 2IF4A 2I1KA 2IJGX 3CGHA 4PUCA 3TWRA 4EZJA 2IONA 3AU5A 4CT0A 3UXGA 1E8XA 4JEUA 2VTBA 2YHCA 4EZLA 2WQ6A 1FT2A 3CSTA 3TWQA 3BEEA 3MV2B 5DIZA 4OAUC 2JABA 4K5BA 4FJZA 2V0PA 3TAXA 2VGXB 3L08A 5DBKA 3APDA 3SD5A 4NQ0A 1BD8A 5G55A 4HRNA 2X6KA 4CCAA 4I6GA 1JCRA 3AS5A 5CRVA 3FEXA 1OWOA 3V2XA 3HDXA 2P2CP 3R9AB 3G2SA 1OWLA 2RFMA 4ANUA 3JUEA 3KSLA 5CERB 3VLFA 2XGOA 5ANLA 3NAWA 5CECB 3B95A 3UKUG 3JXJA 4L2LA 4DI3A 3B13A 2Y1LE 3AS4A 2KXPC 3BG1B 3QARA 4O1OA 5JHAA 2MYOA 3NOGD 3GZ1A 3V2OA 5FQ4A 2XZTG 4HOTA 2P9LG 3SZ7A 3AG2E 4LRZA 4U63A 3GW4A 5CMWA 4I1MA 3DBSA 4APFA 5HQ8A 3CVYA 4KZ0A 2X6IA 1SZ9A 2DZNA 3ZVVA 1ZBPA 5G04J 4R7LA 1HO8A 4UI9K 1MQSA 3ENEA 4M7CA 3SNXA 3ZYQA 3FHEA 3EHQA 2R17C 3ASGA 3CQGB 3CHSA 1N4SA 3HRAA 4LG6A 2X6HA 4BT9A 3FTXA 4H7YA 4U8YD 4U8HA 4TUUA 1V55E 1BI8B 1TNZA 3HXDA 4I6JA 3EIJA 3G2VA 3PEUB 4N5CA 3HXCA 3FUMA 3PNLB 5E76A 2OEVA 3CHQA 3ONLA 3I4RB 3D9NA 2XCCA 1TR4A 4A3TA 3RAUA 2AVPA 3FUIA 5AQAA 4MRUA 5ENSD 3TXNA 1E96B 3FU0A 2KCKA 3FU3A 2L0TB 4XZ4A 5ARFA 3B7RL 5BT1A 3L17A 3C3OA 5C1DA 3NB2A 2KC7A 5IY5E 4UI9C 1Y6IA 3ZRHA 2GRMA 3S7JA 2CHXA 3TWXA 1ELWA 3ASDA 2P9SG 3E33A 2ILRA 4JVSA 2XPIA 4O1PA 3CVWA 1DCQA 2WMNA 1PAQA 3E32A 2ETAA 4I43A 2P58C 3JUIA 2F8XK 3R9MA 5ITZF 2VTBB 4FLHA 1NA0A 2LAIA 1EF1C 2ZISA 1UN8A 3EDTB 4HOSA 2VQ2A 4XI9A 2GGFA 4OVVA 1H6KA 4JZYA 4MS6A 4OVUA 3E4BA 3LJNA 4PS8A 4DI4A 4DX5D 4G24A 3EU9A 4J8EA 2RD0A 1WM5A 1MJ0A 2R03A 3L82A 3DPYA 1TNYA 1MZCA 1MX4A 2OOEA 3TWVA 5AQ9A 2IO2C 4I6EA 2HO1A 5KJLA 3CK7A 4L2YA 3L54A 2LSUA 2I2OA 3GYZA 5FTPA 4FADA 5CBNA 3NZUA 4WNDA 3DSXA 3MKRA 5HKPA 4GZCA 3T8MA 2GRNB 4EPZA 2X38A 1H0AA 2A4ZA 3ULQA 3IHVA 4FULA 3I5PA 3ZHEA 3P1UA 2CHWA 4X8QA 3QB2A 3RU0A 2ONDA 4B8AA 4AM9A 2HM8A 2KCLA 2AWIA 2L6JA 4G11A 1JPLA 5CRUA 3TL5A 4I9EA 1O5MA 3T5XA 2L6BA 3ZHEB 2WXFA 3UX4A 4WWNA 3CEQA 5EYPF 4Q69A 2CFUA 3Q9NC 4C9BB 4LUNU 3TG5A 2UY1B 4HXIA 3CHRA 3G2WA 1AWCB 3Q4AB 4YVQC 2WXMA 4FP7A 3P2BA 3CIAA 5ENTD 2Q7FA 4XE0A 3QNKA 4A3VA 5A6CA 4BTAA 3CR3A 2OV8A 3SHFA 2R59A 1WY6A 2UWJG 5EYLA 3QJZA 3BU8A 3MV3B 4PS7A 3FULA 1OXJA 3L22A 2F37A 4WNEA 3G2UA 2WXLA 1N11A 3BQOA 4LERA 4BT8A 2NXPA 1OCCE 5A7DB 4WUYA 3FUJA 3D9IA 5D66A 3CKBA 1EDUA 4HB5A 2DZOA 5BNWA 5LX8A 4N5QA 4F3VA 3S7FA 4GPMA 3SFZA 1Q2ZA 1D8DA 2VJ8A 4OAVB 4EZKA 5FQ6A 3SFYA 3SF4A 1KT1A 3FUKA 1YMPA 3CK9A 2AXZA 1H2UA 4RSYA 2J49A 3JXIA 5FZQA 