3X3NA

Crystal structure of eccb1 of mycobacterium tuberculosis in spacegroup p21
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
393
structure length
384
Chain Sequence
b'LFQGPHMGTSLFTDRATNQLYVLLSGQLHPVYNLTSARLVLGNPANPATVKSSELSKLPMGQTVGIPGAPYATPVSAGSTSIWTLCDTVARADSTSPVVQTAVIAMPLEIDASIDPLQSHEAVLVSYQGETWIVTTKGRHAIDLTDRALTSSMGIPVTARPTPISEGMFNALPDMGPWQLPPIPAAGAPNSLGLPDDLVIGSVFQIHTDKGPQYYVVLPDGIAQVNATTAAALRATQAHGLVAPPAMVPSLVVRIAERVYPSPLPDEPLKIVSRPQDPALCWSWQRSAGDQSPQSTVLSGRHLPISPSAMNMGIKQIHGTATVYLDGGKFVALSMYYIDPQGVRYGVPNAETAKSLGLSSPQNAPWEIVRLLVDGPVLSKDAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESX-1 secretion system protein EccB1
publication title Core component EccB1 of the Mycobacterium tuberculosis type VII secretion system is a periplasmic ATPase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
total genus 67
structure length 384
sequence length 393
ec nomenclature
pdb deposition date 2015-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.900 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3x3nA01
2.40.50.910 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3x3nA04
5EBDA 5CYUA 4KK7A 3X3NA 3X3MA 5EBCA
chains in the Genus database with same CATH superfamily
5LMNW 2JEAI 2ALYB 4JYAL 5NUCA 5LMNL 1B9NA 4K0KL 3DHQA 3FDTA 3VYSA 3TEHB 4RCNA 2KHJA 2JA5G 2OXPA 3PIP3 1UEAB 2EYLA 1N32L 1V1OA 3AQQA 3OIPA 3M85A 2FMCA 3N6RA 4OWTB 4BY1H 2XVSA 3R93A 4X3KA 4C1NK 2K5DA 3UE1A 2B63H 2BDOA 2JK8A 1RDPD 1MD2D 2F0NA 3OTOQ 3M4QA 4QJFA 1N33Q 3TN2A 2PCFB 4Y52H 4FF1A 4DR6L 1FR3A 1C7YA 2O4XA 3CPFA 5M5WH 3RZDB 2ICEC 2K28A 2JA6B 3S17B 4L6TB 4LF6Q 3PIO3 1JE5A 2RCNA 2D0OA 2SDFA 3G7LA 5DNFA 3HOYH 4HMIA 1DM0B 1NCVA 1EY8A 3H94A 3SE0A 3LWUA 1TWCB 3VR3A 3OTOL 1N9WA 1F2MA 2C5CA 4ABNA 1N33L 1PFSA 5FO7B 4IPCA 4BXXH 1T9HA 1PHJA 4HCSA 2GVAA 5E4WC 3G4SA 1KIXA 1ZXTA 4LF6L 2LFNA 3I73A 1SMYD 4QUCA 1EU3A 2RBMA 1V9PA 4ZRZA 5K36G 2CH4W 2WIIB 2N8NA 3IAYA 1QOHA 2MO0A 4LFCQ 1F77A 4B3TQ 1HUNA 1Y1WB 1ZEQX 3QWNA 1S3OA 1XPOA 1OXUA 4C3HH 5EAYA 3PUYA 2EVBA 3NTIA 1MIUA 3S1QB 1QUQA 4PZ6A 5GAGC 5GQOA 1WI5A 5EPKA 1B70B 1GUGA 4KKSA 2EPBA 3KLSA 2F3WA 5JJZA 1LTID 4B3TL 1LTRD 1SXTA 4K8IA 1I4QA 3IRBA 4V0BA 3KJOA 1AH9A 2DJGC 2F1MA 2L4NA 1C4QA 1LTTD 2JA7H 5KNDA 2NBFA 1CKNB 1RIPA 4CHTB 5IGCA 2G5DA 3I3CA 5ELEA 2EY2A 2MQHA 4BWGB 3PV0A 4GLVB 5M9OA 4KHZA 1LTGD 4OIKA 4HIOA 2R93G 1HCZA 1QJOA 2A6ED 2TSSA 4CKEA 2EYHA 3RN5A 3VR4A 3M9BA 5FLXc 1DCZA 3BYTB 1XNQL 2HDLA 4IPHA 2XRQD 4DNRB 3K80C 1GJXA 1FNWA 1F2ZA 3BVMA 4R4OA 2Z6BA 4RGMA 3GTJB 4TVAB 2VUMH 2I0QA 4CJ1B 3GTMH 1EYAA 2JE6I 1ESFA 5C4XH 3HOZG 3I90A 3I4MB 2EOTA 3A55A 1VQ4A 3CP0A 1F9RA 2WKDA 3VR6A 1G2SA 3G48A 4QL5A 2F4IA 1RJTA 1VQFA 1IYJB 1B3AA 5HGQA 4A3KH 4DV4Q 1PTOB 3L9AX 2AQ2B 3CCMA 4ODGA 2BA1A 1YNXA 3RR5A 1GHKA 3EA6A 3N52A 1ASYA 3FMCA 1SBBB 3NTHA 2VB2X 1YJNA 3IL8A 4L5RC 2H4OA 1O78A 2GN5A 3KLSX 1VQGA 4A93H 1K83B 2R92H 1CA6A 1BNZA 1K0RA 2E76C 4DV4L 3J81E 3VYTA 2F3VA 1Z9FA 3H0GH 4FF4A 2LXJA 1VQEA 3HOUH 2ATWA 1HFGA 4A3GB 2KQ3A 2X6GA 2UXDL 3M7GA 1SAPA 4RKBA 3KOJA 3OIQA 2JEBI 2Z9HA 2UXCL 4JV5Q 3IFTA 2JA6G 1EY0A 1QE6A 2F0UA 4NW2A 4C56C 2VS1A 4X3UA 3HOXB 1E22A 3K5OA 1LLRD 2H5XA 1QVGA 2EY6A 2WV6D 4DAYB 3TMEA 4A76A 4MNOA 4APVA 3S2DH 2F0SA 1L1OB 5FKAC 4JV5L 2YV5A 3LWEA 1Y1VH 1A3VA 2AQ1B 2D0PA 1A3TA 1I5FA 3NXWA 1VQDA 2NB0A 2YU9H 3S16B 3P7JA 5I6YA 1CQVA 1O7IA 3A5ZB 2F03A 5J22A 1EZ8A 3KJPA 4A3MG 4DUZQ 1ONLA 4B9XA 3M3YB 1Y1WG 1IHZA 5GAEC 1PZJD 2AQ3B 2B2WA 1LTSD 5CYUA 2FMMA 1Q8KA 1K28A 1P16A 5I9PA 1IZ6A 2A1AA 4GOPC 1DYQA 1F9PA 3KK7A 3VA5A 1UE7A 5TSSA 1CKOA 4DN4M 3K5MA 1STYA 1VQPA 4NXMQ 1BBWA 3HFZB 3K7UC 4DUZL 1VF7A 3GTKH 3QJYA 4QY7A 2R3ZA 4HJ8A 3T56B 2BA0A 2HCIA 4JVZA 2O2LD 3TP6A 3J80i 4YCUA 1SNCA 3T53B 3NBIA 3VR5A 3M7NA 3I72A 4O42A 2PI2E 3GTOH 3S14B 3TSSA 1VS0A 2Y0SE 3VYRA 1LM0A 1Q1BA 1SE8A 1AZPA 1G6PA 1A15A 4ZKBB 1PH6A 1A8VA 1CUKA 3T1HQ 3K6OA 2ICIA 3CU7A 2RF4A 2AKWB 4EQPA 5C44B 5FLXL 4IUPA 3HKZB 1VQLA 1R4PB 2FINB 2A5HA 2M9VA 1QZHA 2F0TA 1PH4A 1Y8NB 4O1NA 3I4MG 3H3VC 1KTKA 4DF7A 4ZUJA 3OHXC 3T1HL 1K3BC 1QVCA 1SROA 4CJ2C 4JBJA 3MXNA 1J9OA 5EPJA 4RGNA 1GD7A 4DK0A 5JEAH 2F0VA 2AUKA 2HCCA 1H9MA 5A2QE 2E74C 4IUVA 2ZM6Q 2PYKA 2VQEQ 3P1HA 4C2MB 3MXGA 1PMRA 4B3RQ 4DFAA 1EY6A 3S24A 3VR2A 2DGYA 4OO1H 1X56A 3EVQA 1DOKA 5F2DA 3I8ZA 1SE3A 4DR7Q 2E2HH 1V43A 1HA5A 2XRSD 4DV7Q 3I91A 1TS4A 4YIJA 2ZM6L 3L0OA 1TY0A 3X3MA 3DWAA 1VQJA 4P73A 2PI2A 2VQEL 3STBC 3T1YQ 5ELBA 1X9NA 2NVQH 1DJRD 1KRSA 1OTCA 2PQEA 1V1PB 3MEFA 2HT1A 4PMBA 2Q2IA 2OQKA 3RUZA 1JWSD 4C3IG 4DR7L 1TS5A 5C6AA 3QOJA 3CD6A 1SNDA 4DV7L 3HOXG 3M4OB 2EYPA 1SE2A 1U0LA 2IWHA 1NSNS 2CW0C 4JI7L 2IX1A 1GO3E 1TWAB 1NR4A 3CCJA 2NVTH 5J39A 1FL0A 3CCVA 1MSHA 2VQFL 2B8FA 1Q86C 1YITA 2JQOA 2O5JC 3GTGH 4PMWA 3TQYA 5DEHA 1I4HA 1VQOA 1EYCA 2Z6KC 1B8AA 5FLMH 2JJQA 3Q6SA 1SRUA 1JOQA 2B2YC 2K50A 4JI2Q 1SMXA 3Q22A 1X3EA 1PTOD 1TY2A 1NAPA 4CDFC 1DOLA 2B63B 3HOVB 2ZJQA 5FK9C 2HQEA 3DM3A 3VA7A 1EYDA 3EIVA 5J1ZA 3KF6A 5IWAL 2B2VA 1WOCA 1LTLA 3J7ZC 2ZJPA 1VQNA 4JI2L 4AH6A 2B29A 1GUWA 4UP9A 2XIWA 4DR5L 2UUCQ 4NB3A 3QIAA 4C3IH 1YHAA 1KNEA 4R9WA 2Q8IB 3AMUA 1LUZA 3LNNA 2Z4IA 4YHHQ 4F88A 1OXSC 5M5YH 1IL8A 1PH7A 2ZXPA 3FHWA 4DR1Q 4L5SA 1HNZL 3F8TA 1WTXA 2EY5A 2MPMA 3B6YA 4XQJA 1GM5A 2UUCL 5KYLA 3SK8A 5LL6X 3RD4A 2E2IB 1FJGL 1YIJA 1BBUA 5C44G 1PH3A 3HKZG 1PXUA 4G7HC 4RAUC 3E0EA 2B2UA 3W3AA 4OHJA 1CI3M 4DR1L 1EIYB 1QB5D 1I6HH 3NQTA 4JI0Q 1ILPA 1XYIA 1BDOA 1CHQD 3S2HH 5EPLA 3KBXA 2CWPA 5M3MH 3MFGA 1S5ED 4FF3A 3J81c 1D2BA 3UI2A 1SJHD 2B8GA 4UAIA 3BJUA 1IBMQ 4A3DB 4G7OC 3NBHA 4XQQA 2NVYH 1CA5A 3S1MH 1T5EA 3M4PA 3K5LA 2DN8A 1H9SB 2AWNA 4JI0L 2JA7B 4LK1C 1KAAA 1WFQA 2FHTA 4V190 5JJKA 1B9MA 2L1BA 4Y7NH 3TDQA 2F0OA 2VNUD 1PZKD 4JOIC 2WAQE 4OELB 4PZ7A 3S1RH 4OX9Q 4GNXA 1IBML 1FYCA 3Q23A 4POGA 5HY6A 1QILA 2I5MX 4LJZC 4RG1A 3CCSA 4LF8L 1EIGA 1SLJA 2WB1G 5ELDA 5IYCG 3UDIA 3Q8DA 3U58A 1XTDA 5ELOA 4DNTB 4KY6A 1EUJA 5E7NA 4R1JA 4TKOB 4FVMA 2ZTDA 4J15A 4LNQA 3C46A 4C3JH 2AMCB 3BG3A 5LHY1 1QG7A 1X65A 4TSSA 5M5XB 3E0JA 3ND9A 5KEEA 1QNKA 4UP7A 1DZ1A 2NN6G 1Q81C 2L0CA 1L0WA 3A7LA 3MVVA 2KA7A 2QDLA 1E24A 1GHJA 2XN9C 4JBKA 4L5QA 2JSOA 3MEHA 4AYBB 1NMFA 4DR4Q 3NQIA 3FRPB 4DA2A 3D4RA 1KXLA 4L5TA 4BY7G 1VQ7A 3SGIA 2KBNA 5EKLA 2LS01 3S1NH 3QG1A 3URYA 1UAPA 4KHVA 2QF7A 1TWFH 2EJMA 1VQ9A 1NNXA 4XT1B 4NPSA 3H0GB 1TR5A 3PF4A 2PNRC 2PQAA 4JYAQ 5LMNQ 3HOUB 2VY3A 4O2DA 2BE5C 3HOVG 3FKIH 4K0KQ 4DAPA 3S9WA 3P20A 3PUWA 3CMEA 3Q24A 4DR3Q 4WJ4A 2YTYA 2VXWA 1S72A 1A62A 1N32Q 3NE5B 2E2DC 2CKZB 1WCMG 1Z6HA 2K4KA 3CCEA 4M1UB 4IFDG 5CR3A 2L15A 3I2ZA 5C4HA 5G3LF 1QWYA 4DR3L 4HMJA 4R8IA 1NJIC 4DR6Q 4J8QA 3TS0A 3QOLA 1LT5D 4QIWB 3AEVA 2EDGA 1PFNA 3T51B 3KDFA 1G51A 1C0AA 4N9TA 5FJ8G 2K01A 1Y1VB 4DK6C 3PO2H 3ERQA 1QCBD 1LT6D 2PW7A 2HDMA 4A3JH 2JA8H 4DAVA 1D6EC 1P8LA 5D3DA 1M90C 4EQ5A 1HQRD 1EWIA 1KRTA 4ZK9B 4A3FH 1FNUA 1F9SA 2I5HA 3ONAB 4TQUS 3STBD 4A3IG 1B53A 4CDDC 4JG2A 1H9JA 2A73B 2QDBA 3R3OA 1BBXC 5IY0A 3EN2A 1A3UA 4JI6L 4A3DG 3MA2B 5M3FB 4XDXA 4ZQ3A 2CW0D 4K2LA 4MZ9A 1VQ5A 3OWEB 4ZLTF 1E2ZA 3J81L 1TS3A 4KHPQ 1JQYD 4A75A 2CVRA 2KCNA 1HRJA 4EX5A 1TQOA 5AFWA 2F0LA 2K52A 2JA5H 4A3BB 4LF7L 4DAMA 1EZ6A 5IGDA 2IJ0A 4WFN3 4ILWA 3NPPA 1HZ9A 5C3WA 1A6XA 2V4DA 1KC8C 1VF5C 4KHPL 2E2JB 2QILA 3F1ZA 5COYA 2KENA 5J3BA 1TVXA 2K03A 3MHBA 2QW7A 5IP9G 2VW9A 3PO3B 1WTRA 3GTPH 1HTLD 5ELNA 3LX0A 4LF4L 4XXEA 4IFDJ 1FGBD 2IHFA 3J80E 2WKCA 2Q8RE 5C0XG 1E3PA 1BUVT 2N78A 3F2UA 1QUQB 2NVXH 1XNQQ 1IBKL 4BBRG 3J7AV 4E6IA 3A74A 1JOOA 1PVOA 4JW0A 3MXPA 4S3SA 5BN3A 1YZ6A 4LAAA 1XJVA 5C4JH 3K59A 4QQBX 4QF4A 3I55A 1PH8A 2EIFA 1I3QH 2PMZE 1C8CA 4OWWB 3HOWB 1M1KC 1KNAA 1IXRA 1YNNC 1EIHA 2NWGA 4DGZA 2MO1A 4IZ8A 4R4QA 5K36H 1EWCA 1AEXA 1Q1EA 1X32A 3NSWA 1PTOC 3RZOH 2A6HC 3BDOA 3TRZA 1KDBA 4HEDA 1PFBA 1I94Q 4H44C 1BOSA 2PZTA 3HG9A 1Q3LA 3DM1A 1B1ZA 1YJ9A 1D5ZC 1JE4A 1I50H 4H13C 1Y8PB 1Z7TA 3BS1A 1CTMA 4PMCA 1PLFA 3I4NB 3D4DA 3CMAA 1IL2A 2HIXA 3BU2A 1Y8OB 1I94L 5IGEA 4MIUA 2IX0A 1RKNA 1WTWA 3GP7A 5C3EG 2F0IA 1K3RA 4RCOA 3I56A 