3X3NA

Crystal structure of eccb1 of mycobacterium tuberculosis in spacegroup p21
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
393
structure length
384
Chain Sequence
LFQGPHMGTSLFTDRATNQLYVLLSGQLHPVYNLTSARLVLGNPANPATVKSSELSKLPMGQTVGIPGAPYATPVSAGSTSIWTLCDTVARADSTSPVVQTAVIAMPLEIDASIDPLQSHEAVLVSYQGETWIVTTKGRHAIDLTDRALTSSMGIPVTARPTPISEGMFNALPDMGPWQLPPIPAAGAPNSLGLPDDLVIGSVFQIHTDKGPQYYVVLPDGIAQVNATTAAALRATQAHGLVAPPAMVPSLVVRIAERVYPSPLPDEPLKIVSRPQDPALCWSWQRSAGDQSPQSTVLSGRHLPISPSAMNMGIKQIHGTATVYLDGGKFVALSMYYIDPQGVRYGVPNAETAKSLGLSSPQNAPWEIVRLLVDGPVLSKDAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Core component EccB1 of the Mycobacterium tuberculosis type VII secretion system is a periplasmic ATPase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Protein transport
molecule keywords ESX-1 secretion system protein EccB1
total genus 67
structure length 384
sequence length 393
ec nomenclature
pdb deposition date 2015-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.900 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3x3nA01
2.40.50.910 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3x3nA04
3X3NA 4KK7A 5CYUA 5EBDA 5EBCA 3X3MA
chains in the Genus database with same CATH superfamily
2SNSA 3WWVA 1L0WA 3HEJA 2RDGA 2SNMA 2A74C 2B2UC 1YIJA 4LK1C 1YJWA 1SYDA 1ESRA 3U58A 3PO2B 1C7YA 1VQDA 3TSSA 2NVTH 1UE6A 1ENFA 5C6AA 1YNJD 3DXJC 1EYDA 4K8IA 4H02A 3J81L 2Q8TA 1SR3A 3UDIA 1RJTA 1KLGD 2JQOA 5IE8A 3RLNA 1BUVT 3OIPA 5EBDA 4DN4M 1CHPD 3D3RA 1ICWA 4DV0Q 1QUQB 4B3TL 4I7ZC 1UNSA 3O13A 5EGTA 3OWEB 4QIWE 3PF4A 2EVBA 1C0AA 3S15H 1Q81C 3VA7A 4LFBQ 1SFOH 3Q8DA 1V1PA 4E6IA 4PMBA 3QOLA 1TS5A 2OWOA 1GUWA 4P75A 4IFDJ 2F03A 1FD7D 5G3LF 4FF2A 1H9MA 4HEDA 1LACA 2FXQA 1GD7A 2OTLA 4R4CA 3VYSA 1DOLA 2NVXB 3G6JB 1BXTA 1LTAD 4Z9CB 4LFCQ 3PF5A 3KK7A 4GNXA 4A3KH 4IUUA 4B9WA 5CGKA 1PDQA 1WCMB 1KTKA 1GKHA 3R93A 5I9PA 2K14A 1HHVA 2SOBA 1CKMA 3HKZG 4KY6A 5I6WA 2PW7A 1YJ9A 2RVLA 2Y0SE 5BR8L 1ILQA 2EDGA 3E0JA 4AYBG 1LTLA 3PO3G 5DM63 3M85A 1B2TA 1QE6A 1HRJA 2NB0A 2KENA 3PGZA 5DEHA 2DJGC 2A73B 3TP8A 4O42A 1KRTA 4B08A 4XQQA 3P7JA 1E3PA 1S72A 2KUMA 4IPDA 2BE5C 2A6HD 1O7IA 2F0UA 4KLKA 4A3KG 4JI6L 1JOOA 5JOBA 1HNZQ 3HOYG 4CDEC 3S2HB 1WI5A 2HCIA 3X3NA 2EYLA 1XPRA 5CR3A 2CQAA 4RGTA 2VUMG 4B3ML 2VUMH 4OEMB 1XX8A 1NE3A 1N36L 4Q0FA 3ICEA 2LFNA 3RMHA 5LMNW 2A5HA 2HDLA 2I46A 4DR6L 1JQYD 1TWGH 1SAPA 5FLXc 3D6WA 1YHAA 1PYWD 4DAYA 4A3EH 2JA8G 4A3BH 1JWSD 2E2DC 3Q22A 4H44C 1U9RA 5M3MB 2E5LL 3LX0A 3I90A 1SJED 1XNRL 4QMGA 1SE4A 3I4LA 2Q2IA 2UXCL 3F8TA 4CDDC 1Q82C 4DK0A 5EJWA 3STBD 3A55A 4HIKA 2VQEL 4MIUA 4F88A 3I4MH 3PO3B 1DJRD 4B3TQ 2F0HA 4PV1C 1VQ7A 2Y0SG 4N8FA 4DUZQ 4TVAB 1QOHA 2O4XA 1O7YA 2K5VA 1I3QH 4C3IB 1I4RA 2EYOA 3PIPA 1HA5A 1UE1A 5GQOA 5AJ3L 2F0TA 2RQXA 3ER0A 3R8BA 1VQEA 2MPMA 3HOZG 1V1PB 3MC0B 3HS0C 5FO8B 1JC7A 1EIHA 2PI2A 1BF4A 4NKLA 2VXWA 1C48A 3RNUA 3V05A 2K6AA 4C3IH 1I4XA 3CCUA 2F4IA 4A76A 1T9HA 2WKDA 3HOWG 4Y52H 2IX0A 3I8ZA 3ULJA 2E75C 3NXWA 1YJNA 4B9XA 2EJFC 5I2XA 4G7OC 2K75A 2A1AA 2CW0C 1JORA 4DR2L 5BN3A 3A56A 2B3GA 3I72A 4FF4A 1NMGA 3G71A 2PQAB 2PZUA 1E1TA 1D5XC 2BCOA 1SSOA 2B2TC 4L5QA 3G4SA 3TDQA 2EOTA 1B44D 5I6YA 3I3CA 4PNYA 1WTXA 2UUBL 3L7ZC 2EY2A 5EQ0A 1QJOA 5I4DA 3HP3A 4XT3B 1JMCA 1ET9A 1LT6D 2Z6BA 3VYRA 3CC2A 2H5XA 2ZT9C 4V190 1EYCA 1SMYC 3OWFA 1GO3E 2DJFC 5A2QL 1V9PA 4GN3B 5GAEC 2VQFL 5M9OA 4L6TB 3CC7A 2R92G 1AH9A 3LWEA 4LNQA 5IIFA 4DF7A 1AFPA 2LY7A 3LGJA 2TMPA 2L11A 5K5PA 1EU4A 4CKCA 2OQ0A 4LFBL 1D5ZC 3J7AV 1FJGQ 2K50A 3HOXG 5KEEA 3HOVH 1CZGA 3NP8A 3BZCA 4FXKC 1BCPD 3S1QB 2JA8H 5C3XA 4J15A 3S16H 3TBIB 2R7ZG 5IGEA 2HDMA 2RHQB 2EYPA 2YTYA 1K8MA 1DM0B 3NSWA 5IOCA 1SROA 4DUYQ 5FJ8G 3SR1A 1QILA 2K5QA 2B2TA 3W5OA 1R9TB 1S5CD 3BDLA 3MXNB 4XIGS 4IN3A 1JOQA 1XWEA 5DAUA 3BVMA 3DLLA 3D6CA 2A69C 3C1FA 2CW0D 1QWYA 2WB1B 2GVAA 4RG1A 1W6JA 3ZJYC 4NXMQ 1PH6A 3J7AF 2D2CC 4YY3L 1S5ED 2HUGA 3K81C 3A8KE 5C0XI 4CHTB 3E5SA 3DEOA 4YHHL 2OXPA 3GTGH 4QY7A 2KHSA 5FO7B 1N32Q 2KCMA 1SNDA 1HA6A 3QWNA 4GKJQ 5IYCH 1TWCH 2NZHA 1IXRA 4LJZC 4EQOA 5I2YA 1CK1A 2X6GA 3RR5A 2BA0A 3EJIA 4J8QA 5E1FA 3NUCA 1EQVA 2Z6KA 1X3EA 4IUNA 1MGSA 4IURA 2GN5A 2QDBA 4KY7A 4ZK9B 4JV5L 3NEMA 4MTKA 3VR3A 1X56A 1VQHA 4R4TA 5D14A 4BWGB 3H15A 2PPBC 4A3GH 3PUYA 3S14H 5T1GA 5H1SE 4JI3L 1KIXA 3FDTA 4K5VA 2AKWB 3P1HA 1X32A 5C5LA 2WKCA 1JICA 5CV9A 5E4WC 1PH7A 1BQQT 3H09A 4EVOA 4N9PA 4DV6L 1F2LA 1RCVD 3BZKA 3U4ZA 3UI2A 4RMFA 1X3GA 4IZ8A 2B2WC 4B3SQ 1TVXA 2BOSA 4X66L 3A8IE 5D3DA 1KLUD 5M5YH 1KNAA 3BVGA 3CC4A 4BXXG 4LF5Q 4XQJA 2I0QA 2HHHL 1EYAA 3GQBA 4YCWA 2CH4W 2MHVA 2K04A 1HNZL 4DR4L 5NUCA 3AEVA 3JC66 1H9RA 2KOLA 3W1GA 4YWKA 4ZKCB 3H94A 4GNXB 2F3WA 4DV2Q 4R8IA 2VQEQ 2K33A 5ISRA 3S17H 1PTOB 3HOVB 3RLFA 5KIXA 4RFBA 3S2HH 4EQ5A 3QOJA 1CSQA 4O0AA 3OOCA 4APVA 1GUSA 4KN4C 1GXDC 3J81c 2XWBB 1O7ZA 3PMFA 3S16B 4A3FG 3S15B 1MD2D 3T1HL 5LMNL 1HUNA 3IRBA 4BA1I 2K5DA 4X66Q 1IW7D 2WV6D 3I4MG 3T56B 1G6ZA 1HNWL 1CTMA 2FMCA 4UAIA 4QGUA 4LUZA 4ODGA 4DPGA 4ALPA 1F2YA 2JEBI 2PZTA 1JWMD 1GUTA 1H9SA 4OX9L 4KD3A 1I6HB 1EY8A 4LFCL 3J81E 5IWAL 3RZDH 1H95A 3ITPA 1YVCA 1F9QA 1Y8OB 3OTOQ 1MIUA 5HGQA 2E76C 2NN6G 4UPAA 1PH4A 2L15A 2KVMA 4DV3L 3WOFA 5KNBA 5LL6X 1EIFA 2JA7G 4XTCS 2K05A 3ND9A 3EQLC 2XVSA 1EZ8A 5BR8Q 1CM9A 4WJ4A 1IW7C 5J1ZA 1XNQQ 4I7AA 1Q8IA 4X3UA 4A3DH 1IKLA 3C1EA 5M3MG 4C3JB 5EKKA 4CDFC 3GTOB 2B63B 5CC4A 1J6QA 4FNFA 1DYQA 4DFAA 4JI5Q 1JJ2A 3MA2B 1Q46A 5EKLA 4PMCA 4LAAA 1OXUA 1CQVA 3S1NB 4L63B 1SLJA 2QCPX 1R9TH 2JA8B 1Z47A 1EU3A 1KL9A 3J80E 3A8JE 4HCEA 1LV9A 2F3VA 3I7FA 2JSOA 3WDNA 5AFWA 4YWMA 3CW2C 5C0XH 4JCVE 3F2DA 3JAML 1B50A 2OQKA 3SDZA 2R93B 2E2IB 5F2DA 2PNHA 3C46A 4IUPA 4RWSC 4BBSB 1A3UA 1SNOA 5I9OA 4CGYB 3B6YA 1Y1WH 1EQRA 4LW1A 1TWGB 2K5HA 4N9TA 1VQMA 1IBLQ 2K4KA 1D1KA 1A15A 1L2FA 4LF4Q 4NXML 3EBEA 2RF4A 2E2IH 1BBXC 2K03A 1ICFB 1RIPA 1IYUA 2EYFA 5GAGC 5IY0A 2I5LX 4FYDA 4NB3A 1WCMH 3NENA 3L3OC 4JI0Q 4KK7A 4LF7Q 4DV0L 3GDEA 4A3JG 1U4PA 1EFWA 4LF6L 4R4IA 4C3JG 4C1NK 2XRQD 4GOPB 3A54A 2RCFA 1WTPA 3GV3A 4DV1L 2KHIA 4DK6C 1DXMA 2R93G 1MHWC 1RD9D 1HNWQ 3M3YB 5C5MA 2L1BA 5FLXL 2BDNA 3FVQA 3ZYYX 4JOIC 1H9JA 4AYBE 1XYIA 5COYA 5G3LD 1FR3A 3UE0A 1RHPA 2Z9HA 2AQ2B 5LL6S 3TZDA 1VQKA 5IP9G 3HZXA 2HIVA 1PYBA 3PIO3 2EIFA 5ELNA 1L0XB 3M4QA 3S1MB 4AH6A 4DR1Q 5C44H 3A0JA 3NPPA 5IT9L 3PCOB 2LMCB 2A69D 4DV6Q 3R3OA 4LWCA 1NR2A 3MXPA 1K8GA 1TY0A 1KRSA 3FKIG 4DR2Q 2R92B 1VQPA 2F1MA 2EY5A 4KHPL 1AE3A 5M5YB 5FK9C 2EYMA 4C3HG 1T5EA 1G2SA 2K01A 3DMUA 2K5NA 1LTTD 2TSSA 3S1MH 4OGQC 1HZBA 2CQOA 2Q2HA 4OXPA 1NMFA 4PZ7A 4JI2Q 2EJGC 3SVMA 2EJMA 3H0GG 1U5KA 2E2HH 1A2TA 1M4VA 2MP1A 1VQ5A 3OHXC 2L5TA 3PO2G 1WTQA 5K36H 1N34L 3Q23A 3S1NH 3CCEA 3MZ5A 2R7ZB 4IJHA 2VZAA 5C44G 1F2ZA 1LTID 4FXGC 4JI7L 1U4MA 2WB1G 4R1JA 5EPLA 3S14B 3M4YA 2IX3A 1EFID 3LNNA 4A3FB 1B7YB 4C3IG 5EPKA 4EGVA 1QVGA 1EOTA 3HG9A 1UUPA 3BVZA 5IT9c 1IBLL 1NSNS 3SE0A 5M5XB 4A3MH 1E2VA 4KI0A 5JPMC 1FGBD 5IGFA 2NTTA 4N8X1 2NVYB 3G6EA 3HOUH 3TP5A 1HH2P 3K57A 2XSCA 3KF8B 1PA6A 1D7QA 3L0OA 1LO5D 4BBRB 1ML0D 3TP6A 1ENAA 2DUDA 3GP7A 3S9WA 1SBBB 4JYAQ 1SJHD 1S5FD 3ONAB 5EBCA 2VQFQ 1JOKA 3I4OA 1NY4A 4DNTB 3J81i 3I4NH 3R2IA 4G7ZC 2R6GA 4KD4A 3CP0A 1RTNA 1V43A 1STHA 2MUYA 3D4DA 3NK9A 4ME5A 4NDXA 1CFMA 4JPBW 3ULLA 4FXDA 3HKZB 2R7FA 3A74A 4M8AA 4X3KA 3CCRA 1MJEA 4C3JH 4P72A 1VCIA 2OT2A 2NVQB 1EL0A 4JBWA 3OW2A 2ZXRA 3NTHA 4FF1A 3CU7A 1GVPA 1MKHA 1DONA 2CKZB 1HZAA 1PH5A 3FEWX 1YHQA 1T5XD 4A3KB 5JJZA 4S3SA 1NUCA 4P71A 3FRPB 5J3BA 4R9WA 1E2WA 1C8CA 3MHBA 2F52A 1HNXL 4U673 3K58A 4C56C 3GTJB 2IL8A 3S24A 5M5WH 3OIQA 4OWTB 2QILA 2WP8J 4BBSG 4WJ3M 2P5ZX 2EZVA 3N52A 1K8OA 3U50C 2LXKA 3FHWA 5FLMG 3F2BA 1W3SA 2VB2X 1OXSC 3CF5A 3LWUA 1LUZA 1QNKA 2F0KA 2N49A 3KYHC 4C3HH 2SDFA 2H4OA 3CRKC 3OTOL 1XMOQ 2XIWA 3J80c 3HOXH 3HOVG 2ZXOA 1SE2A 2N88A 3RZDB 5CV8A 2YU9H 2B2YA 2KEDA 1SYFA 2MGSA 4H7BA 4A3DB 4B3RL 3UDFA 1P8LA 4QQBX 3FP9A 1VQ8A 1VF5C 2B29A 3EFXD 4XT1B 2QDLA 3MEHA 5IGCA 1IYJB 2ZTCA 1SDFA 2UUCQ 3NQTA 3P20A 1TXYA 3UDXA 1KD1C 2A68C 3K5NA 