1JCSA 4AOFA 3FY4A 3U66A 2ETCA 4LNBA 4YDWA 3PEVB 3JQ1A 4LSZE 1HS6A 4XI0A 3AU4A 3KS2A 2V5QC 2AXVA 3N71A 3TWTA 2R05A 4L1BA 1H19A 1TJCA 1TEZA 3ZW3A 3UIPC 4GB9A 3RRUA 4ILIA 3ISMC 1TN6A 4K5CA 4XX5A 4BETA 4BERA 3CLJA 4AIFA 4UQYA 3LVRE 1UOHA 4J7WA 1BI7B 4DX1A 3SI5A 4IYPA 4UWLA 1SZAA 4TUMA 3TWWA 3S7DA 3TJPA 1UG3A 2EQXA 1O1SA 5EIDA 3Q5MA 3FTYA 3SFXA 2CFZA 2Y3AA 2DCPA 2KATA 3KSQA 4G8LA 3OAWA 2KZTA 4HOQA 5FJYA 4BEPA 3VLDA 2C2LA 1OCOE 3LPZA 1LF8A 4V3IA 3O48A 3PE4A 3C3QA 1ELKA 4GCOA 5BV0A 2XS8A 3HVEA 2NYJA 4KXKB 3CVNA 2LXLA 3ZYMA 4GZDA 3PDNA 3LDZA 4KMOA 2WXRA 4GTVA 1IXVA 3ZYKA 4QFVA 3FTZA 4ACLA 3KD7A 2RKKA 3ONKA 3AG1E 5ENOD 4GYWA 4YNDA 4LNUD 1TYQG 3PVLA 3T5VA 3D9OA 3Q7FA 1Z6TA 2UY1A 2Y4UA 3I3NA 2PM6A 5BPPA 2BKKB 4GZ5A 4CDRA 1A5EA 3V79K 5AQ7A 4JHJA 3S2AA 5ENRD 2KBXA 2A5EA 2MRIA 4ANVA 2DBAA 4JL0A 4AVXA 2A5UA 1KT0A 5KBAA 4KT6B 3FU5A 1TN7A 4JHRA 3CVXA 4E85A 4BY6A 1SW6A 3FH5A 5ENNA 4J8FA 4AV7A 3UM0A 2IY0C 2BKGA 2WPVA 3MGBA 2R5SA 3DPDA 2PL2A 2VGEA 1HXIA 4ABNA 1BU9A 1WAO1 3IBEA 5LOZA 4BFRA 3APFA 4EECA 3CHPA 4JB8P 4DLOA 3MA5A 3QK0A 4UWGA 3W9GA 4LCTA 4ILGA 5ARGA 2H6GA 3ZUVB 2FF4A 5EIBE 3TGOA 3EHMA 1YA0A 3PUKA 1E90A 3VTXA 1HH8A 3GZ2A 1N0RA 2WB2A 1DVPA 4TV3A 2BUGA 4EHMA 5HI7A 4N2QA 1UW4B 4JW1A 4Q96A 1K1BA 3IEGA 3BUAA 1N95A 3OTNA 2WXKA 4I9CA 2GRPB 3EHRA 3JQ0A 3UT4A 2DYSE 1H6OA 1OY3D 4FC8A 3FTUA 3LEWA 3RK6A 1OWNA 4LEUA 5JHBA 4QQIA 1KPSB 1K3ZD 1INZA 4IN3B 3TXMA 4UQZA 5G05J 3SQVA 3MX3A 1NI1A 3MJWA 4GU5A 3PZ1A 1W3BA 2F0YA 4UWKA 4RG9A 4FU3A 1UN9A 3AAAC 2AXUA 2FI7A 1H6PA 3RO2A 2IU1A 3HG0D 4NACA 1FT1A 2J09A 3WG7E 5C2YA 3CKCA 1S70B 2J9QA 3MKQA 4HVBA 2ZIRA 4GA2A 4KYOB 4YDEA 1QNFA 1ELRA 1U2VG 1HG2A 4J8SA 4U0UA 4HBDA 4NRHB 4HQDA 4CEMA 2PM7A 4ANXA 3D9KA 3D9MA 1WDYA 4F6RD 1OUVA 2LNIA 1LTXA 2J4BA 3GZSA 3PZ2A 5AIJA 1HU3A 4N3CA 2P9NG 3ASOE 5EX0A 3CV0A 2J8SD 1X81A 2WXNA 3J5PA 2R02A 1SA5A 2X3MA 4ATGA 2GRRB 3Q47B 5EX3A 2RFAA 3UQ3A 2HE0A 4IULA 3PZ3A 4N39A 5CHEE 3CVUA 4HORA 4DX2A 1MX2A 4G23A 3L9TA 3CVLA 1Z3YA 4HI8A 3OXFA 4U07A 2WXPA 3AS8A 5CCLA 3VTYA 2YNQA 5JJ7A 1XNFA 5T3RA 2XENA 4U0SA 4ATZD 2WXOA 4DK5A 3UTMA 3ULYA 2H6FA 2P9PG 1TNUA 2PQNA 5T4YA 2XGMA 1X5BA
chains in the Genus database with same CATH topology