4A3EB 2UXDQ 4HSVA 4RKLA 1X3PA 2RVLA 5CV7A 4X66Q 1QNUA 5EKKA 1B50A 2UXCQ 2R7ZB 1QZGA 3H91A 1HZAA 3D3RA 4JI4L 5GAHC 1HNXQ 2K5HA 2R93H 3JAMc 3GTLB 1VQAA 3ULPA 1TWGH 1PH5A 4ZYSA 1B7YB 2QEXA 4R4TA 1FD7D 5JPNC 3KF8A 3GTGB 3ER0A 1CQFA 2IL8A 1L1OC 2X6LA 4X66L 1ZYRC 4IUNA 4NMZA 2F0EA 2R7FA 4IN3A 1S5FD 5I2XA 5GADC 3MC0B 5DAUA 1HNXL 3CQZH 1YEZA 4BBSB 3AFQA 1O7ZA 1U5KA 2RHQB 5IGGA 1K8GA 3HOZH 1Q46A 3DUZA 1GUNA 2EY1A 3RLOA 1A0IA 3EROA 2HHHL 5A2QL 4TRDA 1CHPD 1WTPA 1VMCA 5EBDA 4YWKA 5M3FG 4DV1Q 1EQQA 2ASBA 1XPUA 5BN4A 1EEID 3U9SA 3NWTA 3J81j 2K04A 4KY5A 2I07B 3HEJA 1AE3A 4KKUA 1W2BA 3GTQH 1PYWD 4Q5VA 4A3BG 4RGOS 2B2WC 2LY7A 4IO9A 1YI2A 3E9HA 5M5YB 3MXUA 2JXMB 3AB9A 3KLWA 4DV1L 1WD1A 2XWBB 1KL9A 2B2TA 4B3ML 4P75A 3J7AF 1EIFA 1PRTF 5DM63 3PO3G 2I5LX 2IPKD 2BE5D 3OWFA 3D31A 1F2YA 3GQBA 4LMQD 1B3QA 1NR2A 2M00A 3WOEA 1ENCA 3RZDH 2N55A 3E9IA 5C3XA 5IT9E 2IHEA 3MWYW 4ME5A 2JA6H 2DNCA 3S17H 1CZWA 5C5MA 1J6QA 1M8AA 2CQOA 1MSGA 2WB1E 3ERSX 3ITPA 1WJJA 4GOPA 2KCMA 5M3MB 3NP8A 1TWCH 4XQNA 3E5SA 5CV6A 4RMFA 1Q82C 1ET6A 3BYYB 1KQSA 5EBCA 2N88A 4FP5D 3TBIB 4F7XA 2JYOA 1D1KA 4ULLA 2SNMA 2RDGA 3G6JB 3HOWG 3MAQA 4IALA 4DXFA 1STHA 4L8JA 4P2CB 4JBMA 3ND8A 4RA8A 1LT4D 2DNEA 2FFKB 2OEOA 5CC4A 1VMPA 4GLAC 4GS3A 4A3MH 3RLNA 1YJWA 3TP5A 1Y1WH 4A3CG 3AU7A 1IKLA 4HJ7A 3L7ZC 4HTHA 3Q0AA 1RODA 4B08A 4IUUA 1EL0A 1IBLL 2KVMA 3W1BA 3ULLA 1UNSA 2RDFA 2K5WA 1HXYD 4U673 1CSPA 1PA6A 5E4XA 2Z1CA 4I7AA 3I4NG 1LABA 1K8MA 1HQMC 2L12A 1A2TA 1JWUD 2UUAQ 4A3EG 1NMGA 4JI3Q 1JB3A 1RL2A 1LTBD 1JWMD 4OXPA 3EBEA 1AN8A 2D2CC 4DV3L 2EYFA 2R7ZG 4XIGS 3MXNB 1G291 1KABA 2F0WA 2C35B 1AP0A 5FOBB 1PYBA 3KLRA 4YCVA 1BVSA 1AFPA 1H9KA 1R9TB 5KGUA 4A3GG 4RHSA 1SNOA 4UP8A 2UUAL 2HQLA 4PQXA 3SK6A 4JI3L 2MNAA 4K6LA 2L55A 4JI7Q 3A7AB 2L5TA 3JAML 1HNWL 1U9RA 2F0JA 1W6JA 1XNRQ 5EJWA 2VQFQ 3GTJH 1DGSA 2OTLA 1U4RA 4UDUC 1CFMA 4BBSG 3U4ZA 2KEEA 3FKIB 2NYZD 3K5NA 3I4MH 4JBWA 1EU4A 3G6EA 2F3IA 2CCZA 4KN7C 1N36Q 1XXGA 2ZT9C 1Y69U 1XNRL 1WTVA 3R2TA 3SR1A 1G91A 1T5XD 1S4ZA 1PTOH 2Y0SB 2GA4B 4CDEC 1PH9A 1NTGA 1K8AC 5BR8L 1YNND 1N36L 5IWAQ 4N8FA 3NENA 2KUMA 1BF4A 1GKHA 4DPGA 4BY1B 4X62L 1OXTA 1GXDC 4DR5Q 3PO2B 2A6HD 1X55A 3D0FA 2JA8B 4M8AA 2WINB 5FO9B 3P75A 5LMUQ 5IYBG 3PIPA 2GVBA 5M5WB 2RHSB 2Z6KA 1HNZQ 4A3FB 1YBYA 4EQOA 4R8NA 2PW5A 4K2KA 2HIVA 2ES2A 3HOYB 4WJWA 1PFMA 4OGQC 1I4RA 2EQSA 3I4OA 2QKIC 3UDXA 5CV5A 1FJGQ 4DR2Q 2A69C 5CGKA 2VB3X 3HOXH 2DY7A 3F2BA 5LMUL 5IOCA 4HSPA 4GLXA 2NZ1D 4FXDA 3KF6B 1BXTA 2RKSA 3SEBA 1CK1A 5IP7G 2NTTA 1LV9A 1LACA 3PIOA 4AQYL 1VQ8A 3CCRA 2CQAA 1SNQA 3S16H 4DR2L 3BZKA 1G8ZD 1PH1A 1LYLA 1TIID 3SK5A 1WYDA 2Q8TA 3H15A 1BQQT 1I4GA 4C3HB 2UUBL 4X65Q 1E7ZA 1ZYRD 3CHBD 4OWXB 1BCPF 3TZUA 3FPUB 2LXKA 4B9WA 4KV6A 1S5BD 1UUPA 4FF2A 3OW7A 3J7YW 3UDGA 1B4OA 1JORA 3CXCA 3V05A 1GUSA 3GTPB 1V8QA 1XMQQ 4KD4A 4RGTA 3DEOA 5CMDA 1TU2B 4JI8Q 4X65L 3KFUA 1VQIA 4FXKC 3VYUA 3K0YA 4LF8Q 2RA4A 2MJ8A 2K1BA 2MP1A 3QO2A 2RSNA 5H1SE 2A8VA 1XMQL 4ID6A 4HIKA 5C4JB 3EFXD 1XMOQ 1HZBA 2K5QA 4JI8L 1GUTA 2BH2A 2EYMA 3M4YA 5IP7H 4DK1A 5ISRA 1HR0W 5D3IB 1HR0L 4QGUA 1XTCD 1JJCB 1MJEA 2BOSA 3TREA 3BVGA 1VQ6A 2BH8A 5CV8A 3RZOB 2IY5B 5IYDG 2RSOA 5C44H 2ZTCA 2NZOA 4GNXB 1W6KA 3K7AH 2VUMB 3OSOA 4X6AH 1XMOL 4PZ8A 1EQTA 3KUPA 3WWVA 1EYGA 3GTMB 5C4XB 1K9MC 2SNSA 3S15H 4QMGA 3W2DA 1PH2A 1JJGA 3DWQA 4BA1I 5BN5A 1I50B 3GD7A 4A3KB 5T1GA 4FYDA 4HJ5A 4I65A 1YNJC 4KN4C 4YWMA 2Y0SG 1X54A 1SYCA 4LFBQ 1RD9D 4RFBA 1ENAA 5I4DA 3PUZA 3G71A 3F2DA 3H3VH 3FPPA 5IIFA 5IT9c 4A93B 2LSSA 2K32A 4DK3C 2R92B 2KJXA 1HHVA 4G7ZC 3BDLA 4K5VA 4BY1G 2SOBA 1SNPA 2YYZA 4FNFA 2PNHA 4H0LC 1TWGB 4R4CA 5IE8A 2B63G 3RNUA 4LFBL 3WDNA 2VL6A 3R2IA 4IURA 5IODA 1ZKOA 2K05A 5IYCH 5C4ZA 4OONA 4GKKL 4DV5Q 4X3SA 1E2WA 4UPAA 1J5EQ 1SFOH 1IW7C 3TZDA 1I6VC 3CQZB 4HIMA 3HOYG 4ME3A 2PQAB 2OQ0A 3HOZB 3K0XA 5IGBA 2NN6H 5ELFA 4BXXG 1PDQA 4YCWA 3SDZA 4DV5L 3U9OA 3S2DB 1N34Q 3CKIB 1SR3A 1J5EL 2WAQB 2F0GA 4N9PA 3PF5A 2YU9B 2WP8J 4OO1I 1VQHA 3CC7A 2DJFC 2E75C 4KTAA 1RF2D 4BY7H 4CDCC 5AJ3L 2IW3A 3UE0A 4P71A 3A5UA 3GTQB 2MHVA 2CWAA 3GV3A 4JI6Q 4DV2L 2K33A 1C48A 3BDCA 4C3HG 1N34L 5CORA 4DXGA 3KDFB 4EVOA 1HZCA 4DNIA 2R61A 1ET9A 2K14A 3AYHB 4OIJA 4CBVA 1I4XA 3PGZA 1I4PA 3HOVH 5CV4A 4KLKA 1STGA 3MTSA 4LF7Q 3GTKB 4IOAA 5D14A 2K5VA 3HS0C 4FO2A 1WCMH 2VZAA 3A56A 1HJPA 2PZWA 4IFDH 4HJ9A 2JA7G 3PMFA 2QCPX 3F2CA 3GTOB 1EY5A 2D62A 1TS2A 1TWHH 4ZKCB 1KDAA 4LF4Q 3CRKC 3JAMi 4ZCKA 5E1FA 3DLLA 1JC7A 2ZJRA 4A3LG 4HIDA 1IYVA 2A68C 4GKJQ 1VCIA 5KRUA 5C5LA 5FJ8H 1IBKQ 2G9HD 1X3GA 2YTXA 3CAMA 5E3FA 3FEWX 1JCKB 4A4IA 1U4MA 2E2IH 4A3MB 2CFMA 2KCCA 4JC0A 4PNYA 1VQBA 3NHHA 1R4QB 4L63B 2IX3A 4KY7A 2PZUA 2VUMG 3PCOB 4GKJL 2OT2A 5EKIA 2BDNA 2L11A 1D1IA 4A3IH 4XYOA 5C4XG 1CKNA 1AW7A 4NDXA 2P5ZX 3TP7A 3I70A 2N3SA 4LW1A 3C3LA 3CPWA 1VDZA 3NEMA 2EE1A 4KK7A 5JOBA 4LFCL 4A3KG 3W1GA 3OMGA 4AYBG 1VQCA 3KYHC 1Q90A 2A69D 2KHSA 4A3DH 1PRTC 1V1QA 4WRDA 2MGSA 4IOCA 4GN5A 4I7ZC 4JI5Q 2O5IC 1BKBA 1LO5D 1EY7A 1DONA 1JR0D 4KI0A 3A8IE 4KKTA 4MN3A 4PV1C 5ELCA 4A93G 3WOFA 2XTIA 2PPBC 2R92G 4A3LH 3U50C 1UE5A 3I4LA 2RQXA 3H0GG 1CKMA 2F52A 3SHLA 3K57A 5G3LD 3HOUG 2OF1A 5IT9L 1PRTB 4CJ0B 2E2HB 2DUDA 4R4IA 1HFNA 4JI5L 1MKHA 3GV6A 3C1EA 3FP9A 1CT1D 5LL6S 3I7FA 4NP5A 1HA6A 5IP9H 1S5DD 2ID0A 3NTKA 4OEMB 2NVQB 4WJ3M 4HCEA 4JI4Q 4ZAIA 5IGFA 2J7ZA 4LF5Q 5C0XH 3HRZC 1A63A 1S5CD 2OCEA 2EXDA 1EFWA 1ILQA 5M5XH 2QGQA 4BBRH 4RWSC 2LKVA 4P74A 3AFPA 3ULJA 1E1OA 5CBEE 1KHIA 2EJGC 2Z0SA 3T13A 1HTPA 1SJED 3JC66 1WD0A 2NVTB 2K5NA 1SE4A 4IPDA 2WAQG 4NKLA 3OMCA 1Y1VG 1CZGA 4LF5L 4CKBA 5FO8B 3C2PA 1HH2P 3TP8A 1GUOA 1KLGD 5JJIA 1SYFA 3HGBA 1BO0A 4IUTA 3E6ZX 2HHHQ 1STEA 2CHBD 1DOMA 5C0XJ 4LUZA 4O0AA 4DKAC 1M4VA 1KDCA 2AHOB 4LUVA 4MTKA 3V96A 4G57A 1OO9B 2K7VA 4NXNQ 1D8LA 3EQLC 4OL7A 1NY4A 1DXMA 4RH6A 4HAEA 3KF8B 5JVG3 1ASZA 2KEDA 3HP3A 4DAYA 3HKZE 1ENFA 2OWOA 4K8JA 1L1OA 1LT3D 5I2YA 1EOVA 4NXNL 1LTAD 1NE3A 3KBGA 4B3MQ 2D5DA 5C3EH 2PMZB 1YNJD 4C3IB 1RHPA 1J8IA 2N49A 2KHIA 3NELA 4Q0FA 5DLQE 5DM73 2A74C 4KJNA 1STAA 1YVCA 1TXYA 3GDEA 3H3VI 2K6AA 4FDBA 2B2TC 3DXJC 2J0TD 3FVQA 1TKWB 3PQIA 4QB4A 1MI2A 1Q8IA 1X3QA 3D6WA 1SEBD 3DWPA 3OW2A 2F0MA 1I6HB 4KJOA 3NUCA 4X3TA 1VQKA 1SYGA 3S2HB 1IW7D 2YTVA 2MFIA 1STNA 3RN2A 2EJFC 2AWOA 1Q7YC 1UWVA 2KCTA 1Z47A 2XSCA 1FNVA 3BZDB 5D65A 5CBAE 1YHQA 1L0YB 2NVYB 3CW2C 1JB7A 2NN6I 1STBA 5M3FH 4IJLA 5JEAG 4B3SQ 3S1MB 2Q2UA 3CCLA 4GN3B 1X3FA 2JA9A 5KYIA 1PTOF 2CH4A 1IBLQ 4Y7NB 4GOPB 3S1RB 4NXML 4J1MA 4A3BH 2LMCB 2UXBQ 4OO1G 1WTOA 1BR9A 3MZ5A 2G9DA 3ZJYC 2QA4A 3S1QH 1NBWA 4JCVE 4B3SL 1RTNA 1UE1A 3K81C 2E2JH 1SSOA 3NK9A 4ZUIA 3BZCA 5HGTA 3DMUA 3T16A 4K14A 4DV3Q 3PO3H 4WORA 1C9OA 2FJ2A 4LFAQ 3K7AB 2UXBL 2Z8LA 4C3JB 3NWSA 1Q12A 3OPOA 1MHWC 2HUGA 3S15B 2EXZA 4IFDI 1BCPC 1PYSB 1HNWQ 4BA2I 1G6ZA 1E2VA 2QEJC 1E0BA 4HR7B 2F0FA 3A0JA 2KOLA 4YWLA 4LFAL 3SVMA 4LF9Q 2DY8A 1K0SA 3HOWH 4LWCA 1O7YA 4LUOA 2A68D 4K5WA 3C1FA 3W5OA 2WACA 1D7QA 1JICA 3PUXA 3S1NB 4DUYQ 5FLMG 2X69A 1TWFB 1BCPB 2H1EA 4C1NI 1V1PA 2L9HA 4MTNA 4A3CH 1UEBA 5KNBA 2F4VQ 1N8RC 5HURA 4LF9L 4EQNA 4RHRA 3J81i 3A8JE 1U4PA 4YY3Q 2E5LQ 3LGJA 5EGTA 4K6DA 5JPMC 5BR8Q 2ZXRA 1VQMA 1ICFB 2WB1B 2OTJA 1W3SA 1FVIA 3RLFA 3H6MA 4DUYL 5JEAJ 4PG3A 4AIMA 1SFOB 3CRLC 1GOZA 3T4AC 4B3RL 2MUYA 4X62Q 3I4NH 4IQZA 3D8GA 4EGVA 2UU9Q 2F4VL 4IJHA 2ENBA 1XX8A 5K5PA 3SK4A 4KMUC 1CM9A 1PRTD 2EYJA 4YY3L 2E5LL 4A3EH 1ESRA 2NTSA 3J80c 1WTHA 1SMYC 2V1CC 3T1YL 2R7ZH 4DU9A 1K83H 2Z4HA 1MGSA 3QB3A 2TMPA 2XGTA 2BCOA 2UU9L 4ALPA 3CC2A 3ICEA 3GTLH 2WFWA 5I6WA 3IFDA 4A3JB 5I9OA 4BY7B 4A3GH 4XYQA 2E8GA 1L2FA 1EEFD 2JP1A 1DD2A 4GZYC 2B2VC 5L37A 3H09A 2RCFA 1AZQA 3TS2A 3ZYYX 2NZHA 1G2TA 1TT2A 1PZID 5JAVA 2B2YA 4AQYQ 5JVH3 3U4VA 4BBSH 3OOCA 2ZXOA 1H95A 2PO4A 5M3MG 5C0XI 3HZXA 1GVPA 1E1TA 4H02A 4IPGA 5FLXE 3D4WA 1MJCA 3BVZA 2UUBQ 4XTCS 1WCMB 1A2UA 4N8X1 1O80A 3V2TA 1F2LA 3EJIA 3CF5A 1K8OA 1XPRA 3D6CA 5JJLA 2J4XA 1TWHB 1D5XC 4JPBW 1KLUD 5A35A 2JA5B 1KD1C 3MFYA 2A6EC 3K58A 3M3YH 4AYBE 1X6OA 2B2UC 1QVFA 3X3NA 1JOKA 1YHBA 1SYDA 4DV0Q 3QR8A 1AE2A 3RMHA 1B44D 1D5MC 1UE6A 4CKCA 1NUCA 2XWJB 1CSQA 4FXGC 3CCQA 2IT1A 4MHEA 5IYBH 1OXVA 4YHHL 4DV0L 4C3JG 1OXXK 4UY8C 3OYYA 2F0PA 2HD3A 1H9SA 4A3IB 2NVXB 3DEPA 1K73C 1HR0Q 2A19A 4DV6Q 2EYOA 2NUCA 3JAME 1EOTA 2F0KA 2R6GA 3VDYA 2Q2HA 3S14H 4GNXC 3CC4A 4Z9CB 1SYBA 3O13A 1EY4A 4F8MA 2AUJD 4G4KA 1I3QB 2F0QA 3NBHB 1SDFA 1RCVD 5GROA 1RTOA 4DV6L 4QIWE 2R7DA 4H7BA 3A54A 2D9UA 4JOIA 4CGYB 3L2PA 3L3OC 1MBYA 2ZTEA 3FKIG 4HN7A 3GO5A 1SNMA 2C9OA 1WTQA 2F0DA 5T1IA 4JK1C 4KD3A 1KAWA 1PV4A 1II3A 1Y14B 4OX9L 1F9QA 2F0HA 4BS9A 3R8BA 2B3GA 4BBRB 1EFID 2I46A 1L0XB 3HKSA 4JI1Q 3E3XA 4GKKQ 4IUQA 1IKMA 4C2MH 1JJ2A 2B39A 5KIXA 1H9RA 2R93B 1EY9A 3PO2G 1HPCA 3J80L 3SXHA 1ML0D 4A3JG 4X64Q 1R9TH 3PSIA 2Q2TA 2JA8G 1HUMA 1JT8A 4QCLA 4JI1L 1SYEA 5CV9A 2M2LA 1S40A 1O7LA 1EWHA 4K5XA 1JMCA 4A3FG 1FGUA 5IYDH 4P72A 5KNCA 2K75A 4DR4L 2SEBD 1EQRA 3PUVA 1EQVA 1B2TA 2XNAC 1U4LA 3K8AA 2EZVA 3J7A5 5AJ3Q 5EQ0A 4X64L 2KECA 4XT3B 3IKJA 3M4OH 2JN4A 4UHVA 4F87A 4DV2Q 4U68A 4QUFA 1ICWA 1TWAH 1SN8A 3UDFA 1BCPD 3A8KE 1XWEA 2RDHA 1WVLA 4J6HA 4POFA 2FXQA 1IYUA 4HJAA 3CCUA 5C3EB 4GN4B
