3X3NA

Crystal structure of eccb1 of mycobacterium tuberculosis in spacegroup p21
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
393
structure length
384
Chain Sequence
LFQGPHMGTSLFTDRATNQLYVLLSGQLHPVYNLTSARLVLGNPANPATVKSSELSKLPMGQTVGIPGAPYATPVSAGSTSIWTLCDTVARADSTSPVVQTAVIAMPLEIDASIDPLQSHEAVLVSYQGETWIVTTKGRHAIDLTDRALTSSMGIPVTARPTPISEGMFNALPDMGPWQLPPIPAAGAPNSLGLPDDLVIGSVFQIHTDKGPQYYVVLPDGIAQVNATTAAALRATQAHGLVAPPAMVPSLVVRIAERVYPSPLPDEPLKIVSRPQDPALCWSWQRSAGDQSPQSTVLSGRHLPISPSAMNMGIKQIHGTATVYLDGGKFVALSMYYIDPQGVRYGVPNAETAKSLGLSSPQNAPWEIVRLLVDGPVLSKDAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESX-1 secretion system protein EccB1
publication title Core component EccB1 of the Mycobacterium tuberculosis type VII secretion system is a periplasmic ATPase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
total genus 67
structure length 384
sequence length 393
ec nomenclature
pdb deposition date 2015-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.900 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3x3nA01
2.40.50.910 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3x3nA04
5EBCA 5EBDA 5CYUA 3X3NA 3X3MA 4KK7A
chains in the Genus database with same CATH superfamily
5ELEA 4A3IH 4A3BG 1V43A 2SOBA 3S1MB 3E5SA 3MXUA 5IGDA 3C1EA 2C9OA 1CKOA 5KIXA 1EY0A 2FMCA 4PMWA 2RCNA 5COYA 4DR3L 3PIOA 3GTJH 3CXCA 3G4SA 1D1KA 2K5QA 3RN2A 1VQMA 1TT2A 3ND9A 3KK7A 4R4CA 4KHVA 1JICA 1X56A 5EPKA 2RDHA 5J39A 4DV4Q 1GUOA 3S1MH 1CTMA 5C3XA 3HOZG 3UI2A 2VB3X 1Y1WG 2K32A 2B2YC 4KD3A 4PQXA 2EJGC 3ITPA 2VQFL 4ZKCB 1F2MA 1IKMA 1NE3A 4AYBE 5IGEA 3CAMA 4TSSA 2HIVA 3EROA 3OSOA 1DZ1A 4BWGB 2BA1A 4U673 5BR8L 1VQJA 3EN2A 2YV5A 1F9SA 3NTHA 4K2LA 3M7NA 2L12A 2ASBA 4DV6L 4YHHQ 2EXZA 2IHEA 4JPBW 3JAML 2HHHL 4IFDI 1X3QA 4KJNA 1CZGA 5NUCA 1YI2A 2YTVA 3QB3A 1QWYA 1PH2A 4LF7Q 1B50A 4ZUJA 5EBCA 5FO8B 3TN2A 4R8IA 1AZQA 4CGYB 3EFXD 2KA7A 1FGBD 4B08A 2YTXA 1TWGB 2KCTA 4LF5Q 3MC0B 1FJGL 1IKLA 3E3XA 1VQEA 2R61A 1S5DD 2WAQB 3F2CA 3CCSA 1S5CD 3K5MA 3TREA 1GHKA 4R9WA 5C4JB 3F2DA 5E7NA 1XTDA 1DGSA 2QEJC 1L1OB 4GLAC 4A3FG 3A5UA 4C2MH 4K8JA 3EJIA 2NN6H 1Y14B 1TWGH 2FINB 1B3AA 4A3GG 4YWKA 4GOPA 4DV4L 1H9RA 4YWMA 1JJGA 4B9XA 4WFN3 1T9HA 1TVXA 2Q8IB 2AUKA 4HJAA 3VR3A 4JI7L 3B6YA 1QUQB 4OIKA 1SDFA 2KCNA 4DV3Q 1KDBA 2EE1A 1VDZA 2Q2HA 1KHIA 3K8AA 1IYUA 1EYCA 2G9DA 2PQEA 4X3SA 1TY0A 3UDXA 5E3FA 2AMCB 2RHQB 2I46A 1X55A 1D5MC 4ZRZA 4DAYB 3Q22A 2P5ZX 4BXXH 3T51B 2ZTDA 4JV5Q 2D2CC 5T1GA 3OWEB 2X69A 3MAQA 5M5YB 3HS0C 4CDEC 4J6HA 1ILPA 3HOUB 1RHPA 3BVGA 4RGOS 1D1IA 3A5ZB 1AE2A 1VF5C 2A69C 1SAPA 4IUVA 5FLMG 1VQ9A 4LF5L 2EDGA 2TSSA 3R2TA 4C3HG 4DXFA 3MXNA 1TWHB 2NZ1D 1OXVA 3ULJA 3KF6A 3BDLA 2F0IA 3CC7A 2UUBL 4O0AA 4KHZA 2N78A 4DR1L 5M5YH 1PZJD 2O5JC 4LNQA 1CHQD 4BY1G 3HOUH 1TWFB 2DUDA 1L0WA 3RZDB 3HZXA 1YNND 1DJRD 2A68C 1P16A 2CW0D 3W2DA 2PZUA 2JSOA 2OTLA 3KJOA 4OX9L 2KOLA 3NQTA 1HPCA 1V9PA 1TWHH 2H4OA 1A3VA 4P2CB 4OWWB 2XVSA 2N8NA 1EU4A 1RODA 5C0XI 1XWEA 1HR0W 2GN5A 3RZOB 1Y1VB 3OW7A 1VQDA 2BDNA 1TWFH 2JA7G 3RZDH 3KJPA 4HN7A 4LAAA 2XN9C 2KCMA 1MSGA 1NMGA 2UXCQ 3A56A 5M3FG 1N32L 3HGBA 2OWOA 4EGVA 4S3SA 5LMNQ 4N9TA 4C3IB 4UPAA 2Z9HA 1SN8A 2AWNA 1E3PA 2Q2UA 4IFDG 1N33L 2PQAA 5CORA 5FJ8H 3TZUA 5KNDA 2ATWA 4HIKA 3RZOH 1ILQA 3BYYB 1Y1VH 4LUVA 3MHBA 1K8GA 1G6PA 1BKBA 1UEBA 4HEDA 2OXPA 4FF4A 4V190 3E9IA 1YVCA 3ONAB 3P20A 2I5HA 4OGQC 1EFWA 3FPPA 3RUZA 2HT1A 4KY6A 4C3JG 4QCLA 4C3IH 2JA9A 1JCKB 5D14A 1STBA 4KTAA 3CU7A 3K57A 4KKSA 5IT9c 4XQQA 3SDZA 3EIVA 1I94L 1IBKQ 4DUYQ 4HJ7A 2R7ZB 4R1JA 3D6WA 2VUMH 2B2WA 1SNOA 1VQFA 2K6AA 3EBEA 4QGUA 4DKAC 4FF2A 3UE1A 3J7ZC 1JWSD 2VL6A 4QL5A 3T13A 5AFWA 5CV7A 1WYDA 3CD6A 1PTOD 2F0HA 3IRBA 1B53A 3PGZA 5A35A 5M5XB 1K0SA 1KIXA 1N36L 2A5HA 4HMIA 2DJGC 2F0LA 2B63G 2E2DC 3PV0A 2R7ZH 5I6YA 4LMQD 3NEMA 1X32A 2Y0SB 3A54A 3NE5B 5HY6A 1EU3A 1I4PA 1SYGA 2HCIA 3GQBA 4GS3A 3OHXC 3CCJA 2F0DA 2UXCL 2PW5A 1BBXC 3HOXG 1WD0A 4A3MB 5M5XH 3H6MA 5BN3A 2D0PA 4HIMA 5G3LD 3CRKC 3V2TA 3PO3B 1EWCA 1TXYA 3KOJA 2CH4W 1GKHA 2F0UA 1CSQA 4KHPQ 2ENBA 3WOEA 3GP7A 4MZ9A 5GQOA 1KQSA 3I72A 1A0IA 1HZCA 1EQRA 2EY1A 4TVAB 3GD7A 3HP3A 4B3ML 4JI0Q 3M9BA 4UHVA 5CYUA 1FVIA 3DWAA 4LUZA 2B2TC 1I6VC 4A3MH 5K36H 3A8IE 1YHAA 1WTVA 2NVTB 1RD9D 4EQNA 4BS9A 1TIID 1IBKL 1Q90A 3PO3H 4EVOA 1LTTD 3S1RB 2A6HC 1STHA 1KC8C 3SGIA 3D4DA 4DK1A 1S4ZA 3KLSX 4QY7A 1WTOA 3R3OA 1YEZA 4XTCS 5GADC 1F2ZA 2WFWA 3NXWA 5I2XA 4NP5A 5JEAH 3J7YW 2UUAQ 4IJLA 4RA8A 1VQHA 3LNNA 2FXQA 3CQZH 2MPMA 3S1QB 1C4QA 1PDQA 1PLFA 2KCCA 4CKBA 1UWVA 2F0KA 5JJKA 2VS1A 2NVTH 3G6EA 1UE1A 4CDCC 5C44G 4IN3A 2EY6A 4A3JG 3SR1A 1Z47A 2EZVA 3S1RH 4JOIC 4LF8L 1QZGA 1VQ6A 4JBJA 2XWJB 1GOZA 1DYQA 3NWSA 2LXKA 3L0OA 3I2ZA 3CCUA 1Q1EA 1HQRD 1WVLA 5IWAL 4IPDA 1VQNA 3GTLH 2CQOA 4PG3A 2K04A 4ZK9B 1GD7A 4GOPB 2GA4B 1HHVA 4JI6L 3ZJYC 1R9TB 1VQGA 4RKLA 1QILA 2L9HA 4DR5L 1WI5A 3BZDB 1WOCA 4B3RQ 5IY0A 1PH4A 4X65Q 1J8IA 3KBGA 2IJ0A 1EQQA 2QF7A 1YZ6A 1LUZA 1XJVA 4R4QA 1I5FA 3A8KE 4XIGS 3PSIA 3SK6A 4YY3Q 4TRDA 2PNHA 4DXGA 1E2ZA 2ZTEA 1U9RA 1PRTC 4YCWA 4DR4Q 1KRTA 3K80C 5LL6S 4MN3A 1PFNA 1IL2A 1KLGD 1Q8IA 3DWPA 1B4OA 1QE6A 1QUQA 2JEBI 4IZ8A 5CGKA 3T16A 1PRTF 3TRZA 1R9TH 4DAMA 4IUNA 5C4HA 2O4XA 2ZXOA 3GTKB 1XPUA 2MNAA 3K58A 4LFCQ 2ZT9C 2JA8B 4DAYA 2DN8A 1LT3D 2QW7A 1Y69U 4WJ4A 3CKIB 1M90C 1RCVD 3NPPA 1YIJA 5A2QE 2ICEC 4KV6A 2K75A 1NCVA 5EPLA 5IYCG 5TSSA 3PUZA 4A93B 1TR5A 5I6WA 3DHQA 5CBAE 3GTKH 4DR6Q 1HNXL 2JA8H 2F4IA 5IGCA 1Q82C 2B2UA 4HJ8A 1A62A 5JEAJ 3F2UA 3N52A 2Z1CA 2F3WA 4JG2A 4BBRG 2I0QA 2F0PA 4NDXA 5C6AA 4A3EH 1IYVA 2HD3A 4A93H 1XXGA 5ELDA 1T5XD 4X65L 1JOKA 1PV4A 1SE3A 1U4LA 3I4NB 4P72A 3D4RA 2A69D 4WJWA 4X64Q 4HMJA 2EYOA 5J22A 2YTYA 3ERSX 4F7XA 1XTCD 1EZ8A 3I90A 3VYRA 2Z0SA 1HTLD 2HQEA 1OXTA 3MVVA 4JI8Q 3VYTA 2RBMA 5DM73 1VQ4A 4BY7G 2E5LL 3T4AC 3VA7A 1S72A 5IGBA 2PMZE 2RQXA 5EJWA 2IW3A 4L6TB 4K8IA 3I4NH 1F2LA 2XRQD 1QG7A 2A68D 3SK8A 2MJ8A 4BA2I 4TQUS 1F2YA 3HOZB 1H9JA 1L0YB 1Y1WB 1GXDC 1ZYRC 3FRPB 3H09A 4DV0L 1XPOA 2MP1A 5JOBA 5E4XA 3TS2A 4QF4A 1I4GA 2QCPX 3TQYA 4A3CH 1B9NA 4C1NK 2JK8A 1A3UA 3HOYG 2BE5D 2EYFA 3SEBA 5FO9B 4DV1Q 1SYCA 1STEA 1SYEA 1ZXTA 2F0JA 3CC2A 1YNJC 3EA6A 4AIMA 2D9UA 1X54A 4EQPA 4AYBB 2Z6BA 4QIWB 2MGSA 1STNA 3HOZH 1Y1WH 3JAMc 1CA6A 2SDFA 3I56A 1GUSA 2EPBA 4ZLTF 3AFPA 4PZ7A 1D5ZC 4F8MA 3URYA 5IYDG 1LLRD 1Y8OB 2A19A 5DLQE 1YITA 2XNAC 4RG1A 4OHJA 1RDPD 1HZ9A 2VXWA 4X64L 1HXYD 2Z4HA 2JP1A 3VYUA 1X6OA 1CKMA 5D3IB 4XQNA 4RGTA 2PPBC 4OONA 1ML0D 2N55A 3U50C 2AQ3B 2EYLA 2PI2E 5I9OA 4A3DB 4JI5Q 2L11A 1LTSD 5C3WA 4K5WA 4GKKL 4NXMQ 5F2DA 4A3GB 2NB0A 1C0AA 1C8CA 4G7ZC 3SK5A 1O7LA 3FP9A 1B8AA 2L15A 3C2PA 1H9KA 1MKHA 1K28A 1PTOB 2XWBB 3JAME 3CRLC 1OXSC 3HKZB 2I5MX 4X66Q 1LT4D 4A3DH 1SMXA 4CBVA 4BA1I 3HRZC 3TP8A 2JA6G 1CKNA 2EJMA 3KDFB 2L1BA 4A3GH 4F87A 3RR5A 5CC4A 4X3TA 2KECA 4DUZQ 2LS01 2K5DA 3IFDA 3HOVG 2ZJPA 2D5DA 4APVA 5FOBB 2L5TA 1SROA 1ICWA 3MA2B 2NZOA 1PTOH 3K7UC 3M4YA 4DA2A 1L1OC 3QOJA 2HDMA 4OEMB 3I55A 2B3GA 4OO1H 2SNMA 1A2TA 3GV6A 3P7JA 1QVCA 1MJCA 4DV2L 1S5FD 4RMFA 2QEXA 2E2JB 3BS1A 1AFPA 2MHVA 5C4XB 5BN4A 2K5HA 3T56B 1WTWA 2VQEL 1CUKA 2RVLA 4FP5D 2CFMA 5FK9C 4C2MB 1I4HA 2B29A 3BU2A 3K0YA 4JI5L 3RD4A 1WTPA 3HG9A 4BY1B 3G6JB 1D6EC 1GVPA 1SBBB 3PO2G 4P75A 1EIYB 4DN4M 3DM3A 1BVSA 4ABNA 2H5XA 4FDBA 3I91A 2E2JH 2G5DA 2YYZA 1PZID 4A3IG 5C4XH 3H3VH 2E76C 3WWVA 1RL2A 2WB1E 1U0LA 1W2BA 1GJXA 2E74C 3CF5A 1JB7A 1HFNA 2J7ZA 1SMYC 2I07B 1DOMA 2VY3A 4A3LH 3MXPA 1EOVA 3M85A 2R92B 4BY1H 1HZBA 4GNXC 2R93G 3DLLA 5AJ3Q 2R7FA 4XT1B 1Z9FA 2WB1G 5ISRA 3T1YQ 4A3KB 1H9MA 1Q12A 3NWTA 4P71A 1PVOA 2K50A 3K0XA 2E2HB 1J5EQ 1XYIA 1NNXA 3FEWX 3R93A 1IBMQ 1PFSA 3KUPA 4JCVE 5DNFA 4NXNQ 4OL7A 1CM9A 4ME5A 4MIUA 2J0TD 1EEID 1EOTA 1EWHA 1R4QB 1SNQA 4YHHL 2R92H 5EKIA 3EVQA 5KYIA 3ND8A 2SEBD 4PZ6A 1QNUA 3OTOQ 5FO7B 1SNMA 4A3KH 5IP7G 3CCQA 1MJEA 3ULLA 1O7ZA 4HIOA 4LF7L 5IYBG 2E2HH 3WOFA 1EYGA 1HRJA 2EJFC 2F3VA 1E24A 4EQ5A 1ICFB 1JMCA 1PRTD 3MWYW 3GTQB 4DK6C 1Q1BA 3MTSA 3I4MB 1XMOQ 1I4QA 5LMUQ 1VQ8A 4HSVA 