2UXBQ 1STAA 2YTVA 3CPFA 3M4OB 1JE5A 4ZLTF 1YNXA 3OMGA 1G8ZD 1I94Q 1FL0A 5M5XH 1L1OC 4DV5Q 2D5DA 3SK5A 1BCPF 2NN6I 1VQIA 3J7ZC 4H13C 5JEAJ 2JA7B 4MZ9A 1HR0L 4KN7C 3DM3A 4GLAC 5JVH3 4JOIA 1VQOA 1NCVA 3URYA 3RZOB 1RL2A 4KY5A 4ME3A 5JAVA 2MO0A 1WCMG 3FPPA 1PH9A 3G48A 5C4JB 3DWAA 3M4PA 4RCNA 4DXFA 3HOYH 4MNOA 4HSPA 1WVLA 3SK8A 4YY3Q 1LTBD 2EY6A 2B63G 3KJPA 1PFMA 4HIMA 2XGTA 4YHHQ 1F9RA 4O1NA 1LABA 1RODA 1EUJA 1TKWB 4X64Q 3K80C 3M7GA 1N34Q 4JI2L 2VW9A 4FO2A 4IO9A 4K0KQ 1NR4A 5ELCA 3VR2A 3NBIA 4XQNA 1EWCA 4DUZL 3S1RB 2X6LA 2UXDQ 1JB7A 2RDFA 1Q1EA 3H6MA 3OMCA 4KTAA 1BCPC 1X54A 4PMWA 1XXGA 3K59A 2A19A 2MJ8A 2D0PA 2XTIA 4KHPQ 4A3CH 1PTOH 3H3VI 1AW7A 3J80L 2OCEA 4KHVA 1HTPA 2A6HC 5FLMH 1TY2A 5JEAG 1QZHA 3T13A 1XNRQ 3AYHB 4NP5A 4A3BB 4B3MQ 4A75A 4JI4L 3I70A 5GAHC 3M9BA 3E3XA 3QO2A 4UHVA 2QGQA 1YI2A 1K73C 1Q1BA 2ICIA 5TSSA 1PTOC 4I65A 1IYVA 3E0EA 1A3VA 1CHQD 2F0DA 3PIOA 1Q86C 2F0OA 5CYUA 4BBSH 1LM0A 2JN4A 4A3JB 3W1BA 3U9SA 4ULLA 3AFQA 1SYBA 4DA2A 1OO9B 3GTLH 1QVFA 3BG3A 5JEAH 5J22A 2B39A 4BXXH 4F7XA 1PRTC 2QEXA 3T16A 2EXZA 2WFWA 1SXTA 3CMEA 1W2BA 3MWYW 1STYA 3BYTB 2EQSA 1TWAB 2VL6A 4OHJA 4CJ0B 4ILWA 1NNXA 1GJXA 1IKMA 2AMCB 3EN2A 4R8NA 3GTMH 2AWOA 2XN9C 5E3FA 1B53A 1A2UA 4A3MB 5J39A 3PQIA 4M1UB 4IUTA 3NWSA 3GTPH 1KXLA 4GLVB 1PRTB 5LMNQ 5KGUA 1GOZA 3U4VA 4IFDH 2L55A 5M3FG 1Y1VH 5KNDA 3H0GB 2KCCA 4AIMA 1QCBD 2F0NA 3FKIB 1VQ6A 2DGYA 2AQ1B 4ZKBB 1F9PA 4JI6Q 2UUAQ 2F0FA 3EA6A 1X9NA 1D6EC 2Z6KC 3PUVA 3PV0A 2O5JC 1RDPD 5IGDA 4DR7L 4RKBA 4DV2L 3AB9A 3NE5B 4GN5A 4LF7L 3GTPB 2WIIB 2ENBA 2PQAA 4BBRH 1Z9FA 2QEJC 2EXDA 2R92H 1XMQL 3SXHA 1N9WA 2LKVA 2F0SA 2RSNA 1A62A 1PRTF 3DEPA 3PSIA 2PZWA 2Q8RE 1C4QA 1TQOA 1UE7A 3MEFA 2UXDL 2N8NA 2JP1A 3M4OH 1UEBA 1WOCA 4IALA 3DUZA 2AHOB 3D31A 4IUQA 4XYOA 3KLSX 2E74C 3C3LA 1HXYD 1O78A 2XRSD 3NTIA 1AN8A 4GNXC 1BKBA 1ZEQX 3DWQA 3IKJA 1EY6A 1KHIA 4LFAL 4HIOA 1SFOB 2NZOA 3EROA 1WD1A 1DCZA 3KLSA 4DK3C 2Q2TA 3QJYA 1VQCA 1Q8KA 3QG1A 1NJIC 4KKSA 4A3CG 2F0WA 5FKAC 1EWHA 1JB3A 2WAQE 1I94L 1BR9A 2R61A 4RA8A 1VQNA 2JA5G 4A3GB 3TEHB 1XPOA 3CQZB 2RHSB 1N33L 4TQUS 4BY1B 4ZQ3A 2ID0A 3X3MA 4X6AH 2BH2A 3J81j 4DNIA 1JWUD 2ZJQA 2C9OA 1WD0A 1EY4A 4A3LG 4JV5Q 2Z1CA 3FPUB 3OPOA 1PFSA 2ZTEA 3T1YQ 4AQYL 2N55A 3CCSA 1GUOA 5K36G 4JI8Q 1I4HA 3K7AH 3VR6A 3HOXB 4JBMA 3I55A 4RH6A 2AUKA 5HY6A 3D4WA 5C4ZA 4XYQA 1KDAA 2DY7A 2IPKD 4DV7Q 4DUYL 3S1RH 4TRDA 1OTCA 4ZUJA 1IHZA 4NMZA 2JA6G 5BN4A 2Z4IA 4ZCKA 1K83B 4JI7Q 2E2JB 4XXEA 3A5UA 4X64L 4RGOS 1N36Q 3GTKB 4X62Q 1FNVA 1U4LA 1K9MC 3K7AB 1YNNC 5ELDA 3F2CA 4DAMA 2PQEA 3I4NB 4GZYC 4LF9Q 1QUQA 2L12A 2NVTB 4C1NI 3K6OA 3K5OA 1TWAH 1RTOA 4KKTA 4HTHA 3AQQA 2IX1A 1DZ1A 2MO1A 1O7LA 4KJOA 3VR4A 2QKIC 4AQYQ 4RGNA 5CORA 1N32L 3CXCA 3NWTA 1MI2A 2E8GA 2ATWA 3TMEA 1B70B 4A93H 2F0MA 4K2LA 4A93G 5KNCA 1U0LA 4ID6A 1SNCA 3G7LA 5ELOA 3QB3A 3CCLA 2DNEA 1EIYB 2LSSA 2MFIA 3A7LA 5C4XH 2IT1A 5ELBA 2ZM6Q 4A3EB 2ZJRA 3RZOH 4A3JH 2JA9A 1E22A 1XPUA 4JI0L 3IFDA 3I91A 1IL8A 5C4JH 3WOEA 1L1OB 1HNXQ 5ELEA 1S4ZA 3IAYA 1HZ9A 1X65A 4JVZA 5FJ8H 2ZJPA 1PHJA 2NVXH 4G7HC 2JJQA 2N3SA 3PUWA 3RN5A 3ERQA 1MBYA 2NWGA 3H91A 5IYCG 4X3TA 1M90C 2CWAA 3F2UA 2D62A 1FNUA 1EZ6A 1YNJC 3HOWH 1CT1D 3HOYB 2BA1A 2L4NA 2J4XA 1IBKQ 4IPHA 1YZ6A 2KHJA 5FOBB 2B2VA 5DM73 5BN5A 4GOPC 1D1IA 1CA6A 3BS1A 4HAEA 3SGIA 2I07B 4J1MA 1Q7YC 4BY7B 5E7NA 5DLQE 4R4QA 1A3TA 2KEEA 1BBWA 2XWJB 4POFA 2GA4B 4WRDA 1TWCB 3E9IA 3CAMA 3UDGA 4BY1H 2K1BA 4GN4B 2JXMB 2V1CC 2VS1A 2NN6H 1KNEA 1IBMQ 2WAQB 4JI1Q 1W6KA 1QVCA 5M5WB 3KFUA 3TS0A 4QIWB 3HOZH 4PZ6A 3TN2A 4DAVA 1N8RC 1STBA 2DY8A 1JJGA 4CKBA 2Q2UA 3T4AC 2CWPA 3NELA 2A68D 1QNUA 1JR0D 1VQBA 4G4KA 1YEZA 4Y7NH 1GHJA 3GTJH 4JG2A 2NYZD 3KDFA 3BJUA 2OTJA 4A3LH 3HKSA 5C3EH 1S5DD 2F0LA 5JJLA 3T1HQ 2F0PA 3IL8A 2E2JH 1PFNA 3KJOA 4QL5A 3MAQA 3PIP3 2K32A 3H3VC 1TS4A 2KCNA 1HFGA 1YITA 5IP7H 1OXXK 3ND8A 4DR5L 1EY0A 4QUCA 4A3GG 1LT5D 1IBML 2ZXPA 4A3BG 1CKNA 3TZUA 3GTMB 3QIAA 2XNAC 3CMAA 1BDOA 2FMMA 3RUZA 1X3FA 1IL2A 4LF8Q 4L8JA 4IQZA 1N33Q 3HRZC 1VQ4A 2J7ZA 3J7YW 1PTOF 3V2TA 1Y1VB 4ZRZA 1UAPA 2K7VA 2B2YC 4UP7A 3KBGA 3L9AX 1ZYRD 4B3SL 2M9VA 4DAYB 1TS2A 1SN8A 4HN7A 4TKOB 4LF5L 4HR7B 1E24A 5IP7G 4QCLA 2HHHQ 2PI2E 2F4VQ 4R4OA 2E5LQ 1J8IA 4PZ8A 4DR3Q 1LT4D 1O80A 3E9HA 3RD4A 4F87A 3A7AB 5C44B 3F1ZA 1EIGA 2SEBD 2D9UA 1GUNA 1VS0A 3I4NG 1LTRD 2A8VA 4JI4Q 2F0IA 5DNFA 5L37A 4K6LA 1PZKD 1NTGA 3V96A 3KLWA 1JT8A 1HCZA 1G51A 1CKOA 4MHEA 2QA4A 4GS3A 1B9MA 4HJ7A 1F77A 1SMYD 4B3RQ 2F0VA 2R7ZH 4UP8A 3GTKH 5C3WA 1L0YB 2KCTA 5JJIA 1P16A 1STGA 3I56A 3HOUG 5JJKA 2F0GA 2H1EA 3HGBA 1K28A 4X65Q 1HPCA 1B9NA 2QF7A 2WB1E 3NBHB 2F4VL 4JI3Q 1RKNA 1PXUA 1J5EQ 4RHRA 4DV7L 1CI3M 3VYUA 5CV7A 1TT2A 1Y1VG 4OWXB 5JPNC 2Z8LA 3JAME 2EE1A 1V1QA 2D0OA 4IPCA 2HCCA 2CH4A 4QB4A 1SMXA 3MXGA 4GOPA 3Q6SA 3S17B 1Y8PB 1HFNA 3EIVA 2B63H 1I50B 1KQSA 1SNQA 3RLOA 3A5ZB 4K6DA 2MNAA 4LF9L 2RCNA 1B4OA 2HD3A 4HSVA 4K5WA 4KMUC 1V8QA 4QJFA 1VQAA 4MN3A 1I4GA 1KDBA 1F2MA 3T1YL 1YBYA 3D0FA 1I6VC 4HJAA 1FJGL 4RGMA 2ICEC 4HJ5A 1HTLD 2JK8A 3OYYA 1NAPA 3CHBD 3U9OA 2K52A 4JI5L 2Y0SB 2Z0SA 5FLXE 3H0GH 2EPBA 1KABA 2B8FA 3I73A 1C9OA 2EY1A 1I4PA 2PMZB 1MSGA 1B3AA 4OIKA 3K7UC 4IPGA 3GV6A 4FP5D 1QG7A 1DGSA 4DR1L 4IOCA 1BBUA 1YHBA 5GADC 2V4DA 3TREA 3BDOA 1YNND 1EY5A 1PH8A 3KUPA 5IT9E 2E2HB 1VQJA 4YIJA 1AP0A 4IUVA 4EX5A 2VNUD 1S3OA 3T53B 3UE1A 3NQIA 5C3EG 1ASYA 1E1OA 3DWPA 3K0XA 3STBC 2JA5H 1PVOA 4JC0A 3GTQB 1TWHB 2I5MX 1STNA 5IGBA 1EY9A 1Z6HA 5CV4A 2C35B 3PUXA 1K8AC 4K14A 4DV4L 5CV6A 2ZTDA 4YWLA 4AYBB 1DD2A 3SHLA 3RN2A 1PMRA 4A3IH 4JBJA 2J0TD 3VR5A 1AZQA 5D65A 3W3AA 4DV5L 2B2WA 3IFTA 5C4HA 2IJ0A 1B1ZA 1H9KA 1XMQQ 5HURA 3TRZA 3HFZB 4QUFA 4DV3Q 1E7ZA 1X6OA 3I2ZA 1IZ6A 4JYAL 4P2CB 2EYHA 2CHBD 2YTXA 4NXNL 2B8GA 1PV4A 2NBFA 4YCVA 5D3IB 1M1KC 3GO5A 1ILPA 4HIDA 5C4XG 1A0IA 1PZJD 4BBRG 4OO1H 4WFN3 4CJ1B 2O5IC 2BE5D 1Y1WB 2AQ3B 1VQLA 3CCJA 1S5BD 3S2DB 2RKSA 1D2BA 1SE3A 3MFGA 1XJVA 2KA7A 3QR8A 5EAYA 1CSPA 1MSHA 4RAUC 3JAMi 5M3FH 3GTOH 4RKLA 4K0KL 2HQLA 1BVSA 1SYGA 1HUMA 5T1IA 4OELB 1XTCD 1PZID 4OIJA 5KYLA 5IYBG 4K8JA 4A3EG 1PYSB 3Q24A 1Y69U 4G57A 3P75A 2IW3A 2JEAI 2O2LD 1K3RA 3ULPA 4U68A 1LYLA 1TU2B 1I50H 4RHSA 1ET6A 1Q12A 2GVBA 4GKKQ 4ABNA 1HZCA 3ERSX 1EYGA 4A4IA 1DOMA 2RSOA 2F0EA 5KYIA 5IYDH 2R93H 3CCMA 2NZ1D 3K8AA 2PW5A 4DR5Q 4ZUIA 1II3A 1XTDA 3CQZH 1SYEA 2PCFB 3E6ZX 2NUCA 3BZDB 3I4MB 4DGZA 1STEA 1CUKA 1WYDA 3CRLC 1GM5A 1EOVA 3AMUA 5EKIA 4X62L 1E0BA 1Y1WG 4FF3A 3OSOA 5GROA 1OXTA 1I3QB 3TQYA 1SEBD 3CCVA 2F3IA 1FYCA 1KAWA 2BH8A 4O2DA 5LMUQ 3K0YA 4EQPA 3KOJA 1WTVA 1ASZA 3SEBA 2FHTA 2K5WA 5FO9B 3OW7A 5C0XG 4OO1I 1PRTD 3NBHA 4PG3A 1WTRA 3VA5A 2WAQG 3MFYA 2PMZE 1TWFB 1U4RA 4NPSA 1I6HH 4KKUA 2G9HD 4IJLA 3SK4A 2JA5B 1CA5A 1MJCA 1ONLA 3KLRA 4X65L 2FINB 1WTHA 4L5RC 1VF7A 1L1OA 4K5XA 4BY1G 1G291 4ZAIA 2IWHA 3TS2A 1VQGA 2UU9L 1LTSD 1PH2A 5LHY1 1Z7TA 2JA6B 2DNCA 4GLXA 2HT1A 2QW7A 2C5CA 2PYKA 1E2ZA 1WJJA 1M8AA 2NVQH 1KAAA 3TP7A 4PQXA 1UE5A 4DAPA 3R2TA 4CJ2C 2UXBL 1H9SB 2HQEA 2PO4A 4JBKA 2UUCL 4Q5VA 3VDYA 1KC8C 1RF2D 2L0CA 5M3MH 4DR3L 4QF4A 1FGUA 4LMQD 2AUJD 2F0QA 1I5FA 1VMCA 2B2UA 4DXGA 4A93B 1PH1A 4LUVA 1CKNB 4L5TA 3N6RA 5A2QE 1VMPA 4GKJL 1HR0Q 3PO3H 5C3EB 1G91A 2M00A 4FDBA 1X3PA 4UP9A 1D5MC 4YCUA 2YV5A 5C0XJ 2VB3X 3CD6A 4BA2I 1UWVA 1TIID 1XNQL 1X3QA 3C2PA 4HMIA 1BO0A 4UDUC 4Y7NB 4A3IB 1ESFA 5IP9H 4CKEA 1Q3LA 1ENCA 1R4QB 1SYCA 3SK6A 3BDCA 2M2LA 1D8LA 1FNWA 1V1OA 4X3SA 1A6XA 1LLRD 4IFDI 4JI8L 4JI1L 2CVRA 4WJWA 3PO2H 1J9OA 2EYJA 1BOSA 4BY7H 4A3FH 3FKIH 3Q0AA 4MTNA 3DHQA 3MXUA 3M7NA 4DR4Q 2NTSA 1S40A 4HMJA 3VYTA 5HGTA 2OF1A 2AWNA 2PNRC 2ZM6L 1Y8NB 4C2MH 1CZWA 1X55A 2NVYH 3HKZE 2CCZA 2VY3A 3KBXA 4H0LC 3K5LA 2B2VC 2LS01 1VDZA 2K28A 1ZYRC 3J80i 1GUGA 2LXJA 2MQHA 1F9SA 1HJPA 2ALYB 4KV6A 3MVVA 4HCSA 1TR5A 1K0RA 1B3QA 3PUZA 3HOZB 1EEFD 1DOKA 4C3HB 3HOUB 3EVQA 1QB5D 1K3BC 3GTGB 4TSSA 3D4RA 4BY7G 1EWIA 1G6PA 4DU9A 2KQ3A 2IHEA 5ELFA 3K5MA 1PH3A 4OX9Q 2UXCQ 1JJCB 1KDCA 1IBKL 3J7A5 1GHKA 4BS9A 4J6HA 1CQFA 3H3VH 4A3IG 4NXNQ 2YU9B 4KJNA 4L5SA 1ZXTA 4XDXA 5KRUA 2L9HA 5IGGA 1AZPA 1PLFA 2G9DA 2Q8IB 3FMCA 2KBNA 2YYZA 5CV5A 3BYYB 1EEID 1HQRD 1G2TA 5IODA 4DR6Q 2JA6H 2WINB 5E4XA 5EPJA 5AJ3Q 1QZGA 3MTSA 3GTQH 4F8MA 1WTOA 5CBAE 5CMDA 2X69A 4UY8C 3CPWA 1A63A 4OONA 3BU2A 3NHHA 5IWAQ 4A3MG 2KECA 4LUOA 1ZKOA 4OO1G 1AEXA 4DNRB 3M3YH 3AU7A 4DR7Q 2OEOA 2KJXA 4EQNA 3NTKA 1WFQA 3S1QH 3DM1A 2HIXA 2JYOA 1VQFA 2WACA 1K83H 2JA7H 4NW2A 1TWFH 2CFMA 2R7DA 3S2DH 4DKAC 3CKIB 1HR0W 2VUMB 1HQMC 5A35A 4V0BA 1EY7A 4JK1C 5LMUL 1Y14B 1SNMA 4K2KA 4HJ9A 5M3FB 1SNPA 2UUAL 4POGA 1J5EL 1OXVA 1R4PB 1LTGD 2ASBA 4LFAQ 4P74A 1FVIA 2N78A 3JAMc 1BCPB 3D8GA 3GTLB 3GD7A 1PFBA 4LF4L 1EQQA 1Q90A 1A8VA 4CBVA 3MXNA 1SRUA 4IOAA 1TWHH 1SE8A 2ES2A 4JW0A 1NBWA 2DN8A 1UEAB 2F0JA 2G5DA 2RDHA 3KDFB 1K0SA 4HJ8A 1LT3D 4LF6Q 2RBMA 5IYBH 2I5HA 3KF8A 4GKKL 4C2MB 1TS3A 2RA4A 2IY5B 3T51B 1PTOD 5C4XB 4OL7A 4DV1Q 2R3ZA 4FVMA 2BDOA 3KF6A 5CBEE 4RCOA 4DK1A 2FJ2A 4KHZA 4DV4Q 3CCQA 2A6EC 3KF6B 1JE4A 2UUBQ 4IFDG 2JE6I 3L2PA 2A6ED 1AE2A 1XMOL 1VQ9A 1WTWA 1JCKB 2Z4HA 4CDCC 3HOWB 1I4QA 3AFPA 4ZYSA 1EQTA 2IHFA 5IYDG 2UU9Q 5JVG3 1B8AA 4OWWB 4A3DG 4LF8L 2FFKB 4P73A 1BNZA 3W2DA 4WORA