chains in the Genus database with same CATH topology
2JEAI 5NUCA 1B9NA 3DHQA 3FDTA 3VYSA 4RCNA 2OXPA 3PIP3 1UEAB 2EYLA 1V1OA 3OIPA 3M85A 2FMCA 3N6RA 2XVSA 3R93A 4X3KA 4C1NK 2K5DA 2BDOA 1RDPD 1MD2D 2F0NA 3TN2A 2PCFB 4FF1A 1FR3A 2O4XA 3RZDB 2ICEC 2K28A 2JA6B 3S17B 4L6TB 3PIO3 2SDFA 3G7LA 5DNFA 4HMIA 1DM0B 1NCVA 1EY8A 3H94A 3SE0A 3VR3A 3LWUA 1TWCB 4ABNA 1F2MA 2C5CA 5FO7B 4HCSA 5E4WC 1ZXTA 2LFNA 3I73A 1SMYD 4QUCA 1EU3A 2RBMA 4ZRZA 5K36G 2WIIB 3IAYA 1QOHA 1F77A 1HUNA 1Y1WB 1ZEQX 3QWNA 1OXUA 3PUYA 2EVBA 3NTIA 3S1QB 5EPKA 1GUGA 4KKSA 2EPBA 3KLSA 2F3WA 5JJZA 1LTID 1LTRD 1SXTA 4K8IA 1I4QA 4V0BA 2F1MA 2L4NA 1C4QA 1LTTD 5KNDA 2NBFA 4CHTB 5IGCA 3I3CA 5ELEA 2EY2A 4BWGB 3PV0A 5M9OA 4KHZA 1LTGD 4OIKA 1HCZA 1QJOA 2A6ED 2TSSA 4CKEA 2EYHA 3VR4A 1DCZA 3BYTB 2HDLA 2XRQD 4DNRB 1GJXA 1FNWA 1F2ZA 3BVMA 4RGMA 3GTJB 4CJ1B 1EYAA 2JE6I 1ESFA 3I4MB 3I90A 2EOTA 3A55A 1F9RA 2WKDA 3VR6A 1G2SA 2F4IA 1RJTA 1B3AA 1PTOB 3L9AX 2AQ2B 4ODGA 2BA1A 1GHKA 3EA6A 3N52A 3FMCA 1SBBB 3NTHA 2VB2X 3IL8A 2H4OA 1O78A 3KLSX 1K83B 1CA6A 1BNZA 2E76C 3J81E 3VYTA 2F3VA 4FF4A 1HFGA 4A3GB 2KQ3A 2X6GA 3M7GA 1SAPA 4RKBA 3OIQA 2JEBI 3IFTA 1EY0A 1QE6A 2F0UA 4NW2A 4C56C 4X3UA 3HOXB 3K5OA 1LLRD 2EY6A 2WV6D 3TMEA 2F0SA 5FKAC 3LWEA 1A3VA 2AQ1B 1A3TA 3NXWA 2NB0A 3S16B 3P7JA 5I6YA 1CQVA 2F03A 5J22A 1EZ8A 1ONLA 4B9XA 3M3YB 1IHZA 1PZJD 2AQ3B 2B2WA 1LTSD 5CYUA 2FMMA 5I9PA 1DYQA 1F9PA 3KK7A 3VA5A 5TSSA 4DN4M 3K5MA 1STYA 1VF7A 3QJYA 2R3ZA 3T56B 2BA0A 2HCIA 2O2LD 3TP6A 1SNCA 3T53B 3NBIA 3VR5A 3M7NA 3I72A 4O42A 3S14B 3TSSA 3VYRA 1Q1BA 1AZPA 1A15A 4ZKBB 3K6OA 2ICIA 3CU7A 4EQPA 5C44B 5FLXL 4IUPA 3HKZB 1R4PB 2FINB 2A5HA 2M9VA 2F0TA 1Y8NB 4O1NA 3H3VC 1KTKA 4DF7A 4ZUJA 3OHXC 4CJ2C 3MXNA 1J9OA 5EPJA 4RGNA 4DK0A 5JEAH 2F0VA 2AUKA 2HCCA 1H9MA 5A2QE 2E74C 4IUVA 2PYKA 3P1HA 4C2MB 3MXGA 1PMRA 4DFAA 1EY6A 3VR2A 4OO1H 3EVQA 1DOKA 5F2DA 3I8ZA 1SE3A 1V43A 1HA5A 2XRSD 3I91A 1TS4A 4YIJA 1TY0A 3X3MA 3DWAA 5ELBA 1DJRD 2PQEA 1V1PB 4PMBA 3RUZA 1JWSD 4C3IG 1TS5A 5C6AA 3QOJA 1SNDA 3M4OB 2EYPA 1SE2A 2IWHA 1NSNS 2CW0C 2IX1A 1TWAB 1NR4A 5J39A 1MSHA 2B8FA 2O5JC 4PMWA 5DEHA 1I4HA 1EYCA 3Q6SA 1JOQA 2B2YC 3Q22A 1PTOD 1TY2A 1NAPA 1DOLA 2B63B 3HOVB 5FK9C 2HQEA 3VA7A 1EYDA 5J1ZA 2B2VA 1GUWA 2XIWA 3QIAA 4R9WA 1KNEA 2Q8IB 3AMUA 3LNNA 2Z4IA 4F88A 1OXSC 1IL8A 2ZXPA 1WTXA 2EY5A 2MPMA 4XQJA 5KYLA 3SK8A 5LL6X 3RD4A 2E2IB 1PXUA 4G7HC 4RAUC 2B2UA 3W3AA 4OHJA 1CI3M 1QB5D 3NQTA 1ILPA 1XYIA 1BDOA 1CHQD 5EPLA 3KBXA 3MFGA 1S5ED 4FF3A 1D2BA 3UI2A 1SJHD 2B8GA 4UAIA 4A3DB 4G7OC 3NBHA 4XQQA 1CA5A 1T5EA 3K5LA 2DN8A 1H9SB 2AWNA 2JA7B 4LK1C 1KAAA 2FHTA 4V190 1B9MA 2L1BA 3TDQA 2F0OA 2VNUD 1PZKD 1FYCA 3Q23A 1QILA 4LJZC 1EIGA 5ELDA 4DNTB 4KY6A 4TKOB 4FVMA 3C46A 3BG3A 5LHY1 1QG7A 4TSSA 5M5XB 3E0JA 3ND9A 5KEEA 1QNKA 1DZ1A 2NN6G 2L0CA 3A7LA 3MVVA 2KA7A 1GHJA 2XN9C 2JSOA 3MEHA 4AYBB 3NQIA 3FRPB 4DA2A 3D4RA 5EKLA 2LS01 3QG1A 3URYA 1UAPA 4KHVA 2QF7A 2EJMA 4XT1B 3H0GB 1TR5A 2PNRC 3HOUB 2BE5C 4DAPA 3S9WA 3P20A 3PUWA 3Q24A 2VXWA 3NE5B 2E2DC 1Z6HA 4M1UB 4IFDG 5CR3A 5C4HA 5G3LF 1QWYA 4HMJA 4R8IA 4J8QA 3QOLA 1LT5D 4QIWB 2EDGA 1PFNA 3T51B 4N9TA 2K01A 1Y1VB 3ERQA 1QCBD 1LT6D 2PW7A 2HDMA 4DAVA 1D6EC 5D3DA 1HQRD 4ZK9B 1FNUA 1F9SA 4TQUS 3ONAB 1B53A 1H9JA 2A73B 2QDBA 3R3OA 1BBXC 1A3UA 3MA2B 5M3FB 4XDXA 4ZQ3A 2CW0D 4K2LA 3OWEB 4ZLTF 1E2ZA 3J81L 1TS3A 1JQYD 2CVRA 2KCNA 1HRJA 1TQOA 5AFWA 2F0LA 4A3BB 1EZ6A 5IGDA 2IJ0A 4WFN3 4ILWA 3NPPA 5C3WA 1A6XA 2V4DA 1VF5C 2E2JB 2QILA 5COYA 1TVXA 2K03A 3MHBA 3PO3B 1WTRA 1HTLD 3LX0A 4XXEA 4IFDJ 1FGBD 3J80E 2WKCA 2Q8RE 5C0XG 1BUVT 3F2UA 3J7AV 4E6IA 1JOOA 3MXPA 4S3SA 5BN3A 4LAAA 3K59A 4QF4A 1C8CA 3HOWB 1KNAA 1YNNC 1EIHA 2NWGA 4DGZA 4IZ8A 5K36H 1EWCA 1AEXA 1Q1EA 1X32A 3NSWA 1PTOC 2A6HC 3BDOA 1KDBA 4HEDA 1PFBA 4H44C 1BOSA 2PZTA 3HG9A 1Q3LA 3DM1A 1B1ZA 1D5ZC 1JE4A 4H13C 1Y8PB 1Z7TA 3BS1A 1CTMA 4PMCA 1PLFA 3I4NB 3D4DA 1Y8OB 5IGEA 4MIUA 2IX0A 1RKNA 1WTWA 3GP7A 2F0IA 4RCOA 4A3EB 4HSVA 4RKLA 1X3PA 2RVLA 5CV7A 1QNUA 5EKKA 1B50A 2R7ZB 3H91A 3D3RA 3GTLB 4ZYSA 1FD7D 5JPNC 3KF8A 3GTGB 1CQFA 2IL8A 2X6LA 1ZYRC 4IUNA 4NMZA 2F0EA 4IN3A 1S5FD 5I2XA 3MC0B 5DAUA 4BBSB 1O7ZA 5IGGA 3DUZA 1GUNA 2EY1A 3EROA 5A2QL 4TRDA 1CHPD 1WTPA 1VMCA 5EBDA 5BN4A 1EEID 3U9SA 3NWTA 2K04A 4KY5A 2I07B 3HEJA 4KKUA 1PYWD 4Q5VA 4RGOS 2B2WC 2LY7A 5M5YB 3MXUA 2JXMB 3AB9A 1WD1A 2XWBB 2B2TA 3J7AF 1PRTF 5DM63 2IPKD 2BE5D 3OWFA 3D31A 1F2YA 3GQBA 4LMQD 1NR2A 2M00A 3WOEA 1ENCA 2N55A 5IT9E 5C3XA 3MWYW 4ME5A 2DNCA 1CZWA 5C5MA 1M8AA 1MSGA 3ITPA 5M3MB 3NP8A 4XQNA 3E5SA 5CV6A 1ET6A 3BYYB 5EBCA 2N88A 4FP5D 3TBIB 4F7XA 2JYOA 1D1KA 4ULLA 2SNMA 2RDGA 3G6JB 3MAQA 4IALA 4DXFA 1STHA 4L8JA 4P2CB 3ND8A 4RA8A 5CC4A 1LT4D 2DNEA 2FFKB 2OEOA 1VMPA 3TP5A 3AU7A 1IKLA 3L7ZC 4HTHA 3Q0AA 1RODA 4B08A 4IUUA 1EL0A 2KVMA 1UNSA 2RDFA 2K5WA 1HXYD 4U673 5E4XA 2Z1CA 1LABA 1K8MA 1HQMC 2L12A 1A2TA 1JWUD 1JB3A 1LTBD 1JWMD 1AN8A 2D2CC 2EYFA 4XIGS 1G291 1KABA 2F0WA 1AP0A 5FOBB 1AFPA 3KLRA 1H9KA 1R9TB 5KGUA 4RHSA 1SNOA 4PQXA 3SK6A 4K6LA 2L55A 3A7AB 2L5TA 3JAML 1U9RA 2F0JA 1W6JA 5EJWA 1U4RA 4UDUC 1CFMA 2KEEA 3FKIB 2NYZD 3K5NA 4JBWA 1EU4A 4KN7C 1XXGA 2ZT9C 1Y69U 1WTVA 3R2TA 3SR1A 1G91A 1T5XD 1S4ZA 1PTOH 2Y0SB 2GA4B 1YNND 2KUMA 1BF4A 4BY1B 1OXTA 1GXDC 3PO2B 2A6HD 2JA8B 4M8AA 2WINB 5FO9B 3P75A 5M5WB 4A3FB 4EQOA 4R8NA 2PW5A 4K2KA 3HOYB 4WJWA 1PFMA 4OGQC 1I4RA 2QKIC 5CV5A 2A69C 5CGKA 2VB3X 2DY7A 5IOCA 4HSPA 2NZ1D 4FXDA 1BXTA 2RKSA 3SEBA 1CK1A 2NTTA 1LV9A 1LACA 2CQAA 1SNQA 1G8ZD 1TIID 3SK5A 2Q8TA 1BQQT 1I4GA 4C3HB 1ZYRD 3CHBD 1BCPF 3TZUA 3FPUB 4B9WA 4KV6A 1S5BD 1UUPA 4FF2A 3OW7A 3J7YW 1B4OA 1JORA 3V05A 1GUSA 3GTPB 1V8QA 4KD4A 4RGTA 3DEOA 5CMDA 1TU2B 4FXKC 3VYUA 3K0YA 2RA4A 2MJ8A 2K1BA 2MP1A 3QO2A 2RSNA 4ID6A 5C4JB 3EFXD 2K5QA 1GUTA 2EYMA 3M4YA 4DK1A 5ISRA 5D3IB 1XTCD 2BOSA 3BVGA 5CV8A 3RZOB 2RSOA 2VUMB 1W6KA 3OSOA 1EQTA 3KUPA 3GTMB 5C4XB 2SNSA 4QMGA 3W2DA 3DWQA 4BA1I 5BN5A 1I50B 3GD7A 4A3KB 5T1GA 4FYDA 4I65A 1YNJC 4KN4C 1SYCA 1RD9D 4RFBA 1ENAA 5I4DA 3PUZA 3FPPA 5IIFA 4A93B 2K32A 2R92B 2KJXA 1HHVA 4G7ZC 3BDLA 4K5VA 2SOBA 1SNPA 2YYZA 4FNFA 4H0LC 1TWGB 3WDNA 3R2IA 4IURA 5IODA 1ZKOA 2K05A 5C4ZA 4X3SA 1E2WA 1IW7C 3TZDA 1I6VC 3CQZB 3HOZB 5IGBA 2NN6H 5ELFA 1PDQA 3SDZA 3U9OA 3S2DB 3CKIB 2WAQB 2F0GA 4N9PA 2YU9B 2WP8J 4OO1I 2E75C 4KTAA 1RF2D 2IW3A 3GTQB 2MHVA 3GV3A 2K33A 1C48A 3BDCA 4C3HG 5CORA 4DXGA 4EVOA 2R61A 1ET9A 4OIJA 4CBVA 1I4XA 1I4PA 5CV4A 1STGA 3MTSA 3GTKB 5D14A 3HS0C 4FO2A 3A56A 2PZWA 4IFDH 3PMFA 2QCPX 3GTOB 1EY5A 2D62A 1TS2A 4ZKCB 1KDAA 3CRKC 5E1FA 1JC7A 1IYVA 2A68C 1VCIA 5KRUA 5C5LA 2G9HD 5E3FA 3FEWX 1JCKB 1U4MA 4A3MB 2KCCA 4PNYA 3NHHA 1R4QB 4L63B 2IX3A 4KY7A 2PZUA 2OT2A 5EKIA 2BDNA 2L11A 1D1IA 4XYOA 1AW7A 4NDXA 3TP7A 3C3LA 3I70A 1VDZA 2EE1A 4KK7A 5JOBA 3OMGA 2A69D 1Q90A 2KHSA 1PRTC 4WRDA 2MGSA 4I7ZC 2O5IC 1LO5D 1EY7A 1DONA 1JR0D 4KI0A 3A8IE 4KKTA 4MN3A 4PV1C 5ELCA 3WOFA 2PPBC 3I4LA 2RQXA 3SHLA 3K57A 5G3LD 2E2HB 2OF1A 5IT9L 1PRTB 4CJ0B 1HFNA 3GV6A 