1V54E 2DYSE 3ABKE 5B1AE 5B3SE 5IY5E 5B1BE 3ABME 3AG3E 1OCCE 3ASNE 2EIME 2EILE 3AG1E 3ASOE 2DYRE 2EIKE 3X2QE 2Y69E 3AG4E 2EIJE 1OCRE 2EINE 2ZXWE 3ABLE 3AG2E 2OCCE 1V55E 1OCZE 1OCOE 3WG7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 E;  2DYS E;  3ABK E;  5B1A E;  5B3S E;  5IY5 E;  5B1B E;  3ABM E;  3AG3 E;  1OCC E;  3ASN E;  2EIM E;  2EIL E;  3AG1 E;  3ASO E;  2DYR E;  2EIK E;  3X2Q E;  2Y69 E;  3AG4 E;  2EIJ E;  1OCR E;  2EIN E;  2ZXW E;  3ABL E;  3AG2 E;  2OCC E;  1V55 E;  1OCZ E;  1OCO E;  3WG7 E; 
#chains in the Genus database with same CATH topology
 4A1G A;  3V31 A;  1U3C A;  3Q78 A;  5AJL A;  3PH0 C;  3NOC D;  2DYR E;  2CHZ A;  1K8K G;  4BTB A;  4GMJ A;  4CRW A;  3EHN A;  4J8D A;  2AW6 A;  3F6Q A;  1RW2 A;  3IHY A;  3FU6 A;  4I2W A;  2ZGG A;  1JUQ A;  4CDN A;  3KEA A;  4MLP A;  1QYM A;  3QAQ A;  4GTM A;  2QZA A;  3URZ A;  4GZ6 A;  2XPZ A;  2C0L A;  3PE3 A;  5KNG A;  3J5Q B;  4GA0 A;  3ABK E;  1O1R A;  2PZI A;  3HXE A;  4I1O B;  5EKQ D;  1NZN A;  4MBG A;  3QWP A;  3FP3 A;  2FEZ A;  3FDH A;  1HG5 A;  3ZNG A;  2EIJ E;  3OXL A;  3ULE G;  4G8K A;  3NZS A;  4UQX A;  1IQR A;  4BX9 A;  1E8Z A;  4KBQ A;  2GRQ B;  3OXG A;  3TWS A;  2Y69 E;  3DXM G;  1FVF A;  3CHO A;  4OYS A;  3SGH A;  3FUD A;  1OCZ E;  4F1S A;  4DLQ A;  2P9K G;  3SBS A;  3DSW A;  4G1T A;  5FZS A;  1H2V C;  3MKQ B;  3PNT B;  4ILH B;  3DEO A;  1LD7 A;  1N4R A;  3UUX A;  3PUJ A;  4UWH A;  4WWP A;  3D9P A;  3FUN A;  5B1B E;  3D9H A;  2JEK A;  3ABM E;  2VSN A;  1KLX A;  5JJ6 A;  2CG3 A;  3O4Z A;  3C98 A;  3FFL A;  2B6C A;  3ML9 A;  1N94 A;  2XEH A;  2QYJ A;  4B0Z A;  3LCA A;  5H7P A;  2L0I A;  3LY7 A;  4NUR A;  2WM9 A;  3G2T A;  2J08 A;  3FTS A;  4URK A;  4N3A A;  4CZ2 D;  1HZ4 A;  1EPU A;  3Q9U C;  3MZL B;  2IOL A;  2E0I A;  2OVB A;  4RQI A;  3LJ3 A;  3TG4 A;  4KVM A;  2WXH A;  2B0O E;  3DXK G;  3ZXS A;  5J08 A;  5ENP D;  5M72 A;  5LCW J;  2ZXW E;  1E7U A;  4DJA A;  5CBO A;  5EDS A;  3FUF A;  2WMO A;  2E2E A;  2NSZ A;  3RJV A;  1SQM A;  3BG0 B;  1OWP A;  2FO7 A;  3DSV A;  4GYY A;  3U9W A;  2OVF A;  3AJI A;  3ZXP A;  3UIO C;  4FA6 A;  4ACK A;  3ABL E;  4XEI G;  2LXM A;  3B7B A;  3L6A A;  2XPY A;  3C5R A;  4FHK A;  3CK8 A;  1AP7 A;  4Y6W A;  4JD2 G;  1O1T A;  4I1A A;  2ETB A;  4U7E B;  1FCH A;  5CEA A;  5AN8 A;  3Q49 B;  4JA9 A;  3S7B A;  3HVE B;  4GZ3 A;  5G04 C;  1MHQ A;  1N4Q A;  2XZD G;  3LS8 A;  3ZPJ A;  5AJD A;  3ZGQ A;  2Y4T A;  4U96 D;  