3X3UA

Crystal structure of wild-type of e. coli cuta1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
TASVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYEVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of wild-type of E. coli CutA1
rcsb
source organism Escherichia coli k-12
molecule tags Metal binding protein
molecule keywords Divalent-cation tolerance protein CutA
total genus 24
structure length 104
sequence length 104
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3x3uA00
4USIA 3DFEA 2V5HG 1J2VA 2ZFHA 3AA8A 1UL3A 2DCLA 3AA9A 1VFJA 3NCPA 1QY7A 1NH8A 3NCQA 4OZNA 5D4LA 3TA0A 3CE8A 3M05A 4C3LA 3T9ZA 4USJC 2CZ4A 4CNZA 4NYPA 1UFLA 3MHYA 3AH6A 4C3KA 1UMJA 2J9DE 3OPKA 1V3SA 2VD3A 5D4OA 3L7PA 4CO1A 1Q1KA 4USHA 5DRKA 4NYOA 2JJ4D 1NH7A 1H3DA 3TA1A 2PIIA 4OZJA 4WK1A 3TA2A 4RX6A 4RWWA 4AFFA 2NUUG 4Y6IA 4OZLA 4Y65A 4C3MA 1OSCA 1HWUA 1V3RA 2XG8A 2J9EA 1P1LA 1V6HA 2GW8A 1NZAA 2XZWA 2J9DA 2Z0GA 1VHFA 3GSDA 2RD5C 4YB6A 1PILA 2NS1B 2EG2A 3O5TB 4YB7A 2XULA 3N5BA 5L9NA 2NUHA 4WK3A 4RLEA 2EG1A 5DS7A 1O51A 3AHPA 2O67A 4CO4A 2GNKA 1XK8A 3O8WA 3NCRA 3BZQA 4CO3A 5D4PA 2E66A 4IYQA 2J9CA 2ZOMA 1NAQA 1V9OA 5D4NA 4CO2A 1KR4A 4D3GA 4E98A 1UKUA 4CO5A 4D3HA 4CO0A 1GNKA 4ZK7M 1O5JA 2O66A 4RWXA 4YB5A 3HLUA 4R25A 2XBPA 3X3UA 2GX8A 4CNYA 3LF0A
chains in the Genus database with same CATH superfamily
1FDAA 1HQUA 4E2FB 5BJRA 4ZVPB 2DGUA 2LQ5A 3H98A 2AJ1A 3FBFA 5EX0A 1CPZA 3TAPA 3CCES 5HVFA 2R7UA 1RT5A 3PXGa 2WBRA 4DCPB 1I3OB 2JC1A 2FD2A 2XMKA 1N36J 4KJIA 2APOA 3PRBA 2DCLA 4IOBA 2LVWA 2CIMA 2Y1LB 3HSGA 3IWXA 4CLTA 4DZDA 2X51A 4I68A 1BQNB 4IG3A 3U7JA 2XTJP 1M5HA 2KHCA 4DS4A 4LF6F 2IC3A 3RYLA 4X2BA 2IVMA 3CW2C 3C46A 3NS6A 1JJHA 1RCXB 4LSLB 2OLWA 3IRWP 1VBYA 1XNRJ 1CLFA 1FJ7A 4GKKJ 2EXUA 4HI1A 5F8JA 2FVPA 5HQMA 3KJVB 1VMBA 3NGSA 4F4AA 4I56A 4DV4J 2HHSA 1UMJA 2DISA 3JTPA 4JI5J 3LW5C 2W2OP 2QO3A 3NGKA 2HS4A 3TQ1A 4DSIA 1DY3A 3KMQA 1S1XA 3M6XA 4CO1A 2LDYA 2GVZA 4P75A 1GMWA 1SBRA 5DRKA 1CQMA 4R5PA 3U1MA 4NYOA 2OSRA 1VQPS 1U1QA 1NH7A 2FVCA 4QU7A 2OPPB 1WKJA 4RNOA 2LQ8A 2CQGA 2HBZB 2CNNB 5L39A 2XS5A 4J9SA 4DSFA 1TUVA 4ZDNA 3WBZA 4AFFA 1NKEA 4KH1B 4XK8C 4U7CA 2GMLA 2KO1A 2OPRA 3ENVA 2V34A 2HIYA 1HWUA 3QATA 4WCEQ 1L3SA 1FO1A 4PG5A 1HD1A 3H25A 1V3RA 4ZVQB 4QWDA 1RAFB 1U26A 1TV6B 2HNDA 3CXCR 4JI4F 4ITSA 2DB1A 3KK2B 3MM9A 4DQIA 2XMUA 3AQOA 4BCAA 2A2DA 2H51B 4Y3CA 2IDEA 3M6WA 3MUVP 4WZQA 4KQZA 1S57A 2FJBB 1YJ7A 2QEXS 3CULA 3EVOA 3FNNA 4TY8B 3GSDA 1FRKA 4LFCJ 2BBEA 2R7QA 4B9NA 3MMJA 3D2WA 2OPQA 1IWAA 4GKKF 4OI0A 3W5XA 4ED5A 1MWYA 1EETA 5BR8J 1ZA1B 1JNZB 3LQVA 2OO4A 2LU1A 4X4OA 1Q79A 1R8AA 2NUHA 3QIPB 2ZBPA 4DOZA 1LQ9A 1NK0A 1SI9A 1LKZA 4KIAA 4RLEA 2XY5A 2AEMA 2F5GA 3QMQA 2EG1A 1B0TA 2GVZB 4R5PB 2VPYB 3OR1A 2CWXA 4ED3A 3G86A 1SJ3P 2IVYA 1S1VB 4JI3J 2B9YA 1SQGA 5I3UB 1UFKA 1BY9A 3JSRA 4CO4A 1YHQS 4JI8J 4M5IA 5DZ6A 4CYUA 3W2VA 3PW5A 3A12A 4DSLA 2DO4A 1YGYA 1U1MA 5B09A 4LF7F 4UY8T 4OHZA 1C2PA 2ACYA 1G1XA 3P49B 4H4MB 4C8OA 1H98A 4MKAA 4LSLA 2IDLA 2E66A 5ETQA 1F6TA 4DLEA 4HTIA 3F73A 1VC6A 1G7CB 2IC3B 5DQHA 1NAQA 3ISZA 2VONA 3A13A 4KHRA 1JLQA 2JZ5A 1B70B 1NRKA 2BKOA 2RSQA 4C4WA 1NM2A 2QL9B 2F4FA 2KM8C 1IWGA 2R7WA 1WOSA 3QGHA 2ZWPA 1NJXA 5H9EJ 4YDDB 1GNKA 2DNHA 2ZC3A 1VOMA 3V6JA 2CPFA 2V8GA 1PYTA 3M6UA 5U47A 2R8GA 1VJQA 1O6XA 2GMHA 2MQMA 2YNGA 4A8QA 1TVRB 2J7UA 4ER8A 3ZZ0A 4Q44A 4OYIA 4OHYA 5IT9U 4FYXB 4DV1F 3DCAA 3GU0A 2HFOA 5J1NA 3EUNA 1U4BA 4ZVEA 4L3NA 4Q2LA 1TU0B 4F4YA 3QFWA 2CJAA 1UL3A 1NMEB 2ZOGA 4K4VA 3C16A 2XMWA 4MH8A 1ZYQA 4U96A 4LQ3A 2E5LJ 1UA1A 3N0VA 3OTEA 3M8WA 5EWGA 2ZBQA 2OJ3A 3LAKA 1H74A 3DRPA 2E9ZA 4EU0A 2ATCB 1Q82T 4Q8EA 2VPWB 3RG6A 3UQSA 1URNA 2MZTA 3BQ0A 3DRSB 2DRDA 5CCLA 2IAJA 2VQEJ 3MPYA 5LMUF 2UXDJ 1XBWA 1R89A 2MZ1A 3BSNA 1FJEB 5DGBA 4IRKA 2YNHB 3GIRA 4PYDA 5HMYA 4DV6F 1UFLA 4PPDA 1DZ5A 4CTAA 1UAWA 1NK7A 2DKOB 3F56A 3DKDA 4P10A 2CVEA 2MYFA 1D8ZA 2Z58B 3BBCA 4K5SA 1V3SA 3CJKA 4LF9J 3PCOB 4OQJA 2JDJA 3W3SA 1H7XA 1R0BG 3MEEA 2L9WA 2YNIA 4HHJA 2B7BB 4ZJOA 3D7SB 2BX6A 4N5SA 3I5AA 4WWSA 2UVVA 2M8DB 2WSFC 4RO0A 3R8YA 4MK7A 1WHYA 2Z56B 4N77A 1OO0B 4NEYA 4RWWA 2VJVA 4OYAA 4JV5J 2YWWA 1Y5NB 5KG0A 3FK4A 2RE1A 5AE3A 4ID5B 3OW2R 1D9AA 1GFWB 3B82A 1NNDA 1OWXA 3IXQA 1DURA 2MKIA 3LP2A 1KC8T 2CG4A 4DV0F 1B7YB 3CCWA 4NCGA 3E01B 2ZH1A 1L5UA 4BC9A 2HNDB 1IKXA 5GMEA 2AX0A 4L72B 2PI4A 2WVDA 5K8OA 1QD1A 2PA8D 3SSRA 1RWUA 2CWKA 4AD6A 4USWA 5KFOA 3CUNA 2H65B 3N28A 3PY8A 1HQEA 4DU8A 3KLGA 3DN9A 1T9YA 5DDPC 3CCUS 1BD6A 8RUCA 3HFVA 4K59A 5HN0A 2ROGA 1PIEA 1TL7B 2Z30B 1I6JA 4G3IA 4X62J 4ZCKA 4IOAQ 2E29A 2RVJA 2UP1A 1J27A 4KH0B 1RP5A 5E3CA 3R6LB 1FX4A 2ZE2A 1Q5VA 1S1XB 3QGIA 2MZSA 2J5AA 2PO4A 4M5JA 3RB3A 4TU9A 2UUCJ 1ZPWX 2HAIA 3OL9A 1U09A 2XSFA 4KBIA 3CJQA 2ZJPQ 3BPDA 3LALA 5KFAA 1X7VA 4OI4A 5I3PA 4UOFA 5JVGQ 3SV4A 1SL0A 3AXKA 4LIWA 3SXLA 5HP1B 1D9DA 1UWBA 2LMIA 3CDAA 2W2PP 2ZE2B 5ADZA 3K58A 3IP0A 4OZ2A 2C2EA 1WHVA 5EGYA 4ECRA 4N41A 2KVIA 2OD4A 2ZOMA 4RKUC 3D0IE 3KWMA 4WFYA 4DR5J 1IJFB 4O4GB 1NSPA 1UWAA 2MY8A 2I8EA 3BSCA 1RWOB 2AD9A 2RIJA 2X1GA 1EQMA 1U6FA 1Y4ZB 3EWGA 3UDEA 