3X3UA

Crystal structure of wild-type of e. coli cuta1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
TASVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEYEVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divalent-cation tolerance protein CutA
publication title Crystal structure of wild-type of E. coli CutA1
rcsb
source organism Escherichia coli k-12
molecule tags Metal binding protein
total genus 24
structure length 104
sequence length 104
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3x3uA00
2J9DA 3AA9A 3DFEA 4YB6A 1GNKA 3NCPA 3L7PA 1V3RA 2Z0GA 5DS7A 5D4NA 2O67A 2XG8A 4Y65A 1OSCA 1UKUA 2O66A 1O5JA 1XK8A 4CO1A 2J9DE 3HLUA 3O8WA 1KR4A 4Y6IA 3LF0A 1UL3A 4RWXA 1PILA 4ZK7M 4CO5A 1HWUA 4C3KA 1QY7A 1H3DA 1P1LA 1VHFA 3X3UA 4CO3A 4C3LA 2NS1B 4OZNA 3BZQA 1VFJA 2XULA 3AHPA 2PIIA 4CO0A 2GNKA 1Q1KA 2RD5C 4D3HA 4NYPA 1UMJA 5D4LA 2NUUG 4CO4A 2ZOMA 5D4OA 2VD3A 3CE8A 4AFFA 4D3GA 3TA2A 3MHYA 3AA8A 4YB7A 1NZAA 4USHA 4USJC 3GSDA 2JJ4D 2CZ4A 2J9EA 3TA0A 4CNYA 1V3SA 2J9CA 2GW8A 4RLEA 3M05A 1V6HA 2XZWA 2EG2A 3TA1A 5L9NA 1NH8A 4CNZA 1V9OA 4RWWA 4OZJA 2V5HG 4IYQA 3NCQA 2XBPA 3T9ZA 2EG1A 3OPKA 4USIA 3AH6A 1UFLA 4WK3A 5DRKA 1O51A 1J2VA 4YB5A 1NAQA 2E66A 4C3MA 3N5BA 3O5TB 2DCLA 4CO2A 5D4PA 4R25A 2GX8A 4OZLA 1NH7A 4RX6A 2ZFHA 4WK1A 4E98A 4NYOA 3NCRA 2NUHA
chains in the Genus database with same CATH superfamily
5CXTA 5U47A 2E5HA 1YTYA 5D4NA 4L6V3 3BGUA 3AD9C 4K5RA 4IOBA 1XTZA 5EDWA 5F0WA 2XB2D 3P6YC 1CQNA 3SIPB 3EVMA 2BANA 2WCXA 5L8RC 4KGXB 3W5YA 4ZN1A 2DT9A 2IRYA 2HFZA 1NM2A 2Q6BA 3LP2A 3PR5B 2ZC3A 3H4DA 3TP2A 1T8EA 2P8IA 4X2BA 3P5TL 1N0VC 2XZWA 3KHHA 4G1PA 3ADAC 1XNQF 2EG2A 3UNGC 2BOAA 3ZTOA 2OPQA 5AE1A 3MEEB 3T9ZA 5EX3A 5KFXA 4NWBA 2B8PA 3FFIA 1UAWA 1GFWB 1SL0A 3WIUA 3SCIE 5KT7A 1NK7A 4UZBA 3IFEA 4PEOA 6FD1A 3HVAA 2DGWA 1RT2B 2V4RA 3K0JA 5AXLA 3KG0A 2JLFA 3UO0A 4FPIA 1R0CB 2QRRA 1Q78A 2YNGA 4QR2A 2NS1B 1SUQA 3QBCA 3LQVA 3OUYB 3CGIA 1OO0B 1UZHA 1S76D 1YZ7A 2W9CA 4ELVA 5FLXU 5L1KA 4AL5A 3D54A 4KY3A 3R97A 1A9NB 4A4JA 4DQRA 3SEOA 1GTHA 1C1BB 1S1WA 3EDQB 4IRDA 1KN6A 2CJQA 5HAOA 3IR6B 5KG7A 2CPZA 4BS2A 3IBCB 4QJVA 3THVA 1Y7PA 1PBAA 2RUGA 3KK3A 5KFCA 3EXCX 4NE9C 1R8AA 2XMTA 3R6LB 3VAJA 2C1EB 3HHLC 3EVOA 4K4SA 1Q8LA 3RGIA 4CRJA 4YB6A 3AD8C 4FVCA 3R7SB 1U0SA 5HMYA 3C3LA 3G6ES 2IY5B 2UXDJ 3Q86A 1TU0B 1O5JA 1GMWD 3QGIA 1B7FA 4PUOA 1UETA 