3QDN A;  2I1J A;  4YVO A;  5A23 A;  2DWZ A;  3C3R A;  3JCK C;  2VSX E;  2XCB A;  4GTQ A;  3DSS A;  3JYS A;  4M3O A;  5EIL A;  1G3N B;  3LXU X;  4C48 B;  2NC9 A;  3HXF A;  2XQ0 A;  4DX7 D;  4WWO A;  1RZ4 A;  4HLE A;  4HS2 A;  1JCQ A;  2P9I G;  4I17 A;  3T8K A;  3CQC B;  1QQE A;  1OCR E;  1UJJ A;  1U3D A;  3FWV A;  5B3S E;  4IRU A;  1Y8M A;  3D3M A;  1HF8 A;  3ZYL A;  2CG2 A;  5KCM A;  4XIF A;  2F8Y A;  4BX8 A;  4J6I A;  3CVP A;  3Q7A A;  4A63 B;  5G05 C;  3CVQ A;  2PNN A;  3U4T A;  4G26 A;  4J0U A;  2GRO B;  5J90 A;  2XHE A;  4GCN A;  4GML A;  1UJK A;  3MYV A;  3QWV A;  1E7V A;  1IYG A;  2HR2 A;  1B89 A;  1NP7 A;  5FIN A;  1DC2 A;  4N3B A;  3E30 A;  1MYO A;  4A55 A;  5BXO A;  5KJM A;  4ME2 A;  2FBN A;  2J4D A;  2IEJ A;  4EQF A;  4JA7 A;  3QC1 A;  4K0R A;  1OWM A;  2L9B A;  4F1P A;  4YDO A;  2OCC E;  3ZEF A;  4BWR A;  3B7U X;  4P29 A;  1NA3 A;  2HYZ A;  3K9I A;  2XEE A;  1S64 A;  2ZU6 B;  1DCE A;  5KNH D;  2EIM E;  2YIN A;  3E34 A;  4ANW A;  5HS0 A;  4JHK A;  4RG6 A;  1NL4 A;  4GYO A;  3FEY A;  3RRN B;  4F7A A;  4KVO A;  2IQC A;  3ASH A;  5AAR A;  3ASN E;  3LY9 A;  1A17 A;  3IKO B;  3PZ4 A;  4JEH A;  5AEN A;  4E6H A;  3D9L A;  3LY8 A;  1EYH A;  2JLB A;  4GTS A;  3EJN A;  4F53 A;  2XS1 A;  2VGX A;  2WXQ A;  2EIN E;  5LP0 A;  2X6F A;  5AYW D;  1QZ2 A;  5ANR A;  2LO6 A;  3B7T A;  4Z68 A;  2IO3 C;  4GTO A;  4L7T A;  4AY6 A;  4CGW A;  3IV0 A;  1Z5S C;  2MHK A;  1V54 E;  5B1A E;  4AEZ C;  4DX6 D;  3LYA A;  4RVB A;  4BSX A;  4WAF A;  1Z3X A;  3KEZ A;  2XRZ A;  4DRX E;  5JA4 D;  3HHM A;  1HFA A;  3L16 A;  1OT8 A;  2GW1 A;  2KCV A;  1YYH A;  2WVI A;  2DIW A;  4K5A B;  3T9K A;  1FVH A;  1TNB A;  2M63 A;  4U0Z A;  3ASF A;  4HOU A;  3CVV A;  4PS3 A;  4AXH A;  2I9C A;  3UPV A;  3DRA A;  2QY7 A;  5AAO A;  3LKU A;  3RSE G;  4GPK A;  5T8I A;  1GW6 A;  4YDY A;  4GTT A;  4B94 A;  3FTW A;  4TRQ A;  2BTD A;  3FH8 A;  3APC A;  3HXB A;  4HI9 A;  2QYU A;  2Y0B G;  4AJW A;  3SY2 A;  4LNG A;  3SBT B;  5E75 A;  5D0O D;  3U64 A;  4TXQ A;  3HIZ A;  2IFU A;  4G25 A;  4B93 B;  4HRM B;  1TNO A;  4J8Y A;  4AY5 A;  2RG8 A;  2EIK E;  3ZU7 B;  3NBN B;  3AG4 E;  1TJF A;  1JWG A;  3EUV A;  5KJK A;  3LVQ E;  3NQP A;  4FJY A;  2LAH A;  4U8V D;  1KZO A;  1ZU2 A;  4BES A;  5EN5 D;  2LSV A;  1N52 A;  1SVX A;  2YQ8 A;  4O60 A;  