chains in the Genus database with same CATH topology
2SNSA 3HEJA 2RDGA 2SNMA 2A74C 2B2UC 4LK1C 1SYDA 1ESRA 3PO2B 3TSSA 1ENFA 5C6AA 1YNJD 3DXJC 1EYDA 4K8IA 3J81L 2Q8TA 1RJTA 1KLGD 1BUVT 3OIPA 5EBDA 4DN4M 1CHPD 3D3RA 1ICWA 4I7ZC 1UNSA 3O13A 5EGTA 3OWEB 2EVBA 3VA7A 1V1PA 4E6IA 4PMBA 3QOLA 1TS5A 1GUWA 4IFDJ 2F03A 1FD7D 5G3LF 4FF2A 1H9MA 4HEDA 1LACA 3VYSA 1DOLA 2NVXB 3G6JB 1BXTA 1LTAD 4Z9CB 3KK7A 4IUUA 4B9WA 5CGKA 1PDQA 1WCMB 1KTKA 3R93A 5I9PA 1HHVA 2SOBA 4KY6A 5I6WA 2PW7A 2RVLA 1ILQA 2EDGA 3E0JA 5DM63 3M85A 1B2TA 1QE6A 1HRJA 2NB0A 5DEHA 2A73B 3TP8A 4O42A 4B08A 4XQQA 3P7JA 2KUMA 2BE5C 2A6HD 2F0UA 1JOOA 5JOBA 3S2HB 2HCIA 3X3NA 2EYLA 5CR3A 2CQAA 4RGTA 1XX8A 4Q0FA 2LFNA 3RMHA 2A5HA 2HDLA 2I46A 1JQYD 1SAPA 3D6WA 1PYWD 4DAYA 1JWSD 2E2DC 3Q22A 4H44C 1U9RA 5M3MB 3LX0A 3I90A 1SJED 4QMGA 1SE4A 3I4LA 4DK0A 5EJWA 3A55A 4MIUA 4F88A 3PO3B 1DJRD 2F0HA 4PV1C 1QOHA 2O4XA 1O7YA 4C3IB 1I4RA 2EYOA 1HA5A 2F0TA 2RQXA 3R8BA 2MPMA 1V1PB 3MC0B 3HS0C 5FO8B 1JC7A 1EIHA 1BF4A 4NKLA 2VXWA 1C48A 3V05A 2K6AA 1I4XA 2F4IA 2WKDA 2IX0A 3I8ZA 2E75C 3NXWA 4B9XA 2EJFC 5I2XA 4G7OC 2CW0C 1JORA 5BN3A 3A56A 3I72A 4FF4A 2PZUA 1D5XC 2BCOA 1SSOA 2B2TC 3TDQA 2EOTA 1B44D 5I6YA 3I3CA 4PNYA 1WTXA 3L7ZC 2EY2A 5EQ0A 1QJOA 5I4DA 3HP3A 4XT3B 1ET9A 1LT6D 3VYRA 2ZT9C 4V190 1EYCA 1SMYC 3OWFA 5A2QL 5M9OA 4L6TB 3LWEA 5IIFA 4DF7A 1AFPA 2LY7A 2TMPA 2L11A 5K5PA 1EU4A 4CKCA 1D5ZC 3J7AV 5KEEA 1CZGA 3NP8A 4FXKC 1BCPD 3S1QB 5C3XA 3TBIB 5IGEA 2HDMA 2EYPA 1K8MA 1DM0B 3NSWA 5IOCA 3SR1A 1QILA 2K5QA 2B2TA 1R9TB 1S5CD 3BDLA 4XIGS 4IN3A 1JOQA 1XWEA 5DAUA 3BVMA 3D6CA 2A69C 3C1FA 2CW0D 1QWYA 2WB1B 1W6JA 3J7AF 2D2CC 1S5ED 2HUGA 3A8KE 5C0XI 4CHTB 3E5SA 3DEOA 2OXPA 2KHSA 5FO7B 1SNDA 1HA6A 3QWNA 4LJZC 4EQOA 5I2YA 1CK1A 2X6GA 2BA0A 3EJIA 4J8QA 5E1FA 3NUCA 1EQVA 4IUNA 1MGSA 4IURA 2QDBA 4KY7A 4ZK9B 3VR3A 4BWGB 5D14A 2PPBC 3PUYA 5T1GA 3FDTA 4K5VA 3P1HA 1X32A 5C5LA 2WKCA 1JICA 5CV9A 5E4WC 1BQQT 3H09A 4EVOA 4N9PA 1F2LA 1RCVD 3UI2A 4IZ8A 2B2WC 1TVXA 2BOSA 3A8IE 5D3DA 1KLUD 1KNAA 3BVGA 4XQJA 1EYAA 3GQBA 2MHVA 2K04A 5NUCA 1H9RA 2KOLA 4ZKCB 3H94A 2F3WA 4R8IA 2K33A 5ISRA 1PTOB 3HOVB 3RLFA 5KIXA 4RFBA 3QOJA 3OOCA 1GUSA 4KN4C 1GXDC 2XWBB 1O7ZA 3PMFA 3S16B 3S15B 1MD2D 1HUNA 4BA1I 2K5DA 1IW7D 2WV6D 3T56B 1G6ZA 1CTMA 2FMCA 4UAIA 4ODGA 1F2YA 2JEBI 2PZTA 1JWMD 1GUTA 1H9SA 4KD3A 1I6HB 1EY8A 3J81E 3ITPA 1F9QA 1Y8OB 2E76C 2NN6G 2KVMA 3WOFA 5KNBA 5LL6X 4XTCS 2K05A 3ND9A 3EQLC 2XVSA 1EZ8A 1CM9A 1IW7C 5J1ZA 4X3UA 1Q8IA 1IKLA 3C1EA 4C3JB 5EKKA 3GTOB 2B63B 5CC4A 4FNFA 1DYQA 4DFAA 3MA2B 5EKLA 4PMCA 4LAAA 1OXUA 1CQVA 3S1NB 4L63B 2QCPX 2JA8B 1Z47A 1EU3A 3J80E 3A8JE 4HCEA 1LV9A 2F3VA 3WDNA 2JSOA 5AFWA 5C0XH 3JAML 1B50A 3SDZA 2R93B 2E2IB 5F2DA 3C46A 4IUPA 4RWSC 4BBSB 1A3UA 1SNOA 5I9OA 4CGYB 1TWGB 4N9TA 1D1KA 1A15A 1BBXC 2K03A 1IYUA 2EYFA 4FYDA 3L3OC 4KK7A 1U4PA 4C3JG 4C1NK 2XRQD 3A54A 1WTPA 3GV3A 1DXMA 1RD9D 3M3YB 5C5MA 2L1BA 5FLXL 2BDNA 3FVQA 3ZYYX 1XYIA 1H9JA 5COYA 5G3LD 1FR3A 1RHPA 2AQ2B 5LL6S 3TZDA 3HZXA 3PIO3 1L0XB 3S1MB 3NPPA 5IT9L 2LMCB 2A69D 3R3OA 1NR2A 3MXPA 1TY0A 2R92B 2F1MA 2EY5A 5M5YB 5FK9C 2EYMA 4C3HG 1T5EA 1G2SA 2K01A 3DMUA 1LTTD 2TSSA 4OGQC 2EJGC 3SVMA 2EJMA 1A2TA 1M4VA 2MP1A 3OHXC 2L5TA 1WTQA 5K36H 3Q23A 3MZ5A 2R7ZB 1F2ZA 1LTID 4FXGC 1U4MA 3S14B 5EPLA 3M4YA 2IX3A 1EFID 3LNNA 4A3FB 4C3IG 5EPKA 4EGVA 1EOTA 3HG9A 1UUPA 3BVZA 1NSNS 3SE0A 5M5XB 1E2VA 4KI0A 5JPMC 1FGBD 5IGFA 2NTTA 2NVYB 3TP5A 3K57A 2XSCA 1LO5D 4BBRB 1ML0D 3TP6A 1ENAA 3GP7A 3S9WA 1SBBB 1SJHD 1S5FD 3ONAB 5EBCA 1JOKA 4DNTB 3R2IA 4G7ZC 2R6GA 4KD4A 1RTNA 1V43A 1STHA 2MUYA 3D4DA 3NK9A 4ME5A 4NDXA 1CFMA 4FXDA 3HKZB 4M8AA 4X3KA 1VCIA 2OT2A 2NVQB 1EL0A 4JBWA 2ZXRA 3NTHA 4FF1A 3CU7A 1DONA 3FEWX 1T5XD 4A3KB 5JJZA 4S3SA 1NUCA 3FRPB 4R9WA 1E2WA 1C8CA 3MHBA 4U673 3K58A 4C56C 3GTJB 2IL8A 3OIQA 2QILA 2WP8J 2EZVA 3N52A 1K8OA 2VB2X 1OXSC 3LWUA 1QNKA 2F0KA 2SDFA 2H4OA 3CRKC 2XIWA 2ZXOA 1SE2A 2N88A 3RZDB 5CV8A 2B2YA 2KEDA 1SYFA 2MGSA 4H7BA 4A3DB 1VF5C 3EFXD 4XT1B 3MEHA 5IGCA 1SDFA 3NQTA 3P20A 2A68C 3K5NA 1STAA 3M4OB 4ZLTF 3OMGA 1G8ZD 2D5DA 3SK5A 1BCPF 2NN6I 4H13C 5JEAJ 2JA7B 4KN7C 5JVH3 1NCVA 3URYA 3RZOB 4KY5A 5JAVA 3FPPA 5C4JB 3DWAA 4RCNA 4DXFA 1WVLA 4HSPA 3SK8A 1LTBD 2EY6A 1PFMA 1F9RA 4O1NA 1LABA 1RODA 1TKWB 3M7GA 4FO2A 1NR4A 5ELCA 3VR2A 3NBIA 4XQNA 1EWCA 3S1RB 2X6LA 2RDFA 1Q1EA 3H6MA 3OMCA 1BCPC 4KTAA 4PMWA 1XXGA 3K59A 2MJ8A 1PTOH 1AW7A 3J80L 4KHVA 1HTPA 2A6HC 1TY2A 5JEAG 3T13A 4NP5A 4A3BB 3I70A 3QO2A 1Q1BA 2ICIA 5TSSA 1PTOC 4I65A 1IYVA 1A3VA 1CHQD 2F0DA 2F0OA 5CYUA 4A3JB 3U9SA 4ULLA 1SYBA 4DA2A 1OO9B 3BG3A 5JEAH 5J22A 2B39A 4F7XA 1PRTC 3T16A 2EXZA 1SXTA 3MWYW 1STYA 3BYTB 1TWAB 4OHJA 4CJ0B 4ILWA 1GJXA 1IKMA 4R8NA 2AWOA 2XN9C 5E3FA 1B53A 1A2UA 4A3MB 5J39A 4M1UB 4IUTA 3NWSA 1PRTB 5KGUA 1GOZA 4IFDH 2L55A 5KNDA 3H0GB 2KCCA 1QCBD 2F0NA 3FKIB 2AQ1B 4ZKBB 1F9PA 2F0FA 3EA6A 1D6EC 3PUVA 3PV0A 2O5JC 1RDPD 5IGDA 4RKBA 3AB9A 3NE5B 3GTPB 2WIIB 2ENBA 2QEJC 3SXHA 2LKVA 2F0SA 2RSNA 1PRTF 3DEPA 2PZWA 2Q8RE 1C4QA 1TQOA 2JP1A 4IALA 3DUZA 3D31A 4IUQA 4XYOA 3KLSX 2E74C 3C3LA 1HXYD 1O78A 2XRSD 3NTIA 1AN8A 1ZEQX 3DWQA 3IKJA 1EY6A 1SFOB 3EROA 1WD1A 1DCZA 3KLSA 3QJYA 3QG1A 4KKSA 2F0WA 5FKAC 1EWHA 1JB3A 1BR9A 2R61A 4RA8A 4A3GB 3CQZB 4TQUS 4BY1B 4ZQ3A 2ID0A 3X3MA 1JWUD 2C9OA 1WD0A 1EY4A 2Z1CA 3FPUB 3OPOA 2N55A 1GUOA 5K36G 1I4HA 3VR6A 3HOXB 4RH6A 2AUKA 3D4WA 5C4ZA 4XYQA 1KDAA 2DY7A 2IPKD 4TRDA 4ZUJA 1IHZA 4NMZA 5BN4A 2Z4IA 1K83B 2E2JB 4XXEA 4RGOS 3GTKB 1FNVA 1U4LA 3K7AB 1YNNC 5ELDA 2PQEA 3I4NB 4GZYC 2L12A 2NVTB 4C1NI 3K6OA 3K5OA 1RTOA 4KKTA 4HTHA 2IX1A 1DZ1A 1O7LA 4KJOA 3VR4A 2QKIC 4RGNA 5CORA 3NWTA 1MI2A 3TMEA 2F0MA 4K2LA 5KNCA 4ID6A 1SNCA 3G7LA 3QB3A 2DNEA 3A7LA 2IT1A 5ELBA 4A3EB 3IFDA 3I91A 1IL8A 3WOEA 5ELEA 1S4ZA 3IAYA 4G7HC 3PUWA 3ERQA 1MBYA 2NWGA 3H91A 4X3TA 3F2UA 2D62A 1FNUA 1EZ6A 1YNJC 1CT1D 3HOYB 2BA1A 2L4NA 2J4XA 5FOBB 2B2VA 5DM73 5BN5A 1D1IA 1CA6A 3BS1A 4HAEA 2I07B 4J1MA 4BY7B 1A3TA 2KEEA 2XWJB 2GA4B 4WRDA 1TWCB 2K1BA 2JXMB 2NN6H 1KNEA 2WAQB 1W6KA 5M5WB 4QIWB 3TN2A 4DAVA 1STBA 2DY8A 4CKBA 3T4AC 2A68D 1QNUA 1JR0D 4G4KA 1GHJA 2NYZD 1S5DD 2F0LA 2F0PA 3IL8A 1PFNA 3MAQA 3PIP3 2K32A 3H3VC 1TS4A 2KCNA 1HFGA 1OXXK 3ND8A 1EY0A 4QUCA 1LT5D 2ZXPA 3TZUA 3GTMB 3QIAA 2XNAC 1BDOA 2FMMA 3RUZA 4L8JA 4IQZA 3HRZC 2J7ZA 3J7YW 1PTOF 3V2TA 1Y1VB 4ZRZA 1UAPA 2K7VA 2B2YC 3KBGA 3L9AX 1ZYRD 2M9VA 1TS2A 4HN7A 4TKOB 4HR7B 4QCLA 1J8IA 1LT4D 1O80A 3RD4A 4F87A 3A7AB 5C44B 1EIGA 2SEBD 2D9UA 1GUNA 1LTRD 2F0IA 5DNFA 4K6LA 1PZKD 3V96A 1HCZA 4MHEA 1B9MA 1F77A 1SMYD 2F0VA 5C3WA 1L0YB 1STGA 2F0GA 2H1EA 3HGBA 1HPCA 1B9NA 2QF7A 1RKNA 1PXUA 4RHRA 1CI3M 3VYUA 5CV7A 1TT2A 5JPNC 2Z8LA 3JAME 2EE1A 2HCCA 4QB4A 3MXGA 3Q6SA 3S17B 1Y8PB 1HFNA 1I50B 1SNQA 4K6DA 1B4OA 4HSVA 4KMUC 4K5WA 1V8QA 4MN3A 1I4GA 1KDBA 1F2MA 1I6VC 4RGMA 2ICEC 1HTLD 1NAPA 3CHBD 3U9OA 2Y0SB 5FLXE 2EPBA 1KABA 2B8FA 3I73A 2EY1A 1I4PA 2PMZB 1MSGA 1B3AA 4OIKA 3GV6A 4FP5D 1QG7A 