3C1EA 1CT1D 5LL6S 4NP5A 1HA6A 1S5DD 2ID0A 3NTKA 2NVQB 4HCEA 4ZAIA 5IGFA 2J7ZA 5C0XH 3HRZC 1S5CD 1ILQA 4RWSC 2LKVA 5CBEE 2EJGC 3T13A 1HTPA 1SJED 1WD0A 2NVTB 1SE4A 4NKLA 3OMCA 1CZGA 4CKBA 5FO8B 3C2PA 3TP8A 1GUOA 1KLGD 1SYFA 3HGBA 1BO0A 4IUTA 3E6ZX 1STEA 2CHBD 1DOMA 5C0XJ 1M4VA 1KDCA 3V96A 4G57A 1OO9B 2K7VA 3EQLC 4OL7A 1DXMA 4RH6A 4HAEA 5JVG3 2KEDA 3HP3A 4DAYA 1ENFA 4K8JA 1LT3D 5I2YA 1LTAD 3KBGA 2D5DA 2PMZB 1YNJD 4C3IB 1RHPA 1J8IA 4Q0FA 5DM73 2A74C 4KJNA 1STAA 2K6AA 2B2TC 3DXJC 2J0TD 3FVQA 1TKWB 4QB4A 1MI2A 1Q8IA 1X3QA 3D6WA 1SEBD 3DWPA 2F0MA 1I6HB 4KJOA 3NUCA 4X3TA 1SYGA 3S2HB 1IW7D 1STNA 2EJFC 2AWOA 1Z47A 2XSCA 1FNVA 3BZDB 5D65A 5CBAE 1L0YB 2NVYB 2NN6I 1STBA 5JEAG 3S1MB 5KYIA 1PTOF 4Y7NB 3S1RB 4J1MA 2LMCB 4OO1G 1WTOA 1BR9A 3MZ5A 2G9DA 1RTNA 1SSOA 3NK9A 4ZUIA 5HGTA 3DMUA 3T16A 4K14A 4WORA 2FJ2A 3K7AB 2Z8LA 4C3JB 3NWSA 1Q12A 3OPOA 2HUGA 3S15B 2EXZA 4IFDI 1BCPC 4BA2I 1G6ZA 1E2VA 2QEJC 1E0BA 4HR7B 2F0FA 2KOLA 3SVMA 2DY8A 1O7YA 2A68D 4K5WA 3C1FA 2WACA 1JICA 3PUXA 3S1NB 2X69A 1TWFB 1BCPB 2H1EA 4C1NI 1V1PA 2L9HA 5KNBA 5HURA 4EQNA 4RHRA 3A8JE 1U4PA 5EGTA 4K6DA 5JPMC 2ZXRA 2WB1B 3RLFA 3H6MA 5JEAJ 1SFOB 3CRLC 1GOZA 3T4AC 2MUYA 4IQZA 3D8GA 4EGVA 2ENBA 1XX8A 5K5PA 3SK4A 4KMUC 1CM9A 1PRTD 2EYJA 1ESRA 2NTSA 1SMYC 4DU9A 2Z4HA 1MGSA 3QB3A 2TMPA 2BCOA 5I6WA 3IFDA 4A3JB 5I9OA 4BY7B 4XYQA 1EEFD 2JP1A 1DD2A 4GZYC 2B2VC 3H09A 1AZQA 3ZYYX 1G2TA 1TT2A 1PZID 5JAVA 2B2YA 5JVH3 3OOCA 2ZXOA 2PO4A 5C0XI 3HZXA 5FLXE 3D4WA 3BVZA 4XTCS 1WCMB 1A2UA 1O80A 3V2TA 1F2LA 3EJIA 1K8OA 3D6CA 2J4XA 1TWHB 1D5XC 5A35A 1KLUD 2JA5B 3MFYA 2A6EC 3K58A 2B2UC 3X3NA 1JOKA 1SYDA 3RMHA 1B44D 1D5MC 4CKCA 1NUCA 2XWJB 4FXGC 2IT1A 4MHEA 1OXVA 4C3JG 1OXXK 2F0PA 1H9SA 4A3IB 2NVXB 3DEPA 2EYOA 2NUCA 3JAME 1EOTA 2F0KA 2R6GA 4Z9CB 1SYBA 3O13A 1EY4A 4F8MA 2AUJD 4G4KA 1I3QB 2F0QA 1SDFA 1RCVD 1RTOA 4H7BA 3A54A 2D9UA 4CGYB 3L3OC 1MBYA 4HN7A 3GO5A 1SNMA 2C9OA 1WTQA 2F0DA 5T1IA 4JK1C 4KD3A 1II3A 1F9QA 2F0HA 4BS9A 3R8BA 4BBRB 1EFID 2I46A 1L0XB 4IUQA 1IKMA 2B39A 5KIXA 1H9RA 2R93B 1EY9A 1HPCA 3J80L 3SXHA 1ML0D 1HUMA 4QCLA 1SYEA 5CV9A 2M2LA 1O7LA 1EWHA 4K5XA 5KNCA 2SEBD 3PUVA 1EQVA 1B2TA 2XNAC 1U4LA 2EZVA 5EQ0A 2KECA 4XT3B 3IKJA 4F87A 4U68A 4QUFA 1ICWA 1BCPD 3A8KE 1XWEA 2RDHA 1WVLA 4J6HA 1IYUA 5C3EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EBD A;  5CYU A;  4KK7 A;  3X3N A;  3X3M A;  5EBC A; 
#chains in the Genus database with same CATH topology
 5LMN W;  2JEA I;  2ALY B;  4JYA L;  5NUC A;  5LMN L;  1B9N A;  4K0K L;  3DHQ A;  3FDT A;  3VYS A;  3TEH B;  4RCN A;  2KHJ A;  2JA5 G;  2OXP A;  3PIP 3;  1UEA B;  2EYL A;  1N32 L;  1V1O A;  3AQQ A;  3OIP A;  3M85 A;  2FMC A;  3N6R A;  4OWT B;  4BY1 H;  2XVS A;  3R93 A;  4X3K A;  4C1N K;  2K5D A;  3UE1 A;  2B63 H;  2BDO A;  2JK8 A;  1RDP D;  1MD2 D;  2F0N A;  3OTO Q;  3M4Q A;  4QJF A;  1N33 Q;  3TN2 A;  2PCF B;  4Y52 H;  4FF1 A;  4DR6 L;  1FR3 A;  1C7Y A;  2O4X A;  3CPF A;  5M5W H;  3RZD B;  2ICE C;  2K28 A;  2JA6 B;  3S17 B;  4L6T B;  4LF6 Q;  3PIO 3;  1JE5 A;  2RCN A;  2D0O A;  2SDF A;  3G7L A;  5DNF A;  3HOY H;  4HMI A;  1DM0 B;  1NCV A;  1EY8 A;  3H94 A;  3SE0 A;  3LWU A;  1TWC B;  3VR3 A;  3OTO L;  1N9W A;  1F2M A;  2C5C A;  4ABN A;  1N33 L;  1PFS A;  5FO7 B;  4IPC A;  4BXX H;  1T9H A;  1PHJ A;  4HCS A;  2GVA A;  5E4W C;  3G4S A;  1KIX A;  1ZXT A;  4LF6 L;  2LFN A;  3I73 A;  1SMY D;  4QUC A;  1EU3 A;  2RBM A;  1V9P A;  4ZRZ A;  5K36 G;  2CH4 W;  2WII B;  2N8N A;  3IAY A;  1QOH A;  2MO0 A;  4LFC Q;  1F77 A;  4B3T Q;  1HUN A;  1Y1W B;  1ZEQ X;  3QWN A;  1S3O A;  1XPO A;  1OXU A;  4C3H H;  5EAY A;  3PUY A;  2EVB A;  3NTI A;  1MIU A;  3S1Q B;  1QUQ A;  4PZ6 A;  5GAG C;  5GQO A;  1WI5 A;  5EPK A;  1B70 B;  1GUG A;  4KKS A;  2EPB A;  3KLS A;  2F3W A;  5JJZ A;  1LTI D;  4B3T L;  1LTR D;  1SXT A;  4K8I A;  1I4Q A;  3IRB A;  4V0B A;  3KJO A;  1AH9 A;  2DJG C;  2F1M A;  2L4N A;  1C4Q A;  1LTT D;  2JA7 H;  5KND A;  2NBF A;  1CKN B;  1RIP A;  4CHT B;  5IGC A;  2G5D A;  3I3C A;  5ELE A;  2EY2 A;  2MQH A;  4BWG B;  3PV0 A;  4GLV B;  5M9O A;  4KHZ A;  1LTG D;  4OIK A;  4HIO A;  2R93 G;  1HCZ A;  1QJO A;  2A6E D;  2TSS A;  4CKE A;  2EYH A;  3RN5 A;  3VR4 A;  3M9B A;  5FLX c;  1DCZ A;  3BYT B;  1XNQ L;  2HDL A;  4IPH A;  2XRQ D;  4DNR B;  3K80 C;  1GJX A;  1FNW A;  1F2Z A;  3BVM A;  4R4O A;  2Z6B A;  4RGM A;  3GTJ B;  4TVA B;  2VUM H;  2I0Q A;  4CJ1 B;  3GTM H;  1EYA A;  2JE6 I;  1ESF A;  5C4X H;  3HOZ G;  3I90 A;  3I4M B;  2EOT A;  3A55 A;  1VQ4 A;  3CP0 A;  1F9R A;  2WKD A;  3VR6 A;  1G2S A;  3G48 A;  4QL5 A;  2F4I A;  1RJT A;  1VQF A;  1IYJ B;  1B3A A;  5HGQ A;  4A3K H;  4DV4 Q;  1PTO B;  3L9A X;  2AQ2 B;  3CCM A;  4ODG A;  2BA1 A;  1YNX A;  3RR5 A;  1GHK A;  3EA6 A;  3N52 A;  1ASY A;  3FMC A;  1SBB B;  3NTH A;  2VB2 X;  1YJN A;  3IL8 A;  4L5R C;  2H4O A;  1O78 A;  2GN5 A;  3KLS X;  1VQG A;  4A93 H;  1K83 B;  2R92 H;  1CA6 A;  1BNZ A;  1K0R A;  2E76 C;  4DV4 L;  3J81 E;  3VYT A;  2F3V A;  1Z9F A;  3H0G H;  4FF4 A;  2LXJ A;  1VQE A;  3HOU H;  2ATW A;  1HFG A;  4A3G B;  2KQ3 A;  2X6G A;  2UXD L;  3M7G A;  1SAP A;  4RKB A;  3KOJ A;  3OIQ A;  2JEB I;  2Z9H A;  2UXC L;  4JV5 Q;  3IFT A;  2JA6 G;  1EY0 A;  1QE6 A;  2F0U A;  4NW2 A;  4C56 C;  2VS1 A;  4X3U A;  3HOX B;  1E22 A;  3K5O A;  1LLR D;  2H5X A;  1QVG A;  2EY6 A;  2WV6 D;  4DAY B;  3TME A;  4A76 A;  4MNO A;  4APV A;  3S2D H;  2F0S A;  1L1O B;  5FKA C;  4JV5 L;  2YV5 A;  3LWE A;  1Y1V H;  1A3V A;  2AQ1 B;  2D0P A;  1A3T A;  1I5F A;  3NXW A;  1VQD A;  2NB0 A;  2YU9 H;  3S16 B;  3P7J A;  5I6Y A;  1CQV A;  1O7I A;  3A5Z B;  2F03 A;  5J22 A;  1EZ8 A;  3KJP A;  4A3M G;  4DUZ Q;  1ONL A;  4B9X A;  3M3Y B;  1Y1W G;  1IHZ A;  5GAE C;  1PZJ D;  2AQ3 B;  2B2W A;  1LTS D;  5CYU A;  2FMM A;  1Q8K A;  1K28 A;  1P16 A;  5I9P A;  1IZ6 A;  2A1A A;  4GOP C;  1DYQ A;  1F9P A;  3KK7 A;  3VA5 A;  1UE7 A;  5TSS A;  1CKO A;  4DN4 M;  3K5M A;  1STY A;  1VQP A;  4NXM Q;  1BBW A;  3HFZ B;  3K7U C;  4DUZ L;  1VF7 A;  3GTK H;  3QJY A;  4QY7 A;  2R3Z A;  4HJ8 A;  3T56 B;  2BA0 A;  2HCI A;  4JVZ A;  2O2L D;  3TP6 A;  3J80 i;  4YCU A;  1SNC A;  3T53 B;  3NBI A;  3VR5 A;  3M7N A;  3I72 A;  4O42 A;  2PI2 E;  3GTO H;  3S14 B;  3TSS A;  1VS0 A;  2Y0S E;  3VYR A;  1LM0 A;  1Q1B A;  1SE8 A;  1AZP A;  1G6P A;  1A15 A;  4ZKB B;  1PH6 A;  1A8V A;  1CUK A;  3T1H Q;  3K6O A;  2ICI A;  3CU7 A;  2RF4 A;  2AKW B;  4EQP A;  5C44 B;  5FLX L;  4IUP A;  3HKZ B;  1VQL A;  1R4P B;  2FIN B;  2A5H A;  2M9V A;  1QZH A;  2F0T A;  1PH4 A;  1Y8N B;  4O1N A;  3I4M G;  3H3V C;  1KTK A;  4DF7 A;  4ZUJ A;  3OHX C;  3T1H L;  1K3B C;  1QVC A;  1SRO A;  4CJ2 C;  4JBJ A;  3MXN A;  1J9O A;  5EPJ A;  4RGN A;  1GD7 A;  4DK0 A;  5JEA H;  2F0V A;  2AUK A;  2HCC A;  1H9M A;  5A2Q E;  2E74 C;  4IUV A;  2ZM6 Q;  2PYK A;  2VQE Q;  3P1H A;  4C2M B;  3MXG A;  1PMR A;  4B3R Q;  4DFA A;  1EY6 A;  3S24 A;  3VR2 A;  2DGY A;  4OO1 H;  1X56 A;  3EVQ A;  1DOK A;  5F2D A;  3I8Z A;  1SE3 A;  4DR7 Q;  2E2H H;  1V43 A;  1HA5 A;  2XRS D;  4DV7 Q;  3I91 A;  1TS4 A;  4YIJ A;  2ZM6 L;  3L0O A;  1TY0 A;  3X3M A;  3DWA A;  1VQJ A;  4P73 A;  2PI2 A;  2VQE L;  3STB C;  3T1Y Q;  5ELB A;  1X9N A;  2NVQ H;  1DJR D;  1KRS A;  1OTC A;  2PQE A;  1V1P B;  3MEF A;  2HT1 A;  4PMB A;  2Q2I A;  2OQK A;  3RUZ A;  1JWS D;  4C3I G;  4DR7 L;  1TS5 A;  5C6A A;  3QOJ A;  3CD6 A;  1SND A;  4DV7 L;  3HOX G;  3M4O B;  2EYP A;  1SE2 A;  1U0L A;  2IWH A;  1NSN S;  2CW0 C;  4JI7 L;  2IX1 A;  1GO3 E;  1TWA B;  1NR4 A;  3CCJ A;  2NVT H;  5J39 A;  1FL0 A;  3CCV A;  1MSH A;  2VQF L;  2B8F A;  1Q86 C;  1YIT A;  2JQO A;  2O5J C;  3GTG H;  4PMW A;  3TQY A;  5DEH A;  1I4H A;  1VQO A;  1EYC A;  2Z6K C;  1B8A A;  5FLM H;  2JJQ A;  3Q6S A;  1SRU A;  1JOQ A;  2B2Y C;  2K50 A;  4JI2 Q;  1SMX A;  3Q22 A;  1X3E A;  1PTO D;  1TY2 A;  1NAP A;  4CDF C;  1DOL A;  2B63 B;  3HOV B;  2ZJQ A;  5FK9 C;  2HQE A;  3DM3 A;  3VA7 A;  1EYD A;  3EIV A;  5J1Z A;  3KF6 A;  