3V30 A;  4PH4 B;  1PY1 A;  3D9J A;  4GTP A;  1MX6 A;  1KZP A;  4I2Z A;  5D2M C;  1HE8 A;  4CGV A;  4EBA A;  3SO8 A;  2X6J A;  4C0E A;  3ZKJ A;  1H2T C;  2V4L A;  3NF1 A;  3R7Q A;  3ZIM A;  1S63 A;  2QFC A;  3FTV A;  2MOW A;  4DPR A;  3DST A;  3PRE A;  2YHE A;  4FLB A;  1N4P A;  2DVW A;  2V4H C;  3UKR G;  3DWL G;  4GTR A;  2VGY A;  5BV1 A;  4U04 A;  1LD8 A;  4ZHB A;  3UMV A;  1VDY A;  3R7R A;  3CSF A;  4HNA D;  3MCX A;  4XKB A;  1FPP A;  5CCM A;  1DNP A;  1IKN D;  5JJT A;  3QOU A;  1NFI E;  1IHB A;  1D9S A;  4HFG A;  2WXI A;  2BED A;  3PZD A;  1N54 A;  1SA4 A;  3L13 A;  5FQ8 A;  2VYI A;  1K1A A;  2ZGD A;  2WQ7 A;  4DUI A;  3FH7 A;  2H6I A;  4N2S A;  4WNF A;  4FHJ A;  1L5J A;  4K03 A;  4UI9 J;  1D8E A;  3RIB A;  5KJN A;  3IXE A;  1QBQ A;  4XKC A;  1IQU A;  4G2V A;  2EIL E;  4CDM A;  1IHG A;  5FIO A;  3CHM A;  2WQH A;  4H7X A;  3HYM B;  3VLE A;  5BXU A;  5HRY A;  4B8C B;  3ZN3 A;  4KZC A;  3Q79 A;  4UWF A;  4RLY A;  3C72 A;  5JMN D;  5LFA A;  5BW8 C;  1TN8 A;  4HLL A;  3ZFW A;  4MKT A;  4UUC A;  2GRL A;  4JC8 A;  3X2Q E;  3RRM B;  2FUL A;  4A1S A;  3DEP A;  3PRZ A;  1S0P A;  5FZR A;  3W9F A;  1P5Q A;  2LUH A;  5FT9 A;  2XEV A;  2J07 A;  4C0M A;  2XGS A;  3UIN C;  3QKY A;  3UM1 A;  4B89 A;  1BPO A;  5FWQ A;  2C0M A;  2BF0 X;  4Y6C A;  2H6H A;  3Q15 A;  4WNG A;  3EU5 A;  2IOS A;  3U3W A;  4U95 D;  1ZB1 A;  3Q73 A;  4Q94 A;  3RKV A;  5FQ7 A;  5LCW C;  2KZT B;  4APO A;  5AQB A;  4TXP A;  3AG3 E;  4L23 A;  2VSO E;  4O6F A;  4GAA A;  5D0Q D;  3UM3 A;  3PS6 A;  3FUH A;  5CMY A;  4NIK A;  4BSZ B;  4CYM D;  1JWF A;  1HX8 A;  2AJA A;  2VSY A;  3B7S A;  5KWD A;  4HRL A;  4L9P A;  5BUZ A;  2PQR A;  4JXT A;  4GA1 A;  3MEK A;  4D10 C;  2KM4 A;  4EBA G;  3I4G A;  1XGW A;  3ESL A;  3WXX A;  2FO1 E;  3Q75 A;  3E37 A;  3RO3 A;  3DSU A;  2WXG A;  4GMR A;  1BLX B;  3UI2 A;  3TWU A;  2OEW A;  2V5F A;  5CED B;  3KAE A;  4PDX A;  3FUE A;  1N0Q A;  4CT4 A;  2P9U G;  4JPS A;  4AP2 A;  2I6H A;  3UT8 A;  2WXJ A;  4ZFH A;  3ML8 A;  2V8S E;  2QC9 A;  1WG0 A;  3QWW A;  3EIQ C;  1PC2 A;  2R2L A;  1E8Y A;  2XRY A;  1YCS B;  4TXR A;  5G2N A;  3UT7 A;  3UM2 A;  4W9R A;  1N9A A;  1E8W A;  3ESK A;  5ENQ D;  2IF4 A;  2I1K A;  2IJG X;  3CGH A;  4PUC A;  3TWR A;  4EZJ A;  2ION A;  3AU5 A;  4CT0 A;  3UXG A;  1E8X A;  4JEU A;  