4A75A 2EOTA 3BDCA 1GUGA 4UAIA 2V4DA 2PW7A 1KD1C 2K4KA 3AEVA 1LO5D 4JI2Q 3J7A5 1ET6A 3EQLC 2UU9Q 5HURA 2K5WA 3NP8A 2DNCA 4GN4B 4IPGA 1G2SA 2KENA 2B63B 4QUFA 3GTQH 3T53B 2A1AA 1EZ6A 3I4MH 5GAGC 2K05A 4CJ0B 3H94A 1GHJA 2WACA 1MBYA 4UP9A 2N49A 3HOXB 1B70B 4DV3L 2OQKA 1LT6D 1TS5A 1IBML 5CV4A 1YNXA 3AQQA 2ICIA 4KLKA 4NXNL 2JA5G 3GTOB 5C4ZA 2JYOA 5IP9G 1IBLQ 1FNVA 3OYYA 2WAQG 2WIIB 2K01A 4HCSA 2VW9A 1KAAA 2B63H 3E0EA 1SYDA 2HIXA 5C5LA 1CI3M 3G71A 4JV5L 3MEFA 5JVH3 4POGA 2V1CC 1PH9A 3IKJA 3A55A 3J81i 1JR0D 5EKLA 2OCEA 4ZUIA 2NZHA 4GKJQ 3I73A 2B2VC 2EYJA 3HOXH 4LJZC 4IJHA 5M5WB 1SSOA 1NTGA 2K52A 2VUMB 1B7YB 1KAWA 1HNWQ 4M8AA 3KLWA 5IODA 1E7ZA 3GTOH 4IUQA 5FKAC 4DV5Q 4FXDA 2Z6KA 1UUPA 3AYHB 3A7LA 4MNOA 5C3EG 4OELB 1PFMA 4JW0A 1X3GA 2JJQA 3AFQA 5LMUL 4DAPA 4GLVB 3PIP3 1QVGA 3S17B 1TS3A 1DXMA 3MEHA 1X3FA 1BXTA 4X3UA 2DGYA 5M5WH 3BJUA 2Q2IA 3BVZA 1S3OA 3J80i 2SNSA 3I4LA 1CHPD 1KDCA 1ZYRD 3HFZB 4X62Q 3TZDA 2CH4A 4CHTB 1LTID 4U68A 3HOUG 5JJIA 3BG3A 5KRUA 1MSHA 2EXDA 2ZJQA 4IOCA 1W3SA 1N34Q 3S17H 4L8JA 2CKZB 3NBIA 3CC4A 4IPCA 4N8FA 1Q81C 1EL0A 1YNJD 5E1FA 2DY7A 1KRSA 4FXKC 4TKOB 3I4OA 5LHY1 4FXGC 4IUUA 2CHBD 3I3CA 3K5LA 1RJTA 1EQVA 2EIFA 5EQ0A 5C44H 1E2WA 4ZKBB 4KN7C 2IHFA 5LMNL 2LY7A 5C0XH 4A4IA 3Q23A 1R4PB 3R2IA 4RGMA 2F0QA 2RCFA 5H1SE 5EKKA 1WJJA 1CKNB 2RHSB 1IW7C 3PUWA 2FMMA 5C5MA 4K6DA 5KEEA 3F8TA 4DV5L 1JE4A 4P73A 1EUJA 1F9RA 3CMAA 5FJ8G 2F4VQ 5IOCA 5ELBA 4LW1A 1Y1VG 3CQZB 4DNRB 2KJXA 2K5NA 3KDFA 5DAUA 3IAYA 4JVZA 4DUYL 3CCLA 3K59A 1WD1A 4BBSG 2RSNA 2KEEA 2KVMA 4GOPC 3H0GB 1IL8A 3I70A 4C3IG 5IE8A 3S2HB 3T1HQ 1ZEQX 3NSWA 3V05A 3F2BA 1BBUA 4L63B 1HFGA 2BDOA 1LACA 2KQ3A 1JWUD 1N34L 4PZ8A 1HNZQ 4KKUA 3GTLB 2BH8A 4NMZA 1J9OA 3U9SA 3ULPA 1RIPA 3S14B 2DY8A 5KYLA 3K5NA 1K8AC 1K3BC 3K5OA 2F0OA 2F52A 3H0GH 4BBRB 3S2HH 1CA5A 3I7FA 1O7YA 3FKIB 5IYCH 3S2DB 2NTTA 1V1PB 1FYCA 1FD7D 3LWUA 2R7ZG 4K0KQ 4V0BA 2L55A 1PH8A 2RKSA 3R8BA 3QWNA 3SXHA 3DEOA 1B3QA 5FLXc 1JORA 2BA0A 1F9PA 3S14H 2Y0SE 1A3TA 1AEXA 4KHPL 2WP8J 4BBRH 2NVXH 1NUCA 4DAVA 4BY7B 2F0NA 1HZAA 3UDIA 3FKIH 2K5VA 3CHBD 1TS4A 3PCOB 4JI0L 2F4VL 4GZYC 4FO2A 3S2DH 4JI3Q 3GO5A 3DEPA 2Y0SG 2JN4A 3L2PA 4JI4Q 2ZTCA 5K5PA 1VMCA 4HAEA 2KEDA 2ZM6Q 4B3SQ 4YIJA 3HOWB 1S5BD 4DR7Q 3W3AA 5C0XJ 4XQJA 1JB3A 1U4PA 2LXJA 3SHLA 4CJ1B 1HA6A 3X3NA 4QB4A 1EWIA 2B8FA 5BN5A 3T1HL 4PMBA 5K36G 2C5CA 1OXUA 4BY7H 4R4OA 2UUAL 1SNCA 2A73B 5M3MB 1Y8PB 2ALYB 1AZPA 3PO3G 4IQZA 2F0WA 1E0BA 1MIUA 1V1OA 3VR6A 1SJHD 1S5ED 4QQBX 3P1HA 5JEAG 3BZCA 2E75C 1I3QB 2MUYA 3HOWH 1E1OA 5FLXE 4A3EB 4G7HC 1BCPC 4DFAA 2XTIA 3UDGA 1XX8A 3N6RA 5JVG3 2Z4IA 2OF1A 4JK1C 3FPUB 5M3MH 1VQLA 1BCPF 2FJ2A 3HEJA 1PH5A 3NENA 1EIGA 2D62A 1F77A 1LTBD 3TEHB 1A8VA 2N3SA 3RN5A 4LFBQ 1I3QH 4I7AA 3V96A 4DK3C 1DONA 2B39A 3PIPA 4ZQ3A 4C1NI 5KNBA 4KI0A 1BQQT 3CCVA 4B3RL 5KNCA 4DV7Q 2G9HD 2A8VA 1QZHA 3H91A 1FR3A 3U9OA 1EY7A 5FLXL 1SR3A 5I2YA 4JYAQ 4A3BB 4YY3L 4YWLA 3Q6SA 1G91A 2ZXPA 4NW2A 1H9SB 5IGFA 1EYAA 4OWXB 1DOLA 2B2WC 4DR4L 2F0EA 2OEOA 1HR0Q 4DR7L 5CV6A 1EIFA 4B9WA 1L0XB 3TS0A 1UNSA 3TDQA 1TKWB 4RFBA 4LFCL 1QNKA 3L7ZC 4A3BH 3AMUA 4HIDA 4QMGA 2JA6B 3Q0AA 1XNRQ 1VQIA 3AB9A 4MTKA 4LFAQ 3X3MA 5KGUA 4LF6Q 5GAEC 4ILWA 2QA4A 1G291 4JC0A 1P8LA 2JE6I 3I8ZA 1G2TA 5JAVA 5LMNW 2WKDA 5DEHA 2E2IB 5CV5A 1I4XA 2F3IA 1PH6A 4DR3Q 3G7LA 4DR6L 3A0JA 3TBIB 1NJIC 1O7IA 2JA6H 2EYHA 1TWAB 3S9WA 3KF8A 4LF4Q 2LSSA 4XDXA 4LFBL 1KXLA 1PTOC 1J6QA 2K7VA 2CWAA 3BDOA 5I4DA 5E4WC 2NYZD 4DV7L 5HGTA 4RWSC 3U4VA 1D7QA 3IFTA 3J81j 2E2IH 2UUCQ 4XYQA 1PTOF 2Z8LA 4IPHA 4HSPA 1A63A 3J81c 3PO2B 1NAPA 4OIJA 4A93G 4DR2Q 2QGQA 3CPFA 5BR8Q 1TWAH 1UE7A 4HCEA 2AQ2B 5CV9A 4DV6Q 4JI8L 1JE5A 5ELNA 2HHHQ 3VR2A 4A3FB 2F0TA 3ICEA 3TP5A 2J4XA 2OQ0A 4KD4A 4PNYA 4RCOA 2AWOA 4L5SA 2R93B 1SYFA 3S24A 2HCCA 1PMRA 1SRUA 2K1BA 3DUZA 3QIAA 5G3LF 3PO2H 2PCFB 3H3VC 1TWCB 1Z6HA 1BNZA 1MGSA 4UY8C 3I4NG 1SLJA 1FJGQ 1L2FA 3U58A 1OO9B 1K0RA 3J80c 2NN6I 1NR2A 3A7AB 3SE0A 4H13C 4ID6A 4DV1L 4A3FH 3M4OB 2NBFA 4K5VA 4I65A 1K3RA 2WKCA 5EGTA 4A3CG 1B9MA 4JBKA 4R4IA 3J81E 2R93H 4RHRA 2EY5A 1M8AA 4L5QA 2ES2A 1TWCH 2BCOA 4ZCKA 1EY5A 4K5XA 4LF4L 3FMCA 4XT3B 1JOQA 3DMUA 3RLFA 4IOAA 3VR4A 2HUGA 2F0VA 3BYTB 3STBC 1IW7D 3M4OH 1WCMG 4JI7Q 2UUCL 1A2UA 2L4NA 4M1UB 4C3HB 1NBWA 2QDBA 4QIWE 3VYSA 1UE6A 4DR2L 1ASZA 1CQVA 1ET9A 4ME3A 1C9OA 5IP7H 4C56C 3PF4A 5JPMC 3J81L 2IX3A 1YJNA 4NPSA 4RGNA 5IYBH 4RHSA 3K81C 5IIFA 2HDLA 3J80E 1Z7TA 1EY4A 4AYBG 4ALPA 2RDGA 1LTRD 4FF1A 1SJED 4X3KA 5FLMH 5D3DA 1MD2D 2A6HD 4NXML 4RH6A 4C3HH 2GVAA 4XYOA 1PH1A 1DD2A 2DNEA 2EVBA 3O13A 1IZ6A 2JEAI 4CJ2C 3PUYA 4KN4C 1D2BA 1V1PA 1LTGD 4IURA 1E2VA 2KHSA 2KHJA 1RF2D 1ENAA 4X66L 1SFOB 1X3EA 1A6XA 1NMFA 3E0JA 1YJ9A 1PHJA 3SK4A 2JA7B 2JA5B 2B2UC 2CVRA 1XNQQ 3JC66 2CCZA 2UUBQ 3L3OC 4DR1Q 3J80L 5JJLA 5ELCA 4A3DG 5M3FB 4DUZL 1HUNA 4H02A 1HJPA 2B2TA 2M9VA 3D31A 3HKZE 2KBNA 2KHIA 1XPRA 3FHWA 1PYWD 1EY9A 1SFOH 4OX9Q 1AE3A 1XMQQ 1X65A 4O42A 2JA7H 2JA5H 1ESFA 1SNDA 5IP9H 3HKZG 5C3EB 1RKNA 5C4JH 4OO1G 1WTXA 1TY2A 5M3FH 3A8JE 1F9QA 1TU2B 4C3JB 1HA5A 4K14A 5D65A 1C7YA 5EAYA 3D4WA 3OMGA 3CW2C 2N88A 1QOHA 4O1NA 4IFDH 4G4KA 2ID0A 3CCRA 3LGJA 1PH3A 4R4TA 1N32Q 4KK7A 4JOIA 2Q2TA 5DM63 1Q3LA 2NVYB 1JJCB 3J7AF 1PYBA 1WTHA 1N33Q 5C3EH 4DGZA 4POFA 4AQYQ 2JQOA 3MFYA 4C3JH 5L37A 2A6EC 2K03A 1UEAB 2F0MA 2WINB 3UDFA 3CP0A 2NTSA 1WTQA 4GNXB 1STAA 5C4XG 1G8ZD 3NBHB 1MHWC 3D8GA 3W1BA 5AJ3L 2NVYH 2R3ZA 4ODGA 1XNQL 1VF7A 1Q7YC 2WAQE 3T1YL 2PYKA 3PF5A 4KY7A 1BCPD 1VCIA 2NN6G 3M4PA 1I94Q 4A3LG 4J8QA 1LTLA 2PNRC 1EY6A 1J5EL 1LT5D 4O2DA 1T5EA 1U4MA 2AKWB 1HCZA 3WDNA 1H9SA 1VQBA 4HTHA 1JWMD 4QUCA 1GUNA 5I9PA 3VR5A 4P74A 3GV3A 1N8RC 3G48A 1XMQL 2PI2A 1SE8A 3MFGA 1G51A 4IUTA 3BVMA 3OTOL 2IPKD 2YU9B 1PH7A 1N36Q 1EFID 2X6LA 1K8OA 2BE5C 3JAMi 2EY2A 4BXXG 3H15A 2R92G 3M4QA 1WTRA 1X3PA 2FFKB 1KDAA 1AH9A 1IHZA 1H95A 4A3KG 4L5RC 3DWQA 1QB5D 1VS0A 4BBSB 3NHHA 4CDFC 2K28A 1FNUA 1BUVT 3GTGB 1XMOL 3KF8B 4K2KA 1BDOA 3CMEA 4DNTB 2IT1A 3A74A 2YU9H 2IL8A 1RTNA 4AQYL 2BH2A 4JI2L 1BO0A 3CPWA 2UU9L 3P75A 4AH6A 3OMCA 4Q0FA 4NKLA 3NUCA 2I5LX 1AW7A 4B3MQ 2R7DA 5C44B 4A3JB 3AU7A 3NELA 4BBSH 1V8QA 1II3A 3GTGH 3QR8A 1LABA 3LWEA 4IFDJ 4XXEA 4H0LC 4JI1Q 5JJZA 4G7OC 2D0OA 1K9MC 3E6ZX 3I4MG 2L0CA 1TQOA 2F0FA 1FNWA 3CCEA 2ZJRA 4I7ZC 5GROA 1W6JA 2WV6D 1IBLL 3MXGA 1VQCA 4LF9Q 5J3BA 3C46A 3NTKA 1CQFA 4A3JH 5CV8A 3DM1A 2XRSD 4KY5A 4Y7NB 5CR3A 3K6OA 4GKJL 3J7AV 1TS2A 2AUJD 2C35B 4CKEA 1STYA 4LF8Q 1ASYA 1HNWL 1KL9A 2A74C 3D6CA 3GTPB 3C1FA 1E22A 3RMHA 3TP7A 2R6GA 3SVMA 4J1MA 5HGQA 4F88A 5CBEE 1O80A 4DU9A 3OWFA 4PMCA 2UXBQ 1SNPA 5J1ZA 1IXRA 3MZ5A 5IWAQ 4LUOA 4N9PA 4Y7NH 3NTIA 1DOKA 3OIPA 1QCBD 2K33A 5IT9E 4GLXA 2NWGA 4G57A 1LV9A 3PMFA 4JI6Q 4DR5Q 3KFUA 1B1ZA 3S16B 3GTPH 3PQIA 3DXJC 3RLNA 4RKBA 4KKTA 1ONLA 4CKCA 1NSNS 2O2LD 4X62L 3BZKA 4LK1C 1EIHA 1CFMA 2VUMG 1VQ7A 1KTKA 3OOCA 4JI1L 2ZXRA 3S1NB 1D8LA 1HUMA 5EBDA 1KNEA 1Q8KA 2PO4A 4B3TQ 5IT9L 2EYPA 3S16H 2NVXB 4LF9L 2UXDQ 2AQ1B 2LFNA 2B8GA 4GN3B 1SXTA 1LM0A 5EPJA 1ZKOA 1PXUA 2O5IC 3NQIA 4DK0A 2XIWA 1GUTA 1STGA 5IGGA 1I50B 4FF3A 3STBD 4WORA 2IY5B 2MO0A 4L5TA 2PZTA 3QO2A 1VQPA 3S1NH 3PIO3 1JQYD 2H1EA 3CCMA 5C0XG 2CWPA 2RF4A 4UDUC 1JOOA 2XGTA 1MI2A 4WJ3M 4IO9A 1ENFA 1HNXQ 1PYSB 3RLOA 2Q8RE 1A15A 2UXBL 3S1QH 3FDTA 3QOLA 3OW2A 1JT8A 1K8MA 1M4VA 3K7AB 1UE5A 2B2YA 2F1MA 2FHTA 4DNIA 1I50H 3PUXA 1SE4A 5ELOA 3ZYYX 4Q5VA 1U4RA 1PFBA 3M7GA 3TSSA 1VQKA 1EY8A 5ELFA 1HTPA 3VA5A 1L1OA 1FL0A 2PMZB 3OIQA 4A3MG 3Q8DA 3E9HA 1CK1A 1N9WA 1SMYD 2IX0A 1QJOA 3HOYB 1LTAD 4ZYSA 3GDEA 3FVQA 1EEFD 4YCUA 1YHQA 1O78A 1VQOA 3K7AH 2HQLA 4K6LA 1HNZL 2MO1A 3TMEA 1JJ2A 2E5LQ 4H7BA 1X9NA 2DJFC 3Q24A 2IWHA 4B3TL 2OT2A 2K14A 3W1GA 4ULLA 2UXDL 2KUMA 1GO3E 3HOYH 1YNNC 3KLSA 4K0KL 1GUWA 4DV0Q 2CW0C 3H0GG 4KJOA 4KMUC 1Q46A 4RCNA 3MXNB 1Y8NB 1BBWA 3KF6B 2F0GA 2Z6KC 3KBXA 2Q8TA 2PZWA 2MQHA 4QJFA 3ERQA 1I6HB 4GNXA 1B44D 1C48A 1PRTB 1SEBD 5LL6X 2QKIC 4H44C 4Y52H 3TP6A 5IYDH 4FNFA 4JI3L 3RNUA 3NBHA 4JI4L 1ENCA 2VZAA 2M2LA 1NR4A 1HH2P 2ZM6L 4B3SL 4JBMA 1EYDA 3FKIG 2IX1A 1K73C 1D5XC 4RAUC 5A2QL 3M3YB 2NUCA 2RDFA 5GAHC 1DM0B 3W5OA 3ER0A 2A6ED 4GN5A 1VMPA 1I4RA 1PZKD 1SYBA 1E1TA 1I6HH 1AN8A 1YHBA 4NB3A 1OTCA 2MFIA 4YCVA 1VQ5A 1K83B 2X6GA 1BF4A 3C3LA 2E8GA 2XSCA 1BCPB 2GVBA 3HOVB 2CQAA 3D0FA 3U4ZA 1LYLA 1W6KA 3F1ZA 3M3YH 1RTOA 2AHOB 4FVMA 4GKKQ 2F03A 2PQAB 1PA6A 4UP7A 5M9OA 1BR9A 4IUPA 4DF7A 3HOWG 3PUVA 4OWTB 3S15B 4HJ5A 3VDYA 2QILA 1YJWA 4HR7B 1BOSA 1DCZA 1WCMB 4E6IA 3LX0A 3IL8A 1K83H 1U5KA 1HQMC 1YBYA 1AP0A 4EX5A 2JXMB 5M3MG 2JA8G 3HOVH 1Q86C 3OPOA 5CMDA 4UP8A 2NVQB 1KLUD 1M1KC 4OO1I 3GTMB 4MHEA 1B2TA 1UAPA 2RSOA 1GM5A 4N8X1 1KNAA 1IYJB 2RA4A 4R8NA 2VQFQ 2EYMA 3QG1A 2LKVA 1WFQA 4JYAL 2TMPA 1V1QA 4DPGA 3S15H 4Z9CB 4A3EG 1FGUA 4FYDA 2VNUD 1WCMH 4X6AH 1CZWA 2LMCB 2EQSA 2VB2X 1OXXK 4LWCA 4PV1C 4A3IB 3NK9A 1HR0L 5T1IA 1ESRA 4CDDC 1VQAA 1QVFA 4MTNA 3L9AX 1CSPA 4DV2Q 2NVQH 3QJYA 3GTMH 4ZAIA 1S40A 3HKSA 2QDLA 1CT1D 4JBWA 2OTJA 4EQOA 1G6ZA 3GTJB 1SE2A 2BOSA 3D3RA 2VQEQ 2F0SA 2M00A 1XNRL 4OXPA 4A76A 4J15A 2WB1B 4WRDA 1KABA 4LFAL 3H3VI 3KYHC 3KLRA 1EQTA 5JPNC 3UE0A 4IALA 1JC7A 4HJ9A 4LF6L 2B2VA 1NY4A