2E7XA 4I7FA 4CO5A 4E8UA 2UV8A 2FJVA 4CO0A 2E1RA 3MURP 1EB0A 2YKPA 1N56A 4KGMA 1HQ2A 5IM0B 2UU9F 3IA0A 1PJ6A 2AEJA 3IRXB 4DR2F 2RNEA 2ZUAA 5A2QY 1TK5A 3MMAB 2PFFB 3FMBA 1P8GA 4OL8A 1HQUB 1AYEA 5A8WA 3V6HA 2RJZA 1IQTA 2JLGA 2W4CA 3RAQA 2KU7A 3A8KA 1S12A 3GTYX 3DLGB 4DSJA 4JBCA 5EUHA 2JOQA 1FXDA 2W9BA 4URQU 2CPEA 4I2QA 4DR4J 3DFEA 1J2VA 3BKTA 1DTTA 1Y11A 1QTNB 2YWHA 3BO4A 1CEZA 5M2RA 1FNOA 2HFVA 3H59A 3MM8A 1CSJA 3T19A 5ETSA 2YKNB 4M5GA 3JSBA 2I5JA 3QT5A 5B0FA 3C15A 2FTRA 2AJ4A 4H4KA 2DR6A 4DSEA 2WZ1A 2MTLA 1CC8A 3F44A 3T41A 3BR9A 3CJ0A 1I1GA 4KO0A 5FD1A 1EZZB 2PN6A 2R4FA 1OYEA 2FHMA 4Z2XA 3G6VA 5KFCA 1F9HA 2HLUA 3RGIA 4CTAB 5HVGA 4R0JA 4J9LA 3UR3C 2DNQA 5DG7A 1N48A 4LFAF 5T41A 2M2BA 4DR3J 2GJIA 4WU3A 5D15A 3D68A 4LF7J 3AH6A 4LF4F 2E1AA 1WTBA 1X31C 4KO0B 1FDNA 5KG1A 3H90A 1FKOB 3OPKA 2B3TB 1Z2LA 3DRSA 4RJVA 4DN0A 3G6ES 2HVHA 3IG1B 5ETKA 3GG1A 4WZMA 1Q1KA 3NL0A 3ZTOA 1HLWA 3M8ZA 2XCPA 4Y00A 2ATLA 4CRJA 3HMJG 3MEGA 1YRTA 2YBVA 5FLXY 1KBRA 3CD6S 5CYQA 3IMQJ 3R5JB 2WAQD 4Q5VA 1QUPA 3MMBA 3GYXB 3N6NA 4DPXA 3PEHA 4HH0A 4WIIA 5D6GA 2VICA 4IRCA 3A8EA 1WNEA 4UZCA 1Q86T 2ZM6F 1YBAA 3K89A 4J91A 5AXKA 1P1LA 4N76A 2AX1A 2UXBJ 1S10A 2YNGB 3KG4A 2QRRA 3NGUA 3SBMA 4V19X 3EJMA 4ZP6A 5KG6A 1K8AT 1N54B 2DO0A 1VHFA 3AODA 2SXLA 4LBIA 1AUSL 3FEZA 4C11B 3KFWX 4X62F 1KRPA 1X4EA 1RWXB 3W9HA 1J5OB 2HS0A 3M8QA 4OX9F 4HYKA 1U45A 3LWLA 1MMNA 1KN6A 1OMSA 1GMUA 4S0MA 2KTQA 3EGVA 2C2ZB 5A2QU 1YTYA 4MTPA 5A6WA 3CCRS 1RUSA 1NPPA 3RUBL 3AT1B 3MMCB 1JMTA 3QWPA 4A47A 3ENAA 4DV0J 1RT2B 3W5YA 1HW8A 4A8YA 4WTYA 2D3O1 1IBMF 2HGLA 1C4CA 1XK8A 4RR5A 2KFNA 4DQQA 2MQNA 3L4BC 4OYZA 2F8MA 4Q43A 5GADU 3FSYA 4DR5F 1F3VA 2BW2A 2HG4A 3I55S 1XWLA 3I9ZA 4ED6A 2R8KA 4PG7A 3QRQA 4FVMA 4ZPWR 2G2ZA 2XI2A 2XO7A 1N32F 1RZMA 4QIWD 2NXNA 2W1BA 1TKXB 2HPUA 5A0YA 2HRYA 4ES3A 1KEKA 5KG3A 3Q8PB 1RT2A 4QIFA 3E2EA 5ETNA 1NO8A 2GQQA 4QBUA 1OPZA 1ZETA 2MQLA 5FIIA 5C7PA 2UUCF 2WSCC 3SEOA 3KYLA 1TMMA 2XEXA 4B3MJ 4AL6A 4ELVA 2ILZA 3D54A 4CH0S 4ECUA 2DNNA 1TP7A 1WUUA 1MW7A 4PG6A 4C0BA 2L3MA 4X65F 3GIKA 3LF0A 4HL9A 4CH7A 4K0KF 2X1FA 1WF1A 2CPHA 2I0XA 4PWUA 2B7CB 3Q2SC 3W9JA 1F0XA 3D28A 4F2RA 2MEWA 5GAEU 4LF6J 5KFZA 5AE2A 1ELOA 3CCMS 5MLCV 3SFGA 4MK9A 4N8OA 3BH6B 1QLNA 2FVSA 2DR9A 5HVHA 1O0PA 3IS9B 2CJBA 2XQCA 2IBOA 2LDIA 3O6QA 2Z2ZA 4WXWA 5B08A 5KFNA 2WVBA 2ZDPA 4YFUA 4F4ZA 2PT0A 2DH7A 3HHKA 2HHVA 2VC1A 3ZTSA 1PC4A 2DGXA 2E5HA 2J7WA 3T9ZA 3CDBA 4JYAF 2EBEA 2FDNA 3F41A 4Q2MA 5CYQB 4CNZA 2CRLA 2DXFA 2I38A 1HNIB 1HW9A 1A6LA 2IJFA 1SJ4P 2J6UA 2QJ3A 3KXDA 3KG0A 4AYBD 1FDDA 4J9KA 3ILJA 4C3KA 4J9PA 1G2EA 3IR6B 2CJXB 2IAJB 1U2FA 3AB2B 1NK4A 2XNQA 3MWBA 4DEZA 4MKBA 3MAQA 4I6AA 1NK5A 2QL7B 1IKVB 3KKFA 2LQ9A 5LMNF 2BABA 3PW2A 2LQJA 1URRA 1IKYB 3IWLA 1UFWA 2CQIA 2VOOA 2DGOA 3I56S 3VQTA 3C16B 2OMLA 3VAMA 4RW8A 1WG4A 4MT1A 2HSEB 1X60A 4DPWA 2QSFA 4IKAA 2NXCA 2F3JA 4N56A 2N3OA 5KFTA 1S0OA 2KDOA 3FQLA 4IR9A 2BJ3A 4QIVA 3VGVA 2AT1B 2M7SA 3EZUA 4CZCA 1XMOF 2CNLB 4O3RA 4J9QA 2O3DA 1R3NA 3MEDB 1JKHA 4M8LA 4RW9A 3OQ2A 3MF5A 5CCMA 2KT3A 2MJUA 3US5A 2GVDA 1NDKA 2R7TA 1QAIA 3R5CA 6AT1B 1HWJA 2FIUA 3W8PA 2FGOA 3J7YU 2L9DA 5F3TA 2J9DA 4JI6J 4LF5J 3NGDA 3D1OA 1JLCA 4YP3A 3BO3A 4O44A 3UD4P 1HBOA 3GQCA 3ZNJ1 1VRTB 4YY3F 3RRGA 5L1LA 4B3TJ 2CUYA 3TARA 2XULA 4IH7A 1SH2A 3JAMY 3OD2A 4FDFA 2E5IA 3GIIA 3BJYA 4G6VB 5KFUA 1TL5A 3T5HA 2HHPA 3GV5B 5D0RA 1CJTB 4B3RJ 1AT1B 5CH7B 2H5EA 2ZHOA 4GRSA 2GHPA 3M2UB 3TUPA 3S8SA 1REVB 3M30B 1YJWS 1P9YA 4CYUB 5KT4A 1RWNB 2DNZA 3DRXA 4JI8F 2EKNA 4DL5A 3BDEA 1S5ZA 3HP6A 2W2MP 1S0MA 2DJWA 4F2SA 3DRRA 2FJXA 1GH8A 2ZHBA 2DNRA 4LF1A 4RBVA 1U1KA 1MU2B 1QE1A 1S48A 3GFXA 3QIPA 4NX9A 4ZP9A 3Q0AA 3A1YG 5DQIA 4JI7J 1APSA 2OPQB 2D7SA 4ES1A 1KQSR 3PW0A 1Q16B 4KPYA 2J8AA 4TY8A 2OELA 5DLGA 1RGVA 2QA4S 5HLFA 1RACB 5HJXA 3VAGA 2R2UA 2CPJA 3Q8UA 2GAHC 4NCBA 2M70A 1QDUB 4ZK7M 3UCUP 3DU6A 2DPIA 1X9WA 5KFFA 3KDOA 2R3VA 5C25A 1RT6A 3G87A 1GK8A 2R42A 3C14A 1CJKB 3M8SA 1FWKA 2AV5A 4TN2A 3K2YA 4P6QA 4IO9Q 3H5XA 1XNRF 1G6BA 2QFIA 4QWBA 3HVWA 3W61A 3ZZTA 9RUBA 3T5LA 1SCJB 2RRNA 3PIPQ 2ZFHA 4OJGA 2KXFA 1YJTA 3L7UA 2ALYB 3H2VE 1PAUB 4TY9A 1AB8A 2LLZA 4ZVUB 5HBMA 2L48A 1VLYA 4NMLA 4MYUA 1TL4A 1JJ4A 3MR2A 3D6FB 4NLTA 1CBKA 4ICLA 1FXRA 2V63A 3NRBA 4MKVA 4F4XA 2F4VF 4ALZA 2QN6B 3MPWA 1FRMA 4WF9Q 2MQPA 1RAAB 1XTZA 2Z57B 3PACA 1WKLA 5A8RA 4JI0J 2Y8WA 1S7IA 1YQHA 4EMDA 5HLFB 3RBXA 4KFBB 2FVQA 1NKCA 4USJC 2G4BA 3CJ8A 3MECB 1EAYC 4NYPA 1KKHA 4DV2J 2E7VA 2W24A 1UVMA 2HQCA 5KFJA 1S1UA 2UZAA 2VJUA 1T7PA 3G8TA 4DWIA 4O3SA 4KPCA 1RLCL 2W4PA 2YNIB 2K3IA 1WF2A 2KVQE 3JQMA 4RW6A 4Q8FA 3QJJA 1SUQA 3DI6B 3IWNC 4HI2A 1SXLA 2VBYA 1S1WB 1JLBB 3RAMA 1LW0A 4J9MA 3TWZA 4NLQA 5AJ3F 3GR1A 5LT5A 1YRUA 1J5EJ 4YUDA 4FXVA 4UW2A 2ZD1A 1RBLA 2IJNA 4Z7YA 4OX7A 1CJTA 4ES2A 2FQQB 1YJVA 3VGTA 2U1AA 1VYAA 3V4IB 1HD0A 1RHJB 4MFBB 3FEXB 4OLOA 3W65A 2HAFA 1ZTTA 3DDIA 3F0NA 2DTJA 3SSQA 5I42A 3A8JA 2AIRB 4J9VA 3TVYA 2OGUA 4O44B 5BYRA 1UJ6A 1UPMB 3J80U 4GC7A 3FFIA 4IFYA 1JQGA 1T8EA 1X0PA 3GJSB 5THWA 3BS9A 2V2VA 2NYHA 2LA6A 4OYMA 1FJGJ 2FJEB 3HHNB 1UZDA 2CQBA 1FWPA 3CCJS 3QGGA 1P6TA 