5IWA L;  2B2V A;  1WOC A;  1LTL A;  3J7Z C;  2ZJP A;  1VQN A;  4JI2 L;  4AH6 A;  2B29 A;  1GUW A;  4UP9 A;  2XIW A;  4DR5 L;  2UUC Q;  4NB3 A;  3QIA A;  4C3I H;  1YHA A;  1KNE A;  4R9W A;  2Q8I B;  3AMU A;  1LUZ A;  3LNN A;  2Z4I A;  4YHH Q;  4F88 A;  1OXS C;  5M5Y H;  1IL8 A;  1PH7 A;  2ZXP A;  3FHW A;  4DR1 Q;  4L5S A;  1HNZ L;  3F8T A;  1WTX A;  2EY5 A;  2MPM A;  3B6Y A;  4XQJ A;  1GM5 A;  2UUC L;  5KYL A;  3SK8 A;  5LL6 X;  3RD4 A;  2E2I B;  1FJG L;  1YIJ A;  1BBU A;  5C44 G;  1PH3 A;  3HKZ G;  1PXU A;  4G7H C;  4RAU C;  3E0E A;  2B2U A;  3W3A A;  4OHJ A;  1CI3 M;  4DR1 L;  1EIY B;  1QB5 D;  1I6H H;  3NQT A;  4JI0 Q;  1ILP A;  1XYI A;  1BDO A;  1CHQ D;  3S2H H;  5EPL A;  3KBX A;  2CWP A;  5M3M H;  3MFG A;  1S5E D;  4FF3 A;  3J81 c;  1D2B A;  3UI2 A;  1SJH D;  2B8G A;  4UAI A;  3BJU A;  1IBM Q;  4A3D B;  4G7O C;  3NBH A;  4XQQ A;  2NVY H;  1CA5 A;  3S1M H;  1T5E A;  3M4P A;  3K5L A;  2DN8 A;  1H9S B;  2AWN A;  4JI0 L;  2JA7 B;  4LK1 C;  1KAA A;  1WFQ A;  2FHT A;  4V19 0;  5JJK A;  1B9M A;  2L1B A;  4Y7N H;  3TDQ A;  2F0O A;  2VNU D;  1PZK D;  4JOI C;  2WAQ E;  4OEL B;  4PZ7 A;  3S1R H;  4OX9 Q;  4GNX A;  1IBM L;  1FYC A;  3Q23 A;  4POG A;  5HY6 A;  1QIL A;  2I5M X;  4LJZ C;  4RG1 A;  3CCS A;  4LF8 L;  1EIG A;  1SLJ A;  2WB1 G;  5ELD A;  5IYC G;  3UDI A;  3Q8D A;  3U58 A;  1XTD A;  5ELO A;  4DNT B;  4KY6 A;  1EUJ A;  5E7N A;  4R1J A;  4TKO B;  4FVM A;  2ZTD A;  4J15 A;  4LNQ A;  3C46 A;  4C3J H;  2AMC B;  3BG3 A;  5LHY 1;  1QG7 A;  1X65 A;  4TSS A;  5M5X B;  3E0J A;  3ND9 A;  5KEE A;  1QNK A;  4UP7 A;  1DZ1 A;  2NN6 G;  1Q81 C;  2L0C A;  1L0W A;  3A7L A;  3MVV A;  2KA7 A;  2QDL A;  1E24 A;  1GHJ A;  2XN9 C;  4JBK A;  4L5Q A;  2JSO A;  3MEH A;  4AYB B;  1NMF A;  4DR4 Q;  3NQI A;  3FRP B;  4DA2 A;  3D4R A;  1KXL A;  4L5T A;  4BY7 G;  1VQ7 A;  3SGI A;  2KBN A;  5EKL A;  2LS0 1;  3S1N H;  3QG1 A;  3URY A;  1UAP A;  4KHV A;  2QF7 A;  1TWF H;  2EJM A;  1VQ9 A;  1NNX A;  4XT1 B;  4NPS A;  3H0G B;  1TR5 A;  3PF4 A;  2PNR C;  2PQA A;  4JYA Q;  5LMN Q;  3HOU B;  2VY3 A;  4O2D A;  2BE5 C;  3HOV G;  3FKI H;  4K0K Q;  4DAP A;  3S9W A;  3P20 A;  3PUW A;  3CME A;  3Q24 A;  4DR3 Q;  4WJ4 A;  2YTY A;  2VXW A;  1S72 A;  1A62 A;  1N32 Q;  3NE5 B;  2E2D C;  2CKZ B;  1WCM G;  1Z6H A;  2K4K A;  3CCE A;  4M1U B;  4IFD G;  5CR3 A;  2L15 A;  3I2Z A;  5C4H A;  5G3L F;  1QWY A;  4DR3 L;  4HMJ A;  4R8I A;  1NJI C;  4DR6 Q;  4J8Q A;  3TS0 A;  3QOL A;  1LT5 D;  4QIW B;  3AEV A;  2EDG A;  1PFN A;  3T51 B;  3KDF A;  1G51 A;  1C0A A;  4N9T A;  5FJ8 G;  2K01 A;  1Y1V B;  4DK6 C;  3PO2 H;  3ERQ A;  1QCB D;  1LT6 D;  2PW7 A;  2HDM A;  4A3J H;  2JA8 H;  4DAV A;  1D6E C;  1P8L A;  5D3D A;  1M90 C;  4EQ5 A;  1HQR D;  1EWI A;  1KRT A;  4ZK9 B;  4A3F H;  1FNU A;  1F9S A;  2I5H A;  3ONA B;  4TQU S;  3STB D;  4A3I G;  1B53 A;  4CDD C;  4JG2 A;  1H9J A;  2A73 B;  2QDB A;  3R3O A;  1BBX C;  5IY0 A;  3EN2 A;  1A3U A;  4JI6 L;  4A3D G;  3MA2 B;  5M3F B;  4XDX A;  4ZQ3 A;  2CW0 D;  4K2L A;  4MZ9 A;  1VQ5 A;  3OWE B;  4ZLT F;  1E2Z A;  3J81 L;  1TS3 A;  4KHP Q;  1JQY D;  4A75 A;  2CVR A;  2KCN A;  1HRJ A;  4EX5 A;  1TQO A;  5AFW A;  2F0L A;  2K52 A;  2JA5 H;  4A3B B;  4LF7 L;  4DAM A;  1EZ6 A;  5IGD A;  2IJ0 A;  4WFN 3;  4ILW A;  3NPP A;  1HZ9 A;  5C3W A;  1A6X A;  2V4D A;  1KC8 C;  1VF5 C;  4KHP L;  2E2J B;  2QIL A;  3F1Z A;  5COY A;  2KEN A;  5J3B A;  1TVX A;  2K03 A;  3MHB A;  2QW7 A;  5IP9 G;  2VW9 A;  3PO3 B;  1WTR A;  3GTP H;  1HTL D;  5ELN A;  3LX0 A;  4LF4 L;  4XXE A;  4IFD J;  1FGB D;  2IHF A;  3J80 E;  2WKC A;  2Q8R E;  5C0X G;  1E3P A;  1BUV T;  2N78 A;  3F2U A;  1QUQ B;  2NVX H;  1XNQ Q;  1IBK L;  4BBR G;  3J7A V;  4E6I A;  3A74 A;  1JOO A;  1PVO A;  4JW0 A;  3MXP A;  4S3S A;  5BN3 A;  1YZ6 A;  4LAA A;  1XJV A;  5C4J H;  3K59 A;  4QQB X;  4QF4 A;  3I55 A;  1PH8 A;  2EIF A;  1I3Q H;  2PMZ E;  1C8C A;  4OWW B;  3HOW B;  1M1K C;  1KNA A;  1IXR A;  1YNN C;  1EIH A;  2NWG A;  4DGZ A;  2MO1 A;  4IZ8 A;  4R4Q A;  5K36 H;  1EWC A;  1AEX A;  1Q1E A;  1X32 A;  3NSW A;  1PTO C;  3RZO H;  2A6H C;  3BDO A;  3TRZ A;  1KDB A;  4HED A;  1PFB A;  1I94 Q;  4H44 C;  1BOS A;  2PZT A;  3HG9 A;  1Q3L A;  3DM1 A;  1B1Z A;  1YJ9 A;  1D5Z C;  1JE4 A;  1I50 H;  4H13 C;  1Y8P B;  1Z7T A;  3BS1 A;  1CTM A;  4PMC A;  1PLF A;  3I4N B;  3D4D A;  3CMA A;  1IL2 A;  2HIX A;  3BU2 A;  1Y8O B;  1I94 L;  5IGE A;  4MIU A;  2IX0 A;  1RKN A;  1WTW A;  3GP7 A;  5C3E G;  2F0I A;  1K3R A;  4RCO A;  3I56 A;  4A3E B;  2UXD Q;  4HSV A;  4RKL A;  1X3P A;  2RVL A;  5CV7 A;  4X66 Q;  1QNU A;  5EKK A;  1B50 A;  2UXC Q;  2R7Z B;  1QZG A;  3H91 A;  1HZA A;  3D3R A;  4JI4 L;  5GAH C;  1HNX Q;  2K5H A;  2R93 H;  3JAM c;  3GTL B;  1VQA A;  3ULP A;  1TWG H;  1PH5 A;  4ZYS A;  1B7Y B;  2QEX A;  4R4T A;  1FD7 D;  5JPN C;  3KF8 A;  3GTG B;  3ER0 A;  1CQF A;  2IL8 A;  1L1O C;  2X6L A;  4X66 L;  1ZYR C;  4IUN A;  4NMZ A;  2F0E A;  2R7F A;  4IN3 A;  1S5F D;  5I2X A;  5GAD C;  3MC0 B;  5DAU A;  1HNX L;  3CQZ H;  1YEZ A;  4BBS B;  3AFQ A;  1O7Z A;  1U5K A;  2RHQ B;  5IGG A;  1K8G A;  3HOZ H;  1Q46 A;  3DUZ A;  1GUN A;  2EY1 A;  3RLO A;  1A0I A;  3ERO A;  2HHH L;  5A2Q L;  4TRD A;  1CHP D;  1WTP A;  1VMC A;  5EBD A;  4YWK A;  5M3F G;  4DV1 Q;  1EQQ A;  2ASB A;  1XPU A;  5BN4 A;  1EEI D;  3U9S A;  3NWT A;  3J81 j;  2K04 A;  4KY5 A;  2I07 B;  3HEJ A;  1AE3 A;  4KKU A;  1W2B A;  3GTQ H;  1PYW D;  4Q5V A;  4A3B G;  4RGO S;  2B2W C;  2LY7 A;  4IO9 A;  1YI2 A;  3E9H A;  5M5Y B;  3MXU A;  2JXM B;  3AB9 A;  3KLW A;  4DV1 L;  1WD1 A;  2XWB B;  1KL9 A;  2B2T A;  4B3M L;  4P75 A;  3J7A F;  1EIF A;  1PRT F;  5DM6 3;  3PO3 G;  2I5L X;  2IPK D;  2BE5 D;  3OWF A;  3D31 A;  1F2Y A;  3GQB A;  4LMQ D;  1B3Q A;  1NR2 A;  2M00 A;  3WOE A;  1ENC A;  3RZD H;  2N55 A;  3E9I A;  5C3X A;  5IT9 E;  2IHE A;  3MWY W;  4ME5 A;  2JA6 H;  2DNC A;  3S17 H;  1CZW A;  5C5M A;  1J6Q A;  1M8A A;  2CQO A;  1MSG A;  2WB1 E;  3ERS X;  3ITP A;  1WJJ A;  4GOP A;  2KCM A;  5M3M B;  3NP8 A;  1TWC H;  4XQN A;  3E5S A;  5CV6 A;  4RMF A;  1Q82 C;  1ET6 A;  3BYY B;  1KQS A;  5EBC A;  2N88 A;  4FP5 D;  3TBI B;  4F7X A;  2JYO A;  1D1K A;  4ULL A;  2SNM A;  2RDG A;  3G6J B;  3HOW G;  3MAQ A;  4IAL A;  4DXF A;  1STH A;  4L8J A;  4P2C B;  4JBM A;  3ND8 A;  4RA8 A;  1LT4 D;  2DNE A;  2FFK B;  2OEO A;  5CC4 A;  1VMP A;  4GLA C;  4GS3 A;  4A3M H;  3RLN A;  1YJW A;  3TP5 A;  1Y1W H;  4A3C G;  3AU7 A;  1IKL A;  4HJ7 A;  3L7Z C;  4HTH A;  3Q0A A;  1ROD A;  4B08 A;  4IUU A;  1EL0 A;  1IBL L;  2KVM A;  3W1B A;  3ULL A;  1UNS A;  2RDF A;  2K5W A;  1HXY D;  4U67 3;  1CSP A;  1PA6 A;  5E4X A;  2Z1C A;  4I7A A;  3I4N G;  1LAB A;  1K8M A;  1HQM C;  2L12 A;  1A2T A;  1JWU D;  2UUA Q;  4A3E G;  1NMG A;  4JI3 Q;  1JB3 A;  1RL2 A;  1LTB D;  1JWM D;  4OXP A;  3EBE A;  1AN8 A;  2D2C C;  4DV3 L;  2EYF A;  2R7Z G;  4XIG S;  3MXN B;  1G29 1;  1KAB A;  2F0W A;  2C35 B;  1AP0 A;  5FOB B;  1PYB A;  3KLR A;  4YCV A;  1BVS A;  1AFP A;  1H9K A;  1R9T B;  5KGU A;  4A3G G;  4RHS A;  1SNO A;  4UP8 A;  2UUA L;  2HQL A;  4PQX A;  3SK6 A;  4JI3 L;  2MNA A;  4K6L A;  2L55 A;  4JI7 Q;  3A7A B;  2L5T A;  3JAM L;  1HNW L;  1U9R A;  2F0J A;  1W6J A;  1XNR Q;  5EJW A;  2VQF Q;  3GTJ H;  1DGS A;  2OTL A;  1U4R A;  4UDU C;  1CFM A;  4BBS G;  3U4Z A;  2KEE A;  3FKI B;  2NYZ D;  3K5N A;  3I4M H;  4JBW A;  1EU4 A;  3G6E A;  2F3I A;  2CCZ A;  4KN7 C;  1N36 Q;  1XXG A;  2ZT9 C;  1Y69 U;  1XNR L;  1WTV A;  3R2T A;  3SR1 A;  1G91 A;  1T5X D;  1S4Z A;  1PTO H;  2Y0S B;  2GA4 B;  4CDE C;  1PH9 A;  1NTG A;  1K8A C;  5BR8 L;  1YNN D;  1N36 L;  5IWA Q;  4N8F A;  3NEN A;  2KUM A;  1BF4 A;  1GKH A;  4DPG A;  4BY1 B;  4X62 L;  1OXT A;  1GXD C;  4DR5 Q;  3PO2 B;  2A6H D;  1X55 A;  3D0F A;  2JA8 B;  4M8A A;  2WIN B;  5FO9 B;  3P75 A;  5LMU Q;  5IYB G;  3PIP A;  2GVB A;  5M5W B;  2RHS B;  2Z6K A;  1HNZ Q;  4A3F B;  1YBY A;  4EQO A;  4R8N A;  2PW5 A;  4K2K