chains in the Genus database with same CATH topology
5ELEA 1V43A 2SOBA 3S1MB 3E5SA 3MXUA 5IGDA 3C1EA 2C9OA 5KIXA 1EY0A 2FMCA 4PMWA 5COYA 1D1KA 2K5QA 1TT2A 3ND9A 3KK7A 4KHVA 1JICA 5EPKA 2RDHA 5J39A 1GUOA 1CTMA 5C3XA 3UI2A 2VB3X 2K32A 2B2YC 4PQXA 4KD3A 2EJGC 3ITPA 4ZKCB 1F2MA 1IKMA 5IGEA 4TSSA 3EROA 3OSOA 1DZ1A 4BWGB 2BA1A 4U673 3NTHA 1F9SA 3M7NA 4K2LA 2L12A 2EXZA 3JAML 4IFDI 1X3QA 4KJNA 1CZGA 5NUCA 3QB3A 1QWYA 1B50A 4ZUJA 5EBCA 5FO8B 3TN2A 4R8IA 1AZQA 4CGYB 3EFXD 2KA7A 1FGBD 4B08A 1TWGB 3MC0B 1IKLA 2R61A 1S5DD 2WAQB 1S5CD 3K5MA 1GHKA 4R9WA 5C4JB 2QEJC 4K8JA 3EJIA 2NN6H 2FINB 1B3AA 1H9RA 4B9XA 4WFN3 1TVXA 2Q8IB 2AUKA 3VR3A 4OIKA 1SDFA 2KCNA 1KDBA 2EE1A 1VDZA 1IYUA 1EYCA 2G9DA 2PQEA 4X3SA 1TY0A 5E3FA 2I46A 1D5MC 4ZRZA 3Q22A 3T51B 2D2CC 5T1GA 3OWEB 2X69A 3MAQA 5M5YB 3HS0C 4J6HA 1ILPA 3HOUB 1RHPA 3BVGA 4RGOS 1D1IA 1VF5C 2A69C 4IUVA 1SAPA 2EDGA 2TSSA 3R2TA 4C3HG 4DXFA 3MXNA 1TWHB 2NZ1D 1OXVA 3BDLA 2F0IA 4KHZA 1PZJD 2O5JC 1CHQD 1TWFB 3RZDB 3HZXA 1YNND 1DJRD 2A68C 2CW0D 3W2DA 2PZUA 2JSOA 2KOLA 3NQTA 1HPCA 2H4OA 1A3VA 4P2CB 2XVSA 1EU4A 1RODA 5C0XI 1XWEA 3RZOB 1Y1VB 3OW7A 2BDNA 4HN7A 4LAAA 2XN9C 1MSGA 3A56A 3HGBA 4EGVA 4S3SA 4N9TA 4C3IB 2AWNA 4IFDG 5CORA 3TZUA 5KNDA 1ILQA 3BYYB 3MHBA 4HEDA 2OXPA 4FF4A 4V190 3ONAB 3P20A 4OGQC 3FPPA 3RUZA 4KY6A 4C3JG 4QCLA 1JCKB 5D14A 1STBA 4KTAA 3CU7A 3K57A 4KKSA 4XQQA 3SDZA 2R7ZB 3D6WA 2B2WA 1SNOA 2K6AA 4FF2A 1JWSD 3T13A 5AFWA 5CV7A 1PTOD 2F0HA 1B53A 5A35A 5M5XB 2A5HA 4HMIA 2F0LA 2E2DC 3PV0A 5I6YA 4LMQD 1X32A 2Y0SB 3A54A 3NE5B 1EU3A 1I4PA 1SYGA 2HCIA 3GQBA 3OHXC 2F0DA 2PW5A 1BBXC 1WD0A 4A3MB 3H6MA 5BN3A 5G3LD 3CRKC 3V2TA 3PO3B 1EWCA 2F0UA 2ENBA 3WOEA 3GP7A 3I72A 2EY1A 3GD7A 3HP3A 5CYUA 3DWAA 2B2TC 1I6VC 5K36H 3A8IE 1WTVA 2NVTB 1RD9D 4EQNA 4BS9A 1TIID 1Q90A 4EVOA 1LTTD 3S1RB 2A6HC 1STHA 3D4DA 4DK1A 1S4ZA 3KLSX 1WTOA 3R3OA 4XTCS 1F2ZA 3NXWA 5I2XA 4NP5A 5JEAH 3J7YW 4RA8A 3LNNA 2MPMA 3S1QB 1C4QA 1PDQA 1PLFA 2KCCA 4CKBA 2F0KA 4IN3A 2EY6A 3SR1A 1Z47A 2EZVA 2XWJB 1GOZA 1DYQA 3NWSA 1Q1EA 1HQRD 1WVLA 2K04A 4ZK9B 2GA4B 1HHVA 1R9TB 4RKLA 1QILA 2L9HA 3BZDB 1J8IA 3KBGA 2IJ0A 2QF7A 3A8KE 4XIGS 3SK6A 4TRDA 4DXGA 1E2ZA 1U9RA 1PRTC 5LL6S 4MN3A 1PFNA 1KLGD 1Q8IA 3DWPA 1B4OA 1QE6A 2JEBI 4IZ8A 5CGKA 3T16A 1PRTF 4IUNA 5C4HA 2O4XA 2ZXOA 3GTKB 3K58A 2ZT9C 2JA8B 4DAYA 2DN8A 1LT3D 1Y69U 3CKIB 1RCVD 3NPPA 5A2QE 2ICEC 4KV6A 1NCVA 5EPLA 5TSSA 3PUZA 4A93B 1TR5A 5I6WA 3DHQA 5CBAE 2F4IA 5IGCA 2B2UA 5JEAJ 3F2UA 3N52A 2Z1CA 2F3WA 2F0PA 4NDXA 5C6AA 1IYVA 1XXGA 5ELDA 1T5XD 1JOKA 1SE3A 1U4LA 3I4NB 3D4RA 2A69D 4WJWA 4HMJA 2EYOA 5J22A 4F7XA 1XTCD 1EZ8A 3I90A 3VYRA 1HTLD 2HQEA 1OXTA 3MVVA 3VYTA 2RBMA 5DM73 3T4AC 3VA7A 5IGBA 2RQXA 5EJWA 2IW3A 4L6TB 4K8IA 1F2LA 2XRQD 1QG7A 2A68D 3SK8A 2MJ8A 4BA2I 4TQUS 1F2YA 3HOZB 1H9JA 1L0YB 1Y1WB 1GXDC 1ZYRC 3FRPB 3H09A 2MP1A 5JOBA 5E4XA 4QF4A 1I4GA 2QCPX 1B9NA 4C1NK 1A3UA 2BE5D 2EYFA 3SEBA 5FO9B 1SYCA 1STEA 1SYEA 1ZXTA 2F0JA 1YNJC 3EA6A 2D9UA 4EQPA 4AYBB 4QIWB 2MGSA 1STNA 1CA6A 2SDFA 1GUSA 2EPBA 4ZLTF 1D5ZC 4F8MA 3URYA 1LLRD 1Y8OB 2XNAC 4OHJA 1RDPD 2VXWA 1HXYD 2Z4HA 2JP1A 3VYUA 5D3IB 4XQNA 4RGTA 2PPBC 1ML0D 2N55A 2AQ3B 2EYLA 5I9OA 4A3DB 2L11A 1LTSD 5C3WA 4K5WA 5F2DA 4A3GB 2NB0A 1C8CA 4G7ZC 3SK5A 1O7LA 3C2PA 1H9KA 1PTOB 2XWBB 3JAME 3CRLC 1OXSC 3HKZB 1LT4D 4CBVA 4BA1I 3HRZC 3TP8A 2EJMA 2L1BA 4F87A 5CC4A 4X3TA 2KECA 2LS01 2K5DA 3IFDA 2D5DA 5FOBB 2L5TA 1ICWA 3MA2B 1PTOH 3M4YA 4DA2A 3QOJA 2HDMA 4OO1H 2SNMA 1A2TA 3GV6A 3P7JA 1S5FD 2E2JB 3BS1A 1AFPA 2MHVA 5C4XB 5BN4A 3T56B 1WTWA 4FP5D 2RVLA 5FK9C 4C2MB 1I4HA 3K0YA 3RD4A 1WTPA 3HG9A 4BY1B 3G6JB 1D6EC 1SBBB 4DN4M 4ABNA 3I91A 2YYZA 1PZID 2E76C 1GJXA 2E74C 1HFNA 2J7ZA 1SMYC 2I07B 1DOMA 3MXPA 3M85A 2R92B 4XT1B 5ISRA 4A3KB 1H9MA 1Q12A 3NWTA 2E2HB 1XYIA 3FEWX 3R93A 3KUPA 5DNFA 4OL7A 1CM9A 4ME5A 4MIUA 2J0TD 1EEID 1EOTA 1EWHA 1R4QB 1SNQA 5EKIA 3EVQA 5KYIA 3ND8A 2SEBD 1QNUA 5FO7B 1SNMA 1O7ZA 3WOFA 1HRJA 2EJFC 2F3VA 1PRTD 3MWYW 3GTQB 1Q1BA 3MTSA 3I4MB 1I4QA 4HSVA 2EOTA 3BDCA 1GUGA 4UAIA 2V4DA 2PW7A 1LO5D 1ET6A 3EQLC 5HURA 2K5WA 3NP8A 2DNCA 1G2SA 2B63B 4QUFA 3T53B 1EZ6A 2K05A 4CJ0B 3H94A 1GHJA 2WACA 1MBYA 3HOXB 1LT6D 1TS5A 5CV4A 2ICIA 3GTOB 5C4ZA 2JYOA 1FNVA 2WIIB 2K01A 4HCSA 1KAAA 1SYDA 5C5LA 1CI3M 5JVH3 3IKJA 3A55A 1JR0D 5EKLA 4ZUIA 3I73A 2B2VC 2EYJA 4LJZC 5M5WB 1SSOA 2VUMB 4M8AA 5IODA 4IUQA 5FKAC 4FXDA 1UUPA 3A7LA 1PFMA 4DAPA 3PIP3 3S17B 1TS3A 1DXMA 3MEHA 1BXTA 4X3UA 3BVZA 2SNSA 3I4LA 1CHPD 1KDCA 1ZYRD 3TZDA 4CHTB 1LTID 4U68A 3BG3A 5KRUA 1MSHA 4L8JA 3NBIA 1EL0A 1YNJD 5E1FA 2DY7A 4FXKC 4TKOB 5LHY1 4FXGC 4IUUA 2CHBD 3I3CA 3K5LA 1RJTA 1EQVA 5EQ0A 1E2WA 4ZKBB 4KN7C 2LY7A 5C0XH 3Q23A 1R4PB 3R2IA 4RGMA 2F0QA 5EKKA 1IW7C 3PUWA 2FMMA 5C5MA 4K6DA 5KEEA 1JE4A 1F9RA 5IOCA 5ELBA 3CQZB 4DNRB 2KJXA 5DAUA 3IAYA 3K59A 1WD1A 2RSNA 2KEEA 2KVMA 3H0GB 1IL8A 3I70A 4C3IG 3S2HB 1ZEQX 3NSWA 3V05A 4L63B 1HFGA 2BDOA 1LACA 2KQ3A 1JWUD 4KKUA 3GTLB 4NMZA 1J9OA 3U9SA 3S14B 2DY8A 5KYLA 3K5NA 3K5OA 2F0OA 4BBRB 1CA5A 1O7YA 3FKIB 3S2DB 2NTTA 1V1PB 1FYCA 1FD7D 3LWUA 4V0BA 2L55A 2RKSA 3R8BA 3QWNA 3SXHA 3DEOA 1JORA 2BA0A 1F9PA 1A3TA 1AEXA 2WP8J 1NUCA 4DAVA 4BY7B 2F0NA 3CHBD 1TS4A 4GZYC 4FO2A 3GO5A 3DEPA 5K5PA 1VMCA 4HAEA 2KEDA 4YIJA 3HOWB 1S5BD 3W3AA 5C0XJ 4XQJA 1JB3A 1U4PA 3SHLA 4CJ1B 1HA6A 3X3NA 4QB4A 2B8FA 5BN5A 4PMBA 5K36G 2C5CA 1OXUA 1SNCA 2A73B 5M3MB 1Y8PB 1AZPA 4IQZA 2F0WA 1E0BA 1V1OA 3VR6A 1SJHD 1S5ED 3P1HA 5JEAG 2E75C 1I3QB 2MUYA 5FLXE 4A3EB 4G7HC 1BCPC 4DFAA 1XX8A 3N6RA 5JVG3 2Z4IA 2OF1A 4JK1C 3FPUB 1BCPF 2FJ2A 3HEJA 1EIGA 2D62A 1F77A 1LTBD 3V96A 1DONA 2B39A 4ZQ3A 4C1NI 5KNBA 4KI0A 1BQQT 5KNCA 2G9HD 3H91A 1FR3A 3U9OA 1EY7A 5FLXL 5I2YA 4A3BB 3Q6SA 1G91A 2ZXPA 4NW2A 1H9SB 5IGFA 1EYAA 1DOLA 2B2WC 2F0EA 2OEOA 5CV6A 4B9WA 1L0XB 1UNSA 3TDQA 1TKWB 4RFBA 1QNKA 3L7ZC 3AMUA 4QMGA 2JA6B 3Q0AA 3AB9A 3X3MA 5KGUA 4ILWA 1G291 2JE6I 3I8ZA 1G2TA 5JAVA 2WKDA 5DEHA 2E2IB 5CV5A 1I4XA 3G7LA 3TBIB 2EYHA 1TWAB 3S9WA 3KF8A 4XDXA 1PTOC 2K7VA 3BDOA 5I4DA 5E4WC 2NYZD 5HGTA 4RWSC 3IFTA 4XYQA 1PTOF 2Z8LA 4HSPA 3PO2B 1NAPA 4OIJA 4HCEA 2AQ2B 5CV9A 3VR2A 4A3FB 2F0TA 3TP5A 2J4XA 4KD4A 4PNYA 4RCOA 2AWOA 2R93B 1SYFA 2HCCA 1PMRA 2K1BA 3DUZA 3QIAA 5G3LF 2PCFB 3H3VC 1TWCB 1Z6HA 1BNZA 1MGSA 1OO9B 2NN6I 1NR2A 3A7AB 3SE0A 4H13C 4ID6A 3M4OB 2NBFA 4K5VA 4I65A 2WKCA 5EGTA 1B9MA 3J81E 4RHRA 2EY5A 1M8AA 2BCOA 1EY5A 4K5XA 3FMCA 4XT3B 1JOQA 3DMUA 3RLFA 3VR4A 2HUGA 2F0VA 3BYTB 1IW7D 1A2UA 2L4NA 4M1UB 4C3HB 2QDBA 3VYSA 1CQVA 1ET9A 4C56C 5JPMC 3J81L 2IX3A 4RGNA 4RHSA 5IIFA 2HDLA 3J80E 1Z7TA 1EY4A 2RDGA 1LTRD 4FF1A 1SJED 4X3KA 5D3DA 1MD2D 2A6HD 4RH6A 4XYOA 1DD2A 2DNEA 2EVBA 3O13A 2JEAI 4CJ2C 3PUYA 4KN4C 1D2BA 1V1PA 1LTGD 4IURA 1E2VA 2KHSA 1RF2D 1ENAA 1SFOB 1A6XA 3E0JA 3SK4A 2JA7B 2JA5B 2B2UC 2CVRA 3L3OC 3J80L 5ELCA 1HUNA 5M3FB 2B2TA 2M9VA 3D31A 1PYWD 1EY9A 4O42A 1ESFA 1SNDA 5C3EB 1RKNA 4OO1G 1WTXA 1TY2A 3A8JE 1F9QA 1TU2B 4C3JB 1HA5A 4K14A 5D65A 3D4WA 3OMGA 2N88A 