4NASA 3T6BA 2K2PA 3DOKA 1E6YA 1JKHB 1ZM2A 3K17A 3QPIA 1ZAWA 3K0JA 1WC1A 4KV8B 1GTHA 3NMAA 2XMMA 2DIUA 5D8HB 1S4FA 5D78A 1S6OA 1S9GA 1VIOA 4IR1A 1YJRA 2W2QP 3DOLA 5JXSA 2HYIB 1SIWB 5H9FJ 5MAOA 2BE2B 3MXHP 5KT2A 2XNRA 2UVWA 2BXJA 3TJ8A 1FE0A 3TX8A 4LVOP 3QIDA 5L46A 4B08A 3CMQA 1VIXA 4U7UK 2ASLA 3QZ8A 3CJ4A 3KNGA 5HQLA 5IT4A 1TL1A 1C1BA 2F8EX 2PA3A 2RKIA 4PKDB 3GMGA 4TKTA 5CD4H 4CLYA 3BGRA 4I2PA 1Q81T 1RA7A 1RT4A 4H4MA 1Z1ZA 1B4SA 5D4NA 2HVZA 2VHGA 2P8IA 1F9FA 1MMLA 1J5EF 4JOUA 1FESA 1W7WA 3V5RA 2CNKB 3VR1A 2FHJA 2B5JA 4P72A 2X1AA 2GJFA 1S1VA 1T3OA 1T94A 2WHOA 3PG9A 4M5MA 3OR1B 3UW1A 4L75A 4DX6A 5LXYA 4ECZA 1GX6A 2YWFA 3V81A 5L8RC 2HQ3A 4I4BA 1R6VA 4PRFA 3JXOA 2AU0A 1YJ9S 3CMES 1TKTA 5AXNA 5BR8F 3GP9A 3HT3A 4J9OA 4ECSA 1JLEB 4ZKAA 1FD8A 5F8LA 2YX4A 4USTA 1T05B 2HZCA 2HFUA 3VWSA 2CJQA 1M5SA 2VKRA 2DNMA 4IUFA 3HZGA 2QV6A 4OZ3A 3R7NB 3ZFVA 1RTHB 3KHHA 4QCLA 4P52A 3SSSA 3G96A 2V68A 4WXOA 3IGNA 3VHQA 2QC3A 2B43A 5EHHA 1VQOS 3I32A 4C8KA 1IKWA 3NKYA 4L6V3 4PXCA 3RZAA 2ZH4A 1HR0J 1S7HA 4K50A 1AUDA 2K3KA 2KL8A 4Z7CA 2OFGX 5CZXA 1H73A 1LFWA 2A1BA 2MZJA 4K4YA 2I2YA 3NAHA 4KY3A 4I64A 3T9NA 2DRBA 2BUNA 3W62A 2R2SA 1T95A 3LO3A 3ELHA 1HA1A 3MR3A 4JUZA 1TKXA 2H4YB 4CP5A 1WTFA 2A10A 2RT3A 2XY6A 1HYSA 1NSKL 2H3EB 4I6YA 2RHQB 3FBCA 3K5PA 3KG1A 4JP8A 1WHXA 4CT9A 1FEEA 2Z2LA 4W92B 4QYZK 2ERRA 2BW7A 2R8JA 1RAHB 1FF2A 2NYIA 3KMSA 2XY7A 2IVFB 4ILLA 1E6VA 3MMCA 4H4OA 3CDEA 2EC0A 3RW6A 2PIIA 4WK1A 3VCDA 1KHVA 4RZRA 1IR2A 2BJ9A 1KS2A 4DPUA 3GCWP 4XDDA 3ITHB 3HK2A 3PO5A 1G3OA 2RQ4A 4LF5F 1KWMA 1SC3B 3M8QB 4NWBA 4NLDA 3VF0B 1J5OA 4TXSA 5F9LA 2JC0A 4ATNA 1R6YA 3LH2S 1TUGB 3LA0A 1V6HA 2VFTA 4KKOA 4ELTA 1AXQA 1XMOJ 3NNAA 4LF9F 2ROPA 1IR1A 1RTIB 2YNFB 3HKZD 4K4ZA 5E33A 5IZHA 3OLAA 3TAQA 4URGA 3FC9A 2UUAF 2AJ0A 3TR5A 5BXIA 1YZ7A 1WEZA 1WEYA 3SZ2A 5EWFA 2PSZA 1Y7PA 3V6DB 2BANA 3C6UB 1YLXA 4XPCA 4GKJF 1JLGB 1SQEA 4NXNF 3LP0B 4AQYJ 3RB4A 3B54A 3MMBB 5KT5A 1ZA2B 4LR8A 5LMUJ 1YZ6A 1KTQA 4QR0A 2WB4A 2J7KA 2ZITA 3FCWA 1CJUA 3H4BA 3CD5A 2O1PA 3HFZB 3Q8YA 2WOMA 5KFMA 2O67A 4IFVB 4CIOA 3M9OB 2W8KA 1SB6A 4O0NA 3N5FA 1TMJA 1NZ8A 2MPUA 4OMFG 4WYLA 4BWMA 1RHUB 3MI7X 5T14A 1LWEA 3FJ2A 3O8WA 1ZOTA 4NZ6A 4BC7A 4RU2A 3IG1A 1QVFR 3HHDA 3R7BB 4DPYA 4B9SA 1VRUA 2BOAA 4IQXA 1NEEA 1GT8A 5D0EA 1UW9A 2D69A 4LF8F 1SL2A 3BSOA 1K9MT 1B3TA 2J9CA 2PEBA 2GJ2A 2RQMA 2DHGA 1LV5A 4LFBJ 2YTCA 1U8SA 1N34J 3DLEA 4Q45A 2BM0A 1KR4A 3WIVA 2ZH8A 5AJ3J 5KFDA 1CG2A 2C28A 1NHKL 1UKUA 1OYDA 2DHAA 5DQGA 1LK7A 4WJBA 2G0IA 1GXUA 5J2QA 4UY85 1VQ8S 3HHLD 4WP9A 3CDWA 3UR0A 1CULA 4ZVSB 2JLEA 2MDAA 4CLKA 4OJ1A 4RUBA 3P6YC 3C8YA 3QGPA 4DUYJ 3TANA 2EEYA 1G4CA 4XIUA 3PO4A 3ADAC 2GX8A 4AUKA 2V2QA 4WKYA 4TU8A 2JEGA 3HHLC 2RH3A 2V9WA 3Q24A 3RTVA 1HBNB 4X65J 1K47A 3VZIA 3OBIA 1RTDA 1XMQF 3I0SB 5KT3A 2C22A 3HULA 1Q8BA 4O23A 1JLFA 1C0UB 1N5QA 1R7IA 1YWXA 2DY1A 4LT6A 5FDLA 3PKYA 2W9BB 2D74B 3FRZA 4A8MP 3Q2TC 2OPSA 2NXJA 4BS2A 5K14B 2R7OA 2FB0A 2ZNZA 2YWKA 3DU5A 5GAEI 2FLNA 3OXLA 2P2CB 3SQOP 4DQRA 2KI2A 2DYAA 1SC6A 4NLUA 1NH8A 4PXBA 3VTIA 2MHEA 3NCQA 3PX6A 1FRHA 1VBKA 3OJUA 3FBEA 3HO1A 3BGUA 4I7FB 2V2ZA 3G6XA 1YX2A 2GGPA 4N47A 3QSIA 2QLJB 2GZOA 1ROFA 4FF3A 4C2MA 3IBCB 5HSPA 3OVSA 1RKIA 3CC4S 2NXEA 2QTWA 4GO5X 2NZCA 3QWUA 4LBHA 3I5BA 4UF4A 5B7WA 1TFYA 4QZVB 3PKMA 1D1UA 1I94F 4F0MA 2LFVA 4I6WA 4USHA 4ZCMA 4TQSA 3KLFB 3G71S 4U8YA 3TAMA 1JNRB 4LSNA 4OHWA 1B0PA 1SKRA 5I3QA 2KRRA 4OV1A 4K4XA 1VQLS 2JLFA 1TL3B 3OVAA 4E0DA 4X4NA 4OZ0A 4U67Q 1ZM9A 2DGSA 1T0TV 4PEOA 3E51A 5F0UA 5KG4A 3TEHB 3JSMB 4YR3A 3MCMA 4DR6F 1SH3A 2PD1A 2IJRA 4TLQA 1VQNS 2J9EA 1TELA 1D3WA 3MR7A 4PABA 5E7OB 2FHOB 2VPXB 3PW7A 1U6ZA 2F9DA 2L9NA 3PTWA 4TLRA 4ZP8A 2DNOA 2XWXA 3R9LA 1LXNA 3S1TA 7AT1B 5RUBA 4DUYF 3SI8A 2B8PA 3LOUA 2QX0A 1YSJA 2V2KA 4G1QA 3LAMA 4K4SA 4NZ7A 4NLXA 3W8GA 4ED1A 2M4MA 5G0RB 3S01A 4X66J 1NJIT 3UWTA 2KXHA 3E01A 1HBUB 4F02A 1ICEB 3LP1B 1FCAA 4AQYF 1ZAXA 3GG0A 3THVA 1CS4B 4YY3J 3HI9A 2WK4A 2NCKL 2HQFA 4ID5A 3CEDA 3PFOA 3R5DA 2HWHA 2D3ZA 1QSYA 1OQ6A 4JI2F 2UXDF 1C1CA 3UDLA 2C3OA 1EX8A 4X4VA 4LRCA 4RW7B 1D09B 5DS7A 4WTOB 2BJ7A 2QA1A 4X84A 3BREA 1ZM4A 4CLLA 1S0NA 1PCAA 2LU2A 2XYPB 2XZTB 4C98A 2PDAA 1S76D 1UVJA 3CB4A 2G2OA 2RMLA 4CLSA 2V0NA 4QW9A 3MR6A 2ALZA 3NCRA 3P4UB 1GMWD 5C5JA 5KT7A 4DL3A 1HNZJ 3T1AA 3FBBA 1UEVA 3BZQA 2MGZA 3CCSS 3UCGA 1N34F 2ZBCA 5IQQA 1KTVA 2D9PA 4KYZA 2YQ0A 4LF8J 1UVLA 2DEJA 2CQDA 5KT6A 4J9RA 5G0RA 2EFQA 4TYBA 4XAKA 3ONQA 3VGSA 1B0VA 2YNHA 4BLGA 3L3CA 4X4PA 4DV1J 2IM1A 1QSSA 3KDNA 3DLLQ 2UXCJ 2C2RA 4CDIA 2H5IB 4YN3B 2DGWA 4EYHB 1SKSA 4MIWA 4OLPA 5T7LA 4ECTA 3DGPA 4Y2CA 4K2XA 2ABYA 4ZOSA 5E3RA 3DRPB 2XYHB 4JI2J 1RYSA 2AJ2A 1M1HA 3N79A 1L3TA 2XBPA 1HWLA 2KRBA 3M32A 3JSMA 1HI1A 2VG7B 3B6BA 5KTQA 2KZMA 2CQ0A 2YWGA 4NA1A 3CCVS 1HFEL 3ULHA 5F8IA 2F7VA 4B9VA 3CJRA 4ENOA 2ADBA 2HMIB 1DTQB 1SJRA 1DLOB 3PYGA 4LSNB 1DQAA 2QMXA 3VVTA 1KQFB 1VDHA 3K5LA 4R0EA 4ILRA 2E5GA 4FF4A 2EPIA 2BZ2A 2V6AA 3P8BB 3BQ1A 1JIHA 1Z2ZA 4DJBA 1VFJA 5F0WA 3ZC4A 2DEIA 4A8WA 2QL5B 1RAOA 1QAJA 1HNWF 3B4MA 2CA9A 1HNVB 2BMBA 2NXUA 2OUGA 4M95A 4O4RA 3M05A 2G0JA 3M8PB 4ZVGA 