2V4DA 3BDOA 1YNND 1EY5A 3KUPA 5IT9E 2E2HB 4YIJA 1AP0A 4IUVA 2VNUD 3T53B 3NQIA 3DWPA 3GTQB 1TWHB 1STNA 5IGBA 1EY9A 1Z6HA 5CV4A 3PUXA 4K14A 5CV6A 4AYBB 1DD2A 3SHLA 1PMRA 2J0TD 3VR5A 1AZQA 5D65A 3W3AA 2B2WA 3IFTA 5C4HA 2IJ0A 1B1ZA 1H9KA 5HURA 4QUFA 4P2CB 2EYHA 2CHBD 2B8GA 2NBFA 5D3IB 3GO5A 1ILPA 1PZJD 4OO1H 4WFN3 4CJ1B 2O5IC 2BE5D 1Y1WB 2AQ3B 1S5BD 3S2DB 2RKSA 1D2BA 1SE3A 3MFGA 2KA7A 1MSHA 4RAUC 4RKLA 1SYGA 1HUMA 5T1IA 5KYLA 1XTCD 1PZID 4OIJA 4K8JA 3Q24A 1Y69U 4G57A 3P75A 2IW3A 2JEAI 2O2LD 4U68A 1TU2B 4RHSA 1ET6A 1Q12A 4ABNA 1DOMA 2RSOA 2F0EA 5KYIA 2NZ1D 2PW5A 4ZUIA 1II3A 1SYEA 2PCFB 3E6ZX 2NUCA 3BZDB 3I4MB 4DGZA 1STEA 3CRLC 3AMUA 5EKIA 1E0BA 4FF3A 3OSOA 1OXTA 1I3QB 1SEBD 1FYCA 3K0YA 4EQPA 1WTVA 3SEBA 2FHTA 2K5WA 5FO9B 3OW7A 5C0XG 4OO1I 1PRTD 3NBHA 1WTRA 3VA5A 3MFYA 1TWFB 1U4RA 4KKUA 2G9HD 3SK4A 2JA5B 1CA5A 1ONLA 3KLRA 2FINB 1VF7A 4K5XA 1G291 4ZAIA 2IWHA 1LTSD 5LHY1 1Z7TA 2JA6B 2DNCA 2C5CA 2PYKA 1E2ZA 1M8AA 1KAAA 3TP7A 4PQXA 4DAPA 3R2TA 4CJ2C 1H9SB 2HQEA 2PO4A 4Q5VA 1RF2D 2L0CA 4QF4A 4LMQD 2AUJD 2F0QA 1VMCA 2B2UA 4DXGA 4A93B 3N6RA 5A2QE 1VMPA 5C3EB 1G91A 2M00A 1X3PA 1D5MC 5C0XJ 2VB3X 4BA2I 1TIID 1X3QA 3C2PA 4HMIA 4Y7NB 4UDUC 1BO0A 4A3IB 1ESFA 4CKEA 1Q3LA 1ENCA 1R4QB 1SYCA 3SK6A 3BDCA 2M2LA 1FNWA 1V1OA 4X3SA 1A6XA 1LLRD 4IFDI 2CVRA 4WJWA 1J9OA 2EYJA 1BOSA 3Q0AA 3DHQA 3MXUA 3M7NA 2NTSA 4HMJA 3VYTA 5HGTA 2OF1A 2AWNA 2PNRC 1Y8NB 1CZWA 3KBXA 4H0LC 3K5LA 2B2VC 2LS01 1VDZA 2K28A 1ZYRC 1GUGA 1F9SA 4KV6A 3MVVA 4HCSA 1TR5A 3PUZA 3HOZB 1EEFD 1DOKA 4C3HB 3HOUB 3EVQA 1QB5D 3GTGB 4TSSA 3D4RA 4DU9A 2KQ3A 5ELFA 3K5MA 1KDCA 1GHKA 4BS9A 4J6HA 1CQFA 2YU9B 4KJNA 1ZXTA 4XDXA 5KRUA 2L9HA 5IGGA 1AZPA 1PLFA 2G9DA 2Q8IB 3FMCA 2YYZA 5CV5A 3BYYB 1EEID 1HQRD 1G2TA 5IODA 2WINB 5E4XA 5EPJA 3MTSA 4F8MA 1WTOA 5CBAE 5CMDA 2X69A 3NHHA 2KECA 1ZKOA 4OO1G 1AEXA 4DNRB 3AU7A 2OEOA 2KJXA 4EQNA 3NTKA 3DM1A 2JYOA 2WACA 4NW2A 3CKIB 2VUMB 1HQMC 5A35A 4V0BA 1EY7A 4JK1C 1SNMA 4K2KA 5M3FB 1SNPA 1OXVA 1R4PB 1LTGD 1BCPB 3D8GA 3GTLB 3GD7A 1PFBA 1Q90A 4CBVA 3MXNA 2DN8A 1UEAB 2F0JA 2RDHA 1LT3D 2RBMA 3KF8A 4C2MB 1TS3A 2RA4A 3T51B 1PTOD 5C4XB 4OL7A 2R3ZA 4FVMA 2BDOA 5CBEE 4RCOA 4DK1A 2FJ2A 4KHZA 2A6EC 1JE4A 4IFDG 2JE6I 2A6ED 1WTWA 1JCKB 2Z4HA 3HOWB 1I4QA 4ZYSA 1EQTA 5JVG3 2FFKB 1BNZA 3W2DA 4WORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X3N A;  4KK7 A;  5CYU A;  5EBD A;  5EBC A;  3X3M A; 
#chains in the Genus database with same CATH topology
 2SNS A;  3WWV A;  1L0W A;  3HEJ A;  2RDG A;  2SNM A;  2A74 C;  2B2U C;  1YIJ A;  4LK1 C;  1YJW A;  1SYD A;  1ESR A;  3U58 A;  3PO2 B;  1C7Y A;  1VQD A;  3TSS A;  2NVT H;  1UE6 A;  1ENF A;  5C6A A;  1YNJ D;  3DXJ C;  1EYD A;  4K8I A;  4H02 A;  3J81 L;  2Q8T A;  1SR3 A;  3UDI A;  1RJT A;  1KLG D;  2JQO A;  5IE8 A;  3RLN A;  1BUV T;  3OIP A;  5EBD A;  4DN4 M;  1CHP D;  3D3R A;  1ICW A;  4DV0 Q;  1QUQ B;  4B3T L;  4I7Z C;  1UNS A;  3O13 A;  5EGT A;  3OWE B;  4QIW E;  3PF4 A;  2EVB A;  1C0A A;  3S15 H;  1Q81 C;  3VA7 A;  4LFB Q;  1SFO H;  3Q8D A;  1V1P A;  4E6I A;  4PMB A;  3QOL A;  1TS5 A;  2OWO A;  1GUW A;  4P75 A;  4IFD J;  2F03 A;  1FD7 D;  5G3L F;  4FF2 A;  1H9M A;  4HED A;  1LAC A;  2FXQ A;  1GD7 A;  2OTL A;  4R4C A;  3VYS A;  1DOL A;  2NVX B;  3G6J B;  1BXT A;  1LTA D;  4Z9C B;  4LFC Q;  3PF5 A;  3KK7 A;  4GNX A;  4A3K H;  4IUU A;  4B9W A;  5CGK A;  1PDQ A;  1WCM B;  1KTK A;  1GKH A;  3R93 A;  5I9P A;  2K14 A;  1HHV A;  2SOB A;  1CKM A;  3HKZ G;  4KY6 A;  5I6W A;  2PW7 A;  1YJ9 A;  2RVL A;  2Y0S E;  5BR8 L;  1ILQ A;  2EDG A;  3E0J A;  4AYB G;  1LTL A;  3PO3 G;  5DM6 3;  3M85 A;  1B2T A;  1QE6 A;  1HRJ A;  2NB0 A;  2KEN A;  3PGZ A;  5DEH A;  2DJG C;  2A73 B;  3TP8 A;  4O42 A;  1KRT A;  4B08 A;  4XQQ A;  3P7J A;  1E3P A;  1S72 A;  2KUM A;  4IPD A;  2BE5 C;  2A6H D;  1O7I A;  2F0U A;  4KLK A;  4A3K G;  4JI6 L;  1JOO A;  5JOB A;  1HNZ Q;  3HOY G;  4CDE C;  3S2H B;  1WI5 A;  2HCI A;  3X3N A;  2EYL A;  1XPR A;  5CR3 A;  2CQA A;  4RGT A;  2VUM G;  4B3M L;  2VUM H;  4OEM B;  1XX8 A;  1NE3 A;  1N36 L;  4Q0F A;  3ICE A;  2LFN A;  3RMH A;  5LMN W;  2A5H A;  2HDL A;  2I46 A;  4DR6 L;  1JQY D;  1TWG H;  1SAP A;  5FLX c;  3D6W A;  1YHA A;  1PYW D;  4DAY A;  4A3E H;  2JA8 G;  4A3B H;  1JWS D;  2E2D C;  3Q22 A;  4H44 C;  1U9R A;  5M3M B;  2E5L L;  3LX0 A;  3I90 A;  1SJE D;  1XNR L;  4QMG A;  1SE4 A;  3I4L A;  2Q2I A;  2UXC L;  3F8T A;  4CDD C;  1Q82 C;  4DK0 A;  5EJW A;  3STB D;  3A55 A;  4HIK A;  2VQE L;  4MIU A;  4F88 A;  3I4M H;  3PO3 B;  1DJR D;  4B3T Q;  2F0H A;  4PV1 C;  1VQ7 A;  2Y0S G;  4N8F A;  4DUZ Q;  4TVA B;  1QOH A;  2O4X A;  1O7Y A;  2K5V A;  1I3Q H;  4C3I B;  1I4R A;  2EYO A;  3PIP A;  1HA5 A;  1UE1 A;  5GQO A;  5AJ3 L;  2F0T A;  2RQX A;  3ER0 A;  3R8B A;  1VQE A;  2MPM A;  3HOZ G;  1V1P B;  3MC0 B;  3HS0 C;  5FO8 B;  1JC7 A;  1EIH A;  2PI2 A;  1BF4 A;  4NKL A;  2VXW A;  1C48 A;  3RNU A;  3V05 A;  2K6A A;  4C3I H;  1I4X A;  3CCU A;  2F4I A;  4A76 A;  1T9H A;  2WKD A;  3HOW G;  4Y52 H;  2IX0 A;  3I8Z A;  3ULJ A;  2E75 C;  3NXW A;  1YJN A;  4B9X A;  2EJF C;  5I2X A;  4G7O C;  2K75 A;  2A1A A;  2CW0 C;  1JOR A;  4DR2 L;  5BN3 A;  3A56 A;  2B3G A;  3I72 A;  4FF4 A;  1NMG A;  3G71 A;  2PQA B;  2PZU A;  1E1T A;  1D5X C;  2BCO A;  1SSO A;  2B2T C;  4L5Q A;  3G4S A;  3TDQ A;  2EOT A;  1B44 D;  5I6Y A;  3I3C A;  4PNY A;  1WTX A;  2UUB L;  3L7Z C;  2EY2 A;  5EQ0 A;  1QJO A;  5I4D A;  3HP3 A;  4XT3 B;  1JMC A;  1ET9 A;  1LT6 D;  2Z6B A;  3VYR A;  3CC2 A;  2H5X A;  2ZT9 C;  4V19 0;  1EYC A;  1SMY C;  3OWF A;  1GO3 E;  2DJF C;  5A2Q L;  1V9P A;  4GN3 B;  5GAE C;  2VQF L;  5M9O A;  4L6T B;  3CC7 A;  2R92 G;  1AH9 A;  3LWE A;  4LNQ A;  5IIF A;  4DF7 A;  1AFP A;  2LY7 A;  3LGJ A;  2TMP A;  2L11 A;  5K5P A;  1EU4 A;  4CKC A;  2OQ0 A;  4LFB L;  1D5Z C;  3J7A V;  1FJG Q;  2K50 A;  3HOX G;  5KEE A;  3HOV H;  1CZG A;  3NP8 A;  3BZC A;  4FXK C;  1BCP D;  3S1Q B;  2JA8 H;  5C3X A;  4J15 A;  3S16 H;  3TBI B;  2R7Z G;  5IGE A;  2HDM A;  2RHQ B;  2EYP A;  2YTY A;  1K8M A;  1DM0 B;  3NSW A;  5IOC A;  1SRO A;  4DUY Q;  5FJ8 G;  3SR1 A;  1QIL A;  2K5Q A;  2B2T A;  3W5O A;  1R9T B;  1S5C D;  3BDL A;  3MXN B;  4XIG S;  4IN3 A;  1JOQ A;  1XWE A;  5DAU A;  3BVM A;  3DLL A;  3D6C A;  2A69 C;  3C1F A;  2CW0 D;  1QWY A;  2WB1 B;  2GVA A;  4RG1 A;  1W6J A;  3ZJY C;  4NXM Q;  1PH6 A;  3J7A F;  2D2C C;  4YY3 L;  1S5E D;  2HUG A;  3K81 C;  3A8K E;  5C0X I;  4CHT B;  3E5S A;  3DEO A;  4YHH L;  2OXP A;  3GTG H;  4QY7 A;  2KHS A;  5FO7 B;  1N32 Q;  2KCM A;  1SND A;  1HA6 A;  3QWN A;  4GKJ Q;  5IYC H;  1TWC H;  2NZH A;  1IXR A;  4LJZ C;  4EQO A;  5I2Y A;  1CK1 A;  2X6G A;  3RR5 A;  2BA0 A;  3EJI A;  4J8Q A;  5E1F A;  3NUC A;  1EQV A;  2Z6K A;  1X3E A;  4IUN A;  1MGS A;  4IUR A;  2GN5 A;  2QDB A;  4KY7 A;  4ZK9 B;  4JV5 L;  3NEM A;  4MTK A;  3VR3 A;  1X56 A;  1VQH A;  4R4T A;  5D14 A;  4BWG B;  3H15 A;  2PPB C;  4A3G H;  3PUY A;  3S14 H;  5T1G A;  5H1S E;  4JI3 L;  1KIX A;  3FDT A;  4K5V A;  2AKW B;  3P1H A;  1X32 A;  5C5L A;  2WKC A;  1JIC A;  5CV9 A;  5E4W C;  1PH7 A;  1BQQ T;  3H09 A;  4EVO A;  4N9P A;  4DV6 L;  1F2L A;  1RCV D;  3BZK A;  3U4Z A;  3UI2 A;  4RMF A;  1X3G A;  4IZ8 A;  2B2W C;  4B3S Q;  1TVX A;  2BOS A;  4X66 L;  3A8I E;  5D3D A;  1KLU D;  5M5Y H;  1KNA A;  3BVG A;  3CC4 A;  4BXX G;  4LF5 Q;  4XQJ A;  2I0Q A;  2HHH L;  1EYA A;  3GQB A;  4YCW A;  2CH4 W;  2MHV A;  2K04 A;  1HNZ L;  4DR4 L;  5NUC A;  3AEV A;  3JC6 6;  1H9R A;  2KOL A;  3W1G A;  4YWK A;  4ZKC B;  3H94 A;  4GNX B;  2F3W A;  4DV2 Q;  4R8I A;  2VQE Q;  2K33 A;  5ISR A;  3S17 H;  1PTO B;  3HOV B;  3RLF A;  5KIX A;  4RFB A;  3S2H H;  4EQ5 A;  3QOJ A;  1CSQ A;  4O0A A;  3OOC A;  4APV A;  1GUS A;  4KN4 C;  1GXD C;  3J81 c;  2XWB B;  1O7Z A;  3PMF A;  3S16 B;  4A3F G;  3S15 B;  1MD2 D;  3T1H L;  5LMN L;  1HUN A;  3IRB A;  4BA1 I;  2K5D A;  4X66 Q;  1IW7 D;  2WV6 D;  3I4M G;  3T56 B;  1G6Z A;  1HNW L;  1CTM A;  2FMC A;  4UAI A;  