1QOHA 4O1NA 4IFDH 4G4KA 2ID0A 4KK7A 5DM63 1Q3LA 2NVYB 3J7AF 4DGZA 3MFYA 2A6EC 2K03A 1UEAB 2F0MA 2WINB 2NTSA 1WTQA 1STAA 1G8ZD 3D8GA 4ODGA 2R3ZA 1VF7A 2PYKA 4KY7A 1BCPD 1VCIA 2NN6G 4J8QA 2PNRC 1EY6A 1LT5D 1T5EA 1U4MA 1HCZA 3WDNA 1H9SA 4HTHA 1JWMD 4QUCA 1GUNA 5I9PA 3VR5A 3GV3A 3MFGA 4IUTA 3BVMA 2IPKD 2YU9B 1EFID 2X6LA 1K8OA 2BE5C 2EY2A 1WTRA 1X3PA 2FFKB 1KDAA 1IHZA 3DWQA 1QB5D 4BBSB 3NHHA 2K28A 1FNUA 1BUVT 3GTGB 4K2KA 1BDOA 4DNTB 2IT1A 2IL8A 1RTNA 1BO0A 3P75A 3OMCA 4Q0FA 4NKLA 3NUCA 1AW7A 5C44B 4A3JB 3AU7A 1V8QA 1II3A 1LABA 3LWEA 4IFDJ 4XXEA 4H0LC 5JJZA 4G7OC 3E6ZX 2L0CA 1TQOA 2F0FA 1FNWA 4I7ZC 1W6JA 2WV6D 3MXGA 3C46A 3NTKA 1CQFA 5CV8A 3DM1A 2XRSD 4KY5A 4Y7NB 5CR3A 3K6OA 3J7AV 1TS2A 2AUJD 4CKEA 1STYA 2A74C 3D6CA 3GTPB 3C1FA 3RMHA 3TP7A 2R6GA 3SVMA 4J1MA 4F88A 5CBEE 1O80A 4DU9A 3OWFA 4PMCA 1SNPA 5J1ZA 3MZ5A 4N9PA 3NTIA 1DOKA 3OIPA 1QCBD 2K33A 5IT9E 2NWGA 4G57A 1LV9A 3PMFA 1B1ZA 3S16B 3DXJC 4RKBA 4KKTA 1ONLA 4CKCA 1NSNS 2O2LD 4LK1C 1EIHA 1CFMA 1KTKA 3OOCA 2ZXRA 3S1NB 1HUMA 5EBDA 1KNEA 2PO4A 5IT9L 2EYPA 2NVXB 2AQ1B 2LFNA 2B8GA 1SXTA 5EPJA 1ZKOA 1PXUA 2O5IC 3NQIA 4DK0A 2XIWA 1GUTA 1STGA 5IGGA 1I50B 4FF3A 4WORA 2PZTA 3QO2A 3PIO3 1JQYD 2H1EA 5C0XG 4UDUC 1JOOA 1MI2A 1ENFA 2Q8RE 1A15A 3FDTA 3QOLA 1K8MA 1M4VA 3K7AB 2B2YA 2F1MA 2FHTA 3PUXA 1SE4A 3ZYYX 4Q5VA 1U4RA 1PFBA 3M7GA 3TSSA 1EY8A 5ELFA 1HTPA 3VA5A 2PMZB 3OIQA 1CK1A 1SMYD 2IX0A 1QJOA 3HOYB 1LTAD 4ZYSA 3FVQA 1EEFD 1O78A 4K6LA 3TMEA 4H7BA 3Q24A 2IWHA 2OT2A 4ULLA 2KUMA 1YNNC 3KLSA 1GUWA 2CW0C 4KJOA 4KMUC 4RCNA 1Y8NB 2F0GA 3KBXA 2Q8TA 2PZWA 3ERQA 1I6HB 1B44D 1C48A 1PRTB 1SEBD 5LL6X 2QKIC 4H44C 3TP6A 4FNFA 3NBHA 1ENCA 2M2LA 1NR4A 1EYDA 2IX1A 1D5XC 4RAUC 5A2QL 3M3YB 2NUCA 2RDFA 1DM0B 2A6ED 1VMPA 1I4RA 1PZKD 1SYBA 1AN8A 1K83B 2X6GA 1BF4A 3C3LA 2XSCA 1BCPB 3HOVB 2CQAA 1W6KA 1RTOA 4FVMA 2F03A 5M9OA 1BR9A 4IUPA 4DF7A 3PUVA 3S15B 2QILA 4HR7B 1BOSA 1DCZA 1WCMB 4E6IA 3LX0A 3IL8A 1HQMC 1AP0A 2JXMB 3OPOA 5CMDA 2NVQB 1KLUD 4OO1I 3GTMB 4MHEA 1B2TA 1UAPA 2RSOA 1KNAA 2RA4A 4R8NA 2EYMA 2LKVA 3QG1A 2TMPA 4Z9CB 4FYDA 2VNUD 1CZWA 2LMCB 2VB2X 1OXXK 4PV1C 4A3IB 3NK9A 5T1IA 1ESRA 3L9AX 3QJYA 4ZAIA 1CT1D 4JBWA 4EQOA 1G6ZA 3GTJB 1SE2A 2BOSA 3D3RA 2F0SA 2M00A 2WB1B 4WRDA 1KABA 5JPNC 3KLRA 1EQTA 4IALA 1JC7A 2B2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EBC A;  5EBD A;  5CYU A;  3X3N A;  3X3M A;  4KK7 A; 
#chains in the Genus database with same CATH topology
 5ELE A;  4A3I H;  4A3B G;  1V43 A;  2SOB A;  3S1M B;  3E5S A;  3MXU A;  5IGD A;  3C1E A;  2C9O A;  1CKO A;  5KIX A;  1EY0 A;  2FMC A;  4PMW A;  2RCN A;  5COY A;  4DR3 L;  3PIO A;  3GTJ H;  3CXC A;  3G4S A;  1D1K A;  2K5Q A;  3RN2 A;  1VQM A;  1TT2 A;  3ND9 A;  3KK7 A;  4R4C A;  4KHV A;  1JIC A;  1X56 A;  5EPK A;  2RDH A;  5J39 A;  4DV4 Q;  1GUO A;  3S1M H;  1CTM A;  5C3X A;  3HOZ G;  3UI2 A;  2VB3 X;  1Y1W G;  2K32 A;  2B2Y C;  4KD3 A;  4PQX A;  2EJG C;  3ITP A;  2VQF L;  4ZKC B;  1F2M A;  1IKM A;  1NE3 A;  4AYB E;  5IGE A;  3CAM A;  4TSS A;  2HIV A;  3ERO A;  3OSO A;  1DZ1 A;  4BWG B;  2BA1 A;  4U67 3;  5BR8 L;  1VQJ A;  3EN2 A;  2YV5 A;  1F9S A;  3NTH A;  4K2L A;  3M7N A;  2L12 A;  2ASB A;  4DV6 L;  4YHH Q;  2EXZ A;  2IHE A;  4JPB W;  3JAM L;  2HHH L;  4IFD I;  1X3Q A;  4KJN A;  1CZG A;  5NUC A;  1YI2 A;  2YTV A;  3QB3 A;  1QWY A;  1PH2 A;  4LF7 Q;  1B50 A;  4ZUJ A;  5EBC A;  5FO8 B;  3TN2 A;  4R8I A;  1AZQ A;  4CGY B;  3EFX D;  2KA7 A;  1FGB D;  4B08 A;  2YTX A;  1TWG B;  2KCT A;  4LF5 Q;  3MC0 B;  1FJG L;  1IKL A;  3E3X A;  1VQE A;  2R61 A;  1S5D D;  2WAQ B;  3F2C A;  3CCS A;  1S5C D;  3K5M A;  3TRE A;  1GHK A;  4R9W A;  5C4J B;  3F2D A;  5E7N A;  1XTD A;  1DGS A;  2QEJ C;  1L1O B;  4GLA C;  4A3F G;  3A5U A;  4C2M H;  4K8J A;  3EJI A;  2NN6 H;  1Y14 B;  1TWG H;  2FIN B;  1B3A A;  4A3G G;  4YWK A;  4GOP A;  4DV4 L;  1H9R A;  4YWM A;  1JJG A;  4B9X A;  4WFN 3;  1T9H A;  1TVX A;  2Q8I B;  2AUK A;  4HJA A;  3VR3 A;  4JI7 L;  3B6Y A;  1QUQ B;  4OIK A;  1SDF A;  2KCN A;  4DV3 Q;  1KDB A;  2EE1 A;  1VDZ A;  2Q2H A;  1KHI A;  3K8A A;  1IYU A;  1EYC A;  2G9D A;  2PQE A;  4X3S A;  1TY0 A;  3UDX A;  5E3F A;  2AMC B;  2RHQ B;  2I46 A;  1X55 A;  1D5M C;  4ZRZ A;  4DAY B;  3Q22 A;  2P5Z X;  4BXX H;  3T51 B;  2ZTD A;  4JV5 Q;  2D2C C;  5T1G A;  3OWE B;  2X69 A;  3MAQ A;  5M5Y B;  3HS0 C;  4CDE C;  4J6H A;  1ILP A;  3HOU B;  1RHP A;  3BVG A;  4RGO S;  1D1I A;  3A5Z B;  1AE2 A;  1VF5 C;  2A69 C;  1SAP A;  4IUV A;  5FLM G;  1VQ9 A;  4LF5 L;  2EDG A;  2TSS A;  3R2T A;  4C3H G;  4DXF A;  3MXN A;  1TWH B;  2NZ1 D;  1OXV A;  3ULJ A;  3KF6 A;  3BDL A;  2F0I A;  3CC7 A;  2UUB L;  4O0A A;  4KHZ A;  2N78 A;  4DR1 L;  5M5Y H;  1PZJ D;  2O5J C;  4LNQ A;  1CHQ D;  4BY1 G;  3HOU H;  1TWF B;  2DUD A;  1L0W A;  3RZD B;  3HZX A;  1YNN D;  1DJR D;  2A68 C;  1P16 A;  2CW0 D;  3W2D A;  2PZU A;  2JSO A;  2OTL A;  3KJO A;  4OX9 L;  2KOL A;  3NQT A;  1HPC A;  1V9P A;  1TWH H;  2H4O A;  1A3V A;  4P2C B;  4OWW B;  2XVS A;  2N8N A;  1EU4 A;  1ROD A;  5C0X I;  1XWE A;  1HR0 W;  2GN5 A;  3RZO B;  1Y1V B;  3OW7 A;  1VQD A;  2BDN A;  1TWF H;  2JA7 G;  3RZD H;  3KJP A;  4HN7 A;  4LAA A;  2XN9 C;  2KCM A;  1MSG A;  1NMG A;  2UXC Q;  3A56 A;  5M3F G;  1N32 L;  3HGB A;  2OWO A;  4EGV A;  4S3S A;  5LMN Q;  4N9T A;  4C3I B;  4UPA A;  2Z9H A;  1SN8 A;  2AWN A;  1E3P A;  2Q2U A;  4IFD G;  1N33 L;  2PQA A;  5COR A;  5FJ8 H;  3TZU A;  5KND A;  2ATW A;  4HIK A;  3RZO H;  1ILQ A;  3BYY B;  1Y1V H;  4LUV A;  3MHB A;  1K8G A;  1G6P A;  1BKB A;  1UEB A;  4HED A;  2OXP A;  4FF4 A;  4V19 0;  3E9I A;  1YVC A;  3ONA B;  3P20 A;  2I5H A;  4OGQ C;  1EFW A;  3FPP A;  3RUZ A;  2HT1 A;  4KY6 A;  4C3J G;  4QCL A;  4C3I H;  2JA9 A;  1JCK B;  5D14 A;  1STB A;  4KTA A;  3CU7 A;  3K57 A;  4KKS A;  5IT9 c;  4XQQ A;  3SDZ A;  3EIV A;  1I94 L;  1IBK Q;  4DUY Q;  4HJ7 A;  2R7Z B;  4R1J A;  3D6W A;  2VUM H;  2B2W A;  1SNO A;  1VQF A;  2K6A A;  3EBE A;  4QGU A;  4DKA C;  4FF2 A;  3UE1 A;  3J7Z C;  1JWS D;  2VL6 A;  4QL5 A;  3T13 A;  5AFW A;  5CV7 A;  1WYD A;  3CD6 A;  1PTO D;  2F0H A;  3IRB A;  1B53 A;  3PGZ A;  5A35 A;  5M5X B;  1K0S A;  1KIX A;  1N36 L;  2A5H A;  4HMI A;  2DJG C;  2F0L A;  2B63 G;  2E2D C;  3PV0 A;  2R7Z H;  5I6Y A;  4LMQ D;  3NEM A;  1X32 A;  2Y0S B;  3A54 A;  3NE5 B;  5HY6 A;  1EU3 A;  1I4P A;  1SYG A;  2HCI A;  3GQB A;  4GS3 A;  3OHX C;  3CCJ A;  2F0D A;  2UXC L;  2PW5 A;  1BBX C;  3HOX G;  1WD0 A;  4A3M B;  5M5X H;  3H6M A;  5BN3 A;  2D0P A;  4HIM A;  5G3L D;  3CRK C;  3V2T A;  3PO3 B;  1EWC A;  1TXY A;  3KOJ A;  2CH4 W;  1GKH A;  2F0U A;  1CSQ A;  4KHP Q;  2ENB A;  3WOE A;  3GP7 A;  4MZ9 A;  5GQO A;  1KQS A;  3I72 A;  1A0I A;  1HZC A;  1EQR A;  2EY1 A;  4TVA B;  3GD7 A;  3HP3 A;  4B3M L;  4JI0 Q;  3M9B A;  4UHV A;  5CYU A;  1FVI A;  3DWA A;  4LUZ A;  2B2T C;  1I6V C;  4A3M H;  5K36 H;  3A8I E;  1YHA A;  1WTV A;  2NVT B;  1RD9 D;  4EQN A;  4BS9 A;  1TII D;  1IBK L;  1Q90 A;  3PO3 H;  4EVO A;  1LTT D;  3S1R B;  2A6H C;  1STH A;  1KC8 C;  3SGI A;  3D4D A;  4DK1 A;  1S4Z A;  3KLS X;  4QY7 A;  1WTO A;  3R3O A;  1YEZ A;  4XTC S;  5GAD C;  1F2Z A;  2WFW A;  3NXW A;  5I2X A;  4NP5 A;  5JEA H;  3J7Y W;  2UUA Q;  4IJL A;  4RA8 A;  1VQH A;  3LNN A;  2FXQ A;  3CQZ H;  2MPM A;  3S1Q B;  1C4Q A;  1PDQ A;  1PLF A;  2KCC A;  4CKB A;  1UWV A;  2F0K A;  5JJK A;  2VS1 A;  2NVT H;  3G6E A;  1UE1 A;  4CDC C;  5C44 G;  4IN3 A;  2EY6 A;  4A3J G;  3SR1 A;  1Z47 A;  2EZV A;  3S1R H;  4JOI C;  4LF8 L;  1QZG A;  1VQ6 A;  4JBJ A;  2XWJ B;  1GOZ A;  1DYQ A;  3NWS A;  2LXK A;  3L0O A;  3I2Z A;  3CCU A;  1Q1E A;  1HQR D;  1WVL A;  5IWA L;  4IPD A;  1VQN A;  3GTL H;  2CQO A;  4PG3 A;  2K04 A;  4ZK9 B;  1GD7 A;  4GOP B;  2GA4 B;  1HHV A;  4JI6 L;  3ZJY C;  1R9T B;  1VQG A;  4RKL A;  1QIL A;  2L9H A;  4DR5 L;  1WI5 A;  3BZD B;  1WOC A;  4B3R Q;  5IY0 A;  1PH4 A;  4X65 Q;  1J8I A;  3KBG A;  2IJ0 A;  1EQQ A;  2QF7 A;  1YZ6 A;  1LUZ A;  1XJV A;  4R4Q A;  