3FVYA 2WW4A 3G9CA 3I31A 3SCKE 1FRLA 2VBXA 1X4HA 2FHKA 1D9FA 4NLYA 1SJ1A 4FYYB 1HL6A 1BWEA 2QT7A 2GCFA 3ILLA 2X3DA 4B9TA 3OTOJ 3UN2A 3VVUA 2RAQA 1FK9B 3HSDA 2CQPA 2QYCA 4DUZJ 4IH5A 3HF5A 3BEGB 1C0UA 2DHXA 3M7VA 2EC2A 1NHUA 4IH6A 1TQLA 4USUA 4DG1B 1Q4RA 4OI1A 3CCLS 1OJ4A 5KG7A 2D1CA 1JLAB 1KDNA 1DQ9A 1HBNA 4WE1B 5KFVA 2HNYA 2OEMA 5ITHA 2LXIA 3OTBA 1R0CB 4Y6IA 2HLTA 4PUOB 3I4PA 1W2IA 1RT1A 2VPZB 3T1YJ 4AXIA 3HSJA 4RUHA 4FPRA 3H7HB 1V3ZA 4KHPF 5IS2A 2W9CA 5ETLA 2B6AA 1DRZA 3KUGA 3SDEB 3N01A 1HHTP 5KFYA 1DHMA 4BHQA 2JH3A 3HVTA 4OYXA 2G1DA 2B4OA 3W63A 3JAMU 1Y10A 3DLEB 5DZ7A 5E0OA 3PRDA 1FI4A 4QU6A 2VFUA 3N9UC 2HGMA 1NSQA 9ATCB 2R7VA 3MM9B 2HIQA 4AE5A 2V50A 3SQGB 1TK8A 1VQ9S 2GA7A 1VRUB 1WEXA 1LWCA 1RSCA 3O5TB 2C3YA 4ERDA 4Y2AA 2M8HA 2NZ4A 1U0HB 1LWEB 3BDPA 2OPRB 4ZVTB 4F7VA 3GILA 1R8BA 2JWNA 3M1VB 1U49A 2WOMB 4O3QA 1GX5A 1Y3JA 3CO9A 3NLCA 4NI2A 3H5YA 3MPVA 1O51A 3O3LA 2DD8S 1W2BR 1N5YB 2RS8A 3BB5A 1QTMA 1FE4A 2Z2MA 2OPPA 5I4MA 2HHHF 2ZH5A 1VQ6S 2BQRA 4PG8A 2HRTA 2XS2A 3OXFA 1RABB 4WFAQ 3D3BJ 4ZVFA 1LW2A 2Q6BA 1HWIA 3CVKA 3GV8B 4ED7A 1YVFA 2N7CA 4A8KA 1RTJA 3FDSA 4M5NA 2ZVIA 5AXLA 4C0OC 5J1EB 3CC2S 3PZPA 3W2WA 1RTIA 1BWVA 3KJVA 4J90A 1RT3B 1GAOA 4YEAA 2KZZA 4A46A 5CA5A 2OEJA 5ETVA 5GMDA 5KFLA 3WHIA 4PYAA 3TO8A 1VRQC 2JEFA 4OYOA 5HANA 3NBPB 1N88A 4TYAA 4QW8A 5ETPA 1TAQA 2JL9A 4WU2A 3HT0A 4LRBA 1FNMA 4LVNP 1T03A 2QMWA 3DGVA 2L41A 2IBKA 2UXBF 4DL2A 4USVA 5K8NA 4OJHA 4MKYA 1RT3A 3VGUA 1FFWB 4NXMJ 2IY5B 2QSWA 1BC6A 4B9MA 4RBUA 2IPOB 3BGLA 3P3DA 3AY0A 1RAEB 3QO9A 4H4OB 2BR0A 4C6AA 2AQ4A 2ZZNA 2HHTA 2COLA 4K7QA 4U6PA 1WELA 2YWEA 4DR6J 4DPOA 1RDRA 2YKQA 3IR7B 1A7GE 3PVXA 1S97A 1IM4A 1WC3A 2NQPA 5CZVA 1UPPA 2I1RA 3RW7A 2H54B 3DXBA 4Q7AA 3R1LA 1QY7A 1S49A 2KJWA 2BVZA 1XR6A 1R8CA 3HDSA 2Q1LA 4NI2B 1TK0A 3W7BA 5KFQA 1WOOA 3BR8A 3T1HF 4DR4F 4Q0BA 4GO7X 1K1SA 4DI6A 5D3GB 1HPZB 1IBCB 3MM5A 3RR8A 3S7RA 4G65A 4X4UA 3KJFB 1BGXT 4M5DB 1N0UA 4ED4A 2HWIA 3R5AA 2XC9A 3ENQA 2W8LA 1SKWA 4C8LA 2BYCA 2E7WA 1NXIA 3AJDA 3QT7A 3ZTPA 2BJDA 1Q5YA 2G13A 1C4AA 3QZ7A 4HDHA 2RDJA 3DDNA 3MAAB 1NUEA 2OTLS 1WDDA 1QUVA 2HBQB 3D4JA 1ZBTA 1LWFA 3POTB 5GAGI 5GAHU 4HVZA 2P9EA 8ATCB 3EZ5A 2YX7A 2RS2A 1T9UA 1VQYA 2CJYB 3UI3A 3FRYA 1IBKJ 3IGVA 4ELUA 1XQIA 1FHTA 1H3DA 2B6AB 1FRXA 1F5BA 4IG0A 4DDFA 4U95A 2V4JA 3TA1A 4OZJA 4HACB 5GADI 4PQUB 5L9XA 4MIAA 1R8PA 2WONB 2O5DA 2YPYA 4I0WA 2MXYA 2RF2B 2J0XA 5JVHQ 6FD1A 3SYZA 1C0TB 3ENWA 1QAXA 1FWLA 3G82A 1KFDA 2HNYB 1S79A 3H0PA 2EFNA 3OTDA 4USKA 5BYQA 4ZN1A 2QLBB 5JJBA 2W01A 5GMKa 3GV7B 4DG1A 3PJXA 2VF3A 3AJ2A 2XSJB 4NZ0A 4P7TA 4QJVA 3DOMA 4XO0A 5F8GA 2E9RX 2QFJA 2LEAA 2H5JB 1KOHA 3N6LA 3TUIC 4NLRA 1VCTA 3KLEA 1ZAVA 5A8KA 2AWZA 2GIRA 3G82B 3KLHB 2Y0BB 3Q23A 2VDHA 5KFBA 2FPHX 2IM0A 2I6WA 4DX7A 1X0FA 2WVCA 1HMVB 5C42A 4OYPA 3LANA 4DV5J 2RILA 1IQZA 3I0RA 2EKYA 2WVEA 2YH0A 3GFZA 1WC6A 4ZLNA 5L1KA 2G9OA 4DV5F 2VOPA 1Q0NA 2MQOA 1RHMB 1BHNA 3IR5B 2QIFA 3UDCA 3M8RA 2UVUA 4JI1F 4AL5A 1L3VA 4KGVB 4XTTA 1EARA 2HW3A 1KQGB 2VFVA 2ROEA 2AEFA 3HHLA 5B0DA 1CQNA 2NLWA 4DR1F 4DBQA 4ZHRA 1LFPA 2E1CA 4B3OB 4RW4B 2KYXA 3C66A 1RHKB 1FFGB 2CDQA 2ZKUA 3D1QA 1NB2A 3ZZYA 4CO3A 3MOJB 5HK4A 1S6PA 1E6YB 4ZIVA 2AYEA 5DG9A 4DLGA 3NOGA 2H4WB 2Y1IA 1KVJA 5L1IA 2ZC4A 4QIEA 4URSA 4C8MA 3SCLE 2VQFF 3EX7B 3M2RB 2OSQA 3QBCA 4PG4A 1SKUB 4CLPA 1N6QB 4HH1A 3HHEA 1PC5A 4NLPA 4OJ3A 2JEIA 2V8PA 2LECA 4IFYB 4PXEA 2K7JA 4WYWA 3VALA 4DQPA 3PJWA 5ETRA 1UW4A 1X4DA 3DYAB 3RRHA 4M94A 4FS1A 3D0GE 4LRFA 4EO8A 1U1LA 1WACA 2DR8A 4FBTA 2MKCA 2FGCA 1FVQA 5KG2A 4DSKA 2P6TA 3TW0A 3Q86A 3X3UA 5E3QA 1Y00A 1NLKL 2DXDA 5DDQC 4ZIWA 2ZD1B 1M0SA 2ZZTA 1R27B 1RLDA 3DM2A 3GYNA 2XGQA 4GKJJ 5DDRC 4CT8A 2MKJA 3KK3A 5CHCB 1Y5LB 2CXEA 3AA8A 5HMXA 3AOAA 2AYMA 1LNQA 2B51A 2RU9A 2ZH6A 2NR0A 4RW6B 4ECXA 4IO1A 5KOXA 1VK3A 2HVDA 4DL6A 1N8RT 4WFXA 1FFSB 2QYGA 1S1UB 1TFWA 1ZM3A 1N36F 1SVDA 3M6VA 4ZCLA 1X4CA 5IFMA 2KFZA 1GQEA 3MD3A 5HATA 3ILOA 4WP8A 3TZZA 5DLFA 3OTCA 4IQMA 2RQKA 4TNOA 4F0KA 2Y1JA 4OFZA 5J1EA 4NRTA 1RQ0A 1S6PB 3VAIA 3OL8A 4KSEB 2VG6B 2M0GB 3OT9A 3C6TA 3MPDA 4JV2A 3KOAA 3MOZA 3NAIA 3OHBA 4DCJB 3HHLB 1F5CA 3OLBA 2HHHJ 2Y8YA 4NLSA 4PXDA 1GXLA 3LGHA 4F3QA 5F9NA 4OYBA 3TI0A 2HEKA 4DV7F 2BKPA 2LXUA 3QRPA 1LEOA 2E1MC 3IO1A 3CD0A 2WCXA 1TZ0A 2CPIA 2XLJA 2PEHA 2C1EB 1GXTA 1RHRB 2DRAA 4KHPJ 2M9KA 1MN7A 2DY9A 4ZPCA 1V5VA 4HR2A 4DL4A 2E5JA 1BQMB 2VA2A 1HMVA 5C42B 1LWCB 2WSEC 2PE8A 4EZ6A 2OAUA 1V5IB 3EVWA 5A8KB 2AYBA 4YOEA 2IIHA 3H5UA 2UUWA 2AJQA 1UETA 4EEYA 4TU7A 4LRDA 4FN5A 2KM8B 3NMRA 3DOMB 2YH1A 1IBMJ 3HJFA 3DLKA 5IT9Y 4H54A 2GS8A 4FYVB 4EBCA 3SDEA 1PSDA 4EI2A 4J37A 5KFPA 2JVRA 2W9CB 5FJ4A 2XHWA 3JYTA 3FSXA 1HI8A 3NWRA 1SQFA 2BQ3A 2M52A 2RB7A 4LJMA 1KLMA 2RD5C 5B0EA 4L3KA 2HQIA 3GPAA 4YB6A 5DDOC 2HQDA 5J2NA 1S0VA 3CJ3A 4RNNA 4GMKA 2CPDA 1SIZA 1RU1A 2EK6A 2EVZA 3N5BA 4MIBA 5L9NA 2V4QA 4IG0B 1N52B 1T11A 3IN5A 1PAEX 2HNZB 2HWTA 1I51B 3B4DA 3AXMA 3M9MB 3JQJA 4B3MF 1K0VA 2C2KB 3M8YA 1BE4A 3RJMB 4F4KA 3QAEA 3W1YC 2ZVSA 4AT1B 3KHLA 2ZH2A 1F60B 1LOUA 4DR1J 2XI3A 2CNOB 3MM6B 3TUZC 2KXNB 1Q8KA 1HNXJ 3UFCX 1RXOB 3KK1B 2CJ9A 