A;  2HIV A;  2ES2 A;  3HOY B;  4WJW A;  1PFM A;  4OGQ C;  1I4R A;  2EQS A;  3I4O A;  2QKI C;  3UDX A;  5CV5 A;  1FJG Q;  4DR2 Q;  2A69 C;  5CGK A;  2VB3 X;  3HOX H;  2DY7 A;  3F2B A;  5LMU L;  5IOC A;  4HSP A;  4GLX A;  2NZ1 D;  4FXD A;  3KF6 B;  1BXT A;  2RKS A;  3SEB A;  1CK1 A;  5IP7 G;  2NTT A;  1LV9 A;  1LAC A;  3PIO A;  4AQY L;  1VQ8 A;  3CCR A;  2CQA A;  1SNQ A;  3S16 H;  4DR2 L;  3BZK A;  1G8Z D;  1PH1 A;  1LYL A;  1TII D;  3SK5 A;  1WYD A;  2Q8T A;  3H15 A;  1BQQ T;  1I4G A;  4C3H B;  2UUB L;  4X65 Q;  1E7Z A;  1ZYR D;  3CHB D;  4OWX B;  1BCP F;  3TZU A;  3FPU B;  2LXK A;  4B9W A;  4KV6 A;  1S5B D;  1UUP A;  4FF2 A;  3OW7 A;  3J7Y W;  3UDG A;  1B4O A;  1JOR A;  3CXC A;  3V05 A;  1GUS A;  3GTP B;  1V8Q A;  1XMQ Q;  4KD4 A;  4RGT A;  3DEO A;  5CMD A;  1TU2 B;  4JI8 Q;  4X65 L;  3KFU A;  1VQI A;  4FXK C;  3VYU A;  3K0Y A;  4LF8 Q;  2RA4 A;  2MJ8 A;  2K1B A;  2MP1 A;  3QO2 A;  2RSN A;  5H1S E;  2A8V A;  1XMQ L;  4ID6 A;  4HIK A;  5C4J B;  3EFX D;  1XMO Q;  1HZB A;  2K5Q A;  4JI8 L;  1GUT A;  2BH2 A;  2EYM A;  3M4Y A;  5IP7 H;  4DK1 A;  5ISR A;  1HR0 W;  5D3I B;  1HR0 L;  4QGU A;  1XTC D;  1JJC B;  1MJE A;  2BOS A;  3TRE A;  3BVG A;  1VQ6 A;  2BH8 A;  5CV8 A;  3RZO B;  2IY5 B;  5IYD G;  2RSO A;  5C44 H;  2ZTC A;  2NZO A;  4GNX B;  1W6K A;  3K7A H;  2VUM B;  3OSO A;  4X6A H;  1XMO L;  4PZ8 A;  1EQT A;  3KUP A;  3WWV A;  1EYG A;  3GTM B;  5C4X B;  1K9M C;  2SNS A;  3S15 H;  4QMG A;  3W2D A;  1PH2 A;  1JJG A;  3DWQ A;  4BA1 I;  5BN5 A;  1I50 B;  3GD7 A;  4A3K B;  5T1G A;  4FYD A;  4HJ5 A;  4I65 A;  1YNJ C;  4KN4 C;  4YWM A;  2Y0S G;  1X54 A;  1SYC A;  4LFB Q;  1RD9 D;  4RFB A;  1ENA A;  5I4D A;  3PUZ A;  3G71 A;  3F2D A;  3H3V H;  3FPP A;  5IIF A;  5IT9 c;  4A93 B;  2LSS A;  2K32 A;  4DK3 C;  2R92 B;  2KJX A;  1HHV A;  4G7Z C;  3BDL A;  4K5V A;  4BY1 G;  2SOB A;  1SNP A;  2YYZ A;  4FNF A;  2PNH A;  4H0L C;  1TWG B;  4R4C A;  5IE8 A;  2B63 G;  3RNU A;  4LFB L;  3WDN A;  2VL6 A;  3R2I A;  4IUR A;  5IOD A;  1ZKO A;  2K05 A;  5IYC H;  5C4Z A;  4OON A;  4GKK L;  4DV5 Q;  4X3S A;  1E2W A;  4UPA A;  1J5E Q;  1SFO H;  1IW7 C;  3TZD A;  1I6V C;  3CQZ B;  4HIM A;  3HOY G;  4ME3 A;  2PQA B;  2OQ0 A;  3HOZ B;  3K0X A;  5IGB A;  2NN6 H;  5ELF A;  4BXX G;  1PDQ A;  4YCW A;  3SDZ A;  4DV5 L;  3U9O A;  3S2D B;  1N34 Q;  3CKI B;  1SR3 A;  1J5E L;  2WAQ B;  2F0G A;  4N9P A;  3PF5 A;  2YU9 B;  2WP8 J;  4OO1 I;  1VQH A;  3CC7 A;  2DJF C;  2E75 C;  4KTA A;  1RF2 D;  4BY7 H;  4CDC C;  5AJ3 L;  2IW3 A;  3UE0 A;  4P71 A;  3A5U A;  3GTQ B;  2MHV A;  2CWA A;  3GV3 A;  4JI6 Q;  4DV2 L;  2K33 A;  1C48 A;  3BDC A;  4C3H G;  1N34 L;  5COR A;  4DXG A;  3KDF B;  4EVO A;  1HZC A;  4DNI A;  2R61 A;  1ET9 A;  2K14 A;  3AYH B;  4OIJ A;  4CBV A;  1I4X A;  3PGZ A;  1I4P A;  3HOV H;  5CV4 A;  4KLK A;  1STG A;  3MTS A;  4LF7 Q;  3GTK B;  4IOA A;  5D14 A;  2K5V A;  3HS0 C;  4FO2 A;  1WCM H;  2VZA A;  3A56 A;  1HJP A;  2PZW A;  4IFD H;  4HJ9 A;  2JA7 G;  3PMF A;  2QCP X;  3F2C A;  3GTO B;  1EY5 A;  2D62 A;  1TS2 A;  1TWH H;  4ZKC B;  1KDA A;  4LF4 Q;  3CRK C;  3JAM i;  4ZCK A;  5E1F A;  3DLL A;  1JC7 A;  2ZJR A;  4A3L G;  4HID A;  1IYV A;  2A68 C;  4GKJ Q;  1VCI A;  5KRU A;  5C5L A;  5FJ8 H;  1IBK Q;  2G9H D;  1X3G A;  2YTX A;  3CAM A;  5E3F A;  3FEW X;  1JCK B;  4A4I A;  1U4M A;  2E2I H;  4A3M B;  2CFM A;  2KCC A;  4JC0 A;  4PNY A;  1VQB A;  3NHH A;  1R4Q B;  4L63 B;  2IX3 A;  4KY7 A;  2PZU A;  2VUM G;  3PCO B;  4GKJ L;  2OT2 A;  5EKI A;  2BDN A;  2L11 A;  1D1I A;  4A3I H;  4XYO A;  5C4X G;  1CKN A;  1AW7 A;  4NDX A;  2P5Z X;  3TP7 A;  3I70 A;  2N3S A;  4LW1 A;  3C3L A;  3CPW A;  1VDZ A;  3NEM A;  2EE1 A;  4KK7 A;  5JOB A;  4LFC L;  4A3K G;  3W1G A;  3OMG A;  4AYB G;  1VQC A;  3KYH C;  1Q90 A;  2A69 D;  2KHS A;  4A3D H;  1PRT C;  1V1Q A;  4WRD A;  2MGS A;  4IOC A;  4GN5 A;  4I7Z C;  4JI5 Q;  2O5I C;  1BKB A;  1LO5 D;  1EY7 A;  1DON A;  1JR0 D;  4KI0 A;  3A8I E;  4KKT A;  4MN3 A;  4PV1 C;  5ELC A;  4A93 G;  3WOF A;  2XTI A;  2PPB C;  2R92 G;  4A3L H;  3U50 C;  1UE5 A;  3I4L A;  2RQX A;  3H0G G;  1CKM A;  2F52 A;  3SHL A;  3K57 A;  5G3L D;  3HOU G;  2OF1 A;  5IT9 L;  1PRT B;  4CJ0 B;  2E2H B;  2DUD A;  4R4I A;  1HFN A;  4JI5 L;  1MKH A;  3GV6 A;  3C1E A;  3FP9 A;  1CT1 D;  5LL6 S;  3I7F A;  4NP5 A;  1HA6 A;  5IP9 H;  1S5D D;  2ID0 A;  3NTK A;  4OEM B;  2NVQ B;  4WJ3 M;  4HCE A;  4JI4 Q;  4ZAI A;  5IGF A;  2J7Z A;  4LF5 Q;  5C0X H;  3HRZ C;  1A63 A;  1S5C D;  2OCE A;  2EXD A;  1EFW A;  1ILQ A;  5M5X H;  2QGQ A;  4BBR H;  4RWS C;  2LKV A;  4P74 A;  3AFP A;  3ULJ A;  1E1O A;  5CBE E;  1KHI A;  2EJG C;  2Z0S A;  3T13 A;  1HTP A;  1SJE D;  3JC6 6;  1WD0 A;  2NVT B;  2K5N A;  1SE4 A;  4IPD A;  2WAQ G;  4NKL A;  3OMC A;  1Y1V G;  1CZG A;  4LF5 L;  4CKB A;  5FO8 B;  3C2P A;  1HH2 P;  3TP8 A;  1GUO A;  1KLG D;  5JJI A;  1SYF A;  3HGB A;  1BO0 A;  4IUT A;  3E6Z X;  2HHH Q;  1STE A;  2CHB D;  1DOM A;  5C0X J;  4LUZ A;  4O0A A;  4DKA C;  1M4V A;  1KDC A;  2AHO B;  4LUV A;  4MTK A;  3V96 A;  4G57 A;  1OO9 B;  2K7V A;  4NXN Q;  1D8L A;  3EQL C;  4OL7 A;  1NY4 A;  1DXM A;  4RH6 A;  4HAE A;  3KF8 B;  5JVG 3;  1ASZ A;  2KED A;  3HP3 A;  4DAY A;  3HKZ E;  1ENF A;  2OWO A;  4K8J A;  1L1O A;  1LT3 D;  5I2Y A;  1EOV A;  4NXN L;  1LTA D;  1NE3 A;  3KBG A;  4B3M Q;  2D5D A;  5C3E H;  2PMZ B;  1YNJ D;  4C3I B;  1RHP A;  1J8I A;  2N49 A;  2KHI A;  3NEL A;  4Q0F A;  5DLQ E;  5DM7 3;  2A74 C;  4KJN A;  1STA A;  1YVC A;  1TXY A;  3GDE A;  3H3V I;  2K6A A;  4FDB A;  2B2T C;  3DXJ C;  2J0T D;  3FVQ A;  1TKW B;  3PQI A;  4QB4 A;  1MI2 A;  1Q8I A;  1X3Q A;  3D6W A;  1SEB D;  3DWP A;  3OW2 A;  2F0M A;  1I6H B;  4KJO A;  3NUC A;  4X3T A;  1VQK A;  1SYG A;  3S2H B;  1IW7 D;  2YTV A;  2MFI A;  1STN A;  3RN2 A;  2EJF C;  2AWO A;  1Q7Y C;  1UWV A;  2KCT A;  1Z47 A;  2XSC A;  1FNV A;  3BZD B;  5D65 A;  5CBA E;  1YHQ A;  1L0Y B;  2NVY B;  3CW2 C;  1JB7 A;  2NN6 I;  1STB A;  5M3F H;  4IJL A;  5JEA G;  4B3S Q;  3S1M B;  2Q2U A;  3CCL A;  4GN3 B;  1X3F A;  2JA9 A;  5KYI A;  1PTO F;  2CH4 A;  1IBL Q;  4Y7N B;  4GOP B;  3S1R B;  4NXM L;  4J1M A;  4A3B H;  2LMC B;  2UXB Q;  4OO1 G;  1WTO A;  1BR9 A;  3MZ5 A;  2G9D A;  3ZJY C;  2QA4 A;  3S1Q H;  1NBW A;  4JCV E;  4B3S L;  1RTN A;  1UE1 A;  3K81 C;  2E2J H;  1SSO A;  3NK9 A;  4ZUI A;  3BZC A;  5HGT A;  3DMU A;  3T16 A;  4K14 A;  4DV3 Q;  3PO3 H;  4WOR A;  1C9O A;  2FJ2 A;  4LFA Q;  3K7A B;  2UXB L;  2Z8L A;  4C3J B;  3NWS A;  1Q12 A;  3OPO A;  1MHW C;  2HUG A;  3S15 B;  2EXZ A;  4IFD I;  1BCP C;  1PYS B;  1HNW Q;  4BA2 I;  1G6Z A;  1E2V A;  2QEJ C;  1E0B A;  4HR7 B;  2F0F A;  3A0J A;  2KOL A;  4YWL A;  4LFA L;  3SVM A;  4LF9 Q;  2DY8 A;  1K0S A;  3HOW H;  4LWC A;  1O7Y A;  4LUO A;  2A68 D;  4K5W A;  3C1F A;  3W5O A;  2WAC A;  1D7Q A;  1JIC A;  3PUX A;  3S1N B;  4DUY Q;  5FLM G;  2X69 A;  1TWF B;  1BCP B;  2H1E A;  4C1N I;  1V1P A;  2L9H A;  4MTN A;  4A3C H;  1UEB A;  5KNB A;  2F4V Q;  1N8R C;  5HUR A;  4LF9 L;  4EQN A;  4RHR A;  3J81 i;  3A8J E;  1U4P A;  4YY3 Q;  2E5L Q;  3LGJ A;  5EGT A;  4K6D A;  5JPM C;  5BR8 Q;  2ZXR A;  1VQM A;  1ICF B;  2WB1 B;  2OTJ A;  1W3S A;  1FVI A;  3RLF A;  3H6M A;  4DUY L;  5JEA J;  4PG3 A;  4AIM A;  1SFO B;  3CRL C;  1GOZ A;  3T4A C;  4B3R L;  2MUY A;  4X62 Q;  3I4N H;  4IQZ A;  3D8G A;  4EGV A;  2UU9 Q;  2F4V L;  4IJH A;  2ENB A;  1XX8 A;  5K5P A;  3SK4 A;  4KMU C;  1CM9 A;  1PRT D;  2EYJ A;  4YY3 L;  2E5L L;  4A3E H;  1ESR A;  2NTS A;  3J80 c;  1WTH A;  1SMY C;  2V1C C;  3T1Y L;  2R7Z H;  4DU9 A;  1K83 H;  2Z4H A;  1MGS A;  3QB3 A;  2TMP A;  2XGT A;  2BCO A;  2UU9 L;  4ALP A;  3CC2 A;  3ICE A;  3GTL H;  2WFW A;  5I6W A;  3IFD A;  4A3J B;  5I9O A;  4BY7 B;  4A3G H;  4XYQ A;  2E8G A;  1L2F A;  1EEF D;  2JP1 A;  1DD2 A;  4GZY C;  2B2V C;  5L37 A;  3H09 A;  2RCF A;  1AZQ A;  3TS2 A;  3ZYY X;  2NZH A;  1G2T A;  1TT2 A;  1PZI D;  5JAV A;  2B2Y A;  4AQY Q;  