1I5F A;  3A8K E;  4XIG S;  3PSI A;  3SK6 A;  4YY3 Q;  4TRD A;  2PNH A;  4DXG A;  1E2Z A;  2ZTE A;  1U9R A;  1PRT C;  4YCW A;  4DR4 Q;  1KRT A;  3K80 C;  5LL6 S;  4MN3 A;  1PFN A;  1IL2 A;  1KLG D;  1Q8I A;  3DWP A;  1B4O A;  1QE6 A;  1QUQ A;  2JEB I;  4IZ8 A;  5CGK A;  3T16 A;  1PRT F;  3TRZ A;  1R9T H;  4DAM A;  4IUN A;  5C4H A;  2O4X A;  2ZXO A;  3GTK B;  1XPU A;  2MNA A;  3K58 A;  4LFC Q;  2ZT9 C;  2JA8 B;  4DAY A;  2DN8 A;  1LT3 D;  2QW7 A;  1Y69 U;  4WJ4 A;  3CKI B;  1M90 C;  1RCV D;  3NPP A;  1YIJ A;  5A2Q E;  2ICE C;  4KV6 A;  2K75 A;  1NCV A;  5EPL A;  5IYC G;  5TSS A;  3PUZ A;  4A93 B;  1TR5 A;  5I6W A;  3DHQ A;  5CBA E;  3GTK H;  4DR6 Q;  1HNX L;  2JA8 H;  2F4I A;  5IGC A;  1Q82 C;  2B2U A;  4HJ8 A;  1A62 A;  5JEA J;  3F2U A;  3N52 A;  2Z1C A;  2F3W A;  4JG2 A;  4BBR G;  2I0Q A;  2F0P A;  4NDX A;  5C6A A;  4A3E H;  1IYV A;  2HD3 A;  4A93 H;  1XXG A;  5ELD A;  1T5X D;  4X65 L;  1JOK A;  1PV4 A;  1SE3 A;  1U4L A;  3I4N B;  4P72 A;  3D4R A;  2A69 D;  4WJW A;  4X64 Q;  4HMJ A;  2EYO A;  5J22 A;  2YTY A;  3ERS X;  4F7X A;  1XTC D;  1EZ8 A;  3I90 A;  3VYR A;  2Z0S A;  1HTL D;  2HQE A;  1OXT A;  3MVV A;  4JI8 Q;  3VYT A;  2RBM A;  5DM7 3;  1VQ4 A;  4BY7 G;  2E5L L;  3T4A C;  3VA7 A;  1S72 A;  5IGB A;  2PMZ E;  2RQX A;  5EJW A;  2IW3 A;  4L6T B;  4K8I A;  3I4N H;  1F2L A;  2XRQ D;  1QG7 A;  2A68 D;  3SK8 A;  2MJ8 A;  4BA2 I;  4TQU S;  1F2Y A;  3HOZ B;  1H9J A;  1L0Y B;  1Y1W B;  1GXD C;  1ZYR C;  3FRP B;  3H09 A;  4DV0 L;  1XPO A;  2MP1 A;  5JOB A;  5E4X A;  3TS2 A;  4QF4 A;  1I4G A;  2QCP X;  3TQY A;  4A3C H;  1B9N A;  4C1N K;  2JK8 A;  1A3U A;  3HOY G;  2BE5 D;  2EYF A;  3SEB A;  5FO9 B;  4DV1 Q;  1SYC A;  1STE A;  1SYE A;  1ZXT A;  2F0J A;  3CC2 A;  1YNJ C;  3EA6 A;  4AIM A;  2D9U A;  1X54 A;  4EQP A;  4AYB B;  2Z6B A;  4QIW B;  2MGS A;  1STN A;  3HOZ H;  1Y1W H;  3JAM c;  1CA6 A;  2SDF A;  3I56 A;  1GUS A;  2EPB A;  4ZLT F;  3AFP A;  4PZ7 A;  1D5Z C;  4F8M A;  3URY A;  5IYD G;  1LLR D;  1Y8O B;  2A19 A;  5DLQ E;  1YIT A;  2XNA C;  4RG1 A;  4OHJ A;  1RDP D;  1HZ9 A;  2VXW A;  4X64 L;  1HXY D;  2Z4H A;  2JP1 A;  3VYU A;  1X6O A;  1CKM A;  5D3I B;  4XQN A;  4RGT A;  2PPB C;  4OON A;  1ML0 D;  2N55 A;  3U50 C;  2AQ3 B;  2EYL A;  2PI2 E;  5I9O A;  4A3D B;  4JI5 Q;  2L11 A;  1LTS D;  5C3W A;  4K5W A;  4GKK L;  4NXM Q;  5F2D A;  4A3G B;  2NB0 A;  1C0A A;  1C8C A;  4G7Z C;  3SK5 A;  1O7L A;  3FP9 A;  1B8A A;  2L15 A;  3C2P A;  1H9K A;  1MKH A;  1K28 A;  1PTO B;  2XWB B;  3JAM E;  3CRL C;  1OXS C;  3HKZ B;  2I5M X;  4X66 Q;  1LT4 D;  4A3D H;  1SMX A;  4CBV A;  4BA1 I;  3HRZ C;  3TP8 A;  2JA6 G;  1CKN A;  2EJM A;  3KDF B;  2L1B A;  4A3G H;  4F87 A;  3RR5 A;  5CC4 A;  4X3T A;  2KEC A;  4DUZ Q;  2LS0 1;  2K5D A;  3IFD A;  3HOV G;  2ZJP A;  2D5D A;  4APV A;  5FOB B;  2L5T A;  1SRO A;  1ICW A;  3MA2 B;  2NZO A;  1PTO H;  3K7U C;  3M4Y A;  4DA2 A;  1L1O C;  3QOJ A;  2HDM A;  4OEM B;  3I55 A;  2B3G A;  4OO1 H;  2SNM A;  1A2T A;  3GV6 A;  3P7J A;  1QVC A;  1MJC A;  4DV2 L;  1S5F D;  4RMF A;  2QEX A;  2E2J B;  3BS1 A;  1AFP A;  2MHV A;  5C4X B;  5BN4 A;  2K5H A;  3T56 B;  1WTW A;  2VQE L;  1CUK A;  2RVL A;  4FP5 D;  2CFM A;  5FK9 C;  4C2M B;  1I4H A;  2B29 A;  3BU2 A;  3K0Y A;  4JI5 L;  3RD4 A;  1WTP A;  3HG9 A;  4BY1 B;  3G6J B;  1D6E C;  1GVP A;  1SBB B;  3PO2 G;  4P75 A;  1EIY B;  4DN4 M;  3DM3 A;  1BVS A;  4ABN A;  2H5X A;  4FDB A;  3I91 A;  2E2J H;  2G5D A;  2YYZ A;  1PZI D;  4A3I G;  5C4X H;  3H3V H;  2E76 C;  3WWV A;  1RL2 A;  2WB1 E;  1U0L A;  1W2B A;  1GJX A;  2E74 C;  3CF5 A;  1JB7 A;  1HFN A;  2J7Z A;  1SMY C;  2I07 B;  1DOM A;  2VY3 A;  4A3L H;  3MXP A;  1EOV A;  3M85 A;  2R92 B;  4BY1 H;  1HZB A;  4GNX C;  2R93 G;  3DLL A;  5AJ3 Q;  2R7F A;  4XT1 B;  1Z9F A;  2WB1 G;  5ISR A;  3T1Y Q;  4A3K B;  1H9M A;  1Q12 A;  3NWT A;  4P71 A;  1PVO A;  2K50 A;  3K0X A;  2E2H B;  1J5E Q;  1XYI A;  1NNX A;  3FEW X;  3R93 A;  1IBM Q;  1PFS A;  3KUP A;  4JCV E;  5DNF A;  4NXN Q;  4OL7 A;  1CM9 A;  4ME5 A;  4MIU A;  2J0T D;  1EEI D;  1EOT A;  1EWH A;  1R4Q B;  1SNQ A;  4YHH L;  2R92 H;  5EKI A;  3EVQ A;  5KYI A;  3ND8 A;  2SEB D;  4PZ6 A;  1QNU A;  3OTO Q;  5FO7 B;  1SNM A;  4A3K H;  5IP7 G;  3CCQ A;  1MJE A;  3ULL A;  1O7Z A;  4HIO A;  4LF7 L;  5IYB G;  2E2H H;  3WOF A;  1EYG A;  1HRJ A;  2EJF C;  2F3V A;  1E24 A;  4EQ5 A;  1ICF B;  1JMC A;  1PRT D;  3MWY W;  3GTQ B;  4DK6 C;  1Q1B A;  3MTS A;  3I4M B;  1XMO Q;  1I4Q A;  5LMU Q;  1VQ8 A;  4HSV A;  4A75 A;  2EOT A;  3BDC A;  1GUG A;  4UAI A;  2V4D A;  2PW7 A;  1KD1 C;  2K4K A;  3AEV A;  1LO5 D;  4JI2 Q;  3J7A 5;  1ET6 A;  3EQL C;  2UU9 Q;  5HUR A;  2K5W A;  3NP8 A;  2DNC A;  4GN4 B;  4IPG A;  1G2S A;  2KEN A;  2B63 B;  4QUF A;  3GTQ H;  3T53 B;  2A1A A;  1EZ6 A;  3I4M H;  5GAG C;  2K05 A;  4CJ0 B;  3H94 A;  1GHJ A;  2WAC A;  1MBY A;  4UP9 A;  2N49 A;  3HOX B;  1B70 B;  4DV3 L;  2OQK A;  1LT6 D;  1TS5 A;  1IBM L;  5CV4 A;  1YNX A;  3AQQ A;  2ICI A;  4KLK A;  4NXN L;  2JA5 G;  3GTO B;  5C4Z A;  2JYO A;  5IP9 G;  1IBL Q;  1FNV A;  3OYY A;  2WAQ G;  2WII B;  2K01 A;  4HCS A;  2VW9 A;  1KAA A;  2B63 H;  3E0E A;  1SYD A;  2HIX A;  5C5L A;  1CI3 M;  3G71 A;  4JV5 L;  3MEF A;  5JVH 3;  4POG A;  2V1C C;  1PH9 A;  3IKJ A;  3A55 A;  3J81 i;  1JR0 D;  5EKL A;  2OCE A;  4ZUI A;  2NZH A;  4GKJ Q;  3I73 A;  2B2V C;  2EYJ A;  3HOX H;  4LJZ C;  4IJH A;  5M5W B;  1SSO A;  1NTG A;  2K52 A;  2VUM B;  1B7Y B;  1KAW A;  1HNW Q;  4M8A A;  3KLW A;  5IOD A;  1E7Z A;  3GTO H;  4IUQ A;  5FKA C;  4DV5 Q;  4FXD A;  2Z6K A;  1UUP A;  3AYH B;  3A7L A;  4MNO A;  5C3E G;  4OEL B;  1PFM A;  4JW0 A;  1X3G A;  2JJQ A;  3AFQ A;  5LMU L;  4DAP A;  4GLV B;  3PIP 3;  1QVG A;  3S17 B;  1TS3 A;  1DXM A;  3MEH A;  1X3F A;  1BXT A;  4X3U A;  2DGY A;  5M5W H;  3BJU A;  2Q2I A;  3BVZ A;  1S3O A;  3J80 i;  2SNS A;  3I4L A;  1CHP D;  1KDC A;  1ZYR D;  3HFZ B;  4X62 Q;  3TZD A;  2CH4 A;  4CHT B;  1LTI D;  4U68 A;  3HOU G;  5JJI A;  3BG3 A;  5KRU A;  1MSH A;  2EXD A;  2ZJQ A;  4IOC A;  1W3S A;  1N34 Q;  3S17 H;  4L8J A;  2CKZ B;  3NBI A;  3CC4 A;  4IPC A;  4N8F A;  1Q81 C;  1EL0 A;  1YNJ D;  5E1F A;  2DY7 A;  1KRS A;  4FXK C;  4TKO B;  3I4O A;  5LHY 1;  4FXG C;  4IUU A;  2CHB D;  3I3C A;  3K5L A;  1RJT A;  1EQV A;  2EIF A;  5EQ0 A;  5C44 H;  1E2W A;  4ZKB B;  4KN7 C;  2IHF A;  5LMN L;  2LY7 A;  5C0X H;  4A4I A;  3Q23 A;  1R4P B;  3R2I A;  4RGM A;  2F0Q A;  2RCF A;  5H1S E;  5EKK A;  1WJJ A;  1CKN B;  2RHS B;  1IW7 C;  3PUW A;  2FMM A;  5C5M A;  4K6D A;  5KEE A;  3F8T A;  4DV5 L;  1JE4 A;  4P73 A;  1EUJ A;  1F9R A;  3CMA A;  5FJ8 G;  2F4V Q;  5IOC A;  5ELB A;  4LW1 A;  1Y1V G;  3CQZ B;  4DNR B;  2KJX A;  2K5N A;  3KDF A;  5DAU A;  3IAY A;  4JVZ A;  4DUY L;  3CCL A;  3K59 A;  1WD1 A;  4BBS G;  2RSN A;  2KEE A;  2KVM A;  4GOP C;  3H0G B;  1IL8 A;  3I70 A;  4C3I G;  5IE8 A;  3S2H B;  3T1H Q;  1ZEQ X;  3NSW A;  3V05 A;  3F2B A;  1BBU A;  4L63 B;  1HFG A;  2BDO A;  1LAC A;  2KQ3 A;  1JWU D;  1N34 L;  4PZ8 A;  1HNZ Q;  4KKU A;  3GTL B;  2BH8 A;  4NMZ A;  1J9O A;  3U9S A;  3ULP A;  1RIP A;  3S14 B;  2DY8 A;  5KYL A;  3K5N A;  1K8A C;  1K3B C;  3K5O A;  2F0O A;  2F52 A;  3H0G H;  4BBR B;  3S2H H;  1CA5 A;  3I7F A;  1O7Y A;  3FKI B;  5IYC H;  3S2D B;  2NTT A;  1V1P B;  1FYC A;  1FD7 D;  3LWU A;  2R7Z G;  4K0K Q;  4V0B A;  2L55 A;  1PH8 A;  2RKS A;  3R8B A;  3QWN A;  3SXH A;  3DEO A;  1B3Q A;  5FLX c;  1JOR A;  2BA0 A;  1F9P A;  3S14 H;  2Y0S E;  1A3T A;  1AEX A;  4KHP L;  2WP8 J;  4BBR H;  2NVX H;  1NUC A;  4DAV A;  4BY7 B;  2F0N A;  1HZA A;  3UDI A;  3FKI H;  2K5V A;  3CHB D;  1TS4 A;  3PCO B;  4JI0 L;  2F4V L;  4GZY C;  4FO2 A;  3S2D H;  4JI3 Q;  3GO5 A;  3DEP A;  2Y0S G;  2JN4 A;  3L2P A;  4JI4 Q;  2ZTC A;  5K5P A;  1VMC A;  4HAE A;  2KED A;  2ZM6 Q;  4B3S Q;  4YIJ A;  3HOW B;  1S5B D;  4DR7 Q;  3W3A A;  5C0X J;  4XQJ A;  1JB3 A;  1U4P A;  2LXJ A;  3SHL A;  4CJ1 B;  1HA6 