2RF2A 2MXYA 3BR9A 3M6UA 1S9EB 4YB1P 1TMMA 5B0EA 4WIQA 5K8PA 2VKZG 2RNEA 2FHOB 4DN9A 3EZUA 3LOUA 5CYMB 4J9NA 3OL7A 3G8QA 4U67Q 4NCGA 4CLZA 4I64A 4LBHA 3OHAA 2R8IA 3LGMA 3QIPB 2ZE2B 3PYDA 1LW2A 3QAEA 3H40A 4KPCA 1URNA 2R7TA 2E9TA 2AQ4A 4JI0F 2DISA 2GZOA 2YKNB 1I1GA 3OTEA 2ZBIA 2OUGA 3EZ5A 1JIHA 3I9V9 2AEFA 5D0GA 1T3OA 1B70B 1SI9A 2XY7A 1FNOA 3OFGA 4Q0BA 4DR5F 2PI4A 4DPOA 1N48A 1M0SA 2YQ3A 3L4BC 1BQNA 3FBBA 3PNIA 1HWKA 4DR7F 1WELA 1ZTTA 4JP8A 3T1YJ 2HBRB 1U2FA 2F3JA 1M5HA 3I55S 4ILRA 1LWEB 4WWSA 3OD2A 1HPZA 5J2NA 1NPKA 4YMEA 2ZOMA 5KG2A 2V2VA 1S5ZA 4RUCA 3LAMA 5KFKA 3KUHA 1IKXA 1BQXA 4UT4A 2HQCA 3GSDA 3H59A 2YQ1A 1PO6A 1SC6A 3CCMS 1OQ3A 4GRSA 5LXYA 2RAQA 1AXQA 2H48B 1F9FA 1WHXA 4QPTA 3UN2A 4E0DA 5HROB 5H9EK 5JXSA 2OD4A 2J7KA 1R8BA 1FRHA 4B9TA 2DR9A 1NRKA 2XC9A 1YDLA 1WSRA 4AD6A 4MKAA 2IM2A 2M8DB 1ZBTA 3GR0A 1TV6B 3CXCR 1OWXA 2B43A 2AYEA 2AW0A 5GMEA 1NZ8A 1RWNB 2R8JA 4ECQA 4OI6A 2J6UA 2PMWA 3MCOA 4RL1A 1XNRF 1DARA 1OSCA 4YHHF 3W7BA 3KOAA 4G65A 1ZZNA 2V34A 2L3MA 1D9DA 3AQPA 2WK4A 4UW2A 1RT6A 2PIIA 2P9GA 1WWHA 4UOGA 5AE3A 3JTNA 2ZKUA 2FUG9 4OI0A 2ZZTA 3KG1A 5I4MA 1R43A 4USMA 2UV8A 1IBKF 2J5AA 5E2QA 2ACMA 4DV2F 1BE4A 2XYPB 3N6LA 2WOMA 4ETZA 2EW9A 4WF9Q 1EARA 3S7RA 4H4KA 3MECB 1XR7A 2EG1A 1DHMA 3CTRA 3CNQP 2NR0A 5GMDA 3A3NB 2B4UA 1BY9A 2UUCJ 2QYCA 1S0VA 4C48A 3ISZA 4LRAA 4ZCKA 4DV0F 4F4XA 4W98A 2XMVA 3I5AA 4ECZA 4RNNA 4IG0B 4WZMA 1QAJA 4YFUA 2M3DA 4NLUA 5KFEA 1GXTA 5DGAA 1F6TA 4DDFA 3T41A 2FJVA 2D69A 1VQLS 3OL6A 3DGPB 1RTIB 3AOAA 3AHPA 1EQMA 3K5LA 1X7VA 2PC6A 1WDDA 3QT5A 4TQRA 1RTHA 4RW8A 4JI6J 4Z7YA 2ZZNA 1FWPA 2M7SA 1VQ9S 2CZ4A 1FXDA 4RLEA 1Q79A 4NLXA 4KFBB 1KBRA 1BXNA 4FXDA 1N33J 1SKUB 1WSVA 5LSLA 3MUTP 4L74A 4H4MB 3A12A 3DLBA 4RW9A 5HP1B 4DL7A 2ZUAA 5IZHA 1PC5A 2HVDA 4PKDB 1Y11A 2QZ8A 2VBZA 2QLJB 2ADBA 3B78A 2VPWB 2BQUA 3C6TB 2GQQA 1RBLA 4F0MA 3J7YI 4OZ5A 1U7LA 3DGVA 2MQ8A 2QJ3A 2VG7A 1XC9A 2VG6B 4B17A 3UNYA 2B7BB 5KFLA 3VZIA 4B9LA 3C15A 2M9KA 3UQSA 2VB6A 2CRLA 1IR0A 4OV6A 1IQTA 8AT1B 1RWKB 5D6GA 2EVZA 1EHWA 5A6PA 2V69A 3NEKA 1VHIA 1L3VA 3VAHA 5ETQA 1X5TA 3N4WA 4JI7F 1I6JA 3MEDA 1REVA 2HBZB 1OYEA 3UCZP 2J7UA 3GV8B 3MGJA 2AWZA 3D3CJ 5AXKA 1Q86T 2VICA 2NCKL 4P2SA 4X65F 4EEYA 2QEXS 4KHMA 5HO4A 3CCTA 3R1HA 3G87A 5DM7Q 1SH0A 2HAFA 3JTOA 2HWHA 5ETRA 4F2RA 1DURA 2JEJA 2HHUA 3RB4A 3HVTB 1VC0A 2XHCA 1S97A 1UVJA 1RHRB 3HT0A 2J8AA 2R3VA 1Y3KA 