4QGU A;  4LUZ A;  4ODG A;  4DPG A;  4ALP A;  1F2Y A;  2JEB I;  2PZT A;  1JWM D;  1GUT A;  1H9S A;  4OX9 L;  4KD3 A;  1I6H B;  1EY8 A;  4LFC L;  3J81 E;  5IWA L;  3RZD H;  1H95 A;  3ITP A;  1YVC A;  1F9Q A;  1Y8O B;  3OTO Q;  1MIU A;  5HGQ A;  2E76 C;  2NN6 G;  4UPA A;  1PH4 A;  2L15 A;  2KVM A;  4DV3 L;  3WOF A;  5KNB A;  5LL6 X;  1EIF A;  2JA7 G;  4XTC S;  2K05 A;  3ND9 A;  3EQL C;  2XVS A;  1EZ8 A;  5BR8 Q;  1CM9 A;  4WJ4 A;  1IW7 C;  5J1Z A;  1XNQ Q;  4I7A A;  1Q8I A;  4X3U A;  4A3D H;  1IKL A;  3C1E A;  5M3M G;  4C3J B;  5EKK A;  4CDF C;  3GTO B;  2B63 B;  5CC4 A;  1J6Q A;  4FNF A;  1DYQ A;  4DFA A;  4JI5 Q;  1JJ2 A;  3MA2 B;  1Q46 A;  5EKL A;  4PMC A;  4LAA A;  1OXU A;  1CQV A;  3S1N B;  4L63 B;  1SLJ A;  2QCP X;  1R9T H;  2JA8 B;  1Z47 A;  1EU3 A;  1KL9 A;  3J80 E;  3A8J E;  4HCE A;  1LV9 A;  2F3V A;  3I7F A;  2JSO A;  3WDN A;  5AFW A;  4YWM A;  3CW2 C;  5C0X H;  4JCV E;  3F2D A;  3JAM L;  1B50 A;  2OQK A;  3SDZ A;  2R93 B;  2E2I B;  5F2D A;  2PNH A;  3C46 A;  4IUP A;  4RWS C;  4BBS B;  1A3U A;  1SNO A;  5I9O A;  4CGY B;  3B6Y A;  1Y1W H;  1EQR A;  4LW1 A;  1TWG B;  2K5H A;  4N9T A;  1VQM A;  1IBL Q;  2K4K A;  1D1K A;  1A15 A;  1L2F A;  4LF4 Q;  4NXM L;  3EBE A;  2RF4 A;  2E2I H;  1BBX C;  2K03 A;  1ICF B;  1RIP A;  1IYU A;  2EYF A;  5GAG C;  5IY0 A;  2I5L X;  4FYD A;  4NB3 A;  1WCM H;  3NEN A;  3L3O C;  4JI0 Q;  4KK7 A;  4LF7 Q;  4DV0 L;  3GDE A;  4A3J G;  1U4P A;  1EFW A;  4LF6 L;  4R4I A;  4C3J G;  4C1N K;  2XRQ D;  4GOP B;  3A54 A;  2RCF A;  1WTP A;  3GV3 A;  4DV1 L;  2KHI A;  4DK6 C;  1DXM A;  2R93 G;  1MHW C;  1RD9 D;  1HNW Q;  3M3Y B;  5C5M A;  2L1B A;  5FLX L;  2BDN A;  3FVQ A;  3ZYY X;  4JOI C;  1H9J A;  4AYB E;  1XYI A;  5COY A;  5G3L D;  1FR3 A;  3UE0 A;  1RHP A;  2Z9H A;  2AQ2 B;  5LL6 S;  3TZD A;  1VQK A;  5IP9 G;  3HZX A;  2HIV A;  1PYB A;  3PIO 3;  2EIF A;  5ELN A;  1L0X B;  3M4Q A;  3S1M B;  4AH6 A;  4DR1 Q;  5C44 H;  3A0J A;  3NPP A;  5IT9 L;  3PCO B;  2LMC B;  2A69 D;  4DV6 Q;  3R3O A;  4LWC A;  1NR2 A;  3MXP A;  1K8G A;  1TY0 A;  1KRS A;  3FKI G;  4DR2 Q;  2R92 B;  1VQP A;  2F1M A;  2EY5 A;  4KHP L;  1AE3 A;  5M5Y B;  5FK9 C;  2EYM A;  4C3H G;  1T5E A;  1G2S A;  2K01 A;  3DMU A;  2K5N A;  1LTT D;  2TSS A;  3S1M H;  4OGQ C;  1HZB A;  2CQO A;  2Q2H A;  4OXP A;  1NMF A;  4PZ7 A;  4JI2 Q;  2EJG C;  3SVM A;  2EJM A;  3H0G G;  1U5K A;  2E2H H;  1A2T A;  1M4V A;  2MP1 A;  1VQ5 A;  3OHX C;  2L5T A;  3PO2 G;  1WTQ A;  5K36 H;  1N34 L;  3Q23 A;  3S1N H;  3CCE A;  3MZ5 A;  2R7Z B;  4IJH A;  2VZA A;  5C44 G;  1F2Z A;  1LTI D;  4FXG C;  4JI7 L;  1U4M A;  2WB1 G;  4R1J A;  5EPL A;  3S14 B;  3M4Y A;  2IX3 A;  1EFI D;  3LNN A;  4A3F B;  1B7Y B;  4C3I G;  5EPK A;  4EGV A;  1QVG A;  1EOT A;  3HG9 A;  1UUP A;  3BVZ A;  5IT9 c;  1IBL L;  1NSN S;  3SE0 A;  5M5X B;  4A3M H;  1E2V A;  4KI0 A;  5JPM C;  1FGB D;  5IGF A;  2NTT A;  4N8X 1;  2NVY B;  3G6E A;  3HOU H;  3TP5 A;  1HH2 P;  3K57 A;  2XSC A;  3KF8 B;  1PA6 A;  1D7Q A;  3L0O A;  1LO5 D;  4BBR B;  1ML0 D;  3TP6 A;  1ENA A;  2DUD A;  3GP7 A;  3S9W A;  1SBB B;  4JYA Q;  1SJH D;  1S5F D;  3ONA B;  5EBC A;  2VQF Q;  1JOK A;  3I4O A;  1NY4 A;  4DNT B;  3J81 i;  3I4N H;  3R2I A;  4G7Z C;  2R6G A;  4KD4 A;  3CP0 A;  1RTN A;  1V43 A;  1STH A;  2MUY A;  3D4D A;  3NK9 A;  4ME5 A;  4NDX A;  1CFM A;  4JPB W;  3ULL A;  4FXD A;  3HKZ B;  2R7F A;  3A74 A;  4M8A A;  4X3K A;  3CCR A;  1MJE A;  4C3J H;  4P72 A;  1VCI A;  2OT2 A;  2NVQ B;  1EL0 A;  4JBW A;  3OW2 A;  2ZXR A;  3NTH A;  4FF1 A;  3CU7 A;  1GVP A;  1MKH A;  1DON A;  2CKZ B;  1HZA A;  1PH5 A;  3FEW X;  1YHQ A;  1T5X D;  4A3K B;  5JJZ A;  4S3S A;  1NUC A;  4P71 A;  3FRP B;  5J3B A;  4R9W A;  1E2W A;  1C8C A;  3MHB A;  2F52 A;  1HNX L;  4U67 3;  3K58 A;  4C56 C;  3GTJ B;  2IL8 A;  3S24 A;  5M5W H;  3OIQ A;  4OWT B;  2QIL A;  2WP8 J;  4BBS G;  4WJ3 M;  2P5Z X;  2EZV A;  3N52 A;  1K8O A;  3U50 C;  2LXK A;  3FHW A;  5FLM G;  3F2B A;  1W3S A;  2VB2 X;  1OXS C;  3CF5 A;  3LWU A;  1LUZ A;  1QNK A;  2F0K A;  2N49 A;  3KYH C;  4C3H H;  2SDF A;  2H4O A;  3CRK C;  3OTO L;  1XMO Q;  2XIW A;  3J80 c;  3HOX H;  3HOV G;  2ZXO A;  1SE2 A;  2N88 A;  3RZD B;  5CV8 A;  2YU9 H;  2B2Y A;  2KED A;  1SYF A;  2MGS A;  4H7B A;  4A3D B;  4B3R L;  3UDF A;  1P8L A;  4QQB X;  3FP9 A;  1VQ8 A;  1VF5 C;  2B29 A;  3EFX D;  4XT1 B;  2QDL A;  3MEH A;  5IGC A;  1IYJ B;  2ZTC A;  1SDF A;  2UUC Q;  3NQT A;  3P20 A;  1TXY A;  3UDX A;  1KD1 C;  2A68 C;  3K5N A;  2UXB Q;  1STA A;  2YTV A;  3CPF A;  3M4O B;  1JE5 A;  4ZLT F;  1YNX A;  3OMG A;  1G8Z D;  1I94 Q;  1FL0 A;  5M5X H;  1L1O C;  4DV5 Q;  2D5D A;  3SK5 A;  1BCP F;  2NN6 I;  1VQI A;  3J7Z C;  4H13 C;  5JEA J;  2JA7 B;  4MZ9 A;  1HR0 L;  4KN7 C;  3DM3 A;  4GLA C;  5JVH 3;  4JOI A;  1VQO A;  1NCV A;  3URY A;  3RZO B;  1RL2 A;  4KY5 A;  4ME3 A;  5JAV A;  2MO0 A;  1WCM G;  3FPP A;  1PH9 A;  3G48 A;  5C4J B;  3DWA A;  3M4P A;  4RCN A;  4DXF A;  3HOY H;  4MNO A;  4HSP A;  1WVL A;  3SK8 A;  4YY3 Q;  1LTB D;  2EY6 A;  2B63 G;  3KJP A;  1PFM A;  4HIM A;  2XGT A;  4YHH Q;  1F9R A;  4O1N A;  1LAB A;  1ROD A;  1EUJ A;  1TKW B;  4X64 Q;  3K80 C;  3M7G A;  1N34 Q;  4JI2 L;  2VW9 A;  4FO2 A;  4IO9 A;  4K0K Q;  1NR4 A;  5ELC A;  3VR2 A;  3NBI A;  4XQN A;  1EWC A;  4DUZ L;  3S1R B;  2X6L A;  2UXD Q;  1JB7 A;  2RDF A;  1Q1E A;  3H6M A;  3OMC A;  4KTA A;  1BCP C;  1X54 A;  4PMW A;  1XXG A;  3K59 A;  2A19 A;  2MJ8 A;  2D0P A;  2XTI A;  4KHP Q;  4A3C H;  1PTO H;  3H3V I;  1AW7 A;  3J80 L;  2OCE A;  4KHV A;  1HTP A;  2A6H C;  5FLM H;  1TY2 A;  5JEA G;  1QZH A;  3T13 A;  1XNR Q;  3AYH B;  4NP5 A;  4A3B B;  4B3M Q;  4A75 A;  4JI4 L;  3I70 A;  5GAH C;  3M9B A;  3E3X A;  3QO2 A;  4UHV A;  2QGQ A;  1YI2 A;  1K73 C;  1Q1B A;  2ICI A;  5TSS A;  1PTO C;  4I65 A;  1IYV A;  3E0E A;  1A3V A;  1CHQ D;  2F0D A;  3PIO A;  1Q86 C;  2F0O A;  5CYU A;  4BBS H;  1LM0 A;  2JN4 A;  4A3J B;  3W1B A;  3U9S A;  4ULL A;  3AFQ A;  1SYB A;  4DA2 A;  1OO9 B;  3GTL H;  1QVF A;  3BG3 A;  5JEA H;  5J22 A;  2B39 A;  4BXX H;  4F7X A;  1PRT C;  2QEX A;  3T16 A;  2EXZ A;  2WFW A;  1SXT A;  3CME A;  1W2B A;  3MWY W;  1STY A;  3BYT B;  2EQS A;  1TWA B;  2VL6 A;  4OHJ A;  4CJ0 B;  4ILW A;  1NNX A;  1GJX A;  1IKM A;  2AMC B;  3EN2 A;  4R8N A;  3GTM H;  2AWO A;  2XN9 C;  5E3F A;  1B53 A;  1A2U A;  4A3M B;  5J39 A;  3PQI A;  4M1U B;  4IUT A;  3NWS A;  3GTP H;  1KXL A;  4GLV B;  1PRT B;  5LMN Q;  5KGU A;  1GOZ A;  3U4V A;  4IFD H;  2L55 A;  5M3F G;  1Y1V H;  5KND A;  3H0G B;  2KCC A;  4AIM A;  1QCB D;  2F0N A;  3FKI B;  1VQ6 A;  2DGY A;  2AQ1 B;  4ZKB B;  1F9P A;  4JI6 Q;  2UUA Q;  2F0F A;  3EA6 A;  1X9N A;  1D6E C;  2Z6K C;  3PUV A;  3PV0 A;  2O5J C;  1RDP D;  5IGD A;  4DR7 L;  4RKB A;  4DV2 L;  3AB9 A;  3NE5 B;  4GN5 A;  4LF7 L;  3GTP B;  2WII B;  2ENB A;  2PQA A;  4BBR H;  1Z9F A;  2QEJ C;  2EXD A;  2R92 H;  1XMQ L;  3SXH A;  1N9W A;  2LKV A;  2F0S A;  2RSN A;  1A62 A;  1PRT F;  3DEP A;  3PSI A;  2PZW A;  2Q8R E;  1C4Q A;  1TQO A;  1UE7 A;  3MEF A;  2UXD L;  2N8N A;  2JP1 A;  3M4O H;  1UEB A;  1WOC A;  4IAL A;  3DUZ A;  2AHO B;  3D31 A;  4IUQ A;  4XYO A;  3KLS X;  2E74 C;  3C3L A;  1HXY D;  1O78 A;  2XRS D;  3NTI A;  1AN8 A;  4GNX C;  1BKB A;  1ZEQ X;  3DWQ A;  3IKJ A;  1EY6 A;  1KHI A;  4LFA L;  4HIO A;  1SFO B;  2NZO A;  3ERO A;  1WD1 A;  1DCZ A;  3KLS A;  4DK3 C;  2Q2T A;  3QJY A;  1VQC A;  1Q8K A;  3QG1 A;  1NJI C;  4KKS A;  4A3C G;  2F0W A;  5FKA C;  1EWH A;  1JB3 A;  2WAQ E;  1I94 L;  1BR9 A;  2R61 A;  4RA8 A;  1VQN A;  2JA5 G;  4A3G B;  3TEH B;  1XPO A;  3CQZ B;  2RHS B;  1N33 L;  4TQU S;  4BY1 B;  4ZQ3 A;  2ID0 A;  3X3M A;  4X6A H;  2BH2 A;  3J81 j;  4DNI A;  1JWU D;  2ZJQ A;  2C9O A;  1WD0 A;  1EY4 A;  4A3L G;  4JV5 Q;  2Z1C A;  3FPU B;  3OPO A;  1PFS A;  2ZTE A;  3T1Y Q;  4AQY L;  2N55 A;  3CCS A;  1GUO A;  5K36 G;  4JI8 Q;  1I4H A;  3K7A H;  3VR6 A;  3HOX B;  4JBM A;  3I55 A;  4RH6 