A;  3X3N A;  4QB4 A;  1EWI A;  2B8F A;  5BN5 A;  3T1H L;  4PMB A;  5K36 G;  2C5C A;  1OXU A;  4BY7 H;  4R4O A;  2UUA L;  1SNC A;  2A73 B;  5M3M B;  1Y8P B;  2ALY B;  1AZP A;  3PO3 G;  4IQZ A;  2F0W A;  1E0B A;  1MIU A;  1V1O A;  3VR6 A;  1SJH D;  1S5E D;  4QQB X;  3P1H A;  5JEA G;  3BZC A;  2E75 C;  1I3Q B;  2MUY A;  3HOW H;  1E1O A;  5FLX E;  4A3E B;  4G7H C;  1BCP C;  4DFA A;  2XTI A;  3UDG A;  1XX8 A;  3N6R A;  5JVG 3;  2Z4I A;  2OF1 A;  4JK1 C;  3FPU B;  5M3M H;  1VQL A;  1BCP F;  2FJ2 A;  3HEJ A;  1PH5 A;  3NEN A;  1EIG A;  2D62 A;  1F77 A;  1LTB D;  3TEH B;  1A8V A;  2N3S A;  3RN5 A;  4LFB Q;  1I3Q H;  4I7A A;  3V96 A;  4DK3 C;  1DON A;  2B39 A;  3PIP A;  4ZQ3 A;  4C1N I;  5KNB A;  4KI0 A;  1BQQ T;  3CCV A;  4B3R L;  5KNC A;  4DV7 Q;  2G9H D;  2A8V A;  1QZH A;  3H91 A;  1FR3 A;  3U9O A;  1EY7 A;  5FLX L;  1SR3 A;  5I2Y A;  4JYA Q;  4A3B B;  4YY3 L;  4YWL A;  3Q6S A;  1G91 A;  2ZXP A;  4NW2 A;  1H9S B;  5IGF A;  1EYA A;  4OWX B;  1DOL A;  2B2W C;  4DR4 L;  2F0E A;  2OEO A;  1HR0 Q;  4DR7 L;  5CV6 A;  1EIF A;  4B9W A;  1L0X B;  3TS0 A;  1UNS A;  3TDQ A;  1TKW B;  4RFB A;  4LFC L;  1QNK A;  3L7Z C;  4A3B H;  3AMU A;  4HID A;  4QMG A;  2JA6 B;  3Q0A A;  1XNR Q;  1VQI A;  3AB9 A;  4MTK A;  4LFA Q;  3X3M A;  5KGU A;  4LF6 Q;  5GAE C;  4ILW A;  2QA4 A;  1G29 1;  4JC0 A;  1P8L A;  2JE6 I;  3I8Z A;  1G2T A;  5JAV A;  5LMN W;  2WKD A;  5DEH A;  2E2I B;  5CV5 A;  1I4X A;  2F3I A;  1PH6 A;  4DR3 Q;  3G7L A;  4DR6 L;  3A0J A;  3TBI B;  1NJI C;  1O7I A;  2JA6 H;  2EYH A;  1TWA B;  3S9W A;  3KF8 A;  4LF4 Q;  2LSS A;  4XDX A;  4LFB L;  1KXL A;  1PTO C;  1J6Q A;  2K7V A;  2CWA A;  3BDO A;  5I4D A;  5E4W C;  2NYZ D;  4DV7 L;  5HGT A;  4RWS C;  3U4V A;  1D7Q A;  3IFT A;  3J81 j;  2E2I H;  2UUC Q;  4XYQ A;  1PTO F;  2Z8L A;  4IPH A;  4HSP A;  1A63 A;  3J81 c;  3PO2 B;  1NAP A;  4OIJ A;  4A93 G;  4DR2 Q;  2QGQ A;  3CPF A;  5BR8 Q;  1TWA H;  1UE7 A;  4HCE A;  2AQ2 B;  5CV9 A;  4DV6 Q;  4JI8 L;  1JE5 A;  5ELN A;  2HHH Q;  3VR2 A;  4A3F B;  2F0T A;  3ICE A;  3TP5 A;  2J4X A;  2OQ0 A;  4KD4 A;  4PNY A;  4RCO A;  2AWO A;  4L5S A;  2R93 B;  1SYF A;  3S24 A;  2HCC A;  1PMR A;  1SRU A;  2K1B A;  3DUZ A;  3QIA A;  5G3L F;  3PO2 H;  2PCF B;  3H3V C;  1TWC B;  1Z6H A;  1BNZ A;  1MGS A;  4UY8 C;  3I4N G;  1SLJ A;  1FJG Q;  1L2F A;  3U58 A;  1OO9 B;  1K0R A;  3J80 c;  2NN6 I;  1NR2 A;  3A7A B;  3SE0 A;  4H13 C;  4ID6 A;  4DV1 L;  4A3F H;  3M4O B;  2NBF A;  4K5V A;  4I65 A;  1K3R A;  2WKC A;  5EGT A;  4A3C G;  1B9M A;  4JBK A;  4R4I A;  3J81 E;  2R93 H;  4RHR A;  2EY5 A;  1M8A A;  4L5Q A;  2ES2 A;  1TWC H;  2BCO A;  4ZCK A;  1EY5 A;  4K5X A;  4LF4 L;  3FMC A;  4XT3 B;  1JOQ A;  3DMU A;  3RLF A;  4IOA A;  3VR4 A;  2HUG A;  2F0V A;  3BYT B;  3STB C;  1IW7 D;  3M4O H;  1WCM G;  4JI7 Q;  2UUC L;  1A2U A;  2L4N A;  4M1U B;  4C3H B;  1NBW A;  2QDB A;  4QIW E;  3VYS A;  1UE6 A;  4DR2 L;  1ASZ A;  1CQV A;  1ET9 A;  4ME3 A;  1C9O A;  5IP7 H;  4C56 C;  3PF4 A;  5JPM C;  3J81 L;  2IX3 A;  1YJN A;  4NPS A;  4RGN A;  5IYB H;  4RHS A;  3K81 C;  5IIF A;  2HDL A;  3J80 E;  1Z7T A;  1EY4 A;  4AYB G;  4ALP A;  2RDG A;  1LTR D;  4FF1 A;  1SJE D;  4X3K A;  5FLM H;  5D3D A;  1MD2 D;  2A6H D;  4NXM L;  4RH6 A;  4C3H H;  2GVA A;  4XYO A;  1PH1 A;  1DD2 A;  2DNE A;  2EVB A;  3O13 A;  1IZ6 A;  2JEA I;  4CJ2 C;  3PUY A;  4KN4 C;  1D2B A;  1V1P A;  1LTG D;  4IUR A;  1E2V A;  2KHS A;  2KHJ A;  1RF2 D;  1ENA A;  4X66 L;  1SFO B;  1X3E A;  1A6X A;  1NMF A;  3E0J A;  1YJ9 A;  1PHJ A;  3SK4 A;  2JA7 B;  2JA5 B;  2B2U C;  2CVR A;  1XNQ Q;  3JC6 6;  2CCZ A;  2UUB Q;  3L3O C;  4DR1 Q;  3J80 L;  5JJL A;  5ELC A;  4A3D G;  5M3F B;  4DUZ L;  1HUN A;  4H02 A;  1HJP A;  2B2T A;  2M9V A;  3D31 A;  3HKZ E;  2KBN A;  2KHI A;  1XPR A;  3FHW A;  1PYW D;  1EY9 A;  1SFO H;  4OX9 Q;  1AE3 A;  1XMQ Q;  1X65 A;  4O42 A;  2JA7 H;  2JA5 H;  1ESF A;  1SND A;  5IP9 H;  3HKZ G;  5C3E B;  1RKN A;  5C4J H;  4OO1 G;  1WTX A;  1TY2 A;  5M3F H;  3A8J E;  1F9Q A;  1TU2 B;  4C3J B;  1HA5 A;  4K14 A;  5D65 A;  1C7Y A;  5EAY A;  3D4W A;  3OMG A;  3CW2 C;  2N88 A;  1QOH A;  4O1N A;  4IFD H;  4G4K A;  2ID0 A;  3CCR A;  3LGJ A;  1PH3 A;  4R4T A;  1N32 Q;  4KK7 A;  4JOI A;  2Q2T A;  5DM6 3;  1Q3L A;  2NVY B;  1JJC B;  3J7A F;  1PYB A;  1WTH A;  1N33 Q;  5C3E H;  4DGZ A;  4POF A;  4AQY Q;  2JQO A;  3MFY A;  4C3J H;  5L37 A;  2A6E C;  2K03 A;  1UEA B;  2F0M A;  2WIN B;  3UDF A;  3CP0 A;  2NTS A;  1WTQ A;  4GNX B;  1STA A;  5C4X G;  1G8Z D;  3NBH B;  1MHW C;  3D8G A;  3W1B A;  5AJ3 L;  2NVY H;  2R3Z A;  4ODG A;  1XNQ L;  1VF7 A;  1Q7Y C;  2WAQ E;  3T1Y L;  2PYK A;  3PF5 A;  4KY7 A;  1BCP D;  1VCI A;  2NN6 G;  3M4P A;  1I94 Q;  4A3L G;  4J8Q A;  1LTL A;  2PNR C;  1EY6 A;  1J5E L;  1LT5 D;  4O2D A;  1T5E A;  1U4M A;  2AKW B;  1HCZ A;  3WDN A;  1H9S A;  1VQB A;  4HTH A;  1JWM D;  4QUC A;  1GUN A;  5I9P A;  3VR5 A;  4P74 A;  3GV3 A;  1N8R C;  3G48 A;  1XMQ L;  2PI2 A;  1SE8 A;  3MFG A;  1G51 A;  4IUT A;  3BVM A;  3OTO L;  2IPK D;  2YU9 B;  1PH7 A;  1N36 Q;  1EFI D;  2X6L A;  1K8O A;  2BE5 C;  3JAM i;  2EY2 A;  4BXX G;  3H15 A;  2R92 G;  3M4Q A;  1WTR A;  1X3P A;  2FFK B;  1KDA A;  1AH9 A;  1IHZ A;  1H95 A;  4A3K G;  4L5R C;  3DWQ A;  1QB5 D;  1VS0 A;  4BBS B;  3NHH A;  4CDF C;  2K28 A;  1FNU A;  1BUV T;  3GTG B;  1XMO L;  3KF8 B;  4K2K A;  1BDO A;  3CME A;  4DNT B;  2IT1 A;  3A74 A;  2YU9 H;  2IL8 A;  1RTN A;  4AQY L;  2BH2 A;  4JI2 L;  1BO0 A;  3CPW A;  2UU9 L;  3P75 A;  4AH6 A;  3OMC A;  4Q0F A;  4NKL A;  3NUC A;  2I5L X;  1AW7 A;  4B3M Q;  2R7D A;  5C44 B;  4A3J B;  3AU7 A;  3NEL A;  4BBS H;  1V8Q A;  1II3 A;  3GTG H;  3QR8 A;  1LAB A;  3LWE A;  4IFD J;  4XXE A;  4H0L C;  4JI1 Q;  5JJZ A;  4G7O C;  2D0O A;  1K9M C;  3E6Z X;  3I4M G;  2L0C A;  1TQO A;  2F0F A;  1FNW A;  3CCE A;  2ZJR A;  4I7Z C;  5GRO A;  1W6J A;  2WV6 D;  1IBL L;  3MXG A;  1VQC A;  4LF9 Q;  5J3B A;  3C46 A;  3NTK A;  1CQF A;  4A3J H;  5CV8 A;  3DM1 A;  2XRS D;  4KY5 A;  4Y7N B;  5CR3 A;  3K6O A;  4GKJ L;  3J7A V;  1TS2 A;  2AUJ D;  2C35 B;  4CKE A;  1STY A;  4LF8 Q;  1ASY A;  1HNW L;  1KL9 A;  2A74 C;  3D6C A;  3GTP B;  3C1F A;  1E22 A;  3RMH A;  3TP7 A;  2R6G A;  3SVM A;  4J1M A;  5HGQ A;  4F88 A;  5CBE E;  1O80 A;  4DU9 A;  3OWF A;  4PMC A;  2UXB Q;  1SNP A;  5J1Z A;  1IXR A;  3MZ5 A;  5IWA Q;  4LUO A;  4N9P A;  4Y7N H;  3NTI A;  1DOK A;  3OIP A;  1QCB D;  2K33 A;  5IT9 E;  4GLX A;  2NWG A;  4G57 A;  1LV9 A;  3PMF A;  4JI6 Q;  4DR5 Q;  3KFU A;  1B1Z A;  3S16 B;  3GTP H;  3PQI A;  3DXJ C;  3RLN A;  4RKB A;  4KKT A;  1ONL A;  4CKC A;  1NSN S;  2O2L D;  4X62 L;  3BZK A;  4LK1 C;  1EIH A;  1CFM A;  2VUM G;  1VQ7 A;  1KTK A;  3OOC A;  4JI1 L;  2ZXR A;  3S1N B;  1D8L A;  1HUM A;  5EBD A;  1KNE A;  1Q8K A;  2PO4 A;  4B3T Q;  5IT9 L;  2EYP A;  3S16 H;  2NVX B;  4LF9 L;  2UXD Q;  2AQ1 B;  2LFN A;  2B8G A;  4GN3 B;  1SXT A;  1LM0 A;  5EPJ A;  1ZKO A;  1PXU A;  2O5I C;  3NQI A;  4DK0 A;  2XIW A;  1GUT A;  1STG A;  5IGG A;  1I50 B;  4FF3 A;  3STB D;  4WOR A;  2IY5 B;  2MO0 A;  4L5T A;  2PZT A;  3QO2 A;  1VQP A;  3S1N H;  3PIO 3;  1JQY D;  2H1E A;  3CCM A;  5C0X G;  2CWP A;  2RF4 A;  4UDU C;  1JOO A;  2XGT A;  1MI2 A;  4WJ3 M;  4IO9 A;  1ENF A;  1HNX Q;  1PYS B;  3RLO A;  2Q8R E;  1A15 A;  2UXB L;  3S1Q H;  3FDT A;  3QOL A;  3OW2 A;  1JT8 A;  1K8M A;  1M4V A;  3K7A B;  1UE5 A;  2B2Y A;  2F1M A;  2FHT A;  4DNI A;  1I50 H;  3PUX A;  1SE4 A;  5ELO A;  3ZYY X;  4Q5V A;  1U4R A;  1PFB A;  3M7G A;  3TSS A;  1VQK A;  1EY8 A;  5ELF A;  1HTP A;  3VA5 A;  1L1O A;  1FL0 A;  2PMZ B;  3OIQ A;  4A3M G;  3Q8D A;  3E9H A;  1CK1 A;  1N9W A;  1SMY D;  2IX0 A;  1QJO A;  3HOY B;  1LTA D;  4ZYS A;  3GDE A;  3FVQ A;  1EEF D;  4YCU A;  1YHQ A;  1O78 A;  1VQO A;  3K7A H;  2HQL A;  4K6L A;  1HNZ L;  2MO1 A;  3TME A;  1JJ2 A;  2E5L Q;  4H7B A;  1X9N A;  2DJF C;  3Q24 A;  2IWH A;  4B3T L;  2OT2 A;  2K14 A;  3W1G A;  