1YITS 4DFKA 1FVQA 1NU4A 2VZ9A 4PG8A 4ECRA 1YLXA 2I5JA 4PXBA 3MMAA 1HR0J 4BWJA 1U25A 4KE5A 2GCFA 1P6TA 4NZ6A 2K2PA 2BJEA 4CO4A 3M6XA 4A48A 4XTTA 4OX7A 4D3GA 4LF1A 3T1AA 3KLHB 2DK2A 1XMQJ 2BKPA 5HN0A 3VF0B 1N8RT 2M2BA 2LXUA 4FPRA 3MPYA 3UDVA 2FZKB 4LF9J 3ENWA 3BBCA 2OPSA 4F04B 2OFHX 4C0BA 1TQLA 3BO2A 4ZPDA 1WEXA 4WBFA 1FVSA 3RBXA 2V8HA 4RX6A 1KR4A 4ERDA 2WONA 2NPIA 1J27A 5F8MA 4H4KC 5A6WA 2VA2A 5B0CA 1TKXB 4J37A 5G0RA 4LF7F 1KQGB 2XCPA 2R2RA 3UI3A 3KMSA 2F63A 2BXJA 1QVGR 3CVKA 5LJ3Y 2MSTA 2V8GA 3IRWP 3JAMU 2HQGA 3HX9A 2ZBCA 3TVKA 4CO3A 2OPRA 3LA0A 2RDDA 5JMNA 5M2UA 5K8NA 9RUBA 2DNZA 3LH2S 4MFBA 2KXFA 3EE3A 3CJ3A 2Y1LB 2CQ1A 4OMFG 2E29A 3IO1A 1BC6A 2HVEA 3FCHA 2UXCJ 1FDDA 3RRHA 4NOHA 2Y0BB 2BX6A 2PT0A 3Q24A 4TU7A 2N7CA 1T9UA 2V2ZA 3QPIA 3HFZB 2VC0A 4RBUA 4ILMA 1ZPWX 2E66A 2W7AA 3ZZZA 3W63A 1G4CA 1LWCB 3JSMB 2ZH7A 4P9SA 4CLWA 4CYUA 4NLWA 1FRMA 5IWAJ 2ASJA 4RWXA 1YX2A 1Y0HA 4H4OA 3PZPA 2GV1A 2YPYA 2PGCA 5JVGQ 4EFAC 2XG8A 2XLKA 3F73A 1NKEA 2GQCA 1RACB 1R7IA 2ATCB 1VQMS 1L3UA 2MLZA 2HKEA 4RU2A 4DR2J 1FKOA 1HQUB 3QJLA 5D0EA 2FY8A 1VQYA 1GXUA 4MMOA 4DCPB 1P9YA 2CQIA 1NK0A 2VFRA 2OAUA 3M8YA 2GAHC 2ASDA 4I67A 2G13A 1WHYA 2HNDA 2HFNA 3M2RB 3NG8A 1U0HA 5ETMA 2Q66A 1ELOA 3QO9A 1I94J 3CCLS 3UDCA 4ZHRA 2KT5A 2BE9B 3ICLA 1VRQC 3W2WB 1HMVA 1MWZA 3HXMA 3FEYB 1PJ7A 3IS9B 4J7CA 3NWGA 2FHKA 4OYXA 4FF1A 4IFVB 4OZ2A 1KOOA 3M2VA 3OJSA 2EFNA 2FJAB 4DSLA 5IT9U 1HARA 5K9FA 2O67A 4ZLNA 5HBMB 1RADB 5J2PB 2CQ0A 2CFXA 1H7XA 4UTGA 1KQKA 2DO0A 1FKAF 4HEA9 4MYTA 4G1IA 2IBKA 1S6OA 1HKAA 4RU9A 4DF4A 4DL6A 1VQKS 5KG0A 1VK8A 3DRRA 2YNIB 1GK8A 3TI0A 4LFCJ 1ICEB 2RILA 3SCLE 1FKPB 3HT3A 2ZWOA 2HNZA 4DL2A 4ZVOB 3TA0A 4DX8H 2MQQA 4YUDA 2KDOA 2GIRA 1DTTA 4RO0A 2B56A 1FE4A 4B9NA 5LMNJ 2XMJA 1G1XA 1IBLF 3P45B 2ZNZA 3GIJA 4Y34A 1KNZA 2RQMA 2NXNA 4X62F 2WSCC 3KJVB 3CPWR 2C3MA 2KB2A 4S0MA 2HG4A 2NLWA 4ZPCA 1N52B 3JSBA 1VQ6S 4LRFA 2FD2A 5LXRA 3ELHA 3BS9A 4UOHA 2W9BB 2VC1A 4XDCA 4KV8B 4EBEA 2QE5A 1N32J 2NXEA 1NCLA 3T6BA 1NDCA 5C2CA 2CPXA 1D8ZA 2QFIA 1XIQA 4I69A 4MT1A 1MG7A 3IRXA 4LFAJ 1VQPS 4IQXA 3UFCX 4XIUA 1VFJA 1WI8A 2K1RA 4U8VA 2Y3YA 5C24A 4XO0A 1E6YA 4ED8A 3MOJB 2LEAA 3U02A 3SZ2A 2CQHA 2E1AA 2R7WA 2OD6A 2MQOA 3IR7B 3FGVA 2PD1A 3DYAA 3B4MA 4C11A 2CQPA 4OYBA 5F0UA 1U1MA 1NK6A 1X31C 3RRGA 4NA1A 3MUVP 1VJQA 3MMCA 3PR4A 2LDIA 1NEEA 2IM0A 4I2QB 3TZYA 1S48A 2X1FA 4QR1A 4QW9A 2WBRA 