A;  2AUK A;  5HY6 A;  3D4W A;  5C4Z A;  4XYQ A;  1KDA A;  2DY7 A;  2IPK D;  4DV7 Q;  4DUY L;  3S1R H;  4TRD A;  1OTC A;  4ZUJ A;  1IHZ A;  4NMZ A;  2JA6 G;  5BN4 A;  2Z4I A;  4ZCK A;  1K83 B;  4JI7 Q;  2E2J B;  4XXE A;  3A5U A;  4X64 L;  4RGO S;  1N36 Q;  3GTK B;  4X62 Q;  1FNV A;  1U4L A;  1K9M C;  3K7A B;  1YNN C;  5ELD A;  3F2C A;  4DAM A;  2PQE A;  3I4N B;  4GZY C;  4LF9 Q;  1QUQ A;  2L12 A;  2NVT B;  4C1N I;  3K6O A;  3K5O A;  1TWA H;  1RTO A;  4KKT A;  4HTH A;  3AQQ A;  2IX1 A;  1DZ1 A;  2MO1 A;  1O7L A;  4KJO A;  3VR4 A;  2QKI C;  4AQY Q;  4RGN A;  5COR A;  1N32 L;  3CXC A;  3NWT A;  1MI2 A;  2E8G A;  2ATW A;  3TME A;  1B70 B;  4A93 H;  2F0M A;  4K2L A;  4A93 G;  5KNC A;  1U0L A;  4ID6 A;  1SNC A;  3G7L A;  5ELO A;  3QB3 A;  3CCL A;  2DNE A;  1EIY B;  2LSS A;  2MFI A;  3A7L A;  5C4X H;  2IT1 A;  5ELB A;  2ZM6 Q;  4A3E B;  2ZJR A;  3RZO H;  4A3J H;  2JA9 A;  1E22 A;  1XPU A;  4JI0 L;  3IFD A;  3I91 A;  1IL8 A;  5C4J H;  3WOE A;  1L1O B;  1HNX Q;  5ELE A;  1S4Z A;  3IAY A;  1HZ9 A;  1X65 A;  4JVZ A;  5FJ8 H;  2ZJP A;  1PHJ A;  2NVX H;  4G7H C;  2JJQ A;  2N3S A;  3PUW A;  3RN5 A;  3ERQ A;  1MBY A;  2NWG A;  3H91 A;  5IYC G;  4X3T A;  1M90 C;  2CWA A;  3F2U A;  2D62 A;  1FNU A;  1EZ6 A;  1YNJ C;  3HOW H;  1CT1 D;  3HOY B;  2BA1 A;  2L4N A;  2J4X A;  1IBK Q;  4IPH A;  1YZ6 A;  2KHJ A;  5FOB B;  2B2V A;  5DM7 3;  5BN5 A;  4GOP C;  1D1I A;  1CA6 A;  3BS1 A;  4HAE A;  3SGI A;  2I07 B;  4J1M A;  1Q7Y C;  4BY7 B;  5E7N A;  5DLQ E;  4R4Q A;  1A3T A;  2KEE A;  1BBW A;  2XWJ B;  4POF A;  2GA4 B;  4WRD A;  1TWC B;  3E9I A;  3CAM A;  3UDG A;  4BY1 H;  2K1B A;  4GN4 B;  2JXM B;  2V1C C;  2VS1 A;  2NN6 H;  1KNE A;  1IBM Q;  2WAQ B;  4JI1 Q;  1W6K A;  1QVC A;  5M5W B;  3KFU A;  3TS0 A;  4QIW B;  3HOZ H;  4PZ6 A;  3TN2 A;  4DAV A;  1N8R C;  1STB A;  2DY8 A;  1JJG A;  4CKB A;  2Q2U A;  3T4A C;  2CWP A;  3NEL A;  2A68 D;  1QNU A;  1JR0 D;  1VQB A;  4G4K A;  1YEZ A;  4Y7N H;  1GHJ A;  3GTJ H;  4JG2 A;  2NYZ D;  3KDF A;  3BJU A;  2OTJ A;  4A3L H;  3HKS A;  5C3E H;  1S5D D;  2F0L A;  5JJL A;  3T1H Q;  2F0P A;  3IL8 A;  2E2J H;  1PFN A;  3KJO A;  4QL5 A;  3MAQ A;  3PIP 3;  2K32 A;  3H3V C;  1TS4 A;  2KCN A;  1HFG A;  1YIT A;  5IP7 H;  1OXX K;  3ND8 A;  4DR5 L;  1EY0 A;  4QUC A;  4A3G G;  1LT5 D;  1IBM L;  2ZXP A;  4A3B G;  1CKN A;  3TZU A;  3GTM B;  3QIA A;  2XNA C;  3CMA A;  1BDO A;  2FMM A;  3RUZ A;  1X3F A;  1IL2 A;  4LF8 Q;  4L8J A;  4IQZ A;  1N33 Q;  3HRZ C;  1VQ4 A;  2J7Z A;  3J7Y W;  1PTO F;  3V2T A;  1Y1V B;  4ZRZ A;  1UAP A;  2K7V A;  2B2Y C;  4UP7 A;  3KBG A;  3L9A X;  1ZYR D;  4B3S L;  2M9V A;  4DAY B;  1TS2 A;  1SN8 A;  4HN7 A;  4TKO B;  4LF5 L;  4HR7 B;  1E24 A;  5IP7 G;  4QCL A;  2HHH Q;  2PI2 E;  2F4V Q;  4R4O A;  2E5L Q;  1J8I A;  4PZ8 A;  4DR3 Q;  1LT4 D;  1O80 A;  3E9H A;  3RD4 A;  4F87 A;  3A7A B;  5C44 B;  3F1Z A;  1EIG A;  2SEB D;  2D9U A;  1GUN A;  1VS0 A;  3I4N G;  1LTR D;  2A8V A;  4JI4 Q;  2F0I A;  5DNF A;  5L37 A;  4K6L A;  1PZK D;  1NTG A;  3V96 A;  3KLW A;  1JT8 A;  1HCZ A;  1G51 A;  1CKO A;  4MHE A;  2QA4 A;  4GS3 A;  1B9M A;  4HJ7 A;  1F77 A;  1SMY D;  4B3R Q;  2F0V A;  2R7Z H;  4UP8 A;  3GTK H;  5C3W A;  1L0Y B;  2KCT A;  5JJI A;  1P16 A;  1STG A;  3I56 A;  3HOU G;  5JJK A;  2F0G A;  2H1E A;  3HGB A;  1K28 A;  4X65 Q;  1HPC A;  1B9N A;  2QF7 A;  2WB1 E;  3NBH B;  2F4V L;  4JI3 Q;  1RKN A;  1PXU A;  1J5E Q;  4RHR A;  4DV7 L;  1CI3 M;  3VYU A;  5CV7 A;  1TT2 A;  1Y1V G;  4OWX B;  5JPN C;  2Z8L A;  3JAM E;  2EE1 A;  1V1Q A;  2D0O A;  4IPC A;  2HCC A;  2CH4 A;  4QB4 A;  1SMX A;  3MXG A;  4GOP A;  3Q6S A;  3S17 B;  1Y8P B;  1HFN A;  3EIV A;  2B63 H;  1I50 B;  1KQS A;  1SNQ A;  3RLO A;  3A5Z B;  4K6D A;  2MNA A;  4LF9 L;  2RCN A;  1B4O A;  2HD3 A;  4HSV A;  4K5W A;  4KMU C;  1V8Q A;  4QJF A;  1VQA A;  4MN3 A;  1I4G A;  1KDB A;  1F2M A;  3T1Y L;  1YBY A;  3D0F A;  1I6V C;  4HJA A;  1FJG L;  4RGM A;  2ICE C;  4HJ5 A;  1HTL D;  2JK8 A;  3OYY A;  1NAP A;  3CHB D;  3U9O A;  2K52 A;  4JI5 L;  2Y0S B;  2Z0S A;  5FLX E;  3H0G H;  2EPB A;  1KAB A;  2B8F A;  3I73 A;  1C9O A;  2EY1 A;  1I4P A;  2PMZ B;  1MSG A;  1B3A A;  4OIK A;  3K7U C;  4IPG A;  3GV6 A;  4FP5 D;  1QG7 A;  1DGS A;  4DR1 L;  4IOC A;  1BBU A;  1YHB A;  5GAD C;  2V4D A;  3TRE A;  3BDO A;  1YNN D;  1EY5 A;  1PH8 A;  3KUP A;  5IT9 E;  2E2H B;  1VQJ A;  4YIJ A;  1AP0 A;  4IUV A;  4EX5 A;  2VNU D;  1S3O A;  3T53 B;  3UE1 A;  3NQI A;  5C3E G;  1ASY A;  1E1O A;  3DWP A;  3K0X A;  3STB C;  2JA5 H;  1PVO A;  4JC0 A;  3GTQ B;  1TWH B;  2I5M X;  1STN A;  5IGB A;  1EY9 A;  1Z6H A;  5CV4 A;  2C35 B;  3PUX A;  1K8A C;  4K14 A;  4DV4 L;  5CV6 A;  2ZTD A;  4YWL A;  4AYB B;  1DD2 A;  3SHL A;  3RN2 A;  1PMR A;  4A3I H;  4JBJ A;  2J0T D;  3VR5 A;  1AZQ A;  5D65 A;  3W3A A;  4DV5 L;  2B2W A;  3IFT A;  5C4H A;  2IJ0 A;  1B1Z A;  1H9K A;  1XMQ Q;  5HUR A;  3TRZ A;  3HFZ B;  4QUF A;  4DV3 Q;  1E7Z A;  1X6O A;  3I2Z A;  1IZ6 A;  4JYA L;  4P2C B;  2EYH A;  2CHB D;  2YTX A;  4NXN L;  2B8G A;  1PV4 A;  2NBF A;  4YCV A;  5D3I B;  1M1K C;  3GO5 A;  1ILP A;  4HID A;  5C4X G;  1A0I A;  1PZJ D;  4BBR G;  4OO1 H;  4WFN 3;  4CJ1 B;  2O5I C;  2BE5 D;  1Y1W B;  2AQ3 B;  1VQL A;  3CCJ A;  1S5B D;  3S2D B;  2RKS A;  1D2B A;  1SE3 A;  3MFG A;  1XJV A;  2KA7 A;  3QR8 A;  5EAY A;  1CSP A;  1MSH A;  4RAU C;  3JAM i;  5M3F H;  3GTO H;  4RKL A;  4K0K L;  2HQL A;  1BVS A;  1SYG A;  1HUM A;  5T1I A;  4OEL B;  1XTC D;  1PZI D;  4OIJ A;  5KYL A;  5IYB G;  4K8J A;  4A3E G;  1PYS B;  3Q24 A;  1Y69 U;  4G57 A;  3P75 A;  2IW3 A;  2JEA I;  2O2L D;  1K3R A;  3ULP A;  4U68 A;  1LYL A;  1TU2 B;  1I50 H;  4RHS A;  1ET6 A;  1Q12 A;  2GVB A;  4GKK Q;  4ABN A;  1HZC A;  3ERS X;  1EYG A;  4A4I A;  1DOM A;  2RSO A;  2F0E A;  5KYI A;  5IYD H;  2R93 H;  3CCM A;  2NZ1 D;  3K8A A;  2PW5 A;  4DR5 Q;  4ZUI A;  1II3 A;  1XTD A;  3CQZ H;  1SYE A;  2PCF B;  3E6Z X;  2NUC A;  3BZD B;  3I4M B;  4DGZ A;  1STE A;  1CUK A;  1WYD A;  3CRL C;  1GM5 A;  1EOV A;  3AMU A;  5EKI A;  4X62 L;  1E0B A;  1Y1W G;  4FF3 A;  3OSO A;  5GRO A;  1OXT A;  1I3Q B;  3TQY A;  1SEB D;  3CCV A;  2F3I A;  1FYC A;  1KAW A;  2BH8 A;  4O2D A;  5LMU Q;  3K0Y A;  4EQP A;  3KOJ A;  1WTV A;  1ASZ A;  3SEB A;  2FHT A;  2K5W A;  5FO9 B;  3OW7 A;  5C0X G;  4OO1 I;  1PRT D;  3NBH A;  4PG3 A;  1WTR A;  3VA5 A;  2WAQ G;  3MFY A;  2PMZ E;  1TWF B;  1U4R A;  4NPS A;  1I6H H;  4KKU A;  2G9H D;  4IJL A;  3SK4 A;  2JA5 B;  1CA5 A;  1MJC A;  1ONL A;  3KLR A;  4X65 L;  2FIN B;  1WTH A;  4L5R C;  1VF7 A;  1L1O A;  4K5X A;  4BY1 G;  1G29 1;  4ZAI A;  2IWH A;  3TS2 A;  1VQG A;  2UU9 L;  1LTS D;  1PH2 A;  5LHY 1;  1Z7T A;  2JA6 B;  2DNC A;  4GLX A;  2HT1 A;  2QW7 A;  2C5C A;  2PYK A;  1E2Z A;  1WJJ A;  1M8A A;  2NVQ H;  1KAA A;  3TP7 A;  4PQX A;  1UE5 A;  4DAP A;  3R2T A;  4CJ2 C;  2UXB L;  1H9S B;  2HQE A;  2PO4 A;  4JBK A;  2UUC L;  4Q5V A;  3VDY A;  1KC8 C;  1RF2 D;  2L0C A;  5M3M H;  4DR3 L;  4QF4 A;  1FGU A;  4LMQ D;  2AUJ D;  2F0Q A;  1I5F A;  1VMC A;  2B2U A;  4DXG A;  4A93 B;  1PH1 A;  4LUV A;  1CKN B;  4L5T A;  3N6R A;  5A2Q E;  1VMP A;  4GKJ L;  1HR0 Q;  3PO3 H;  5C3E B;  1G91 A;  2M00 A;  4FDB A;  1X3P A;  4UP9 A;  1D5M C;  4YCU A;  2YV5 A;  5C0X J;  2VB3 X;  3CD6 A;  4BA2 I;  1UWV A;  1TII D;  1XNQ L;  1X3Q A;  3C2P A;  4HMI A;  1BO0 A;  4UDU C;  4Y7N B;  4A3I B;  1ESF A;  5IP9 H;  4CKE A;  1Q3L A;  1ENC A;  1R4Q B;  1SYC A;  3SK6 A;  3BDC A;  2M2L A;  1D8L A;  1FNW A;  1V1O A;  4X3S A;  1A6X A;  1LLR D;  4IFD I;  4JI8 L;  4JI1 L;  2CVR A;  4WJW A;  3PO2 H;  1J9O A;  2EYJ A;  1BOS A;  4BY7 H;  4A3F H;  3FKI H;  3Q0A A;  4MTN A;  3DHQ A;  3MXU A;  3M7N A;  4DR4 Q;  2NTS A;  1S40 A;  4HMJ A;  3VYT A;  5HGT A;  2OF1 A;  2AWN A;  2PNR C;  2ZM6 L;  1Y8N B;  4C2M H;  1CZW A;  1X55 A;  2NVY H;  3HKZ E;  2CCZ A;  2VY3 A;  3KBX A;  4H0L C;  3K5L A;  2B2V C;  2LS0 1;  1VDZ A;  2K28 A;  1ZYR C;  3J80 i;  1GUG