1R0AA 3GE9A 2IMOA 5D3GA 2IA0A 1RAIB 4Q0BB 5CYMB 3M8PA 5HMZA 1KFSA 2RDDA 3GWCA 3PHEA 2MLYA 3THPA 5K8PA 2Z4PA 2POKA 5IOLA 1N0VC 2B9XA 3PDNA 3CTRA 5J2NB 5LSLA 5FLXU 3H20A 2CYYA 2ZH7A 3FZBA 1YBUA 1KHWA 3RB6A 3NG8A 3OR2A 5IXUA 2GHWA 2O66A 3TQEA 2XMTA 2X1BA 4O3OA 2N4CA 3AD8C 1U02A 3GZ7A 3RBEA 2FC8A 1SH0A 2DR7A 1X8DA 2N7YA 1VR6A 1YG0A 1RWKB 3Q8VA 1DTQA 1DJ0A 2A0FB 1FKPA 3PYDA 1KQKA 4DZ6A 3J7YI 2R7RA 4RNMA 3KJNB 4RW8B 4KGXB 2DNLA 1OY9A 5IQ6A 2R8HA 3VAJA 5KFEA 4DFJA 4FVCA 2IM3A 1IKYA 4MYTA 2VZ9A 4QR1A 2LKZA 2PC6A 2P5VA 1D0EA 3DNCA 2QLWA 3NXZA 4IDKA 4KC5A 2MZQA 4UOHA 1AZSB 3UN3A 3JB9k 3WX4A 3P45B 4NLGA 4Y2IA 4ID8A 2KG1A 2R9LA 2CKWA 2QMUB 5HL7Q 3KUHA 4EZ9A 3BO2A 1F1BB 1IXKA 1OQ3A 3OSPA 2AF6A 3PNIA 1OPIA 1PJ7A 4NEZA 3TA0A 4YMEA 1DARA 5IT0A 3NS7B 4NCAA 1R8HA 4ETZA 2DXEA 4GVBA 2MZRA 5B0BA 1T9XA 1TKZA 4GVBB 4TQRA 4Y34A 1WC5A 1B99A 3CJSA 1Q78A 2ADCA 3ZZUA 4ZVOB 5LXRA 5JMNA 4F3OA 5E3AA 3NP5A 3HX9A 5C24A 4JI6F 3TJAA 4X64F 1XR7A 1T05A 4KKOB 1X4GA 4ZCIA 4W4MA 2MSSA 3K59A 3HZEA 3Q8SB 1MWZA 3LPEA 1XIQA 4Y2MA 2YVSA 4F0HA 2YY3A 4LBPA 4RNFA 4IDKB 3VV2B 2EFPA 3AFGA 1CS4A 1I94J 1VQ4S 4JI7F 4HT7A 1UJ4A 3CJ2A 4C3MA 1OSCA 3QFHA 1B64A 3CMAS 5E5NA 5CXTA 2HBYB 3ZO7A 1H2UX 5J2MB 3LUYA 1HNZF 4ZS6A 4UOGA 1T9WA 3HVTB 5KFSA 3U1LA 4G1QB 2H48B 4A8XA 2FY8A 2R7SA 2F63A 3QLHB 5HROA 4C48A 2CQ1A 2BV3A 1NPRA 2GW8A 3JS9A 1RWPB 2Q43A 2W25A 3BN4A 3D6HB 1Q53A 4DX8H 3ZXWA 2XLIA 3VAHA 3OR2B 1TKDA 1RA6A 3J7AN 4QWEA 1ZH5A 2W9AA 3DYAA 1FRJA 1RT1B 1XMBA 1H2VZ 3W64A 1W25A 6FDRA 2ZJRQ 4NA2A 1JB0C 1M1KT 4PUOA 1PILA 4WFZA 3QSYB 1VBXA 1DAXA 4K5RA 1S6QA 3DLBA 5EX3A 4DHVA 1N4LA 1PKUA 4YB1P 3W5ZA 1X4BA 3FCHA 4OIXA 3L7OA 4KR0B 3UVJB 2WB1D 3BYRA 3ZTRA 3SCIE 5DM7Q 2PMHA 2GC8A 1F9EB 3TAMB 3TOQA 4KHMA 4EGLA 1R0AB 3R1HA 1HR0F 3KLFA 1M90T 5E41A 3PR5B 2D3UA 2MHNA 3MM6A 3AHPA 3UD5A 1CVJA 1NDLA 2OEKA 2OTJS 3U27A 2BJ1A 3ICLA 4DUTA 5KFGA 3MFHA 3RBZA 3I87A 2GIFA 3KLIA 1HHQA 4JV0A 3WC0A 3GIMA 1FERA 1RT7A 4H4KC 1FA0A 2HNZA 3TVZA 1U7LA 5HJYA 5D4PA 4RUCA 3Q8QB 1PGZA 1UA0A 2N3LA 4EWTA 1PBAA 3D3CJ 3LWMA 4F3MA 3T5KA 1VISA 1YIJS 1RT7B 3MM7A 3ISNC 3WQPA 4CLUA 4LSZB 1TKTB 4NA3A 1FD2A 1JX4A 1SPBP 2KH9A 3OFFA 1KLMB 3CD7A 4MK8A 3U02A 5EWEA 4FF1A 1RE1B 3WC2A 1WHWA 4D3HA 1WC0A 2IRXA 3ZZPA 5L38A 3M9NB 1O5JA 2FLLA 4IRDA 3B78A 4K4TA 5AE1A 3BKFA 4CLZA 2N4DA 3HSZA 1DLOA 4QPTA 2YQ1A 2CZVC 3AD9C 4R25A 2FHJD 3SFUA 1XMQJ 2DITA 3R27A 3AD7C 2V67A 4DV6J 1RTDB 2XGPA 2ILYA 4WKRA 2AGQA 4ZP7A 2D3OR 1Z4UA 4B3TF 2V69A 3M32B 1SC4B 3BGOP 4OYWA 3OL6A 4ZLLA 4C8ZA 3V4MA 2RF2A 1DQ8A 1BQMA 1YDLA 2B9WA 2WONA 4J9UE 3WIUA 2B56A 2FY1A 2L08A 2X3GA 2H9ZA 4L73A 4PQUA 1FVSA 5H1SV 2XO6A 2AYGA 3TZWA 1MWQA 1VGYA 2CFXA 4DQSA 2ZBIA 3PYFA 3AA9A 2WBMA 3QLHA 4P2MA 3NCPA 5HROB 4KT0C 4DXLA 3PM9A 1VQMS 1F5AA 4W90B 2A18A 3HJVA 3AAWB 2W7AA 4QIGA 4O3NA 4CM2A 5J2MA 2EK1A 4ZN3A 2OIHA 2RHSB 1BUXA 1MNEA 2XHCA 2UV8G 2ASYA 3EICA 1NHVA 2V8VA 3N6MA 2MB0B 2ZHAA 2ZEJA 1WF0A 3L9ZA 3D6TB 3CCTA 3LGMA 1SV5A 2LQBA 1WSVA 4KV8A 2GAGC 2DK2A 2OD6A 5KFHA 1KVKA 2VG6A 3C2PA 1KONA 2I5JB 5IWAF 1HPZA 3MM5B 1KSPA 1U24A 4EFAC 2YX1A 4RW7A 4WIQA 2C2DA 1CJUB 3T6JA 4X4RA 2HZVA 2YKOA 1X5OA 5C24B 2JFKA 5B0CA 1UEKA 3MCNA 4OI3A 2EI5A 3M4XA 1VQ5S 1XEZA 4C8YA 3OUYA 2IFXA 4DR3F 3DLGA 3TA2A 4CM0A 1TKZB 4DF4A 1S59A 4ZPBA 2BANB 1REGX 3C6UA 1ULRA 3QQCD 3K5MA 1FXLA 5A8WB 3KK3B 4DMZA 5CYJA 2KJVA 2XMVA 2VQEF 3M2VA 2HURA 4CLFA 1KD1T 4PZVA 5H9EK 1UVKA 1RI7A 3EDRB 3MEKA 1PBUA 1HBMA 2FZCB 2OFHX 3VZHA 1VQSA 4O0IA 2EFVA 5LMNJ 1T03B 2FLPA 3OSNA 4FZVA 2J76E 3DI6A 4LRAA 1AZSA 4ZITA 1VI7A 2BKNA 3TJ9A 3D5MA 3ITHA 4J5OA 2ZZMA 3DLJA 1TTHB 3FKBA 4QWCA 4P73A 1WG1A 1F3FA 2K8GA 4ANDA 2HBRB 3I82A 2WTFA 2JFDA 1RISA 1SJFA 5H9FK 3JQKA 4DV2F 2VQFJ 1Q95G 2HHQA 1FKPB 4KFBA 4NYZA 1E6VB 1RTJB 1H2TZ 2QA4G 4F8RA 1AFIA 2XS7A 4DUZF 4IOCQ 1KP6A 2F65A 3IC1A 4NLVA 3EGWB 2ACMA 4RW4A 2Y0SD 2K06A 3ETMA 4ZHRB 2V8DA 4F25A 5KFKA 4X4TA 4B3OA 3G2XA 3Q89A 5DJBA 4ICLB 1OIAA 3J81j 4FP9A 4GC6A 2HRUA 2O01C 1N5YA 5F3ZA 3LTOA 5L1JA 1TL7A 5DO2A 3WDOA 1S72S 3BPSP 1SJQA 2IYGA 1XC9A 4BDPA 2EWHA 1N5TA 3HVAA 3M1VA 2GGPB 1OY8A 1P1TA 2AZ1A 3MPUB 4TVAB 5J2PB 2FUG9 5KG5A 1RHQB 4B02A 4F26A 1HKAA 5IV4A 5HO4A 4EK2A 1U0HA 1EIYB 4WP3A 1CJKA 1PYSB 1H7WA 1WJ9A 5AXMA 4CO2A 1IKXB 2C3MA 3D6MB 5DETA 3J81Y 3OL7A 4NCGB 4B3SJ 3P96A 1O8BA 3THTA 1RT6B 2MLXA 3IBWA 1H0HB 1IKWB 3I9V9 4YS2A 1UTAA 2RUSA 3RRKA 5CABA 4X66F 3RBDA 2UU9J 2OPSB 4QPXA 4RWXA 1BLUA 5FDLB 2HVIA 2XSJA 1VBZA 1JLFB 7FD1A 1IBLJ 1S9EB 1F2HA 1JJCB 2W2NP 1U1OA 4ZVHA 2J0WA 4G1PA 2DH9A 3GLJA 1Y3KA 3D67A 2MKYA 2VG5B 5KFRA 3GR0A 1N32J 1C0TA 3FEYB 3OXGA 3QYYA 4XPEA 3CJTA 2Q3PA 3JSYA 5D77A 4EBEA 3MEEB 2UVRA 4FS2A 5K9FA 3FGVA 2VG5A 3W60A 3PV8A 1CULB 4WE1A 3JYTB 2V4JB 5LL6d 2VDIA 2OKQA 5LJ5Y 2VASA 5J2QB 2VA3A 1YK9A 2CQ3A 1HARA 2P6SA 1S9EA 1RTZA 1Y0HA 1WORA 4C8NA 5D0GA 4JI4J 3J7ZT 2RUGA 4NL5A 1LWFB 2DNYA 4USMA 2IHR1 2VU5A 1VQKS 1MSWD 1NCLA 1FTRA 4OZ5A 4HT5A 3BGRB 4I2PB 4P2XA 3MTJA 5IV3A 8AT1B 1RWVB 2CZ4A 3MFIA 3GJRB 1BMQB 2V94A 4LF2A 1K44A 1VRTA 3HKWA 1FKAF 2DGTA 4JB8B 3PX4A 4QYZJ 3MHYA 4DV3F 1JLCB 2M88A 3CJ5A 4ZPVR 3CWJA 5J2PA 3D0HE 