5F8JA 3C14B 1QSLA 3TO8A 1HNVB 1FX2A 2NUHA 3H2UB 3TR5A 3PXGa 1Q95G 1R8PA 1WF2A 5KT6A 1NSKL 2GHWA 4GKJJ 3M30A 3M9MB 2RIJA 3I87A 2MY8A 1J5EF 4GO7X 4K7QA 2IMWP 3V6JA 5CYMA 4F26A 2ZDOA 4OZNA 3E8OA 1RT5A 3IWXA 2YH1A 4CH0S 1VBYA 3DDKA 2DHXA 3G6VA 3DRPA 2W2MP 5D15A 5DDRC 4DR6F 1TZ0A 3AA8A 4IR1A 3HK2A 2QN6B 4CH7A 3DRXA 1S4FA 1IJEB 4GO5X 2EFQA 2DITA 3PW5A 1ULRA 1M5SA 1HW8A 2ZM6F 4LQ3A 2AYBA 4KGKA 1PJ6A 2C3PA 3NGTA 2ZVSA 3ULHA 4L75A 2AX0A 1RSCA 3D3BJ 2R7VA 2RHQB 3V81A 4K4TA 1UP1A 4GC7A 4DLGA 3FQLA 3MM8A 3HO1A 2AJ0A 5L1LA 5K14B 2R2UA 2Y8YA 1MMLA 3IWNC 2E44A 4OLPA 1RHKB 2MJNA 4I2PB 3N5FA 1MSWD 4J9LA 3CCES 1YI2S 1YQHA 2DGUA 1YK9A 2QV6A 4WZQA 4ZK7M 4B3OA 1HBOA 3PX6A 4JUZA 3R5DA 2L9WA 2FB0A 4ZOSA 2XTJP 9ATCB 3VQSA 2FJBB 1SQEA 1R6YA 4ZP9A 2HFOA 4N76A 8RUCA 1G3OA 2AYGA 1S1TA 1AUDA 4OYWA 5GAEI 5HQLA 2J6TA 3BPDA 1SXLA 1TV6A 4O4RA 5E3QA 1FNXH 2DH8A 1N4LA 3BKFA 1SJ3P 4ED2A 3AJ1A 4PQUB 3R5AA 1W25A 1YVFA 1EB0A 1RAIB 2E7WA 4FYYB 1N33F 2CUYA 3PIOQ 2X1BA 4DV3J 2HSEB 5KAKA 2BR0A 5KFVA 2OLWA 1WC5A 4UOCA 5C42B 4M5JA 2E9RX 2YTCA 2AU0A 3C6UB 5KG6A 4ATNA 3N28A 1APSA 4ZP7A 2DVIA 3IP0A 2WHOA 3KDOA 3E51A 1U2CA 2F4VF 2W2QP 2WTFA 4ECUA 4YEAA 2A2CA 2RE1A 4NYPA 1HYSA 4P7VA 5DG8A 5CYJA 2VPZB 3G82B 4A47A 1U4BA 2V8DA 3WZ0A 1MROB 2IYIA 5AJ3F 3MECA 3FSIA 3VGSA 4MH8A 3NBPA 2E5GA 4X4VA 4B9VA 4MIWA 4DQSA 1R31A 4OLOA 2LP4A 4R0EA 5ETSA 3W9JA 4LQ9A 3CDUA 1RABB 2Y8WA 3CJ2A 1QUVA 3HHNB 2B4OA 2NYHA 4X4NA 2I2YA 2IC3B 1T94A 5SUHA 1KOHA 2GFFA 3KLGA 1NKCA 1BWVA 1IBCB 3RJMB 2AHOB 3J7Z5 5JJBA 4BC7A 4NLGA 1B99A 4R8UB 4RUBA 3DGPA 1PBUA 1RXOB 2DBBA 4DMZA 2OPPB 2XSJA 2XSFA 2P9EA 2OFGX 4OI4A 1RT4B 3PFEA 2R7QA 1S57A 2GAGC 3SQGA 3AAWB 3OTBA 3MEGB 2AF6A 1DRZA 1BMQB 5IV4A 2R42A 4C6AA 2X3GA 4EWTA 4Y2MA 5KG4A 2MKIA 4I4BA 4USTA 4JI3J 3GSIA 3OTOF 4UF4A 1DQ9A 4DX6A 4FYWB 1REGX 1TK5A 4H4MA 1BWEA 2HMIA 1HHSA 4USUA 4NMLA 1NPRA 1RLCL 3KLVA 1EETA 4WFBQ 4LBPA 1RA6A 1VLYA 5IQQA 3OVSA 3K5PA 1NO8A 2HRUA 2MGZB 2VASA 4EYIB 2CWXA 3R7BB 1TKDA 5KT5A 2XMAA 4CLPA 5LMUJ 2DXEA 3J80Y 1K1SA 3JQKA 2DHGA 5B0FA 3RB0A 4IQMA 1F5BA 3NRBA 1T02A 1RAOA 2HQFA 4JV5J 5LJ5Y 2BUNA 1TMJA 5KFUA 1YRUA 1NMEB 2OMOA 2LQJA 4JOUA 2VFSA 2Z8QA 5J2QA 3SV3A 3ETMA 1IR2A 3OW2R 3WIVA 5DDPC 4DUYJ 2EKNA 1O0PA 3BPSP 2VOOA 1A6LA 4K4YA 3EJMA 2A1BA 4QWAA 2XMWA 1X4BA 1B7YB 1YBAA 1IWAA 1NXIA 4C0OC 1HBMA 2E7XA 3ZZYA 1Y5NB 3CCSS 3C46A 4C3MA 4PPZA 1KQSR 