5JVH 3;  3U4V A;  4BBS H;  3OOC A;  2ZXO A;  1H95 A;  2PO4 A;  5M3M G;  5C0X I;  3HZX A;  1GVP A;  1E1T A;  4H02 A;  4IPG A;  5FLX E;  3D4W A;  1MJC A;  3BVZ A;  2UUB Q;  4XTC S;  1WCM B;  1A2U A;  4N8X 1;  1O80 A;  3V2T A;  1F2L A;  3EJI A;  3CF5 A;  1K8O A;  1XPR A;  3D6C A;  5JJL A;  2J4X A;  1TWH B;  1D5X C;  4JPB W;  1KLU D;  5A35 A;  2JA5 B;  1KD1 C;  3MFY A;  2A6E C;  3K58 A;  3M3Y H;  4AYB E;  1X6O A;  2B2U C;  1QVF A;  3X3N A;  1JOK A;  1YHB A;  1SYD A;  4DV0 Q;  3QR8 A;  1AE2 A;  3RMH A;  1B44 D;  1D5M C;  1UE6 A;  4CKC A;  1NUC A;  2XWJ B;  1CSQ A;  4FXG C;  3CCQ A;  2IT1 A;  4MHE A;  5IYB H;  1OXV A;  4YHH L;  4DV0 L;  4C3J G;  1OXX K;  4UY8 C;  3OYY A;  2F0P A;  2HD3 A;  1H9S A;  4A3I B;  2NVX B;  3DEP A;  1K73 C;  1HR0 Q;  2A19 A;  4DV6 Q;  2EYO A;  2NUC A;  3JAM E;  1EOT A;  2F0K A;  2R6G A;  3VDY A;  2Q2H A;  3S14 H;  4GNX C;  3CC4 A;  4Z9C B;  1SYB A;  3O13 A;  1EY4 A;  4F8M A;  2AUJ D;  4G4K A;  1I3Q B;  2F0Q A;  3NBH B;  1SDF A;  1RCV D;  5GRO A;  1RTO A;  4DV6 L;  4QIW E;  2R7D A;  4H7B A;  3A54 A;  2D9U A;  4JOI A;  4CGY B;  3L2P A;  3L3O C;  1MBY A;  2ZTE A;  3FKI G;  4HN7 A;  3GO5 A;  1SNM A;  2C9O A;  1WTQ A;  2F0D A;  5T1I A;  4JK1 C;  4KD3 A;  1KAW A;  1PV4 A;  1II3 A;  1Y14 B;  4OX9 L;  1F9Q A;  2F0H A;  4BS9 A;  3R8B A;  2B3G A;  4BBR B;  1EFI D;  2I46 A;  1L0X B;  3HKS A;  4JI1 Q;  3E3X A;  4GKK Q;  4IUQ A;  1IKM A;  4C2M H;  1JJ2 A;  2B39 A;  5KIX A;  1H9R A;  2R93 B;  1EY9 A;  3PO2 G;  1HPC A;  3J80 L;  3SXH A;  1ML0 D;  4A3J G;  4X64 Q;  1R9T H;  3PSI A;  2Q2T A;  2JA8 G;  1HUM A;  1JT8 A;  4QCL A;  4JI1 L;  1SYE A;  5CV9 A;  2M2L A;  1S40 A;  1O7L A;  1EWH A;  4K5X A;  1JMC A;  4A3F G;  1FGU A;  5IYD H;  4P72 A;  5KNC A;  2K75 A;  4DR4 L;  2SEB D;  1EQR A;  3PUV A;  1EQV A;  1B2T A;  2XNA C;  1U4L A;  3K8A A;  2EZV A;  3J7A 5;  5AJ3 Q;  5EQ0 A;  4X64 L;  2KEC A;  4XT3 B;  3IKJ A;  3M4O H;  2JN4 A;  4UHV A;  4F87 A;  4DV2 Q;  4U68 A;  4QUF A;  1ICW A;  1TWA H;  1SN8 A;  3UDF A;  1BCP D;  3A8K E;  1XWE A;  2RDH A;  1WVL A;  4J6H A;  4POF A;  2FXQ A;  1IYU A;  4HJA A;  3CCU A;  5C3E B;  4GN4 B; 
#chains in the Genus database with same CATH homology
 2JEA I;  5NUC A;  1B9N A;  3DHQ A;  3FDT A;  3VYS A;  4RCN A;  2OXP A;  3PIP 3;  1UEA B;  2EYL A;  1V1O A;  3OIP A;  3M85 A;  2FMC A;  3N6R A;  2XVS A;  3R93 A;  4X3K A;  4C1N K;  2K5D A;  2BDO A;  1RDP D;  1MD2 D;  2F0N A;  3TN2 A;  2PCF B;  4FF1 A;  1FR3 A;  2O4X A;  3RZD B;  2ICE C;  2K28 A;  2JA6 B;  3S17 B;  4L6T B;  3PIO 3;  2SDF A;  3G7L A;  5DNF A;  4HMI A;  1DM0 B;  1NCV A;  1EY8 A;  3H94 A;  3SE0 A;  3VR3 A;  3LWU A;  1TWC B;  4ABN A;  1F2M A;  2C5C A;  5FO7 B;  4HCS A;  5E4W C;  1ZXT A;  2LFN A;  3I73 A;  1SMY D;  4QUC A;  1EU3 A;  2RBM A;  4ZRZ A;  5K36 G;  2WII B;  3IAY A;  1QOH A;  1F77 A;  1HUN A;  1Y1W B;  1ZEQ X;  3QWN A;  1OXU A;  3PUY A;  2EVB A;  3NTI A;  3S1Q B;  5EPK A;  1GUG A;  4KKS A;  2EPB A;  3KLS A;  2F3W A;  5JJZ A;  1LTI D;  1LTR D;  1SXT A;  4K8I A;  1I4Q A;  4V0B A;  2F1M A;  2L4N A;  1C4Q A;  1LTT D;  5KND A;  2NBF A;  4CHT B;  5IGC A;  3I3C A;  5ELE A;  2EY2 A;  4BWG B;  3PV0 A;  5M9O A;  4KHZ A;  1LTG D;  4OIK A;  1HCZ A;  1QJO A;  2A6E D;  2TSS A;  4CKE A;  2EYH A;  3VR4 A;  1DCZ A;  3BYT B;  2HDL A;  2XRQ D;  4DNR B;  1GJX A;  1FNW A;  1F2Z A;  3BVM A;  4RGM A;  3GTJ B;  4CJ1 B;  1EYA A;  2JE6 I;  1ESF A;  3I4M B;  3I90 A;  2EOT A;  3A55 A;  1F9R A;  2WKD A;  3VR6 A;  1G2S A;  2F4I A;  1RJT A;  1B3A A;  1PTO B;  3L9A X;  2AQ2 B;  4ODG A;  2BA1 A;  1GHK A;  3EA6 A;  3N52 A;  3FMC A;  1SBB B;  3NTH A;  2VB2 X;  3IL8 A;  2H4O A;  1O78 A;  3KLS X;  1K83 B;  1CA6 A;  1BNZ A;  2E76 C;  3J81 E;  3VYT A;  2F3V A;  4FF4 A;  1HFG A;  4A3G B;  2KQ3 A;  2X6G A;  3M7G A;  1SAP A;  4RKB A;  3OIQ A;  2JEB I;  3IFT A;  1EY0 A;  1QE6 A;  2F0U A;  4NW2 A;  4C56 C;  4X3U A;  3HOX B;  3K5O A;  1LLR D;  2EY6 A;  2WV6 D;  3TME A;  2F0S A;  5FKA C;  3LWE A;  1A3V A;  2AQ1 B;  1A3T A;  3NXW A;  2NB0 A;  3S16 B;  3P7J A;  5I6Y A;  1CQV A;  2F03 A;  5J22 A;  1EZ8 A;  1ONL A;  4B9X A;  3M3Y B;  1IHZ A;  1PZJ D;  2AQ3 B;  2B2W A;  1LTS D;  5CYU A;  2FMM A;  5I9P A;  1DYQ A;  1F9P A;  3KK7 A;  3VA5 A;  5TSS A;  4DN4 M;  3K5M A;  1STY A;  1VF7 A;  3QJY A;  2R3Z A;  3T56 B;  2BA0 A;  2HCI A;  2O2L D;  3TP6 A;  1SNC A;  3T53 B;  3NBI A;  3VR5 A;  3M7N A;  3I72 A;  4O42 A;  3S14 B;  3TSS A;  3VYR A;  1Q1B A;  1AZP A;  1A15 A;  4ZKB B;  3K6O A;  2ICI A;  3CU7 A;  4EQP A;  5C44 B;  5FLX L;  4IUP A;  3HKZ B;  1R4P B;  2FIN B;  2A5H A;  2M9V A;  2F0T A;  1Y8N B;  4O1N A;  3H3V C;  1KTK A;  4DF7 A;  4ZUJ A;  3OHX C;  4CJ2 C;  3MXN A;  1J9O A;  5EPJ A;  4RGN A;  4DK0 A;  5JEA H;  2F0V A;  2AUK A;  2HCC A;  1H9M A;  5A2Q E;  2E74 C;  4IUV A;  2PYK A;  3P1H A;  4C2M B;  3MXG A;  1PMR A;  4DFA A;  1EY6 A;  3VR2 A;  4OO1 H;  3EVQ A;  1DOK A;  5F2D A;  3I8Z A;  1SE3 A;  1V43 A;  1HA5 A;  2XRS D;  3I91 A;  1TS4 A;  4YIJ A;  1TY0 A;  3X3M A;  3DWA A;  5ELB A;  1DJR D;  2PQE A;  1V1P B;  4PMB A;  3RUZ A;  1JWS D;  4C3I G;  1TS5 A;  5C6A A;  3QOJ A;  1SND A;  3M4O B;  2EYP A;  1SE2 A;  2IWH A;  1NSN S;  2CW0 C;  2IX1 A;  1TWA B;  1NR4 A;  5J39 A;  1MSH A;  2B8F A;  2O5J C;  4PMW A;  5DEH A;  1I4H A;  1EYC A;  3Q6S A;  1JOQ A;  2B2Y C;  3Q22 A;  1PTO D;  1TY2 A;  1NAP A;  1DOL A;  2B63 B;  3HOV B;  5FK9 C;  2HQE A;  3VA7 A;  1EYD A;  5J1Z A;  2B2V A;  1GUW A;  2XIW A;  3QIA A;  4R9W A;  1KNE A;  2Q8I B;  3AMU A;  3LNN A;  2Z4I A;  4F88 A;  1OXS C;  1IL8 A;  2ZXP A;  1WTX A;  2EY5 A;  2MPM A;  4XQJ A;  5KYL A;  3SK8 A;  5LL6 X;  3RD4 A;  2E2I B;  1PXU A;  4G7H C;  4RAU C;  2B2U A;  3W3A A;  4OHJ A;  1CI3 M;  1QB5 D;  3NQT A;  1ILP A;  1XYI A;  1BDO A;  1CHQ D;  5EPL A;  3KBX A;  3MFG A;  1S5E D;  4FF3 A;  1D2B A;  3UI2 A;  1SJH D;  2B8G A;  4UAI A;  4A3D B;  4G7O C;  3NBH A;  4XQQ A;  1CA5 A;  1T5E A;  3K5L A;  2DN8 A;  1H9S B;  2AWN A;  2JA7 B;  4LK1 C;  1KAA A;  2FHT A;  4V19 0;  1B9M A;  2L1B A;  3TDQ A;  2F0O A;  2VNU D;  1PZK D;  1FYC A;  3Q23 A;  1QIL A;  4LJZ C;  1EIG A;  5ELD A;  4DNT B;  4KY6 A;  4TKO B;  4FVM A;  3C46 A;  3BG3 A;  5LHY 1;  1QG7 A;  4TSS A;  5M5X B;  3E0J A;  3ND9 A;  5KEE A;  1QNK A;  1DZ1 A;  2NN6 G;  2L0C A;  3A7L A;  3MVV A;  2KA7 A;  1GHJ A;  2XN9 C;  2JSO A;  3MEH A;  4AYB B;  3NQI A;  3FRP B;  4DA2 A;  3D4R A;  5EKL A;  2LS0 1;  3QG1 A;  3URY A;  1UAP A;  4KHV A;  2QF7 A;  2EJM A;  4XT1 B;  3H0G B;  1TR5 A;  2PNR C;  3HOU B;  2BE5 C;  4DAP A;  3S9W A;  3P20 A;  3PUW A;  3Q24 A;  2VXW A;  3NE5 B;  2E2D C;  1Z6H A;  4M1U B;  4IFD G;  5CR3 A;  5C4H A;  5G3L F;  1QWY A;  4HMJ A;  4R8I A;  4J8Q A;  3QOL A;  1LT5 D;  4QIW B;  2EDG A;  1PFN A;  3T51 B;  4N9T A;  2K01 A;  1Y1V B;  3ERQ A;  1QCB D;  1LT6 D;  2PW7 A;  2HDM A;  4DAV A;  1D6E C;  5D3D A;  1HQR D;  4ZK9 B;  1FNU A;  1F9S A;  4TQU S;  3ONA B;  1B53 A;  1H9J A;  2A73 B;  2QDB A;  3R3O A;  1BBX C;  1A3U A;  3MA2 B;  5M3F B;  4XDX A;  4ZQ3 A;  2CW0 D;  4K2L A;  3OWE B;  4ZLT F;  1E2Z A;  3J81 L;  1TS3 A;  1JQY D;  2CVR A;  2KCN A;  1HRJ A;  1TQO A;  5AFW A;  2F0L A;  4A3B B;  1EZ6 A;  5IGD A;  2IJ0 A;  4WFN 3;  4ILW A;  3NPP A;  5C3W A;  1A6X A;  2V4D A;  1VF5 C;  2E2J B;  2QIL A;  5COY A;  1TVX A;  2K03 A;  3MHB A;  3PO3 B;  1WTR A;  1HTL D;  3LX0 A;  4XXE A;  4IFD J;  1FGB D;  3J80 E;  2WKC A;  2Q8R E;  5C0X G;  1BUV T;  3F2U A;  3J7A V;  4E6I A;  1JOO A;  3MXP A;  4S3S A;  5BN3 A;  4LAA A;  3K59 A;  4QF4 A;  1C8C A;  3HOW B;  1KNA A;  1YNN C;  1EIH A;  2NWG A;  4DGZ A;  4IZ8 A;  5K36 H;  1EWC A;  1AEX A;  1Q1E A;  1X32 A;  3NSW A;  1PTO C;  2A6H C;  3BDO A;  1KDB A;  4HED A;  1PFB A;  4H44 C;  1BOS A;  2PZT A;  3HG9 A;  1Q3L A;  3DM1 A;  1B1Z A;  1D5Z C;  1JE4 A;  4H13 C;  1Y8P B;  1Z7T A;  3BS1 A;  1CTM A;  4PMC A;  1PLF A;  3I4N B;  3D4D A;  1Y8O B;  5IGE A;  4MIU A;  2IX0 A;  1RKN A;  1WTW A;  