A;  2LXJ A;  2MQH A;  1F9S A;  1HJP A;  2ALY B;  4KV6 A;  3MVV A;  4HCS A;  1TR5 A;  1K0R A;  1B3Q A;  3PUZ A;  3HOZ B;  1EEF D;  1DOK A;  4C3H B;  3HOU B;  3EVQ A;  1QB5 D;  1K3B C;  3GTG B;  4TSS A;  3D4R A;  4BY7 G;  1EWI A;  1G6P A;  4DU9 A;  2KQ3 A;  2IHE A;  5ELF A;  3K5M A;  1PH3 A;  4OX9 Q;  2UXC Q;  1JJC B;  1KDC A;  1IBK L;  3J7A 5;  1GHK A;  4BS9 A;  4J6H A;  1CQF A;  3H3V H;  4A3I G;  4NXN Q;  2YU9 B;  4KJN A;  4L5S A;  1ZXT A;  4XDX A;  5KRU A;  2L9H A;  5IGG A;  1AZP A;  1PLF A;  2G9D A;  2Q8I B;  3FMC A;  2KBN A;  2YYZ A;  5CV5 A;  3BYY B;  1EEI D;  1HQR D;  1G2T A;  5IOD A;  4DR6 Q;  2JA6 H;  2WIN B;  5E4X A;  5EPJ A;  5AJ3 Q;  1QZG A;  3MTS A;  3GTQ H;  4F8M A;  1WTO A;  5CBA E;  5CMD A;  2X69 A;  4UY8 C;  3CPW A;  1A63 A;  4OON A;  3BU2 A;  3NHH A;  5IWA Q;  4A3M G;  2KEC A;  4LUO A;  1ZKO A;  4OO1 G;  1AEX A;  4DNR B;  3M3Y H;  3AU7 A;  4DR7 Q;  2OEO A;  2KJX A;  4EQN A;  3NTK A;  1WFQ A;  3S1Q H;  3DM1 A;  2HIX A;  2JYO A;  1VQF A;  2WAC A;  1K83 H;  2JA7 H;  4NW2 A;  1TWF H;  2CFM A;  2R7D A;  3S2D H;  4DKA C;  3CKI B;  1HR0 W;  2VUM B;  1HQM C;  5A35 A;  4V0B A;  1EY7 A;  4JK1 C;  5LMU L;  1Y14 B;  1SNM A;  4K2K A;  4HJ9 A;  5M3F B;  1SNP A;  2UUA L;  4POG A;  1J5E L;  1OXV A;  1R4P B;  1LTG D;  2ASB A;  4LFA Q;  4P74 A;  1FVI A;  2N78 A;  3JAM c;  1BCP B;  3D8G A;  3GTL B;  3GD7 A;  1PFB A;  4LF4 L;  1EQQ A;  1Q90 A;  1A8V A;  4CBV A;  3MXN A;  1SRU A;  4IOA A;  1TWH H;  1SE8 A;  2ES2 A;  4JW0 A;  1NBW A;  2DN8 A;  1UEA B;  2F0J A;  2G5D A;  2RDH A;  3KDF B;  1K0S A;  4HJ8 A;  1LT3 D;  4LF6 Q;  2RBM A;  5IYB H;  2I5H A;  3KF8 A;  4GKK L;  4C2M B;  1TS3 A;  2RA4 A;  2IY5 B;  3T51 B;  1PTO D;  5C4X B;  4OL7 A;  4DV1 Q;  2R3Z A;  4FVM A;  2BDO A;  3KF6 A;  5CBE E;  4RCO A;  4DK1 A;  2FJ2 A;  4KHZ A;  4DV4 Q;  3CCQ A;  2A6E C;  3KF6 B;  1JE4 A;  2UUB Q;  4IFD G;  2JE6 I;  3L2P A;  2A6E D;  1AE2 A;  1XMO L;  1VQ9 A;  1WTW A;  1JCK B;  2Z4H A;  4CDC C;  3HOW B;  1I4Q A;  3AFP A;  4ZYS A;  1EQT A;  2IHF A;  5IYD G;  2UU9 Q;  5JVG 3;  1B8A A;  4OWW B;  4A3D G;  4LF8 L;  2FFK B;  4P73 A;  1BNZ A;  3W2D A;  4WOR A; 
#chains in the Genus database with same CATH homology
 2SNS A;  3HEJ A;  2RDG A;  2SNM A;  2A74 C;  2B2U C;  4LK1 C;  1SYD A;  1ESR A;  3PO2 B;  3TSS A;  1ENF A;  5C6A A;  1YNJ D;  3DXJ C;  1EYD A;  4K8I A;  3J81 L;  2Q8T A;  1RJT A;  1KLG D;  1BUV T;  3OIP A;  5EBD A;  4DN4 M;  1CHP D;  3D3R A;  1ICW A;  4I7Z C;  1UNS A;  3O13 A;  5EGT A;  3OWE B;  2EVB A;  3VA7 A;  1V1P A;  4E6I A;  4PMB A;  3QOL A;  1TS5 A;  1GUW A;  4IFD J;  2F03 A;  1FD7 D;  5G3L F;  4FF2 A;  1H9M A;  4HED A;  1LAC A;  3VYS A;  1DOL A;  2NVX B;  3G6J B;  1BXT A;  1LTA D;  4Z9C B;  3KK7 A;  4IUU A;  4B9W A;  5CGK A;  1PDQ A;  1WCM B;  1KTK A;  3R93 A;  5I9P A;  1HHV A;  2SOB A;  4KY6 A;  5I6W A;  2PW7 A;  2RVL A;  1ILQ A;  2EDG A;  3E0J A;  5DM6 3;  3M85 A;  1B2T A;  1QE6 A;  1HRJ A;  2NB0 A;  5DEH A;  2A73 B;  3TP8 A;  4O42 A;  4B08 A;  4XQQ A;  3P7J A;  2KUM A;  2BE5 C;  2A6H D;  2F0U A;  1JOO A;  5JOB A;  3S2H B;  2HCI A;  3X3N A;  2EYL A;  5CR3 A;  2CQA A;  4RGT A;  1XX8 A;  4Q0F A;  2LFN A;  3RMH A;  2A5H A;  2HDL A;  2I46 A;  1JQY D;  1SAP A;  3D6W A;  1PYW D;  4DAY A;  1JWS D;  2E2D C;  3Q22 A;  4H44 C;  1U9R A;  5M3M B;  3LX0 A;  3I90 A;  1SJE D;  4QMG A;  1SE4 A;  3I4L A;  4DK0 A;  5EJW A;  3A55 A;  4MIU A;  4F88 A;  3PO3 B;  1DJR D;  2F0H A;  4PV1 C;  1QOH A;  2O4X A;  1O7Y A;  4C3I B;  1I4R A;  2EYO A;  1HA5 A;  2F0T A;  2RQX A;  3R8B A;  2MPM A;  1V1P B;  3MC0 B;  3HS0 C;  5FO8 B;  1JC7 A;  1EIH A;  1BF4 A;  4NKL A;  2VXW A;  1C48 A;  3V05 A;  2K6A A;  1I4X A;  2F4I A;  2WKD A;  2IX0 A;  3I8Z A;  2E75 C;  3NXW A;  4B9X A;  2EJF C;  5I2X A;  4G7O C;  2CW0 C;  1JOR A;  5BN3 A;  3A56 A;  3I72 A;  4FF4 A;  2PZU A;  1D5X C;  2BCO A;  1SSO A;  2B2T C;  3TDQ A;  2EOT A;  1B44 D;  5I6Y A;  3I3C A;  4PNY A;  1WTX A;  3L7Z C;  2EY2 A;  5EQ0 A;  1QJO A;  5I4D A;  3HP3 A;  4XT3 B;  1ET9 A;  1LT6 D;  3VYR A;  2ZT9 C;  4V19 0;  1EYC A;  1SMY C;  3OWF A;  5A2Q L;  5M9O A;  4L6T B;  3LWE A;  5IIF A;  4DF7 A;  1AFP A;  2LY7 A;  2TMP A;  2L11 A;  5K5P A;  1EU4 A;  4CKC A;  1D5Z C;  3J7A V;  5KEE A;  1CZG A;  3NP8 A;  4FXK C;  1BCP D;  3S1Q B;  5C3X A;  3TBI B;  5IGE A;  2HDM A;  2EYP A;  1K8M A;  1DM0 B;  3NSW A;  5IOC A;  3SR1 A;  1QIL A;  2K5Q A;  2B2T A;  1R9T B;  1S5C D;  3BDL A;  4XIG S;  4IN3 A;  1JOQ A;  1XWE A;  5DAU A;  3BVM A;  3D6C A;  2A69 C;  3C1F A;  2CW0 D;  1QWY A;  2WB1 B;  1W6J A;  3J7A F;  2D2C C;  1S5E D;  2HUG A;  3A8K E;  5C0X I;  4CHT B;  3E5S A;  3DEO A;  2OXP A;  2KHS A;  5FO7 B;  1SND A;  1HA6 A;  3QWN A;  4LJZ C;  4EQO A;  5I2Y A;  1CK1 A;  2X6G A;  2BA0 A;  3EJI A;  4J8Q A;  5E1F A;  3NUC A;  1EQV A;  4IUN A;  1MGS A;  4IUR A;  2QDB A;  4KY7 A;  4ZK9 B;  3VR3 A;  4BWG B;  5D14 A;  2PPB C;  3PUY A;  5T1G A;  3FDT A;  4K5V A;  3P1H A;  1X32 A;  5C5L A;  2WKC A;  1JIC A;  5CV9 A;  5E4W C;  1BQQ T;  3H09 A;  4EVO A;  4N9P A;  1F2L A;  1RCV D;  3UI2 A;  4IZ8 A;  2B2W C;  1TVX A;  2BOS A;  3A8I E;  5D3D A;  1KLU D;  1KNA A;  3BVG A;  4XQJ A;  1EYA A;  3GQB A;  2MHV A;  2K04 A;  5NUC A;  1H9R A;  2KOL A;  4ZKC B;  3H94 A;  2F3W A;  4R8I A;  2K33 A;  5ISR A;  1PTO B;  3HOV B;  3RLF A;  5KIX A;  4RFB A;  3QOJ A;  3OOC A;  1GUS A;  4KN4 C;  1GXD C;  2XWB B;  1O7Z A;  3PMF A;  3S16 B;  3S15 B;  1MD2 D;  1HUN A;  4BA1 I;  2K5D A;  1IW7 D;  2WV6 D;  3T56 B;  1G6Z A;  1CTM A;  2FMC A;  4UAI A;  4ODG A;  1F2Y A;  2JEB I;  2PZT A;  1JWM D;  1GUT A;  1H9S A;  4KD3 A;  1I6H B;  1EY8 A;  3J81 E;  3ITP A;  1F9Q A;  1Y8O B;  2E76 C;  2NN6 G;  2KVM A;  3WOF A;  5KNB A;  5LL6 X;  4XTC S;  2K05 A;  3ND9 A;  3EQL C;  2XVS A;  1EZ8 A;  1CM9 A;  1IW7 C;  5J1Z A;  4X3U A;  1Q8I A;  1IKL A;  3C1E A;  4C3J B;  5EKK A;  3GTO B;  2B63 B;  5CC4 A;  4FNF A;  1DYQ A;  4DFA A;  3MA2 B;  5EKL A;  4PMC A;  4LAA A;  1OXU A;  1CQV A;  3S1N B;  4L63 B;  2QCP X;  2JA8 B;  1Z47 A;  1EU3 A;  3J80 E;  3A8J E;  4HCE A;  1LV9 A;  2F3V A;  3WDN A;  2JSO A;  5AFW A;  5C0X H;  3JAM L;  1B50 A;  3SDZ A;  2R93 B;  2E2I B;  5F2D A;  3C46 A;  4IUP A;  4RWS C;  4BBS B;  1A3U A;  1SNO A;  5I9O A;  4CGY B;  1TWG B;  4N9T A;  1D1K A;  1A15 A;  1BBX C;  2K03 A;  1IYU A;  2EYF A;  4FYD A;  3L3O C;  4KK7 A;  1U4P A;  4C3J G;  4C1N K;  2XRQ D;  3A54 A;  1WTP A;  3GV3 A;  1DXM A;  1RD9 D;  3M3Y B;  5C5M A;  2L1B A;  5FLX L;  2BDN A;  3FVQ A;  3ZYY X;  1XYI A;  1H9J A;  5COY A;  5G3L D;  1FR3 A;  1RHP A;  2AQ2 B;  5LL6 S;  3TZD A;  3HZX A;  3PIO 3;  1L0X B;  3S1M B;  3NPP A;  5IT9 L;  2LMC B;  2A69 D;  3R3O A;  1NR2 A;  3MXP A;  1TY0 A;  2R92 B;  2F1M A;  2EY5 A;  5M5Y B;  5FK9 C;  2EYM A;  4C3H G;  1T5E A;  1G2S A;  2K01 A;  3DMU A;  1LTT D;  2TSS A;  4OGQ C;  2EJG C;  3SVM A;  2EJM A;  1A2T A;  1M4V A;  2MP1 A;  3OHX C;  2L5T A;  1WTQ A;  5K36 H;  3Q23 A;  3MZ5 A;  2R7Z B;  1F2Z A;  1LTI D;  4FXG C;  1U4M A;  3S14 B;  5EPL A;  3M4Y A;  2IX3 A;  1EFI D;  3LNN A;  4A3F B;  4C3I G;  5EPK A;  4EGV A;  1EOT A;  3HG9 A;  1UUP A;  3BVZ A;  1NSN S;  3SE0 A;  5M5X B;  1E2V A;  4KI0 A;  5JPM C;  1FGB D;  5IGF A;  2NTT A;  2NVY B;  3TP5 A;  3K57 A;  2XSC A;  1LO5 D;  4BBR B;  1ML0 D;  3TP6 A;  1ENA A;  3GP7 A;  3S9W A;  1SBB B;  1SJH D;  1S5F D;  3ONA B;  5EBC A;  1JOK A;  4DNT B;  3R2I A;  4G7Z C;  2R6G A;  4KD4 A;  1RTN A;  1V43 A;  1STH A;  2MUY A;  3D4D A;  3NK9 A;  4ME5 A;  4NDX A;  1CFM A;  4FXD A;  3HKZ B;  4M8A A;  4X3K A;  1VCI A;  2OT2 A;  2NVQ B;  1EL0 A;  4JBW A;  2ZXR A;  3NTH A;  4FF1 A;  3CU7 A;  1DON A;  3FEW X;  1T5X D;  4A3K B;  5JJZ A;  4S3S A;  1NUC A;  3FRP B;  4R9W A;  1E2W A;  1C8C A;  3MHB A;  4U67 3;  3K58 A;  4C56 C;  3GTJ B;  2IL8 A;  3OIQ A;  2QIL A;  2WP8 J;  2EZV A;  3N52 A;  1K8O A;  2VB2 X;  1OXS C;  3LWU A;  1QNK A;  2F0K A;  2SDF A;  2H4O A;  3CRK C;  2XIW A;  2ZXO A;  