3CD5A 2F9JA 4OX9J 3VWSA 1WKLA 5K5MA 1LOUA 3DRSA 2EFOA 3SSQA 3DOKA 2QT7A 2H5IB 2Z0GA 2XWXA 1NJXA 2JLGA 1N5TA 3SQOP 5IWAF 2ZITA 4OHYA 3BKTA 3U1LA 1C0UA 4WFAQ 2U1AA 1SCJB 4IO1A 1N5SA 1UEUA 2KG0A 3AODA 3SXLA 2BANB 4YR2A 2VBYA 1VHFA 2EFGA 4RBVA 3VAMA 1BHNA 2W7PA 3J81Y 1HNIA 1WD6A 5IC6B 4I7FA 2GVDB 3AJ2A 4U9RA 3LP2B 4HHUA 4RUHA 2CPJA 2CXEA 3F0NA 1TL1A 2UXBJ 4EU0A 4NLSA 1RT7B 2CVIA 4DU7A 2FZCB 1I3OB 2RT3A 1SJ4P 1G2EA 2MQPA 3OV7A 4QU6A 1PKUA 3LP0A 3UW1A 2OPQB 3ZC4A 2JEGA 1K44A 2XBPA 3FFIB 4XDDA 2VBXA 3THTA 1HL6A 5KFNA 3N5BA 3IA0A 1UA1A 2BDPA 5KFTA 3Q8PB 4JI8J 4NZ7A 1HNXJ 5K8MA 4U6PA 2R7OA 4ED3A 3GLJA 4M5HA 2YWWA 2C42A 4QYRA 1JLEB 1FX4A 3H5YA 3D0HE 4PG6A 5HATA 3PW2A 3BGRA 4A8SA 3D5MA 3B82A 3CC2S 4HTIA 2FLLA 2YNGB 4ZPAA 1RU2A 1SUQB 1VMBA 2G1DA 1WEYA 3FEZA 1QSSA 1Q8KA 2P6SA 1Q1KA 3PACA 2POKA 3CULA 4K2XA 1UVNA 2W9CB 4ZP8A 4RW7A 2C3UA 2KTQA 1UZDA 4IH6A 1SC4B 1L5UA 4CLYA 3H20A 3FVYA 2JDJA 2E5LJ 4XAKA 4P2FA 3R1LA 4CCHA 1VGYA 1V3SA 2OEJA 4N7TA 4LFCF 1EP4A 3DOLA 2VFUA 1T9WA 3KK3B 2HRTA 2YWFA 3PRDA 4YDDB 5KOWA 1YHQS 4FP9A 3BF4A 1JWWA 4PG5A 4UQGA 1D9FA 2ZFHA 3CCVS 3TOQA 1AYEA 1ZYQA 2RRAA 3FEXB 2HFUA 1EQ0A 1QD1A 4WE1A 3QJPA 1U1RA 4R0JA 4DPTA 1FD8A 1QDUB 5GAGU 2M88A 4PWUA 2D3OR 2C2MB 1QJHA 1WOPA 3V5RA 3OL9A 5C7PA 4PUOB 4FNIA 1H74A 1RI7A 2RF2B 5J2MA 1H3DA 5F8HA 1N32F 2XZTB 2DH7A 1TKTA 4PXCA 4K5SA 4AT1B 1N5VA 4LFAF 4M95A 3H5SA 1T3NA 2PMZD 3Q8QB 4FXWA 3UN3A 4NCGB 2W4PA 3F56A 4KHPJ 5G4DA 2A6MA 3IS9A 3FKBA 4EYHB 1QLNA 1D3WA 2UUAJ 3QFHA 3BV8A 4LF4F 2QO3A 2L48A 5J1NA 3RZAA 5HANA 1PGZA 3MFIA 2ROEA 5GADI 4C8KA 3HZEA 1URRA 3TZXA 4WTOB 2FVPA 4YQWA 1CJTA 3BR8A 4AXIA 2ZEJA 4J9MA 1CBKA 4J9RA 2LMIA 1N36J 1JLCA 5KG3A 2V68A 3HJVA 5HBMA 1JLBA 2V4QA 3BSNA 1YJTA 4CT9A 4NX9A 2C2NA 2DNLA 4B9UA 4Q0BB 3KUGA 5CQGA 2R7SA 1KQFB 4IRKA 1YWXA 2RRBA 4I0WA 4HYKA 1BQNB 4Q45A 1SL2A 1VYAA 2I38A 4DG1A 5A0YB 3I96A 4GC6A 5IS2A 4OL8A 2YPZA 3UDEA 2UUBF 3QAUA 1JLAA 4ZKAA 4OYAA 4C3LA 3BQ0A 2EFVA 1FKPA 3O6QA 1HPZB 4KGMA 5H9EJ 5J2NB 5A2QY 2W25A 2CAJA 3D67A 1I51B 3CDWA 2XZDB 4DXLA 2HK3A 3CJ8A 3L9ZA 4HT5A 1S6QA 1GMVA 3RAQA 1IKXB 1RP5A 2R7RA 2ZBQA 1Q5VA 4G3IA 4DN0A 1SC1B 2KT2A 4ID5A 2W4CA 3KJVA 3IR5B 3C8YA 4QBUA 3PHTA 5FDLA 1UFWA 1TUVA 3NY0A 3W60A 4X4RA 1NJWA 5DDOC 5DQGA 2JRSA 3SYZA 1GH8A 2W9BA 2XS5A 4KV8A 2QLFB 2FHJA 1X9WA 2AKWB 5L1IA 2XLIA 1IN0A 4B3RJ 1NB7A 5B09A 4MYUA 5M2RA 5F41A 5D0HA 2LU2A 