4U9RA 2HFNA 1HNVA 2VD3A 1FJGF 2CADA 2Z8QA 5D4OA 1S4EA 3NGRA 2GVDB 4ZVRB 1DFDA 1NJZA 2LP4A 5D0HA 4EBDA 2BE2A 4WFNQ 3GJTB 3MEDA 4ZA1A 2E9TA 3DXSX 3DLHA 3H2UB 5K8MA 3VAFA 1IJEB 4RX6A 2H1YA 3V6DA 4M5LA 2NUUG 3C6TB 1KLNA 1RADB 4ZJLA 2XM3A 3UPFA 2VB6A 3QO9B 3DOKB 2DT9A 2HMIA 1XNQJ 2IMWP 1WKKA 2V8HA 4EUVA 2OH2A 1D8YA 4NXMF 3K57A 3A3PB 1RWWB 4M1KA 4K8RA 2NPFA 4ECQA 2HQGA 4HKQA 2PMWA 4QR2A 1RBOB 4ANEA 4OHXA 4F4WA 2C2MB 3UN5A 3QJLA 3HXMA 2OMOA 5K5MA 3EMTA 2HZAA 3W9IA 5I42B 3EE3A 4PQAA 2QLXA 1N33F 3BSAA 4NRUA 4ILMA 2Z0GA 4MFBA 2U2FA 1NU4A 2RDIA 1I5OB 2V4RA 3NNHA 1HBMB 1L3UA 4NXNJ 2RRBA 2XYGB 3CIMA 1CC7A 1VLOA 1RYRA 3T5JA 1MN9A 3M2VB 4LFBF 2HK2A 3DRYA 1LW2B 5I3UA 3J7Z5 3NGTA 4FYWB 1LW0B 4I67A 5ETOA 1XERA 2OP5A 4B9UA 2HHXA 3HVRA 1UVIA 4Y28C 3OUYB 2C2NA 4DL7A 4KTQA 3HD1A 5BYSA 1NB7A 2C3UA 4K4WA 2ZJQQ 1EETB 3PJ9A 4ZJQA 5E2QA 3J7A1 4YR2A 4KGKA 3M2RA 1F2GA 3T1YF 3AOCA 2Z2YB 3GYGA 2R7XA 2NREA 3NOCA 1UZHA 3PHTA 3EPIA 4HDGA 3RAXA 3DC2A 2E44A 4Y0FA 1K1QA 4CI0B 4WFBQ 1T9TA 2NSCA 1RKJA 1V9OA 1SV5B 1XR5A 4E98A 1FT8A 2MY7A 1KNZA 3X1LB 5GAGU 3TZYA 4UZBA 1X4AA 2ZWOA 4UUWA 1QAYA 1HBUA 1WC4A 2GO8A 3K7RA 5LOQA 3KK2A 4XDCA 2VKZG 1R43A 1FTCA 3OJSA 2GMJA 2DR5A 3CDUA 4OI6A 2KHDA 4LQ9A 4DCOB 4JI1J 1ZPVA 1S6UA 2QA2A 2FJWA 1Y5IB 1QJHA 2MKSA 3HLUA 2Q66A 5F8HA 3V6KA 2A2CA 4LMZA 3OFHA 4ZLPA 2GFFA 2HFZA 1U47A 3J80Y 5IC4B 3PFEA 4ECVA 1H72C 4MJKA 3O44A 5KOWA 1M5KC 2CPXA 3PR4A 4ED0A 2CQ4A 2W7OA 2DH8A 4DR2J 3FMWA 1X4FA 4USIA 3CF5Q 1IN0A 3A3NB 3EXCX 5HMWA 2RRAA 1IBLF 3G8SA 3V81B 5C25B 4CQ1A 3N4WA 4UT4A 5K20B 3EDQB 4RNHA 4QWAA 1W26A 4P74A 3MUTP 3QT8A 4I69A 1OS5A 4UUXA 1PJ5A 4W98A 5A76A 3H40A 3TX0A 2JSXA 2XMJA 4OZNA 1P9QC 1FK9A 4AXJA 4M63A 2EFOA 2BRLA 3TEGA 1RT4B 3SV3A 1ZZNA 1U6BA 3Q83A 2DHHA 5J1PA 1C1BB 3Q8RB 3MCOA 4LUBA 2VV5A 3MM7B 2UUBJ 1HIYA 4FNHA 3ILIA 4F67A 1VHIA 2AJFE 2B9EA 5C2GA 4ETXA 2KG0A 1AFJA 4C11A 3R2CJ 2J9DE 1PG5B 3KHGA 4LFCF 2VC0A 2GHVC 3D9BA 4PCQA 4ZLJA 2I9SA 3KLIB 1JXEA 5KAKA 2Y1RI 4LR7A 3M2UA 2QLFB 2N82B 5JUMA 1U1PA 1X9SA 3MAHA 3POTA 3D66A 4RBTA 5EN1A 2HK3A 3MAAA 3DOLB 2KFYA 4OHVA 4NLWA 1S9GB 1PYOB 4RL1A 4DV4F 1VS3A 2MQ8A 3JTOA 4B3SF 3DMJB 1RK8A 4V1Ak 5C2CA 2A3JA 2ZH3A 3PRVA 1GMVA 2AGOA 1YJNS 1NK6A 1EQ0A 2GO9A 5HQ8A 1AA1B 2DNPA 3BM7A 2HHWA 1UP1A 4OX8A 4F36A 3K5OA 3T1HJ 3UVJA 1S77D 1LXJA 2EFGA 3EGZA 2MJNA 2PFDA 4UTGA 3FSIA 4KGZB 2XG8A 4DFPA 1LWXA 1S6QB 2BE7D 3FQKA 3GFHA 4PR6A 1CJVA 3GSIA 4ECWA 1FEHA 2DGQA 1NK9A 4RW9B 2YKAA 2Y9HA 1IUJA 2JNJA 1YBTA 3HM9A 1NZAA 5T7LB 5SUHA 2BM1A 4ZPDA 3QNWB 4YHHJ 2WVFA 2XB2D 5HP1A 5SZTA 3BF4A 3IAS9 2NS1B 3K5NA 2EG2A 2F9JA 2MKKA 2UXCF 2FZGB 2KN4A 1H38A 1VJWA 2J6TA 4I1TA 3ET6B 4O3PA 2XMAA 2G1HA 3AOBA 3IM9A 1FNXH 5ETTA 2MGZB 3NY0A 2XWYA 1S1WA 4A8SA 1SUQB 2ASJA 2LA4A 2DCUB 3C15B 4ZMMA 3KHRA 1SL1A 1IKVA 2FVRA 3GONA 2VUGA 2YKNA 3NBPA 2J6SA 2C42A 4NOHA 2C3PA 2Q79A 2ZNYA 3V2UC 5IWAJ 1M5VC 4OV6A 3R2DJ 1EKSA 2HGNA 1XJWB 4OZ1A 4P71A 3DDKA 1QVGR 3P5TL 2B4UA 1TUWA 1C1CB 2FYXA 1XNQF 3W2WB 2ASDA 2JX2A 2MKHA 3I96A 3LGNA 2CG8A 4IYQA 1U8WA 4P2FA 1IR0A 5KFXA 3H2LA 3DHXA 1JLGA 2YXLA 1Y9OA 1P27B 4KE5A 5A8RB 1UCNA 1VK8A 1EJ7L 1BQXA 2Q6CA 3IS9A 3LP1A 3WX8A 2IRYA 4RUAA 1JXLA 1EP4B 4Z37A 2EW9A 2VFRA 4C9DA 3IRXA 2FJAB 2J8SA 4OI2A 3TRGA 3UE2A 2VIHA 1N33J 4JI3F 4HHHA 1MROB 4B9LA 3AJ1A 4L76A 2ZKTA 2ZOFA 3BYPA 3W66A 1S9FA 3MR5A 1B7FA 2B0GA 4CNYA 2Y3YA 4O4GA 2MSTA 3TNVA 4V19J 5CAAA 4L74A 1WG5A 2G0CA 4ED2A 2BJEA 2NPIA 2BOPA 1U0SA 2C2OB 2FLOA 3E8OA 1L3KA 5IC6B 4K4UA 3GCXP 3SQGA 4RU9A 2NSBA 1WOPA 3TUJC 3BQ2A 2KT5A 1U1RA 1HNXF 3CCZA 2F4VJ 2DPJA 3KUEA 2BJ8A 1YKWA 4X4QA 3IAM9 2VH7A 5D4LA 1RAGB 2JEJA 3GFYA 5A0YB 2DVIA 2AGPA 2J0QD 2DBBA 3CE8A 3L09A 4DFKA 3PX0A 1A0OB 4C3LA 5HI7A 1MU2A 1QE1B 5DG8A 4DV3J 1HYSB 4UQGA 3T3FA 5G4DA 4FYDA 2VFSA 3DRRB 1FJCA 2CAJA 3CCQS 1JLAA 2EBGA 2PGCA 4FKYA 5CYMA 3G4SS 2ZH9A 3VQSA 3KLGB 4J7CA 2LEBA 3NS5A 1M5OC 3WZ0A 2F1FA 1M1GA 3UDVA 2QG9B 3C3LA 1RBAA 2BACA 2P9CA 5LSOA 3KK1A 1WD6A 1T3NA 1VC0A 1M5PC 4LR9A 3KLVA 3MDFA 4JI5F 1UEUA 5B0GA 4UQTA 1T9VA 1KVIA 2AHOB 2K1RB 2YKMB 5K14A 1YJUA 4OX9J 1U2CA 4A8OA 2B4VA 1MLAA 1HBOB 1RTHA 4WPAA 1UJ5A 3VAKA 2IA6A 1FRIA 2BA9A 1HWKA 3MD1A 4OZLA 3CO0P 4KRWA 4U8VA 4YDXA 1WSRA 1NJYA 1JJ2R 1JLEA 3HFKA 1S1TB 2VBWA 2M3DA 3CT9A 2OI2A 4DL0C 4PWDB 4NPOA 3OHAA 4KB7A 3QJPA 4QYRA 1GTEA 4F04B 2F8HA 4FF2A 3BKUA 4DR7F 1FDBA 3MCSA 2HS3A 5EDWA 4R8UA 3ZZOA 4K2JA 4DV7J 2MLZA 3QAUA 4DPTA 3OTOF 4M5KA 1NJWA 2GV1A 2GIQA 2DHSA 1N5SA 2DNGA 3DLKB 4ZPAA 3SMZA 3Q22A 2A6OA 1U2RA 4YB7A 2B4PA 4OX6A 2QGFB 3EXYA 4Y2KA 2VG7A 5B0AA 3MEGB 2CQ2A 4WK3A 4DN9A 1UVNA 1EHWA 4GVLA 2MQQA 1TL1B 3A8IA 2HKEA 3OVBA 4C7QA 2BE9B 2JRSA 1X5TA 2R2RA 4MMOA 3GJQB 1HNWJ 4X64J 3MTKA 1H6KX 2LCWA 3DGPB 4B17A 3FZ2A 1RB0A 3OFGA 3QT6A 4NLOA 1K73T 3ZZZA 1FKOA 1SC1B 4G1IA 3RR7A 3UNGC 2PI5A 5DGAA 1K0TA 3GIJA 4CH1A 2GNKA 3J81U 2AW0A 2D41A 1HNIA 4FKXA 1ACMB 4LFAJ 1U25A 3R5GA 4BWJA 2FJDB 4FPIA 4JV1A 3EYZA 3C19A 2WRMA 3I6PA 4JI0F 2CZ9A 1GEHA 3SIPB 2HVEA 3I5CA 4R8UB 4ED8A 4DF8A 3FUYA 4KAIA 2AKWB 4A4JA 1WI6A 2MMYA 1FX2A 4D3GA 1TVRA 3P5BP 5LM7E 2PMZD 5HAOA 5F41A 4CLWA 2XCAA 3H4DA 