1SE2 A;  2N88 A;  3RZD B;  5CV8 A;  2B2Y A;  2KED A;  1SYF A;  2MGS A;  4H7B A;  4A3D B;  1VF5 C;  3EFX D;  4XT1 B;  3MEH A;  5IGC A;  1SDF A;  3NQT A;  3P20 A;  2A68 C;  3K5N A;  1STA A;  3M4O B;  4ZLT F;  3OMG A;  1G8Z D;  2D5D A;  3SK5 A;  1BCP F;  2NN6 I;  4H13 C;  5JEA J;  2JA7 B;  4KN7 C;  5JVH 3;  1NCV A;  3URY A;  3RZO B;  4KY5 A;  5JAV A;  3FPP A;  5C4J B;  3DWA A;  4RCN A;  4DXF A;  1WVL A;  4HSP A;  3SK8 A;  1LTB D;  2EY6 A;  1PFM A;  1F9R A;  4O1N A;  1LAB A;  1ROD A;  1TKW B;  3M7G A;  4FO2 A;  1NR4 A;  5ELC A;  3VR2 A;  3NBI A;  4XQN A;  1EWC A;  3S1R B;  2X6L A;  2RDF A;  1Q1E A;  3H6M A;  3OMC A;  1BCP C;  4KTA A;  4PMW A;  1XXG A;  3K59 A;  2MJ8 A;  1PTO H;  1AW7 A;  3J80 L;  4KHV A;  1HTP A;  2A6H C;  1TY2 A;  5JEA G;  3T13 A;  4NP5 A;  4A3B B;  3I70 A;  3QO2 A;  1Q1B A;  2ICI A;  5TSS A;  1PTO C;  4I65 A;  1IYV A;  1A3V A;  1CHQ D;  2F0D A;  2F0O A;  5CYU A;  4A3J B;  3U9S A;  4ULL A;  1SYB A;  4DA2 A;  1OO9 B;  3BG3 A;  5JEA H;  5J22 A;  2B39 A;  4F7X A;  1PRT C;  3T16 A;  2EXZ A;  1SXT A;  3MWY W;  1STY A;  3BYT B;  1TWA B;  4OHJ A;  4CJ0 B;  4ILW A;  1GJX A;  1IKM A;  4R8N A;  2AWO A;  2XN9 C;  5E3F A;  1B53 A;  1A2U A;  4A3M B;  5J39 A;  4M1U B;  4IUT A;  3NWS A;  1PRT B;  5KGU A;  1GOZ A;  4IFD H;  2L55 A;  5KND A;  3H0G B;  2KCC A;  1QCB D;  2F0N A;  3FKI B;  2AQ1 B;  4ZKB B;  1F9P A;  2F0F A;  3EA6 A;  1D6E C;  3PUV A;  3PV0 A;  2O5J C;  1RDP D;  5IGD A;  4RKB A;  3AB9 A;  3NE5 B;  3GTP B;  2WII B;  2ENB A;  2QEJ C;  3SXH A;  2LKV A;  2F0S A;  2RSN A;  1PRT F;  3DEP A;  2PZW A;  2Q8R E;  1C4Q A;  1TQO A;  2JP1 A;  4IAL A;  3DUZ A;  3D31 A;  4IUQ A;  4XYO A;  3KLS X;  2E74 C;  3C3L A;  1HXY D;  1O78 A;  2XRS D;  3NTI A;  1AN8 A;  1ZEQ X;  3DWQ A;  3IKJ A;  1EY6 A;  1SFO B;  3ERO A;  1WD1 A;  1DCZ A;  3KLS A;  3QJY A;  3QG1 A;  4KKS A;  2F0W A;  5FKA C;  1EWH A;  1JB3 A;  1BR9 A;  2R61 A;  4RA8 A;  4A3G B;  3CQZ B;  4TQU S;  4BY1 B;  4ZQ3 A;  2ID0 A;  3X3M A;  1JWU D;  2C9O A;  1WD0 A;  1EY4 A;  2Z1C A;  3FPU B;  3OPO A;  2N55 A;  1GUO A;  5K36 G;  1I4H A;  3VR6 A;  3HOX B;  4RH6 A;  2AUK A;  3D4W A;  5C4Z A;  4XYQ A;  1KDA A;  2DY7 A;  2IPK D;  4TRD A;  4ZUJ A;  1IHZ A;  4NMZ A;  5BN4 A;  2Z4I A;  1K83 B;  2E2J B;  4XXE A;  4RGO S;  3GTK B;  1FNV A;  1U4L A;  3K7A B;  1YNN C;  5ELD A;  2PQE A;  3I4N B;  4GZY C;  2L12 A;  2NVT B;  4C1N I;  3K6O A;  3K5O A;  1RTO A;  4KKT A;  4HTH A;  2IX1 A;  1DZ1 A;  1O7L A;  4KJO A;  3VR4 A;  2QKI C;  4RGN A;  5COR A;  3NWT A;  1MI2 A;  3TME A;  2F0M A;  4K2L A;  5KNC A;  4ID6 A;  1SNC A;  3G7L A;  3QB3 A;  2DNE A;  3A7L A;  2IT1 A;  5ELB A;  4A3E B;  3IFD A;  3I91 A;  1IL8 A;  3WOE A;  5ELE A;  1S4Z A;  3IAY A;  4G7H C;  3PUW A;  3ERQ A;  1MBY A;  2NWG A;  3H91 A;  4X3T A;  3F2U A;  2D62 A;  1FNU A;  1EZ6 A;  1YNJ C;  1CT1 D;  3HOY B;  2BA1 A;  2L4N A;  2J4X A;  5FOB B;  2B2V A;  5DM7 3;  5BN5 A;  1D1I A;  1CA6 A;  3BS1 A;  4HAE A;  2I07 B;  4J1M A;  4BY7 B;  1A3T A;  2KEE A;  2XWJ B;  2GA4 B;  4WRD A;  1TWC B;  2K1B A;  2JXM B;  2NN6 H;  1KNE A;  2WAQ B;  1W6K A;  5M5W B;  4QIW B;  3TN2 A;  4DAV A;  1STB A;  2DY8 A;  4CKB A;  3T4A C;  2A68 D;  1QNU A;  1JR0 D;  4G4K A;  1GHJ A;  2NYZ D;  1S5D D;  2F0L A;  2F0P A;  3IL8 A;  1PFN A;  3MAQ A;  3PIP 3;  2K32 A;  3H3V C;  1TS4 A;  2KCN A;  1HFG A;  1OXX K;  3ND8 A;  1EY0 A;  4QUC A;  1LT5 D;  2ZXP A;  3TZU A;  3GTM B;  3QIA A;  2XNA C;  1BDO A;  2FMM A;  3RUZ A;  4L8J A;  4IQZ A;  3HRZ C;  2J7Z A;  3J7Y W;  1PTO F;  3V2T A;  1Y1V B;  4ZRZ A;  1UAP A;  2K7V A;  2B2Y C;  3KBG A;  3L9A X;  1ZYR D;  2M9V A;  1TS2 A;  4HN7 A;  4TKO B;  4HR7 B;  4QCL A;  1J8I A;  1LT4 D;  1O80 A;  3RD4 A;  4F87 A;  3A7A B;  5C44 B;  1EIG A;  2SEB D;  2D9U A;  1GUN A;  1LTR D;  2F0I A;  5DNF A;  4K6L A;  1PZK D;  3V96 A;  1HCZ A;  4MHE A;  1B9M A;  1F77 A;  1SMY D;  2F0V A;  5C3W A;  1L0Y B;  1STG A;  2F0G A;  2H1E A;  3HGB A;  1HPC A;  1B9N A;  2QF7 A;  1RKN A;  1PXU A;  4RHR A;  1CI3 M;  3VYU A;  5CV7 A;  1TT2 A;  5JPN C;  2Z8L A;  3JAM E;  2EE1 A;  2HCC A;  4QB4 A;  3MXG A;  3Q6S A;  3S17 B;  1Y8P B;  1HFN A;  1I50 B;  1SNQ A;  4K6D A;  1B4O A;  4HSV A;  4KMU C;  4K5W A;  1V8Q A;  4MN3 A;  1I4G A;  1KDB A;  1F2M A;  1I6V C;  4RGM A;  2ICE C;  1HTL D;  1NAP A;  3CHB D;  3U9O A;  2Y0S B;  5FLX E;  2EPB A;  1KAB A;  2B8F A;  3I73 A;  2EY1 A;  1I4P A;  2PMZ B;  1MSG A;  1B3A A;  4OIK A;  3GV6 A;  4FP5 D;  1QG7 A;  2V4D A;  3BDO A;  1YNN D;  1EY5 A;  3KUP A;  5IT9 E;  2E2H B;  4YIJ A;  1AP0 A;  4IUV A;  2VNU D;  3T53 B;  3NQI A;  3DWP A;  3GTQ B;  1TWH B;  1STN A;  5IGB A;  1EY9 A;  1Z6H A;  5CV4 A;  3PUX A;  4K14 A;  5CV6 A;  4AYB B;  1DD2 A;  3SHL A;  1PMR A;  2J0T D;  3VR5 A;  1AZQ A;  5D65 A;  3W3A A;  2B2W A;  3IFT A;  5C4H A;  2IJ0 A;  1B1Z A;  1H9K A;  5HUR A;  4QUF A;  4P2C B;  2EYH A;  2CHB D;  2B8G A;  2NBF A;  5D3I B;  3GO5 A;  1ILP A;  1PZJ D;  4OO1 H;  4WFN 3;  4CJ1 B;  2O5I C;  2BE5 D;  1Y1W B;  2AQ3 B;  1S5B D;  3S2D B;  2RKS A;  1D2B A;  1SE3 A;  3MFG A;  2KA7 A;  1MSH A;  4RAU C;  4RKL A;  1SYG A;  1HUM A;  5T1I A;  5KYL A;  1XTC D;  1PZI D;  4OIJ A;  4K8J A;  3Q24 A;  1Y69 U;  4G57 A;  3P75 A;  2IW3 A;  2JEA I;  2O2L D;  4U68 A;  1TU2 B;  4RHS A;  1ET6 A;  1Q12 A;  4ABN A;  1DOM A;  2RSO A;  2F0E A;  5KYI A;  2NZ1 D;  2PW5 A;  4ZUI A;  1II3 A;  1SYE A;  2PCF B;  3E6Z X;  2NUC A;  3BZD B;  3I4M B;  4DGZ A;  1STE A;  3CRL C;  3AMU A;  5EKI A;  1E0B A;  4FF3 A;  3OSO A;  1OXT A;  1I3Q B;  1SEB D;  1FYC A;  3K0Y A;  4EQP A;  1WTV A;  3SEB A;  2FHT A;  2K5W A;  5FO9 B;  3OW7 A;  5C0X G;  4OO1 I;  1PRT D;  3NBH A;  1WTR A;  3VA5 A;  3MFY A;  1TWF B;  1U4R A;  4KKU A;  2G9H D;  3SK4 A;  2JA5 B;  1CA5 A;  1ONL A;  3KLR A;  2FIN B;  1VF7 A;  4K5X A;  1G29 1;  4ZAI A;  2IWH A;  1LTS D;  5LHY 1;  1Z7T A;  2JA6 B;  2DNC A;  2C5C A;  2PYK A;  1E2Z A;  1M8A A;  1KAA A;  3TP7 A;  4PQX A;  4DAP A;  3R2T A;  4CJ2 C;  1H9S B;  2HQE A;  2PO4 A;  4Q5V A;  1RF2 D;  2L0C A;  4QF4 A;  4LMQ D;  2AUJ D;  2F0Q A;  1VMC A;  2B2U A;  4DXG A;  4A93 B;  3N6R A;  5A2Q E;  1VMP A;  5C3E B;  1G91 A;  2M00 A;  1X3P A;  1D5M C;  5C0X J;  2VB3 X;  4BA2 I;  1TII D;  1X3Q A;  3C2P A;  4HMI A;  4Y7N B;  4UDU C;  1BO0 A;  4A3I B;  1ESF A;  4CKE A;  1Q3L A;  1ENC A;  1R4Q B;  1SYC A;  3SK6 A;  3BDC A;  2M2L A;  1FNW A;  1V1O A;  4X3S A;  1A6X A;  1LLR D;  4IFD I;  2CVR A;  4WJW A;  1J9O A;  2EYJ A;  1BOS A;  3Q0A A;  3DHQ A;  3MXU A;  3M7N A;  2NTS A;  4HMJ A;  3VYT A;  5HGT A;  2OF1 A;  2AWN A;  2PNR C;  1Y8N B;  1CZW A;  3KBX A;  4H0L C;  3K5L A;  2B2V C;  2LS0 1;  1VDZ A;  2K28 A;  1ZYR C;  1GUG A;  1F9S A;  4KV6 A;  3MVV A;  4HCS A;  1TR5 A;  3PUZ A;  3HOZ B;  1EEF D;  1DOK A;  4C3H B;  3HOU B;  3EVQ A;  1QB5 D;  3GTG B;  4TSS A;  3D4R A;  4DU9 A;  2KQ3 A;  5ELF A;  3K5M A;  1KDC A;  1GHK A;  4BS9 A;  4J6H A;  1CQF A;  2YU9 B;  4KJN A;  1ZXT A;  4XDX A;  5KRU A;  2L9H A;  5IGG A;  1AZP A;  1PLF A;  2G9D A;  2Q8I B;  3FMC A;  2YYZ A;  5CV5 A;  3BYY B;  1EEI D;  1HQR D;  1G2T A;  5IOD A;  2WIN B;  5E4X A;  5EPJ A;  3MTS A;  4F8M A;  1WTO A;  5CBA E;  5CMD A;  2X69 A;  3NHH A;  2KEC A;  1ZKO A;  4OO1 G;  1AEX A;  4DNR B;  3AU7 A;  2OEO A;  2KJX A;  4EQN A;  3NTK A;  3DM1 A;  2JYO A;  2WAC A;  4NW2 A;  3CKI B;  2VUM B;  1HQM C;  5A35 A;  4V0B A;  1EY7 A;  4JK1 C;  1SNM A;  4K2K A;  5M3F B;  1SNP A;  1OXV A;  1R4P B;  1LTG D;  1BCP B;  3D8G A;  3GTL B;  3GD7 A;  1PFB A;  1Q90 A;  4CBV A;  3MXN A;  2DN8 A;  1UEA B;  2F0J A;  2RDH A;  1LT3 D;  2RBM A;  3KF8 A;  4C2M B;  1TS3 A;  2RA4 A;  3T51 B;  1PTO D;  5C4X B;  4OL7 A;  2R3Z A;  4FVM A;  2BDO A;  5CBE E;  4RCO A;  4DK1 A;  2FJ2 A;  4KHZ A;  2A6E C;  1JE4 A;  4IFD G;  2JE6 I;  2A6E D;  1WTW A;  1JCK B;  2Z4H A;  3HOW B;  1I4Q A;  4ZYS A;  1EQT A;  5JVG 3;  2FFK B;  1BNZ A;  3W2D A;  4WOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...