7AT1B 4I6WA 3MAQA 3GJRB 4ECXA 4LUBA 5CYQA 5IT0A 4IH5A 2H9ZA 4ZVSB 4DLEA 2PFFB 1UL3A 4ZITA 2H4WB 4U96A 3Q8YA 3GG0A 1RT6B 2EWHA 3TUIC 1L3SA 4PCQA 1RDRA 1QAIA 3JSRA 4DUTA 1LW0A 2JC1A 4A8YA 2DEJA 1U02A 1FRIA 4IOAQ 2PI5A 4PXEA 3M8SA 3Q8RB 3A8JA 4DX5A 4G1QA 2Z57B 1S12A 2HFSA 2J7WA 3JS9A 5DLFA 4J9UE 3OR1A 2GGPB 1IUJA 2V5HG 4DUZJ 1RLDA 1SPBP 1XMOJ 1Q16B 2N7YA 1U8SA 1S0NA 3M8ZA 3SCJE 1KS2A 1KTQA 1ZOTA 1RBAA 4KGVB 5LL6d 4QWCA 5CD4A 4FS1A 2K3KA 1HW9A 1JLFA 4F50A 2V8VA 3W66A 4AQYJ 1TAUA 1SV5A 4JI5J 3MI7X 4NXMJ 3P8BB 4IO9Q 1VCTA 2COLA 4M5LA 2YX7A 2LQBA 4TKTA 2V4JA 2RDJA 3CT9A 3JYTA 1VC5A 3MWBA 2WSFC 5D3GB 3I0SB 1K8AT 2JZ5A 5HVHA 4LIWA 2A18A 2GHVC 1RTHB 3M6WA 4QR0A 4DV1F 1GX6A 3K17A 3IXQA 3K5OA 2XI3A 3PJWA 2JFKA 4Q8FA 1CQMA 5AXMA 3BGLA 2O1PA 2GW8A 1KVKA 3SDEA 5E3PA 3MM7A 4EZ6A 1HNZJ 2KXHA 4X66J 2KKHA 4B3MF 4RW9B 4DX7A 4ZLPA 4R25A 1LEOA 4E98A 2XWYA 4DR4J 4FNHA 5I42B 2CIMA 4DR1J 2VF3A 2OELA 3M4XA 4FYVB 4YOEA 5T7LA 5FLXY 2ZKTA 4Y65A 2Z56B 2JWNA 2XNQA 2QLWA 3QNWB 3KTQA 2Y1RI 4DZ6A 1RTDA 2VG7B 4DSJA 4UZCA 5A8KA 4OQJA 5KFPA 2DY1A 1A7GE 2LA4A 3C15B 4NLVA 1ZM3A 4AL7A 5SZTA 4C8OA 3FRYA 4Y2IA 5I3QA 1Y4ZB 1F3FA 1N0UA 3H42A 1IM4A 2MKCA 4DQPA 5F8NA 2G2YA 2A0FB 3FUYA 3GCWP 1REVB 3HFKA 3MEDB 5HQMA 2W01A 3G9CA 2VPXB 2JEIA 4I6YA 5HK4A 3FZ2A 1S0OA 1HWLA 2V50A 1DQAA 1NAQA 3L7UA 4X4PA 2QA2A 4DWIA 1TELA 2JOQA 4UY85 3T5HA 4RJVA 2B3TB 4QIEA 2HVZA 4N8OA 1TFYA 1KHVA 4RUAA 5KFRA 5LMUF 3EGVA 1IR1A 5HMWA 4CO1A 1FNMA 1FRLA 2HS0A 3G82A 1H2VZ 3UR0A 4CZCA 2I5JB 2BJ1A 2VL1A 2R2SA 3MMAB 4FYDA 2YWEA 4JV5F 4ZVUB 2YWHA 2X1GA 3W8PA 3EZOA 1H73A 5DO2A 3VGVA 3NXZA 4KRWA 3ENVA 4CWBA 3OFFA 4DS4A 1EKSA 1X4AA 2LQ8A 4X4QA 4AUKA 2OPSB 4JI1J 4I68A 4USVA 3EGZA 4YB5A 3TWZA 3I31A 1S6PA 4ELTA 1YG0A 4O3RA 2B9YA 4LF2A 2NQPA 4QYZJ 4O3PA 1MN7A 1QAYA 4ZCIA 2WONB 1PYOB 3N79A 4LFBJ 3JQJA 3N0VA 3MEGA 2AGPA 1B3TA 1MW7A 3GG1A 3TAQA 2DR7A 4P2XA 3LF0A 4L76A 3IBFB 2MY7A 5BR8F 2B8QA 1AZSA 4ZJLA 3CD7A 1KVJA 1H98A 1OYDA 5IM0A 4OI2A 4E8UA 2UU9F 5HLFA 2OMLA 1N88A 4MFBB 5C2GA 4YN3B 2IJNA 4JI2J 1S9FA 2LXFA 1JXLA 4Q2LA 2DNGA 2YVSA 3VGTA 2DRAA 5GAHI 2ROGA 3CJ0A 3CWJA 4CNYA 1UWBA 4LSNA 3OHBA 4HDGA 2J0WA 3ILLA 3EGNA 2ZH3A 3W5ZA 2P2CB 2W9AA 2P9CA 2YNFA 2W4DA 5F9NA 4TY8A 4DOZA 3KLIA 1WF1A 2KL8A 4CYUB 2DKOB 2GX8A 2Q6CA 4KO0A 1P9QC 4BDPA 2NZCA 2HQIA 4LR7A 5ETOA 2HHPA 2JFDA 1HNXF 4Z2XA 1MU2A 3QQCD 4CTAA 2J9DE 1GAOA 1FKOB 