2VTB A;  2YHC A;  4EZL A;  2WQ6 A;  1FT2 A;  3CST A;  3TWQ A;  3BEE A;  3MV2 B;  5DIZ A;  4OAU C;  2JAB A;  4K5B A;  4FJZ A;  2V0P A;  3TAX A;  2VGX B;  3L08 A;  5DBK A;  3APD A;  3SD5 A;  4NQ0 A;  1BD8 A;  5G55 A;  4HRN A;  2X6K A;  4CCA A;  4I6G A;  1JCR A;  3AS5 A;  5CRV A;  3FEX A;  1OWO A;  3V2X A;  3HDX A;  2P2C P;  3R9A B;  3G2S A;  1OWL A;  2RFM A;  4ANU A;  3JUE A;  3KSL A;  5CER B;  3VLF A;  2XGO A;  5ANL A;  3NAW A;  5CEC B;  3B95 A;  3UKU G;  3JXJ A;  4L2L A;  4DI3 A;  3B13 A;  2Y1L E;  3AS4 A;  2KXP C;  3BG1 B;  3QAR A;  4O1O A;  5JHA A;  2MYO A;  3NOG D;  3GZ1 A;  3V2O A;  5FQ4 A;  2XZT G;  4HOT A;  2P9L G;  3SZ7 A;  3AG2 E;  4LRZ A;  4U63 A;  3GW4 A;  5CMW A;  4I1M A;  3DBS A;  4APF A;  5HQ8 A;  3CVY A;  4KZ0 A;  2X6I A;  1SZ9 A;  2DZN A;  3ZVV A;  1ZBP A;  5G04 J;  4R7L A;  1HO8 A;  4UI9 K;  1MQS A;  3ENE A;  4M7C A;  3SNX A;  3ZYQ A;  3FHE A;  3EHQ A;  2R17 C;  3ASG A;  3CQG B;  3CHS A;  1N4S A;  3HRA A;  4LG6 A;  2X6H A;  4BT9 A;  3FTX A;  4H7Y A;  4U8Y D;  4U8H A;  4TUU A;  1V55 E;  1BI8 B;  1TNZ A;  3HXD A;  4I6J A;  3EIJ A;  3G2V A;  3PEU B;  4N5C A;  3HXC A;  3FUM A;  3PNL B;  5E76 A;  2OEV A;  3CHQ A;  3ONL A;  3I4R B;  3D9N A;  2XCC A;  1TR4 A;  4A3T A;  3RAU A;  2AVP A;  3FUI A;  5AQA A;  4MRU A;  5ENS D;  3TXN A;  1E96 B;  3FU0 A;  2KCK A;  3FU3 A;  2L0T B;  4XZ4 A;  5ARF A;  3B7R L;  5BT1 A;  3L17 A;  3C3O A;  5C1D A;  3NB2 A;  2KC7 A;  5IY5 E;  4UI9 C;  1Y6I A;  3ZRH A;  2GRM A;  3S7J A;  2CHX A;  3TWX A;  1ELW A;  3ASD A;  2P9S G;  3E33 A;  2ILR A;  4JVS A;  2XPI A;  4O1P A;  3CVW A;  1DCQ A;  2WMN A;  1PAQ A;  3E32 A;  2ETA A;  4I43 A;  2P58 C;  3JUI A;  2F8X K;  3R9M A;  5ITZ F;  2VTB B;  4FLH A;  1NA0 A;  2LAI A;  1EF1 C;  2ZIS A;  1UN8 A;  3EDT B;  4HOS A;  2VQ2 A;  4XI9 A;  2GGF A;  4OVV A;  1H6K A;  4JZY A;  4MS6 A;  4OVU A;  3E4B A;  3LJN A;  4PS8 A;  4DI4 A;  4DX5 D;  4G24 A;  3EU9 A;  4J8E A;  2RD0 A;  1WM5 A;  1MJ0 A;  2R03 A;  3L82 A;  3DPY A;  1TNY A;  1MZC A;  1MX4 A;  2OOE A;  3TWV A;  5AQ9 A;  2IO2 C;  4I6E A;  2HO1 A;  5KJL A;  3CK7 A;  4L2Y A;  3L54 A;  2LSU A;  2I2O A;  3GYZ A;  5FTP A;  4FAD A;  5CBN A;  3NZU A;  4WND A;  3DSX A;  3MKR A;  5HKP A;  4GZC A;  3T8M A;  2GRN B;  4EPZ A;  2X38 A;  1H0A A;  2A4Z A;  3ULQ A;  3IHV A;  4FUL A;  