2UUAJ 4PWDA 2YNFA 4BBYA 1JXVA 4C97A 3MM8B 1VC5A 1S1TA 4J9NA 3KNAA 3KTQA 1RJJA 4YB5A 4A8FA 3A3OB 4DX5A 1NDCA 1QM9A 3AQPA 4LF4J 4I2QB 1JLQB 3R3TA 3TP2A 2CDRB 2J0SD 2YQ3A 3UD3P 1NSAA 1XN9A 2LYVA 2K1RA 2YKMA 3R5BA 2GQCA 1N5VA 1RAJA 3I4HX 3PYEA 4M5HA 1MG7A 4RPFA 2FC9A 3R97A 4CWBA 3PIOQ 3V4IA 1TR0A 2V5HG 3MMAA 4PWWA 4PAAA 4X4SA 4HHUA 3DM2B 2IYIA 4YHHF 3H5SA 3CIZA 3EGNA 4N8NA 5IM0A 2E1PA 1X9MA 4DR7J 2CPZA 3R7SB 3W2VB 3K8WA 2DGVA 1VQ7S 3BGFA 1Q7LB 2A6MA 3U1NA 1YI2S 1R31A 1NK8A 2CVIA 3BBFA 3NNCA 1ITPA 1DBDA 1JLBA 1NBEB 4N7TA 3ISND 3ETOA 2ZBRA 4ZPTR 5AT1B 1HI0P 3RU0A 3ZNUA 2KYZA 4F50A 3BBBA 3CGIA 5F8NA 2XLKA 4K0KJ 1X5PA 2KB2A 3D1HA 2UUTA 1N6QA 5KFWA 2UUBF 1UWBB 1NPKA 2GQ2A 1U1NA 3MECA 1TL3A 1WI8A 2DNKA 1X5SA 3TVKA 4FBUA 3FCVA 2R2TA 3RB0A 3CC7S 1IBKF 4NMXA 4P9SA 2AZ3A 2YPZA 1YRXA 3L7PA 4QQBA 3LPYA 4HTJA 4B3RF 3UNYA 4FXDA 1IM6A 2R8IA 2JJ4D 2F40A 3QRRA 3CNQP 3G8QA 3HD2A 1TV6A 2LEPA 5CD4A 2CPYA 2P9GA 5HBMB 1A9NB 3IFEA 1RWMB 2VL1A 1NDPA 1OY6A 2ZUGA 2HHUA 4DU7A 4Y65A 3G6YA 3TZXA 2IRUA 3UCZP 1RU2A 2OHDA 3EZOA 4YR0A 3I0RB 1HQEB 2D9OA 2VBZA 3NEKA 4JV5F 5LJ3Y 1IVZA 2KT2A 1MROA 1EKRA 2CQHA 1NKBA 2G2YA 4FNIA 4P7VA 1YITS 1TAUA 1LK5A 1RCOB 2WW8A 3IM8A 3K8VA 2FZKB 3C14B 1EP4A 4QOTA 5GVQA 4WBFA 3SCJE 5A6PA 3OV7A 3KLHA 1T02A 3KLEB 3EVMA 3LP2B 4AL7A 4YQWA 2M5YA 2B5JB 2XZWA 3HCXA 2W4DA 2B8QA 3UO0A 5KFIA 3L95X 4ECYA 2XZDB 3B8HA 3I0SA 4UOCA 5CQGA 2DIVA 4FXWA 4C0HA 1U48A 4U7UD 3HPOA 5F8MA 2X7IA 1Q8IA 1QSLA 3BN7A 5E3PA 7FDRA 1JK9B 1AROP 2RKIB 1KOOA 2KKHA 3JTNA 2W7PA 3E3XA 2BDPA 2HFSA 3TYTA 4DS5A 2LXFA 4DFMA 4HACA 1BQNA 4IG3B 3ZTQA 3PW4A 2VODA 2V9KA 5ETMA 3IBFB 3NWGA 3CJKB 3DHWC 3ZZRA 3CSKA 4NE9C 1S99A 4MAKA 2ZM6J 2E5LF 3ET6A 3H8YA 1Q8LA 1WDTA 1REVA 3M30A 1OSDA 1RT5B 3OFEA 2ZDOA 5M2UA 5DM6Q 3EPGA 2JHEA 2AMCB 3KJQB 3EM1A 3A4TA 4EO6A 4JYAJ 4HEA9 4LIRA 4CCHA 1Q7YT 2IM2A 2BRKA 3MUMP 4EYIB 4PPZA 4HLBA 5LSRA 3O1LA 2BQUA 4M5DA 4P2SA 1MMDA 3CPWR 1AW0A 3O2IA 1PO6A 3GB0A 1CJVB 1ZTWA 3AB4B 3MZIA 4IFVA 4ANCA 3H42A 2CJKA 1WWHA 3BH7B 1BXNA 1DTTB 2AP6A 2JVOA 3BV8A 3S6EA 1JWWA 3FFIB 2BEFA 4LREA 1HHSA 2RQCA 3R6GB 5M2PA 3LP0A 5GAHI 2RU3A 2QE5A 2K7KA 1ZZFA 3DMJA 3MGJA 2CQCA 3PEJA 4A48A 2QZ8A 1ZS6A
chains in the Genus database with same CATH topology
1FDAA 1HQUA 5BJRA 2DGUA 2LQ5A 3H98A 2AJ1A 5EX0A 1CPZA 3TAPA 3CCES 2R7UA 1RT5A 3PXGa 2WBRA 2XMKA 2FD2A 2JC1A 4KJIA 2APOA 3PRBA 2DCLA 4IOBA 2LVWA 2CIMA 3IWXA 2X51A 4I68A 1BQNB 4IG3A 3U7JA 1M5HA 2KHCA 4DS4A 4LF6F 2IC3A 3RYLA 4X2BA 2IVMA 3C46A 3NS6A 1JJHA 1VBYA 4LSLB 2OLWA 3IRWP 1FJ7A 1CLFA 4HI1A 5F8JA 2FVPA 3KJVB 1VMBA 4I56A 2HHSA 1UMJA 2DISA 3JTPA 3LW5C 3NGKA 2QO3A 2HS4A 3TQ1A 4DSIA 3KMQA 1S1XA 3M6XA 4CO1A 2LDYA 4R5PA 5DRKA 4J9OA 1SBRA 1VQPS 1CQMA 1U1QA 3U1MA 4NYOA 2OSRA 4QU7A 1NH7A 2FVCA 2OPPB 4RNOA 2CQGA 5L39A 2XS5A 4J9SA 4DSFA 1TUVA 4ZDNA 3WBZA 4AFFA 1NKEA 4XK8C 4U7CA 2GMLA 2KO1A 2OPRA 3ENVA 1HWUA 4WCEQ 1L3SA 1FO1A 4PG5A 1HD1A 3H25A 1V3RA 4QWDA 1U26A 1TV6B 2HNDA 3CXCR 4JI4F 4ITSA 2DB1A 3KK2B 3MM9A 4DQIA 2XMUA 3AQOA 4BCAA 2A2DA 4Y3CA 3MUVP 3M6WA 4WZQA 4KQZA 2QEXS 2FJBB 3CULA 3FNNA 4TY8B 3GSDA 1FRKA 2BBEA 2R7QA 4B9NA 3MMJA 3D2WA 2OPQA 4GKKF 4OI0A 4ED5A 1MWYA 1EETA 3LQVA 1JNZB 4X4OA 2OO4A 2LU1A 1Q79A 1R8AA 2NUHA 3QIPB 4DOZA 1NK0A 1LQ9A 1SI9A 1LKZA 4KIAA 4RLEA 2XY5A 3QMQA 2EG1A 1B0TA 4R5PB 2VPYB 3OR1A 1SJ3P 4ED3A 3G86A 2IVYA 1S1VB 2B9YA 5I3UB 1BY9A 3JSRA 4CO4A 1YHQS 4DSLA 3W2VA 3PW5A 4LF7F 4UY8T 2DO4A 1YGYA 1U1MA 5B09A 4OHZA 1C2PA 2ACYA 1G1XA 3P49B 4H4MB 4C8OA 1H98A 4MKAA 4LSLA 2E66A 4DLEA 1VC6A 4HTIA 3F73A 1G7CB 2IC3B 5DQHA 1NAQA 3ISZA 2VONA 4KHRA 1JLQA 2JZ5A 1NRKA 2RSQA 4C4WA 2KM8C 2R7WA 3QGHA 1NJXA 5H9EJ 4YDDB 1GNKA 2DNHA 2ZC3A 1VOMA 3V6JA 2CPFA 2V8GA 3M6UA 5U47A 2R8GA 2MQMA 2GMHA 2YNGA 4A8QA 1TVRB 2J7UA 3ZZ0A 4Q44A 4OHYA 4DV1F 3DCAA 5J1NA 2HFOA 3EUNA 1U4BA 4ZVEA 4L3NA 4Q2LA 4F4YA 2CJAA 1UL3A 2ZOGA 4K4VA 4LQ3A 2XMWA 4MH8A 1ZYQA 1UA1A 3N0VA 3OTEA 5EWGA 2OJ3A 3LAKA 3DRPA 2E9ZA 4EU0A 1Q82T 1URNA 2VPWB 3UQSA 2MZTA 3BQ0A 3DRSB 5CCLA 2IAJA 3MPYA 5LMUF 1XBWA 1R89A 2MZ1A 3BSNA 1FJEB 5DGBA 4IRKA 2YNHB 5HMYA 4DV6F 1UFLA 4PPDA 1DZ5A 4CTAA 1UAWA 1NK7A 3F56A 2CVEA 2MYFA 1D8ZA 4K5SA 3CJKA 1V3SA 4OQJA 2JDJA 3W3SA 1H7XA 3MEEA 2L9WA 2YNIA 4HHJA 2B7BB 4N5SA 3I5AA 2UVVA 2M8DB 2WSFC 4MK7A 1WHYA 4N77A 1OO0B 4RWWA 5KG0A 1Y5NB 2RE1A 5AE3A 4ID5B 3OW2R 1D9AA 3B82A 1NNDA 1OWXA 3IXQA 1DURA 2MKIA 3LP2A 1KC8T 2CG4A 4DV0F 3CCWA 4NCGA 3E01B 2ZH1A 1L5UA 4BC9A 2HNDB 1IKXA 2PI4A 2AX0A 4L72B 5K8OA 2PA8D 3SSRA 5KFOA 1RWUA 3CUNA 3PY8A 3N28A 1HQEA 3KLGA 3DN9A 5DDPC 3CCUS 1BD6A 4K59A 5HN0A 2ROGA 4G3IA 1I6JA 4ZCKA 4IOAQ 2E29A 2RVJA 2UP1A 1RP5A 5E3CA 2ZE2A 3QGIA 1S1XB 1A9NB 2MZSA 2J5AA 2PO4A 3RB3A 4TU9A 1ZPWX 2HAIA 3OL9A 1U09A 2XSFA 4KBIA 2ZJPQ 3LALA 5KFAA 1X7VA 4OI4A 5I3PA 5JVGQ 3SV4A 1SL0A 4LIWA 3SXLA 1D9DA 1UWBA 2LMIA 3CDAA 2ZE2B 5ADZA 2C2EA 1WHVA 5EGYA 4ECRA 4N41A 2KVIA 2OD4A 2ZOMA 4RKUC 3D0IE 3KWMA 4WFYA 1IJFB 4O4GB 2MY8A 3BSCA 2I8EA 2AD9A 2RIJA 2X1GA 4CO5A 1U6FA 1Y4ZB 2FJVA 2E7XA 4I7FA 4E8UA 2UV8A 4CO0A 2E1RA 3MURP 1N56A 2YKPA 4KGMA 5IM0B 2UU9F 3IA0A 3IRXB 4DR2F 2RNEA 5A2QY 