3OSPA 4FF3A 3SSRA 1HWUA 4QIWD 3N6NA 5HQ8A 4OHZA 3CDEA 4QWBA 4CLTA 2UUTA 3KUEA 1JK9B 3V2UC 4D3HA 4KBIA 2HNDB 2JL9A 3DDIA 1M1HA 1YRTA 4DCJB 2HHQA 1U0HB 3R8YA 5KFIA 3QO9B 4X64J 1IKYA 4NYZA 4PYDA 2AJ4A 3H7HB 1HMVB 2HS3A 4YR0A 2XS2A 5L1JA 4ZVGA 1ROFA 3NCQA 4TNOA 3TX8A 2D7SA 3QLHA 2UVRA 1XR6A 1RTZA 1CS4A 5GVQA 1RBOB 2QL9B 1JLGA 3M2VB 1FJGF 3MUMP 3M1VA 3IAS9 1KRPA 4RBTA 2ASYA 2EBGA 3TRGA 4KJIA 1M5KC 1WNEA 1ZAWA 3ZO7A 3LP1A 3OXFA 3KJQB 2XLJA 1ZAVA 2GVDA 4HT7A 1CJKA 1MWYA 4JI4J 4ZVTB 3HSGA 2Y1JA 1BGXT 2RB7A 3V6HA 1BQMB 3K8VA 1RT7A 3KXDA 1SH2A 3UR3C 3HDSA 4GVBA 1NSAA 2M5YA 3VHQA 1VC6A 2PO4A 2OHDA 2ALZA 4Z7CA 1QTMA 3ITHA 3DRRB 3MHYA 4WU3A 3LPYA 4YB7A 4J9VA 3G2XA 1N34J 1RKJA 2WW8A 2CKWA 1YKWA 2HNZB 1CPZA 3CC4S 1IXKA 1IVZA 3EDRB 2VV5A 1DTTB 2W2OP 1FDBA 3M05A 4OV1A 3ZZTA 3X1LB 2HNYA 3AY0A 4OX8A 5RUBA 4IDKA 4F7VA 3RBDA 2V94A 2HHWA 2UUAF 4DV7J 3LW5C 1JLEA 3UCGA 2D41A 3H2VE 5HJYA 4DSFA 3M6VA 3L7PA 2RSQA 2CA9A 3GE9A 3V4IA 3T1HJ 3D1QA 1BD6A 3MCNA 2RQ4A 1NUEA 5ITHA 4C98A 3IRXB 2QL7B 4F0KA 2DGVA 2H1YA 3VCDA 4RKUC 4YY3J 1FK9B 1XWLA 4LF6F 2K1RB 2MZJA 2ZD1A 1NHKL 5C24B 2PDAA 3M8QA 1E6YB 5D8HB 5EUHA 2MJUA 2VBWA 1M5PC 3J7YU 2FHJD 3VR1A 1FRKA 5HMZA 3AFGA 3T3FA 2MHNA 1NBEB 2BEFA 4DSIA 3DYAB 3W62A 2Y1IA 4C11B 4B08A 3DLJA 1SJFA 4HL9A 3PV8A 2HIYA 3G8SA 4DV4F 1TK8A 4X4SA 2ZH6A 3MMCB 3SCKE 5EGYA 4IYQA 2JHEA 3NS5A 1FCAA 3BYPA 2ZVIA 4J5OA 4Y3CA 5LM7E 1IQZA 1UEVA 5F8LA 4IFYA 5DZ7A 3J81j 5B0GA 1ZM2A 1Q8BA 3IGVA 3BO4A 4WCEQ 2HZVA 1WG4A 1UVKA 2CG8A 2UZAA 4HH0A 4C4WA 2AMCB 3M30B 1AB8A 4CLUA 3BDPA 2DD8S 2OSQA 3GONA 2BKNA 2YBVA 2FVRA 2DR5A 1RT5B 3C16A 2RQCA 2WVCA 2MZSA 3GYGA 2BV3A 3DRPB 1KHWA 2VPYB 2RD5C 2V67A 1SC3B 2KHCA 5F9LA 2UP1A 5DZ6A 2AD9A 1LWFA 1LK5A 5FD1A 2HRYA 4OI1A 2Z2MA 2XNRA 4FKXA 3LPEA 3DLLQ 3GJTB 4DBQA 1NDLA 1U1OA 4KKOA 4OYZA 3PJ9A 2ERRA 3HKWA 2JH3A 1UJ5A 2AZ3A 2FLNA 1XNQJ 4HLBA 5HMXA 2N3LA 3JAMY 5HVFA 1M5OC 5B0DA 4OIXA 3V81B 3MM6A 5A0YA 1YJWS 4DUZF 1XMOF 3MM8B 4F25A 3DOMA 1Q82T 2DNPA 3ZTPA 3ILIA 2ZZMA 3ET6A 4PAAA 1HLWA 3MOZA 3BBBA 5KFWA 3NGUA 2UV8G 2V63A 3R9LA 3MR3A 4Y6IA 4B3OB 3ZXWA 1HBOB 4W4MA 4KTQA 5J1PA 3DM2A 2UVWA 5C25A 3PTWA 4NXMF 1RWUA 5KOXA 2RJZA 4FDFA 1T9XA 4NA2A 3HD1A 3KLFA 3GCXP 2M0GB 1W7WA 3K59A 4CDIA 3I0RB 1AT1B 4GMKA 2E5JA 2C2OB 2BJ7A 3GFZA 1RJJA 4C0HA 1S1TB 3DNCA 3TEHB 1K1QA 1GEHA 4PYAA 3GMGA 4KC5A 4F02A 4LMZA 2YKMA 2PSZA 1T9YA 4X4UA 