3GP7 A;  2F0I A;  4RCO A;  4A3E B;  4HSV A;  4RKL A;  1X3P A;  2RVL A;  5CV7 A;  1QNU A;  5EKK A;  1B50 A;  2R7Z B;  3H91 A;  3D3R A;  3GTL B;  4ZYS A;  1FD7 D;  5JPN C;  3KF8 A;  3GTG B;  1CQF A;  2IL8 A;  2X6L A;  1ZYR C;  4IUN A;  4NMZ A;  2F0E A;  4IN3 A;  1S5F D;  5I2X A;  3MC0 B;  5DAU A;  4BBS B;  1O7Z A;  5IGG A;  3DUZ A;  1GUN A;  2EY1 A;  3ERO A;  5A2Q L;  4TRD A;  1CHP D;  1WTP A;  1VMC A;  5EBD A;  5BN4 A;  1EEI D;  3U9S A;  3NWT A;  2K04 A;  4KY5 A;  2I07 B;  3HEJ A;  4KKU A;  1PYW D;  4Q5V A;  4RGO S;  2B2W C;  2LY7 A;  5M5Y B;  3MXU A;  2JXM B;  3AB9 A;  1WD1 A;  2XWB B;  2B2T A;  3J7A F;  1PRT F;  5DM6 3;  2IPK D;  2BE5 D;  3OWF A;  3D31 A;  1F2Y A;  3GQB A;  4LMQ D;  1NR2 A;  2M00 A;  3WOE A;  1ENC A;  2N55 A;  5IT9 E;  5C3X A;  3MWY W;  4ME5 A;  2DNC A;  1CZW A;  5C5M A;  1M8A A;  1MSG A;  3ITP A;  5M3M B;  3NP8 A;  4XQN A;  3E5S A;  5CV6 A;  1ET6 A;  3BYY B;  5EBC A;  2N88 A;  4FP5 D;  3TBI B;  4F7X A;  2JYO A;  1D1K A;  4ULL A;  2SNM A;  2RDG A;  3G6J B;  3MAQ A;  4IAL A;  4DXF A;  1STH A;  4L8J A;  4P2C B;  3ND8 A;  4RA8 A;  5CC4 A;  1LT4 D;  2DNE A;  2FFK B;  2OEO A;  1VMP A;  3TP5 A;  3AU7 A;  1IKL A;  3L7Z C;  4HTH A;  3Q0A A;  1ROD A;  4B08 A;  4IUU A;  1EL0 A;  2KVM A;  1UNS A;  2RDF A;  2K5W A;  1HXY D;  4U67 3;  5E4X A;  2Z1C A;  1LAB A;  1K8M A;  1HQM C;  2L12 A;  1A2T A;  1JWU D;  1JB3 A;  1LTB D;  1JWM D;  1AN8 A;  2D2C C;  2EYF A;  4XIG S;  1G29 1;  1KAB A;  2F0W A;  1AP0 A;  5FOB B;  1AFP A;  3KLR A;  1H9K A;  1R9T B;  5KGU A;  4RHS A;  1SNO A;  4PQX A;  3SK6 A;  4K6L A;  2L55 A;  3A7A B;  2L5T A;  3JAM L;  1U9R A;  2F0J A;  1W6J A;  5EJW A;  1U4R A;  4UDU C;  1CFM A;  2KEE A;  3FKI B;  2NYZ D;  3K5N A;  4JBW A;  1EU4 A;  4KN7 C;  1XXG A;  2ZT9 C;  1Y69 U;  1WTV A;  3R2T A;  3SR1 A;  1G91 A;  1T5X D;  1S4Z A;  1PTO H;  2Y0S B;  2GA4 B;  1YNN D;  2KUM A;  1BF4 A;  4BY1 B;  1OXT A;  1GXD C;  3PO2 B;  2A6H D;  2JA8 B;  4M8A A;  2WIN B;  5FO9 B;  3P75 A;  5M5W B;  4A3F B;  4EQO A;  4R8N A;  2PW5 A;  4K2K A;  3HOY B;  4WJW A;  1PFM A;  4OGQ C;  1I4R A;  2QKI C;  5CV5 A;  2A69 C;  5CGK A;  2VB3 X;  2DY7 A;  5IOC A;  4HSP A;  2NZ1 D;  4FXD A;  1BXT A;  2RKS A;  3SEB A;  1CK1 A;  2NTT A;  1LV9 A;  1LAC A;  2CQA A;  1SNQ A;  1G8Z D;  1TII D;  3SK5 A;  2Q8T A;  1BQQ T;  1I4G A;  4C3H B;  1ZYR D;  3CHB D;  1BCP F;  3TZU A;  3FPU B;  4B9W A;  4KV6 A;  1S5B D;  1UUP A;  4FF2 A;  3OW7 A;  3J7Y W;  1B4O A;  1JOR A;  3V05 A;  1GUS A;  3GTP B;  1V8Q A;  4KD4 A;  4RGT A;  3DEO A;  5CMD A;  1TU2 B;  4FXK C;  3VYU A;  3K0Y A;  2RA4 A;  2MJ8 A;  2K1B A;  2MP1 A;  3QO2 A;  2RSN A;  4ID6 A;  5C4J B;  3EFX D;  2K5Q A;  1GUT A;  2EYM A;  3M4Y A;  4DK1 A;  5ISR A;  5D3I B;  1XTC D;  2BOS A;  3BVG A;  5CV8 A;  3RZO B;  2RSO A;  2VUM B;  1W6K A;  3OSO A;  1EQT A;  3KUP A;  3GTM B;  5C4X B;  2SNS A;  4QMG A;  3W2D A;  3DWQ A;  4BA1 I;  5BN5 A;  1I50 B;  3GD7 A;  4A3K B;  5T1G A;  4FYD A;  4I65 A;  1YNJ C;  4KN4 C;  1SYC A;  1RD9 D;  4RFB A;  1ENA A;  5I4D A;  3PUZ A;  3FPP A;  5IIF A;  4A93 B;  2K32 A;  2R92 B;  2KJX A;  1HHV A;  4G7Z C;  3BDL A;  4K5V A;  2SOB A;  1SNP A;  2YYZ A;  4FNF A;  4H0L C;  1TWG B;  3WDN A;  3R2I A;  4IUR A;  5IOD A;  1ZKO A;  2K05 A;  5C4Z A;  4X3S A;  1E2W A;  1IW7 C;  3TZD A;  1I6V C;  3CQZ B;  3HOZ B;  5IGB A;  2NN6 H;  5ELF A;  1PDQ A;  3SDZ A;  3U9O A;  3S2D B;  3CKI B;  2WAQ B;  2F0G A;  4N9P A;  2YU9 B;  2WP8 J;  4OO1 I;  2E75 C;  4KTA A;  1RF2 D;  2IW3 A;  3GTQ B;  2MHV A;  3GV3 A;  2K33 A;  1C48 A;  3BDC A;  4C3H G;  5COR A;  4DXG A;  4EVO A;  2R61 A;  1ET9 A;  4OIJ A;  4CBV A;  1I4X A;  1I4P A;  5CV4 A;  1STG A;  3MTS A;  3GTK B;  5D14 A;  3HS0 C;  4FO2 A;  3A56 A;  2PZW A;  4IFD H;  3PMF A;  2QCP X;  3GTO B;  1EY5 A;  2D62 A;  1TS2 A;  4ZKC B;  1KDA A;  3CRK C;  5E1F A;  1JC7 A;  1IYV A;  2A68 C;  1VCI A;  5KRU A;  5C5L A;  2G9H D;  5E3F A;  3FEW X;  1JCK B;  1U4M A;  4A3M B;  2KCC A;  4PNY A;  3NHH A;  1R4Q B;  4L63 B;  2IX3 A;  4KY7 A;  2PZU A;  2OT2 A;  5EKI A;  2BDN A;  2L11 A;  1D1I A;  4XYO A;  1AW7 A;  4NDX A;  3TP7 A;  3C3L A;  3I70 A;  1VDZ A;  2EE1 A;  4KK7 A;  5JOB A;  3OMG A;  2A69 D;  1Q90 A;  2KHS A;  1PRT C;  4WRD A;  2MGS A;  4I7Z C;  2O5I C;  1LO5 D;  1EY7 A;  1DON A;  1JR0 D;  4KI0 A;  3A8I E;  4KKT A;  4MN3 A;  4PV1 C;  5ELC A;  3WOF A;  2PPB C;  3I4L A;  2RQX A;  3SHL A;  3K57 A;  5G3L D;  2E2H B;  2OF1 A;  5IT9 L;  1PRT B;  4CJ0 B;  1HFN A;  3GV6 A;  3C1E A;  1CT1 D;  5LL6 S;  4NP5 A;  1HA6 A;  1S5D D;  2ID0 A;  3NTK A;  2NVQ B;  4HCE A;  4ZAI A;  5IGF A;  2J7Z A;  5C0X H;  3HRZ C;  1S5C D;  1ILQ A;  4RWS C;  2LKV A;  5CBE E;  2EJG C;  3T13 A;  1HTP A;  1SJE D;  1WD0 A;  2NVT B;  1SE4 A;  4NKL A;  3OMC A;  1CZG A;  4CKB A;  5FO8 B;  3C2P A;  3TP8 A;  1GUO A;  1KLG D;  1SYF A;  3HGB A;  1BO0 A;  4IUT A;  3E6Z X;  1STE A;  2CHB D;  1DOM A;  5C0X J;  1M4V A;  1KDC A;  3V96 A;  4G57 A;  1OO9 B;  2K7V A;  3EQL C;  4OL7 A;  1DXM A;  4RH6 A;  4HAE A;  5JVG 3;  2KED A;  3HP3 A;  4DAY A;  1ENF A;  4K8J A;  1LT3 D;  5I2Y A;  1LTA D;  3KBG A;  2D5D A;  2PMZ B;  1YNJ D;  4C3I B;  1RHP A;  1J8I A;  4Q0F A;  5DM7 3;  2A74 C;  4KJN A;  1STA A;  2K6A A;  2B2T C;  3DXJ C;  2J0T D;  3FVQ A;  1TKW B;  4QB4 A;  1MI2 A;  1Q8I A;  1X3Q A;  3D6W A;  1SEB D;  3DWP A;  2F0M A;  1I6H B;  4KJO A;  3NUC A;  4X3T A;  1SYG A;  3S2H B;  1IW7 D;  1STN A;  2EJF C;  2AWO A;  1Z47 A;  2XSC A;  1FNV A;  3BZD B;  5D65 A;  5CBA E;  1L0Y B;  2NVY B;  2NN6 I;  1STB A;  5JEA G;  3S1M B;  5KYI A;  1PTO F;  4Y7N B;  3S1R B;  4J1M A;  2LMC B;  4OO1 G;  1WTO A;  1BR9 A;  3MZ5 A;  2G9D A;  1RTN A;  1SSO A;  3NK9 A;  4ZUI A;  5HGT A;  3DMU A;  3T16 A;  4K14 A;  4WOR A;  2FJ2 A;  3K7A B;  2Z8L A;  4C3J B;  3NWS A;  1Q12 A;  3OPO A;  2HUG A;  3S15 B;  2EXZ A;  4IFD I;  1BCP C;  4BA2 I;  1G6Z A;  1E2V A;  2QEJ C;  1E0B A;  4HR7 B;  2F0F A;  2KOL A;  3SVM A;  2DY8 A;  1O7Y A;  2A68 D;  4K5W A;  3C1F A;  2WAC A;  1JIC A;  3PUX A;  3S1N B;  2X69 A;  1TWF B;  1BCP B;  2H1E A;  4C1N I;  1V1P A;  2L9H A;  5KNB A;  5HUR A;  4EQN A;  4RHR A;  3A8J E;  1U4P A;  5EGT A;  4K6D A;  5JPM C;  2ZXR A;  2WB1 B;  3RLF A;  3H6M A;  5JEA J;  1SFO B;  3CRL C;  1GOZ A;  3T4A C;  2MUY A;  4IQZ A;  3D8G A;  4EGV A;  2ENB A;  1XX8 A;  5K5P A;  3SK4 A;  4KMU C;  1CM9 A;  1PRT D;  2EYJ A;  1ESR A;  2NTS A;  1SMY C;  4DU9 A;  2Z4H A;  1MGS A;  3QB3 A;  2TMP A;  2BCO A;  5I6W A;  3IFD A;  4A3J B;  5I9O A;  4BY7 B;  4XYQ A;  1EEF D;  2JP1 A;  1DD2 A;  4GZY C;  2B2V C;  3H09 A;  1AZQ A;  3ZYY X;  1G2T A;  1TT2 A;  1PZI D;  5JAV A;  2B2Y A;  5JVH 3;  3OOC A;  2ZXO A;  2PO4 A;  5C0X I;  3HZX A;  5FLX E;  3D4W A;  3BVZ A;  4XTC S;  1WCM B;  1A2U A;  1O80 A;  3V2T A;  1F2L A;  3EJI A;  1K8O A;  3D6C A;  2J4X A;  1TWH B;  1D5X C;  5A35 A;  1KLU D;  2JA5 B;  3MFY A;  2A6E C;  3K58 A;  2B2U C;  3X3N A;  1JOK A;  1SYD A;  3RMH A;  1B44 D;  1D5M C;  4CKC A;  1NUC A;  2XWJ B;  4FXG C;  2IT1 A;  4MHE A;  1OXV A;  4C3J G;  1OXX K;  2F0P A;  1H9S A;  4A3I B;  2NVX B;  3DEP A;  2EYO A;  2NUC A;  3JAM E;  1EOT A;  2F0K A;  2R6G A;  4Z9C B;  1SYB A;  3O13 A;  1EY4 A;  4F8M A;  2AUJ D;  4G4K A;  1I3Q B;  2F0Q A;  1SDF A;  1RCV D;  1RTO A;  4H7B A;  3A54 A;  2D9U A;  4CGY B;  3L3O C;  1MBY A;  4HN7 A;  3GO5 A;  1SNM A;  2C9O A;  1WTQ A;  2F0D A;  5T1I A;  4JK1 C;  4KD3 A;  1II3 A;  1F9Q A;  2F0H A;  4BS9 A;  3R8B A;  4BBR B;  1EFI D;  2I46 A;  1L0X B;  4IUQ A;  1IKM A;  2B39 A;  5KIX A;  1H9R A;  2R93 B;  1EY9 A;  1HPC A;  3J80 L;  3SXH A;  1ML0 D;  1HUM A;  4QCL A;  1SYE A;  5CV9 A;  2M2L A;  1O7L A;  1EWH A;  4K5X A;  5KNC A;  2SEB D;  3PUV A;  1EQV A;  1B2T A;  2XNA C;  1U4L A;  2EZV A;  5EQ0 A;  2KEC A;  4XT3 B;  3IKJ A;  4F87 A;  4U68 A;  4QUF A;  1ICW A;  1BCP D;  3A8K E;  1XWE A;  2RDH A;  1WVL A;  4J6H A;  1IYU A;  5C3E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...