4ULL A;  2UXD L;  2KUM A;  1GO3 E;  3HOY H;  1YNN C;  3KLS A;  4K0K L;  1GUW A;  4DV0 Q;  2CW0 C;  3H0G G;  4KJO A;  4KMU C;  1Q46 A;  4RCN A;  3MXN B;  1Y8N B;  1BBW A;  3KF6 B;  2F0G A;  2Z6K C;  3KBX A;  2Q8T A;  2PZW A;  2MQH A;  4QJF A;  3ERQ A;  1I6H B;  4GNX A;  1B44 D;  1C48 A;  1PRT B;  1SEB D;  5LL6 X;  2QKI C;  4H44 C;  4Y52 H;  3TP6 A;  5IYD H;  4FNF A;  4JI3 L;  3RNU A;  3NBH A;  4JI4 L;  1ENC A;  2VZA A;  2M2L A;  1NR4 A;  1HH2 P;  2ZM6 L;  4B3S L;  4JBM A;  1EYD A;  3FKI G;  2IX1 A;  1K73 C;  1D5X C;  4RAU C;  5A2Q L;  3M3Y B;  2NUC A;  2RDF A;  5GAH C;  1DM0 B;  3W5O A;  3ER0 A;  2A6E D;  4GN5 A;  1VMP A;  1I4R A;  1PZK D;  1SYB A;  1E1T A;  1I6H H;  1AN8 A;  1YHB A;  4NB3 A;  1OTC A;  2MFI A;  4YCV A;  1VQ5 A;  1K83 B;  2X6G A;  1BF4 A;  3C3L A;  2E8G A;  2XSC A;  1BCP B;  2GVB A;  3HOV B;  2CQA A;  3D0F A;  3U4Z A;  1LYL A;  1W6K A;  3F1Z A;  3M3Y H;  1RTO A;  2AHO B;  4FVM A;  4GKK Q;  2F03 A;  2PQA B;  1PA6 A;  4UP7 A;  5M9O A;  1BR9 A;  4IUP A;  4DF7 A;  3HOW G;  3PUV A;  4OWT B;  3S15 B;  4HJ5 A;  3VDY A;  2QIL A;  1YJW A;  4HR7 B;  1BOS A;  1DCZ A;  1WCM B;  4E6I A;  3LX0 A;  3IL8 A;  1K83 H;  1U5K A;  1HQM C;  1YBY A;  1AP0 A;  4EX5 A;  2JXM B;  5M3M G;  2JA8 G;  3HOV H;  1Q86 C;  3OPO A;  5CMD A;  4UP8 A;  2NVQ B;  1KLU D;  1M1K C;  4OO1 I;  3GTM B;  4MHE A;  1B2T A;  1UAP A;  2RSO A;  1GM5 A;  4N8X 1;  1KNA A;  1IYJ B;  2RA4 A;  4R8N A;  2VQF Q;  2EYM A;  3QG1 A;  2LKV A;  1WFQ A;  4JYA L;  2TMP A;  1V1Q A;  4DPG A;  3S15 H;  4Z9C B;  4A3E G;  1FGU A;  4FYD A;  2VNU D;  1WCM H;  4X6A H;  1CZW A;  2LMC B;  2EQS A;  2VB2 X;  1OXX K;  4LWC A;  4PV1 C;  4A3I B;  3NK9 A;  1HR0 L;  5T1I A;  1ESR A;  4CDD C;  1VQA A;  1QVF A;  4MTN A;  3L9A X;  1CSP A;  4DV2 Q;  2NVQ H;  3QJY A;  3GTM H;  4ZAI A;  1S40 A;  3HKS A;  2QDL A;  1CT1 D;  4JBW A;  2OTJ A;  4EQO A;  1G6Z A;  3GTJ B;  1SE2 A;  2BOS A;  3D3R A;  2VQE Q;  2F0S A;  2M00 A;  1XNR L;  4OXP A;  4A76 A;  4J15 A;  2WB1 B;  4WRD A;  1KAB A;  4LFA L;  3H3V I;  3KYH C;  3KLR A;  1EQT A;  5JPN C;  3UE0 A;  4IAL A;  1JC7 A;  4HJ9 A;  4LF6 L;  2B2V A;  1NY4 A; 
#chains in the Genus database with same CATH homology
 5ELE A;  1V43 A;  2SOB A;  3S1M B;  3E5S A;  3MXU A;  5IGD A;  3C1E A;  2C9O A;  5KIX A;  1EY0 A;  2FMC A;  4PMW A;  5COY A;  1D1K A;  2K5Q A;  1TT2 A;  3ND9 A;  3KK7 A;  4KHV A;  1JIC A;  5EPK A;  2RDH A;  5J39 A;  1GUO A;  1CTM A;  5C3X A;  3UI2 A;  2VB3 X;  2K32 A;  2B2Y C;  4PQX A;  4KD3 A;  2EJG C;  3ITP A;  4ZKC B;  1F2M A;  1IKM A;  5IGE A;  4TSS A;  3ERO A;  3OSO A;  1DZ1 A;  4BWG B;  2BA1 A;  4U67 3;  3NTH A;  1F9S A;  3M7N A;  4K2L A;  2L12 A;  2EXZ A;  3JAM L;  4IFD I;  1X3Q A;  4KJN A;  1CZG A;  5NUC A;  3QB3 A;  1QWY A;  1B50 A;  4ZUJ A;  5EBC A;  5FO8 B;  3TN2 A;  4R8I A;  1AZQ A;  4CGY B;  3EFX D;  2KA7 A;  1FGB D;  4B08 A;  1TWG B;  3MC0 B;  1IKL A;  2R61 A;  1S5D D;  2WAQ B;  1S5C D;  3K5M A;  1GHK A;  4R9W A;  5C4J B;  2QEJ C;  4K8J A;  3EJI A;  2NN6 H;  2FIN B;  1B3A A;  1H9R A;  4B9X A;  4WFN 3;  1TVX A;  2Q8I B;  2AUK A;  3VR3 A;  4OIK A;  1SDF A;  2KCN A;  1KDB A;  2EE1 A;  1VDZ A;  1IYU A;  1EYC A;  2G9D A;  2PQE A;  4X3S A;  1TY0 A;  5E3F A;  2I46 A;  1D5M C;  4ZRZ A;  3Q22 A;  3T51 B;  2D2C C;  5T1G A;  3OWE B;  2X69 A;  3MAQ A;  5M5Y B;  3HS0 C;  4J6H A;  1ILP A;  3HOU B;  1RHP A;  3BVG A;  4RGO S;  1D1I A;  1VF5 C;  2A69 C;  4IUV A;  1SAP A;  2EDG A;  2TSS A;  3R2T A;  4C3H G;  4DXF A;  3MXN A;  1TWH B;  2NZ1 D;  1OXV A;  3BDL A;  2F0I A;  4KHZ A;  1PZJ D;  2O5J C;  1CHQ D;  1TWF B;  3RZD B;  3HZX A;  1YNN D;  1DJR D;  2A68 C;  2CW0 D;  3W2D A;  2PZU A;  2JSO A;  2KOL A;  3NQT A;  1HPC A;  2H4O A;  1A3V A;  4P2C B;  2XVS A;  1EU4 A;  1ROD A;  5C0X I;  1XWE A;  3RZO B;  1Y1V B;  3OW7 A;  2BDN A;  4HN7 A;  4LAA A;  2XN9 C;  1MSG A;  3A56 A;  3HGB A;  4EGV A;  4S3S A;  4N9T A;  4C3I B;  2AWN A;  4IFD G;  5COR A;  3TZU A;  5KND A;  1ILQ A;  3BYY B;  3MHB A;  4HED A;  2OXP A;  4FF4 A;  4V19 0;  3ONA B;  3P20 A;  4OGQ C;  3FPP A;  3RUZ A;  4KY6 A;  4C3J G;  4QCL A;  1JCK B;  5D14 A;  1STB A;  4KTA A;  3CU7 A;  3K57 A;  4KKS A;  4XQQ A;  3SDZ A;  2R7Z B;  3D6W A;  2B2W A;  1SNO A;  2K6A A;  4FF2 A;  1JWS D;  3T13 A;  5AFW A;  5CV7 A;  1PTO D;  2F0H A;  1B53 A;  5A35 A;  5M5X B;  2A5H A;  4HMI A;  2F0L A;  2E2D C;  3PV0 A;  5I6Y A;  4LMQ D;  1X32 A;  2Y0S B;  3A54 A;  3NE5 B;  1EU3 A;  1I4P A;  1SYG A;  2HCI A;  3GQB A;  3OHX C;  2F0D A;  2PW5 A;  1BBX C;  1WD0 A;  4A3M B;  3H6M A;  5BN3 A;  5G3L D;  3CRK C;  3V2T A;  3PO3 B;  1EWC A;  2F0U A;  2ENB A;  3WOE A;  3GP7 A;  3I72 A;  2EY1 A;  3GD7 A;  3HP3 A;  5CYU A;  3DWA A;  2B2T C;  1I6V C;  5K36 H;  3A8I E;  1WTV A;  2NVT B;  1RD9 D;  4EQN A;  4BS9 A;  1TII D;  1Q90 A;  4EVO A;  1LTT D;  3S1R B;  2A6H C;  1STH A;  3D4D A;  4DK1 A;  1S4Z A;  3KLS X;  1WTO A;  3R3O A;  4XTC S;  1F2Z A;  3NXW A;  5I2X A;  4NP5 A;  5JEA H;  3J7Y W;  4RA8 A;  3LNN A;  2MPM A;  3S1Q B;  1C4Q A;  1PDQ A;  1PLF A;  2KCC A;  4CKB A;  2F0K A;  4IN3 A;  2EY6 A;  3SR1 A;  1Z47 A;  2EZV A;  2XWJ B;  1GOZ A;  1DYQ A;  3NWS A;  1Q1E A;  1HQR D;  1WVL A;  2K04 A;  4ZK9 B;  2GA4 B;  1HHV A;  1R9T B;  4RKL A;  1QIL A;  2L9H A;  3BZD B;  1J8I A;  3KBG A;  2IJ0 A;  2QF7 A;  3A8K E;  4XIG S;  3SK6 A;  4TRD A;  4DXG A;  1E2Z A;  1U9R A;  1PRT C;  5LL6 S;  4MN3 A;  1PFN A;  1KLG D;  1Q8I A;  3DWP A;  1B4O A;  1QE6 A;  2JEB I;  4IZ8 A;  5CGK A;  3T16 A;  1PRT F;  4IUN A;  5C4H A;  2O4X A;  2ZXO A;  3GTK B;  3K58 A;  2ZT9 C;  2JA8 B;  4DAY A;  2DN8 A;  1LT3 D;  1Y69 U;  3CKI B;  1RCV D;  3NPP A;  5A2Q E;  2ICE C;  4KV6 A;  1NCV A;  5EPL A;  5TSS A;  3PUZ A;  4A93 B;  1TR5 A;  5I6W A;  3DHQ A;  5CBA E;  2F4I A;  5IGC A;  2B2U A;  5JEA J;  3F2U A;  3N52 A;  2Z1C A;  2F3W A;  2F0P A;  4NDX A;  5C6A A;  1IYV A;  1XXG A;  5ELD A;  1T5X D;  1JOK A;  1SE3 A;  1U4L A;  3I4N B;  3D4R A;  2A69 D;  4WJW A;  4HMJ A;  2EYO A;  5J22 A;  4F7X A;  1XTC D;  1EZ8 A;  3I90 A;  3VYR A;  1HTL D;  2HQE A;  1OXT A;  3MVV A;  3VYT A;  2RBM A;  5DM7 3;  3T4A C;  3VA7 A;  5IGB A;  2RQX A;  5EJW A;  2IW3 A;  4L6T B;  4K8I A;  1F2L A;  2XRQ D;  1QG7 A;  2A68 D;  3SK8 A;  2MJ8 A;  4BA2 I;  4TQU S;  1F2Y A;  3HOZ B;  1H9J A;  1L0Y B;  1Y1W B;  1GXD C;  1ZYR C;  3FRP B;  3H09 A;  2MP1 A;  5JOB A;  5E4X A;  4QF4 A;  1I4G A;  2QCP X;  1B9N A;  4C1N K;  1A3U A;  2BE5 D;  2EYF A;  3SEB A;  5FO9 B;  1SYC A;  1STE A;  1SYE A;  1ZXT A;  2F0J A;  1YNJ C;  3EA6 A;  2D9U A;  4EQP A;  4AYB B;  4QIW B;  2MGS A;  1STN A;  1CA6 A;  2SDF A;  1GUS A;  2EPB A;  4ZLT F;  1D5Z C;  4F8M A;  3URY A;  1LLR D;  1Y8O B;  2XNA C;  4OHJ A;  1RDP D;  2VXW A;  1HXY D;  2Z4H A;  2JP1 A;  3VYU A;  5D3I B;  4XQN A;  4RGT A;  2PPB C;  1ML0 D;  2N55 A;  2AQ3 B;  2EYL A;  5I9O A;  4A3D B;  2L11 A;  1LTS D;  5C3W A;  4K5W A;  5F2D A;  4A3G B;  2NB0 A;  1C8C A;  4G7Z C;  3SK5 A;  1O7L A;  3C2P A;  1H9K A;  1PTO B;  2XWB B;  3JAM E;  3CRL C;  1OXS C;  3HKZ B;  1LT4 D;  4CBV A;  4BA1 I;  3HRZ C;  3TP8 A;  2EJM A;  2L1B A;  4F87 A;  5CC4 A;  4X3T A;  2KEC A;  2LS0 1;  2K5D A;  3IFD A;  2D5D A;  5FOB B;  2L5T A;  1ICW A;  3MA2 B;  1PTO H;  3M4Y A;  4DA2 A;  3QOJ A;  2HDM A;  4OO1 H;  2SNM A;  1A2T A;  3GV6 A;  3P7J A;  1S5F D;  2E2J B;  3BS1 A;  1AFP A;  2MHV A;  5C4X B;  5BN4 A;  3T56 B;  1WTW A;  4FP5 D;  2RVL A;  5FK9 C;  4C2M B;  1I4H A;  3K0Y A;  3RD4 A;  1WTP A;  3HG9 A;  4BY1 B;  3G6J B;  1D6E C;  1SBB B;  4DN4 M;  4ABN A;  3I91 A;  2YYZ A;  1PZI D;  2E76 C;  1GJX A;  2E74 C;  1HFN A;  2J7Z A;  1SMY C;  2I07 B;  1DOM A;  3MXP A;  3M85 A;  2R92 B;  4XT1 B;  5ISR A;  4A3K B;  1H9M A;  1Q12 A;  3NWT A;  2E2H B;  1XYI A;  3FEW X;  3R93 A;  3KUP A;  5DNF A;  4OL7 A;  1CM9 A;  4ME5 A;  4MIU A;  2J0T D;  1EEI D;  1EOT A;  1EWH A;  1R4Q B;  1SNQ A;  5EKI A;  3EVQ A;  5KYI A;  3ND8 A;  2SEB D;  1QNU A;  5FO7 B;  