3I5P A;  3ZHE A;  3P1U A;  2CHW A;  4X8Q A;  3QB2 A;  3RU0 A;  2OND A;  4B8A A;  4AM9 A;  2HM8 A;  2KCL A;  2AWI A;  2L6J A;  4G11 A;  1JPL A;  5CRU A;  3TL5 A;  4I9E A;  1O5M A;  3T5X A;  2L6B A;  3ZHE B;  2WXF A;  3UX4 A;  4WWN A;  3CEQ A;  5EYP F;  4Q69 A;  2CFU A;  3Q9N C;  4C9B B;  4LUN U;  3TG5 A;  2UY1 B;  4HXI A;  3CHR A;  3G2W A;  1AWC B;  3Q4A B;  4YVQ C;  2WXM A;  4FP7 A;  3P2B A;  3CIA A;  5ENT D;  2Q7F A;  4XE0 A;  3QNK A;  4A3V A;  5A6C A;  4BTA A;  3CR3 A;  2OV8 A;  3SHF A;  2R59 A;  1WY6 A;  2UWJ G;  5EYL A;  3QJZ A;  3BU8 A;  3MV3 B;  4PS7 A;  3FUL A;  1OXJ A;  3L22 A;  2F37 A;  4WNE A;  3G2U A;  2WXL A;  1N11 A;  3BQO A;  4LER A;  4BT8 A;  2NXP A;  1OCC E;  5A7D B;  4WUY A;  3FUJ A;  3D9I A;  5D66 A;  3CKB A;  1EDU A;  4HB5 A;  2DZO A;  5BNW A;  5LX8 A;  4N5Q A;  4F3V A;  3S7F A;  4GPM A;  3SFZ A;  1Q2Z A;  1D8D A;  2VJ8 A;  4OAV B;  4EZK A;  5FQ6 A;  3SFY A;  3SF4 A;  1KT1 A;  3FUK A;  1YMP A;  3CK9 A;  2AXZ A;  1H2U A;  4RSY A;  2J49 A;  3JXI A;  5FZQ A;  1JCS A;  4AOF A;  3FY4 A;  3U66 A;  2ETC A;  4LNB A;  4YDW A;  3PEV B;  3JQ1 A;  4LSZ E;  1HS6 A;  4XI0 A;  3AU4 A;  3KS2 A;  2V5Q C;  2AXV A;  3N71 A;  3TWT A;  2R05 A;  4L1B A;  1H19 A;  1TJC A;  1TEZ A;  3ZW3 A;  3UIP C;  4GB9 A;  3RRU A;  4ILI A;  3ISM C;  1TN6 A;  4K5C A;  4XX5 A;  4BET A;  4BER A;  3CLJ A;  4AIF A;  4UQY A;  3LVR E;  1UOH A;  4J7W A;  1BI7 B;  4DX1 A;  3SI5 A;  4IYP A;  4UWL A;  1SZA A;  4TUM A;  3TWW A;  3S7D A;  3TJP A;  1UG3 A;  2EQX A;  1O1S A;  5EID A;  3Q5M A;  3FTY A;  3SFX A;  2CFZ A;  2Y3A A;  2DCP A;  2KAT A;  3KSQ A;  4G8L A;  3OAW A;  2KZT A;  4HOQ A;  5FJY A;  4BEP A;  3VLD A;  2C2L A;  1OCO E;  3LPZ A;  1LF8 A;  4V3I A;  3O48 A;  3PE4 A;  3C3Q A;  1ELK A;  4GCO A;  5BV0 A;  2XS8 A;  3HVE A;  2NYJ A;  4KXK B;  3CVN A;  2LXL A;  3ZYM A;  4GZD A;  3PDN A;  3LDZ A;  4KMO A;  2WXR A;  4GTV A;  1IXV A;  3ZYK A;  4QFV A;  3FTZ A;  4ACL A;  3KD7 A;  2RKK A;  3ONK A;  3AG1 E;  5ENO D;  4GYW A;  4YND A;  4LNU D;  1TYQ G;  3PVL A;  3T5V A;  3D9O A;  3Q7F A;  1Z6T A;  2UY1 A;  2Y4U A;  3I3N A;  2PM6 A;  5BPP A;  2BKK B;  4GZ5 A;  4CDR A;  1A5E A;  3V79 K;  5AQ7 A;  4JHJ A;  3S2A A;  5ENR D;  2KBX A;  2A5E A;  2MRI A;  4ANV A;  2DBA A;  4JL0 A;  4AVX A;  2A5U A;  1KT0 A;  5KBA A;  4KT6 B;  