1TK5A 3MMAB 2PFFB 3FMBA 1P8GA 4OL8A 1HQUB 5A8WA 3V6HA 2RJZA 2JLGA 2W4CA 3RAQA 2KU7A 3DLGB 4DSJA 4JBCA 5EUHA 2JOQA 1FXDA 2W9BA 4URQU 2CPEA 4I2QA 3DFEA 1J2VA 1DTTA 3BO4A 2YWHA 1CEZA 5M2RA 1FNOA 3H59A 3MM8A 1CSJA 3T19A 2YKNB 3JSBA 2I5JA 5B0FA 4H4KA 2FTRA 2AJ4A 4DSEA 1CC8A 3F44A 3BR9A 3CJ0A 1I1GA 4KO0A 5FD1A 2R4FA 2PN6A 3G6VA 4Z2XA 2FHMA 5KFCA 2HLUA 4J9LA 4CTAB 5DG7A 4R0JA 1N48A 3UR3C 2DNQA 4LFAF 5T41A 2M2BA 2GJIA 4WU3A 3AH6A 4LF4F 2E1AA 1WTBA 4KO0B 1FDNA 5KG1A 2HVHA 1FKOB 3OPKA 2B3TB 1Z2LA 3DRSA 4DN0A 3G6ES 3IG1B 3GG1A 4WZMA 1Q1KA 3NL0A 2XCPA 4Y00A 2ATLA 3HMJG 3MEGA 1YRTA 5FLXY 3CD6S 5CYQA 2WAQD 4Q5VA 1QUPA 3MMBA 3GYXB 3N6NA 3PEHA 4HH0A 4WIIA 5D6GA 4IRCA 3A8EA 1WNEA 1Q86T 2ZM6F 1YBAA 5AXKA 1P1LA 4N76A 2AX1A 1S10A 2YNGB 3KG4A 2QRRA 4V19X 5KG6A 4ZP6A 1K8AT 1N54B 2DO0A 1VHFA 3K58A 2SXLA 4C11B 3FEZA 3KFWX 4X62F 1KRPA 1X4EA 1J5OB 2HS0A 3M8QA 4OX9F 4HYKA 1U45A 3LWLA 1MMNA 1KN6A 2KTQA 1YTYA 4MTPA 5A6WA 3MMCB 1JMTA 3QWPA 4A47A 1RT2B 4A8YA 1HW8A 1IBMF 4WTYA 2HGLA 1C4CA 1XK8A 2KFNA 4DQQA 2MQNA 2F8MA 4Q43A 5GADU 3FSYA 4DR5F 2HG4A 2BW2A 3I55S 1XWLA 3I9ZA 4ED6A 2R8KA 4PG7A 4FVMA 4ZPWR 2XI2A 2XO7A 1N32F 4QIWD 1TKXB 2HPUA 5A0YA 2HRYA 4ES3A 1KEKA 5KG3A 3Q8PB 1RT2A 4QIFA 3E2EA 1NO8A 2GQQA 4QBUA 1OPZA 1ZETA 2MQLA 5FIIA 2UUCF 2WSCC 3SEOA 3KYLA 2XEXA 4AL6A 4ELVA 2ILZA 3D54A 4CH0S 4ECUA 2DNNA 1TP7A 1MW7A 4PG6A 4C0BA 2L3MA 4X65F 3GIKA 3LF0A 4HL9A 4CH7A 4K0KF 2X1FA 1WF1A 2CPHA 2I0XA 4PWUA 2B7CB 3Q2SC 1F0XA 3D28A 4F2RA 5GAEU 5KFZA 5AE2A 1ELOA 3CCMS 5MLCV 3SFGA 4MK9A 4N8OA 1QLNA 2FVSA 2DR9A 1O0PA 3IS9B 2CJBA 2IBOA 2LDIA 3O6QA 4WXWA 5B08A 5KFNA 4YFUA 4F4ZA 2ZDPA 2PT0A 2DH7A 3HHKA 2HHVA 2VC1A 1PC4A 2DGXA 2E5HA 2J7WA 3T9ZA 3CDBA 4JYAF 2EBEA 2FDNA 3F41A 4Q2MA 5CYQB 4CNZA 2CRLA 2I38A 1HNIB 1HW9A 1A6LA 2IJFA 1SJ4P 2J6UA 4J9PA 3KG0A 4AYBD 1FDDA 4J9KA 4C3KA 1G2EA 3IR6B 1NK4A 2IAJB 1U2FA 3AB2B 2XNQA 3MWBA 4DEZA 4MKBA 3MAQA 4I6AA 1NK5A 1IKVB 3KKFA 2LQ9A 5LMNF 2BABA 3PW2A 2LQJA 1URRA 1IKYB 3IWLA 1UFWA 2CQIA 2VOOA 2DGOA 3I56S 3VQTA 3VAMA 2OMLA 4RW8A 1WG4A 2QSFA 4IKAA 4N56A 2F3JA 2N3OA 5KFTA 1S0OA 2KDOA 3FQLA 4IR9A 4QIVA 4CZCA 2M7SA 3EZUA 1XMOF 4O3RA 4J9QA 2O3DA 1R3NA 3MEDB 1JKHA 4M8LA 4RW9A 3OQ2A 3MF5A 5CCMA 2KT3A 2MJUA 3US5A 2R7TA 1QAIA 3R5CA 1HWJA 2FIUA 2FGOA 3J7YU 2L9DA 5F3TA 2J9DA 3NGDA 3D1OA 1JLCA 4YP3A 3BO3A 4O44A 3UD4P 1HBOA 3GQCA 1VRTB 4YY3F 3RRGA 5L1LA 3TARA 2XULA 4IH7A 1SH2A 3JAMY 2E5IA 3GIIA 3BJYA 4G6VB 5KFUA 1TL5A 3T5HA 2HHPA 3GV5B 5CH7B 2H5EA 2ZHOA 2GHPA 3M2UB 3S8SA 1REVB 3M30B 1YJWS 5KT4A 2DNZA 3DRXA 4JI8F 4DL5A 3BDEA 3HP6A 1S0MA 2DJWA 4F2SA 3DRRA 2FJXA 1GH8A 2ZHBA 2DNRA 4RBVA 1U1KA 1MU2B 1QE1A 1S48A 3GFXA 3QIPA 4NX9A 4ZP9A 3Q0AA 3A1YG 5DQIA 1APSA 2OPQB 2D7SA 4ES1A 1KQSR 3PW0A 1Q16B 4KPYA 2J8AA 4TY8A 5DLGA 5HLFA 1RGVA 2QA4S 3VAGA 2R2UA 2CPJA 4NCBA 2M70A 4ZK7M 3UCUP 3DU6A 2DPIA 1X9WA 5KFFA 5C25A 1RT6A 3M8SA 2AV5A 4TN2A 3K2YA 4P6QA 4IO9Q 3H5XA 1XNRF 1G6BA 4QWBA 3HVWA 3ZZTA 3T5LA 2RRNA 3PIPQ 2ZFHA 4OJGA 2KXFA 1YJTA 3H2VE 4TY9A 5HBMA 2LLZA 2L48A 1VLYA 4NMLA 4MYUA 1TL4A 1JJ4A 3MR2A 4NLTA 4ICLA 1FXRA 3NRBA 4F4XA 2F4VF 4ALZA 3MPWA 4WF9Q 1FRMA 2MQPA 1XTZA 3PACA 5A8RA 1YQHA 5HLFB 2FVQA 4KFBB 1NKCA 4USJC 2G4BA 3MECB 4NYPA 2W24A 1UVMA 5KFJA 1S1UA 2UZAA 1T7PA 4DWIA 3G8TA 4O3SA 2W4PA 2YNIB 2K3IA 1WF2A 3QJJA 4RW6A 4Q8FA 1SUQA 3DI6B 3IWNC 4HI2A 1SXLA 2VBYA 1S1WB 1JLBB 3RAMA 1LW0A 4J9MA 4NLQA 5AJ3F 3GR1A 5LT5A 1YRUA 4YUDA 4FXVA 4UW2A 2ZD1A 2IJNA 4OX7A 4ES2A 1YJVA 2U1AA 3V4IB 1HD0A 4MFBB 3FEXB 4OLOA 1ZTTA 2DTJA 3SSQA 5I42A 3TVYA 4O44B 5BYRA 1UJ6A 4GC7A 3FFIA 4IFYA 1T8EA 1X0PA 5THWA 3BS9A 2LA6A 3HHNB 2FJEB 2CQBA 3CCJS 3QGGA 1P6TA 3T6BA 2K2PA 3DOKA 1E6YA 1JKHB 1ZM2A 3QPIA 1ZAWA 3K0JA 4KV8B 1GTHA 3NMAA 2XMMA 2DIUA 5D8HB 1S4FA 5D78A 1S6OA 1S9GA 1VIOA 4IR1A 1YJRA 3DOLA 5JXSA 2HYIB 1SIWB 5H9FJ 5MAOA 2BE2B 5KT2A 2XNRA 2UVWA 2BXJA 1FE0A 3TX8A 4LVOP 3QIDA 4B08A 1VIXA 4U7UK 2ASLA 3QZ8A 3CJ4A 3KNGA 5IT4A 1TL1A 1C1BA 2F8EX 2PA3A 2RKIA 4PKDB 3GMGA 4TKTA 5CD4H 1S0VA 3BGRA 4I2PA 1Q81T 1RA7A 1RT4A 4H4MA 1Z1ZA 5D4NA 2HVZA 1F9FA 1MMLA 1J5EF 4JOUA 1FESA 3V5RA 3VR1A 2FHJA 2B5JA 2X1AA 2WHOA 1S1VA 1T3OA 1T94A 3UW1A 5LXYA 3OR1B 4ECZA 1GX6A 2YWFA 3V81A 5L8RC 2HQ3A 4I4BA 4PRFA 2AU0A 1YJ9S 3CMES 1TKTA 5AXNA 5BR8F 3HT3A 4ECSA 1JLEB 4ZKAA 1FD8A 5F8LA 2YX4A 2HZCA 3VWSA 2CJQA 1M5SA 2VKRA 2DNMA 4IUFA 3HZGA 2QV6A 3ZFVA 4QCLA 1RTHB 3KHHA 3SSSA 3G96A 4WXOA 3IGNA 1VQOS 2B43A 5EHHA 3I32A 4C8KA 1IKWA 3NKYA 4L6V3 4PXCA 3RZAA 2ZH4A 4K50A 1S7HA 1AUDA 2K3KA 2OFGX 5CZXA 1LFWA 2I2YA 2A1BA 2MZJA 4K4YA 3NAHA 4I64A 3T9NA 2DRBA 2BUNA 2R2SA 1T95A 3LO3A 3MR3A 1HA1A 4JUZA 1TKXA 1WTFA 2A10A 2RT3A 2XY6A 1HYSA 4I6YA 3K5PA 3KG1A 1WHXA 4CT9A 1FEEA 2Z2LA 4W92B 2ERRA 2R8JA 1FF2A 2NYIA 3KMSA 2XY7A 2IVFB 4ILLA 1E6VA 3MMCA 4H4OA 3CDEA 2EC0A 3RW6A 2PIIA 4WK1A 3VCDA 1KHVA 4RZRA 1KS2A 4XDDA 3ITHB 3HK2A 3PO5A 1G3OA 2RQ4A 4LF5F 3M8QB 4NWBA 4NLDA 3VF0B 1J5OA 4TXSA 5F9LA 2JC0A 4ATNA 1R6YA 3LH2S 1V6HA 2VFTA 4KKOA 4ELTA 1AXQA 3NNAA 4LF9F 2ROPA 1RTIB 2YNFB 3HKZD 4K4ZA 5E33A 5IZHA 3OLAA 3TAQA 4URGA 2UUAF 2AJ0A 3TR5A 1WEZA 1WEYA 3SZ2A 5EWFA 2PSZA