1SNM A;  1O7Z A;  3WOF A;  1HRJ A;  2EJF C;  2F3V A;  1PRT D;  3MWY W;  3GTQ B;  1Q1B A;  3MTS A;  3I4M B;  1I4Q A;  4HSV A;  2EOT A;  3BDC A;  1GUG A;  4UAI A;  2V4D A;  2PW7 A;  1LO5 D;  1ET6 A;  3EQL C;  5HUR A;  2K5W A;  3NP8 A;  2DNC A;  1G2S A;  2B63 B;  4QUF A;  3T53 B;  1EZ6 A;  2K05 A;  4CJ0 B;  3H94 A;  1GHJ A;  2WAC A;  1MBY A;  3HOX B;  1LT6 D;  1TS5 A;  5CV4 A;  2ICI A;  3GTO B;  5C4Z A;  2JYO A;  1FNV A;  2WII B;  2K01 A;  4HCS A;  1KAA A;  1SYD A;  5C5L A;  1CI3 M;  5JVH 3;  3IKJ A;  3A55 A;  1JR0 D;  5EKL A;  4ZUI A;  3I73 A;  2B2V C;  2EYJ A;  4LJZ C;  5M5W B;  1SSO A;  2VUM B;  4M8A A;  5IOD A;  4IUQ A;  5FKA C;  4FXD A;  1UUP A;  3A7L A;  1PFM A;  4DAP A;  3PIP 3;  3S17 B;  1TS3 A;  1DXM A;  3MEH A;  1BXT A;  4X3U A;  3BVZ A;  2SNS A;  3I4L A;  1CHP D;  1KDC A;  1ZYR D;  3TZD A;  4CHT B;  1LTI D;  4U68 A;  3BG3 A;  5KRU A;  1MSH A;  4L8J A;  3NBI A;  1EL0 A;  1YNJ D;  5E1F A;  2DY7 A;  4FXK C;  4TKO B;  5LHY 1;  4FXG C;  4IUU A;  2CHB D;  3I3C A;  3K5L A;  1RJT A;  1EQV A;  5EQ0 A;  1E2W A;  4ZKB B;  4KN7 C;  2LY7 A;  5C0X H;  3Q23 A;  1R4P B;  3R2I A;  4RGM A;  2F0Q A;  5EKK A;  1IW7 C;  3PUW A;  2FMM A;  5C5M A;  4K6D A;  5KEE A;  1JE4 A;  1F9R A;  5IOC A;  5ELB A;  3CQZ B;  4DNR B;  2KJX A;  5DAU A;  3IAY A;  3K59 A;  1WD1 A;  2RSN A;  2KEE A;  2KVM A;  3H0G B;  1IL8 A;  3I70 A;  4C3I G;  3S2H B;  1ZEQ X;  3NSW A;  3V05 A;  4L63 B;  1HFG A;  2BDO A;  1LAC A;  2KQ3 A;  1JWU D;  4KKU A;  3GTL B;  4NMZ A;  1J9O A;  3U9S A;  3S14 B;  2DY8 A;  5KYL A;  3K5N A;  3K5O A;  2F0O A;  4BBR B;  1CA5 A;  1O7Y A;  3FKI B;  3S2D B;  2NTT A;  1V1P B;  1FYC A;  1FD7 D;  3LWU A;  4V0B A;  2L55 A;  2RKS A;  3R8B A;  3QWN A;  3SXH A;  3DEO A;  1JOR A;  2BA0 A;  1F9P A;  1A3T A;  1AEX A;  2WP8 J;  1NUC A;  4DAV A;  4BY7 B;  2F0N A;  3CHB D;  1TS4 A;  4GZY C;  4FO2 A;  3GO5 A;  3DEP A;  5K5P A;  1VMC A;  4HAE A;  2KED A;  4YIJ A;  3HOW B;  1S5B D;  3W3A A;  5C0X J;  4XQJ A;  1JB3 A;  1U4P A;  3SHL A;  4CJ1 B;  1HA6 A;  3X3N A;  4QB4 A;  2B8F A;  5BN5 A;  4PMB A;  5K36 G;  2C5C A;  1OXU A;  1SNC A;  2A73 B;  5M3M B;  1Y8P B;  1AZP A;  4IQZ A;  2F0W A;  1E0B A;  1V1O A;  3VR6 A;  1SJH D;  1S5E D;  3P1H A;  5JEA G;  2E75 C;  1I3Q B;  2MUY A;  5FLX E;  4A3E B;  4G7H C;  1BCP C;  4DFA A;  1XX8 A;  3N6R A;  5JVG 3;  2Z4I A;  2OF1 A;  4JK1 C;  3FPU B;  1BCP F;  2FJ2 A;  3HEJ A;  1EIG A;  2D62 A;  1F77 A;  1LTB D;  3V96 A;  1DON A;  2B39 A;  4ZQ3 A;  4C1N I;  5KNB A;  4KI0 A;  1BQQ T;  5KNC A;  2G9H D;  3H91 A;  1FR3 A;  3U9O A;  1EY7 A;  5FLX L;  5I2Y A;  4A3B B;  3Q6S A;  1G91 A;  2ZXP A;  4NW2 A;  1H9S B;  5IGF A;  1EYA A;  1DOL A;  2B2W C;  2F0E A;  2OEO A;  5CV6 A;  4B9W A;  1L0X B;  1UNS A;  3TDQ A;  1TKW B;  4RFB A;  1QNK A;  3L7Z C;  3AMU A;  4QMG A;  2JA6 B;  3Q0A A;  3AB9 A;  3X3M A;  5KGU A;  4ILW A;  1G29 1;  2JE6 I;  3I8Z A;  1G2T A;  5JAV A;  2WKD A;  5DEH A;  2E2I B;  5CV5 A;  1I4X A;  3G7L A;  3TBI B;  2EYH A;  1TWA B;  3S9W A;  3KF8 A;  4XDX A;  1PTO C;  2K7V A;  3BDO A;  5I4D A;  5E4W C;  2NYZ D;  5HGT A;  4RWS C;  3IFT A;  4XYQ A;  1PTO F;  2Z8L A;  4HSP A;  3PO2 B;  1NAP A;  4OIJ A;  4HCE A;  2AQ2 B;  5CV9 A;  3VR2 A;  4A3F B;  2F0T A;  3TP5 A;  2J4X A;  4KD4 A;  4PNY A;  4RCO A;  2AWO A;  2R93 B;  1SYF A;  2HCC A;  1PMR A;  2K1B A;  3DUZ A;  3QIA A;  5G3L F;  2PCF B;  3H3V C;  1TWC B;  1Z6H A;  1BNZ A;  1MGS A;  1OO9 B;  2NN6 I;  1NR2 A;  3A7A B;  3SE0 A;  4H13 C;  4ID6 A;  3M4O B;  2NBF A;  4K5V A;  4I65 A;  2WKC A;  5EGT A;  1B9M A;  3J81 E;  4RHR A;  2EY5 A;  1M8A A;  2BCO A;  1EY5 A;  4K5X A;  3FMC A;  4XT3 B;  1JOQ A;  3DMU A;  3RLF A;  3VR4 A;  2HUG A;  2F0V A;  3BYT B;  1IW7 D;  1A2U A;  2L4N A;  4M1U B;  4C3H B;  2QDB A;  3VYS A;  1CQV A;  1ET9 A;  4C56 C;  5JPM C;  3J81 L;  2IX3 A;  4RGN A;  4RHS A;  5IIF A;  2HDL A;  3J80 E;  1Z7T A;  1EY4 A;  2RDG A;  1LTR D;  4FF1 A;  1SJE D;  4X3K A;  5D3D A;  1MD2 D;  2A6H D;  4RH6 A;  4XYO A;  1DD2 A;  2DNE A;  2EVB A;  3O13 A;  2JEA I;  4CJ2 C;  3PUY A;  4KN4 C;  1D2B A;  1V1P A;  1LTG D;  4IUR A;  1E2V A;  2KHS A;  1RF2 D;  1ENA A;  1SFO B;  1A6X A;  3E0J A;  3SK4 A;  2JA7 B;  2JA5 B;  2B2U C;  2CVR A;  3L3O C;  3J80 L;  5ELC A;  1HUN A;  5M3F B;  2B2T A;  2M9V A;  3D31 A;  1PYW D;  1EY9 A;  4O42 A;  1ESF A;  1SND A;  5C3E B;  1RKN A;  4OO1 G;  1WTX A;  1TY2 A;  3A8J E;  1F9Q A;  1TU2 B;  4C3J B;  1HA5 A;  4K14 A;  5D65 A;  3D4W A;  3OMG A;  2N88 A;  1QOH A;  4O1N A;  4IFD H;  4G4K A;  2ID0 A;  4KK7 A;  5DM6 3;  1Q3L A;  2NVY B;  3J7A F;  4DGZ A;  3MFY A;  2A6E C;  2K03 A;  1UEA B;  2F0M A;  2WIN B;  2NTS A;  1WTQ A;  1STA A;  1G8Z D;  3D8G A;  4ODG A;  2R3Z A;  1VF7 A;  2PYK A;  4KY7 A;  1BCP D;  1VCI A;  2NN6 G;  4J8Q A;  2PNR C;  1EY6 A;  1LT5 D;  1T5E A;  1U4M A;  1HCZ A;  3WDN A;  1H9S A;  4HTH A;  1JWM D;  4QUC A;  1GUN A;  5I9P A;  3VR5 A;  3GV3 A;  3MFG A;  4IUT A;  3BVM A;  2IPK D;  2YU9 B;  1EFI D;  2X6L A;  1K8O A;  2BE5 C;  2EY2 A;  1WTR A;  1X3P A;  2FFK B;  1KDA A;  1IHZ A;  3DWQ A;  1QB5 D;  4BBS B;  3NHH A;  2K28 A;  1FNU A;  1BUV T;  3GTG B;  4K2K A;  1BDO A;  4DNT B;  2IT1 A;  2IL8 A;  1RTN A;  1BO0 A;  3P75 A;  3OMC A;  4Q0F A;  4NKL A;  3NUC A;  1AW7 A;  5C44 B;  4A3J B;  3AU7 A;  1V8Q A;  1II3 A;  1LAB A;  3LWE A;  4IFD J;  4XXE A;  4H0L C;  5JJZ A;  4G7O C;  3E6Z X;  2L0C A;  1TQO A;  2F0F A;  1FNW A;  4I7Z C;  1W6J A;  2WV6 D;  3MXG A;  3C46 A;  3NTK A;  1CQF A;  5CV8 A;  3DM1 A;  2XRS D;  4KY5 A;  4Y7N B;  5CR3 A;  3K6O A;  3J7A V;  1TS2 A;  2AUJ D;  4CKE A;  1STY A;  2A74 C;  3D6C A;  3GTP B;  3C1F A;  3RMH A;  3TP7 A;  2R6G A;  3SVM A;  4J1M A;  4F88 A;  5CBE E;  1O80 A;  4DU9 A;  3OWF A;  4PMC A;  1SNP A;  5J1Z A;  3MZ5 A;  4N9P A;  3NTI A;  1DOK A;  3OIP A;  1QCB D;  2K33 A;  5IT9 E;  2NWG A;  4G57 A;  1LV9 A;  3PMF A;  1B1Z A;  3S16 B;  3DXJ C;  4RKB A;  4KKT A;  1ONL A;  4CKC A;  1NSN S;  2O2L D;  4LK1 C;  1EIH A;  1CFM A;  1KTK A;  3OOC A;  2ZXR A;  3S1N B;  1HUM A;  5EBD A;  1KNE A;  2PO4 A;  5IT9 L;  2EYP A;  2NVX B;  2AQ1 B;  2LFN A;  2B8G A;  1SXT A;  5EPJ A;  1ZKO A;  1PXU A;  2O5I C;  3NQI A;  4DK0 A;  2XIW A;  1GUT A;  1STG A;  5IGG A;  1I50 B;  4FF3 A;  4WOR A;  2PZT A;  3QO2 A;  3PIO 3;  1JQY D;  2H1E A;  5C0X G;  4UDU C;  1JOO A;  1MI2 A;  1ENF A;  2Q8R E;  1A15 A;  3FDT A;  3QOL A;  1K8M A;  1M4V A;  3K7A B;  2B2Y A;  2F1M A;  2FHT A;  3PUX A;  1SE4 A;  3ZYY X;  4Q5V A;  1U4R A;  1PFB A;  3M7G A;  3TSS A;  1EY8 A;  5ELF A;  1HTP A;  3VA5 A;  2PMZ B;  3OIQ A;  1CK1 A;  1SMY D;  2IX0 A;  1QJO A;  3HOY B;  1LTA D;  4ZYS A;  3FVQ A;  1EEF D;  1O78 A;  4K6L A;  3TME A;  4H7B A;  3Q24 A;  2IWH A;  2OT2 A;  4ULL A;  2KUM A;  1YNN C;  3KLS A;  1GUW A;  2CW0 C;  4KJO A;  4KMU C;  4RCN A;  1Y8N B;  2F0G A;  3KBX A;  2Q8T A;  2PZW A;  3ERQ A;  1I6H B;  1B44 D;  1C48 A;  1PRT B;  1SEB D;  5LL6 X;  2QKI C;  4H44 C;  3TP6 A;  4FNF A;  3NBH A;  1ENC A;  2M2L A;  1NR4 A;  1EYD A;  2IX1 A;  1D5X C;  4RAU C;  5A2Q L;  3M3Y B;  2NUC A;  2RDF A;  1DM0 B;  2A6E D;  1VMP A;  1I4R A;  1PZK D;  1SYB A;  1AN8 A;  1K83 B;  2X6G A;  1BF4 A;  3C3L A;  2XSC A;  1BCP B;  3HOV B;  2CQA A;  1W6K A;  1RTO A;  4FVM A;  2F03 A;  5M9O A;  1BR9 A;  4IUP A;  4DF7 A;  3PUV A;  3S15 B;  2QIL A;  4HR7 B;  1BOS A;  1DCZ A;  1WCM B;  4E6I A;  3LX0 A;  3IL8 A;  1HQM C;  1AP0 A;  2JXM B;  3OPO A;  5CMD A;  2NVQ B;  1KLU D;  4OO1 I;  3GTM B;  4MHE A;  1B2T A;  1UAP A;  2RSO A;  1KNA A;  2RA4 A;  4R8N A;  2EYM A;  2LKV A;  3QG1 A;  2TMP A;  4Z9C B;  4FYD A;  2VNU D;  1CZW A;  2LMC B;  2VB2 X;  1OXX K;  4PV1 C;  4A3I B;  3NK9 A;  5T1I A;  1ESR A;  3L9A X;  3QJY A;  4ZAI A;  1CT1 D;  4JBW A;  4EQO A;  1G6Z A;  3GTJ B;  1SE2 A;  2BOS A;  3D3R A;  2F0S A;  2M00 A;  2WB1 B;  4WRD A;  1KAB A;  5JPN C;  3KLR A;  1EQT A;  4IAL A;  1JC7 A;  2B2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...