3FU5 A;  1TN7 A;  4JHR A;  3CVX A;  4E85 A;  4BY6 A;  1SW6 A;  3FH5 A;  5ENN A;  4J8F A;  4AV7 A;  3UM0 A;  2IY0 C;  2BKG A;  2WPV A;  3MGB A;  2R5S A;  3DPD A;  2PL2 A;  2VGE A;  1HXI A;  4ABN A;  1BU9 A;  1WAO 1;  3IBE A;  5LOZ A;  4BFR A;  3APF A;  4EEC A;  3CHP A;  4JB8 P;  4DLO A;  3MA5 A;  3QK0 A;  4UWG A;  3W9G A;  4LCT A;  4ILG A;  5ARG A;  2H6G A;  3ZUV B;  2FF4 A;  5EIB E;  3TGO A;  3EHM A;  1YA0 A;  3PUK A;  1E90 A;  3VTX A;  1HH8 A;  3GZ2 A;  1N0R A;  2WB2 A;  1DVP A;  4TV3 A;  2BUG A;  4EHM A;  5HI7 A;  4N2Q A;  1UW4 B;  4JW1 A;  4Q96 A;  1K1B A;  3IEG A;  3BUA A;  1N95 A;  3OTN A;  2WXK A;  4I9C A;  2GRP B;  3EHR A;  3JQ0 A;  3UT4 A;  2DYS E;  1H6O A;  1OY3 D;  4FC8 A;  3FTU A;  3LEW A;  3RK6 A;  1OWN A;  4LEU A;  5JHB A;  4QQI A;  1KPS B;  1K3Z D;  1INZ A;  4IN3 B;  3TXM A;  4UQZ A;  5G05 J;  3SQV A;  3MX3 A;  1NI1 A;  3MJW A;  4GU5 A;  3PZ1 A;  1W3B A;  2F0Y A;  4UWK A;  4RG9 A;  4FU3 A;  1UN9 A;  3AAA C;  2AXU A;  2FI7 A;  1H6P A;  3RO2 A;  2IU1 A;  3HG0 D;  4NAC A;  1FT1 A;  2J09 A;  3WG7 E;  5C2Y A;  3CKC A;  1S70 B;  2J9Q A;  3MKQ A;  4HVB A;  2ZIR A;  4GA2 A;  4KYO B;  4YDE A;  1QNF A;  1ELR A;  1U2V G;  1HG2 A;  4J8S A;  4U0U A;  4HBD A;  4NRH B;  4HQD A;  4CEM A;  2PM7 A;  4ANX A;  3D9K A;  3D9M A;  1WDY A;  4F6R D;  1OUV A;  2LNI A;  1LTX A;  2J4B A;  3GZS A;  3PZ2 A;  5AIJ A;  1HU3 A;  4N3C A;  2P9N G;  3ASO E;  5EX0 A;  3CV0 A;  2J8S D;  1X81 A;  2WXN A;  3J5P A;  2R02 A;  1SA5 A;  2X3M A;  4ATG A;  2GRR B;  3Q47 B;  5EX3 A;  2RFA A;  3UQ3 A;  2HE0 A;  4IUL A;  3PZ3 A;  4N39 A;  5CHE E;  3CVU A;  4HOR A;  4DX2 A;  1MX2 A;  4G23 A;  3L9T A;  3CVL A;  1Z3Y A;  4HI8 A;  3OXF A;  4U07 A;  2WXP A;  3AS8 A;  5CCL A;  3VTY A;  2YNQ A;  5JJ7 A;  1XNF A;  5T3R A;  2XEN A;  4U0S A;  4ATZ D;  2WXO A;  4DK5 A;  3UTM A;  3ULY A;  2H6F A;  2P9P G;  1TNU A;  2PQN A;  5T4Y A;  2XGM A;  1X5B A; 
#chains in the Genus database with same CATH homology
 1V54 E;  2DYS E;  3ABK E;  5B1A E;  5B3S E;  5IY5 E;  5B1B E;  3ABM E;  3AG3 E;  1OCC E;  3ASN E;  2EIM E;  2EIL E;  3AG1 E;  3ASO E;  2DYR E;  2EIK E;  3X2Q E;  2Y69 E;  3AG4 E;  2EIJ E;  1OCR E;  2EIN E;  2ZXW E;  3ABL E;  3AG2 E;  2OCC E;  1V55 E;  1OCZ E;  1OCO E;  3WG7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...