2E1CA 1RB0A 1Z2ZA 2MKYA 3VTIA 1DBDA 2VUGA 3VVUA 4ZP6A 2IJFA 4NCBA 2DCLA 4ENOA 4A8WA 4X66F 5BYQA 3Q83A 2ZJQQ 1VDHA 1SH3A 3VVTA 3RW6A 2O3DA 4W90B 3RBZA 4C2MA 4Y2CA 1TR0A 5L39A 2QA1A 4DR3J 1NJIT 4V1Ak 1FD2A 3RU0A 2MLYA 1X4DA 2HBYB 5DLGA 3T5JA 3P4UB 4RNFA 2DB1A 4L73A 2LDYA 2DHHA 1HYSB 4A8KA 2ALYB 2VD3A 2F7VA 2ZUGA 2C2DA 1SBRA 3TA2A 6AT1B 3MTJA 2GO8A 2GGPA 1RYSA 5E3CA 4MK8A 3QSYB 3NBPB 5A8RA 4FS2A 5ETLA 3K57A 4DJBA 1YJ9S 2V6AA 5HVGA 1EZZB 4F0HA 3QZ7A 3TW0A 2VKRA 1W2IA 4MK7A 3CD0A 1Q81T 1HHTP 2X7IA 4J9OA 3KLGB 4P6QA 4U95A 4RNMA 4F4YA 1Q8IA 4Q7AA 1OS5A 4DI6A 3WX4A 3HHEA 2E5IA 5D3GA 2K8GA 3I0SA 4UQTA 2XSJB 4DR5J 5IC4B 3R3TA 1NHVA 4WJBA 4MIAA 3SQGB 4DR7J 3H8YA 1V3ZA 1IKWA 1Q0NA 2BYCA 4KH1B 1OMSA 1ZZFA 2J76E 3PO5A 1SQFA 4NXNJ 2KU7A 4Y2AA 1VIXA 1OSDA 2GJFA 1N5QA 2AP6A 1YJRA 2AJQA 3OLBA 3QGGA 2JNJA 2HMIB 2LLZA 4ITSA 3LWMA 5F3TA 1X0FA 4JYAF 5GMKa 3T5KA 2XO7A 3RAMA 2GIFA 1EETB 3DLKB 2GIQA 1WHWA 5I42A 2GMJA 2W1BA 4HI1A 1DTQB 3HKZD 3GFHA 3PYFA 3BH6B 5HJXA 1T11A 3W3SA 3D6HB 1FT8A 1NH7A 3G86A 2XY6A 4WK1A 3PKYA 4F4WA 1KLNA 4ILLA 3G8TA 3HFVA 4C7QA 4K4ZA 3OTDA 4WXOA 2IRXA 1U09A 3R5CA 4JB8B 3Q0AA 2ABYA 4P2MA 3CJ5A 3PX4A 2CNOB 2MZRA 3KK2A 1XNRJ 3CCJS 4YHHJ 3OXGA 1KDNA 3UD4P 3DLEB 1H2UX 3EPGA 1P8GA 3GZ7A 2RU3A 1RTJA 1RKIA 2FZGB 4OYPA 3GV7B 3ZNUA 2YNHB 2B6AA 4LF5F 4LREA 1CC8A 1UMJA 5D4LA 5J2QB 4HDHA 1VLOA 3GFXA 2ZDPA 3MM9A 4BLGA 2HHSA 3D9BA 3QT6A 1QUPA 1K9MT 4HHJA 4JI2F 1NKBA 4K8RA 1DLOB 4P75A 4DV2J 2VHGA 1HBMB 1OJ4A 2CQCA 1VBXA 1RK8A 2Q79A 1U1QA 3OR2B 1U6BA 1V5VA 1WC3A 2K06A 3DRSB 4M5GA 4C9DA 3W64A 1ZA1B 4F36A 4DHVA 3DOKB 3A3OB 5T41A 3B54A 1C0TA 5F8IA 1FWLA 1TAQA 2CNLB 2F40A 5E0OA 4ANDA 1B64A 3HSDA 1C0UB 3CMQA 2DYAA 3BREA 5IV3A 1XK8A 1NSPA 2HHXA 1R6VA 1JX4A 1SQGA 2GJ2A 4QIVA 4ZLLA 1HQEB 3TUJC 1HNWJ 4LSLA 4N5SA 2IFXA 1HNIB 4I7FB 3DU5A 4ED7A 1YSJA 5I3UA 1TL1B 3J7AN 1PG5B 1QM9A 3KFWX 3AOCA 4RR5A 4TY9A 1XQIA 2ZH5A 2RHSB 2SXLA 4N8NA 2FLOA 1FTCA 2KFYA 3LP0B 3D6MB 3TA1A 4X64F 3I56S 3F41A 4I1TA 4IOCQ 3GR1A 3MR2A 2NZ4A 5DETA 3HSZA 4PWDA 1S1XA 5MLCV 3OFEA 3PG9A 2ILYA 2W24A 4USKA 2GJIA 2CNNB 2BQRA 2LQ5A 2F8MA 1V3RA 4NL5A 1VS3A 2FC9A 3NGSA 4M63A 5DJBA 4MJKA 3DHXA 3BGRB 4A8XA 3FDSA 1K47A 3HZGA 1VQ7S 2M4MA 3W9IA 1FDAA 3QIDA 2WAQD 1CJUA 4JI4F 4QIGA 3MMJA 2NUUG 3P3DA 3CIZA 2QMWA 4RW7B 1U26A 1FHTA 4AFFA 2KH9A 4LRBA 1TVRA 5EN1A 2HAIA 2JVRA 2AGOA 2VDIA 2XCAA 4DV5J 2QLBB 2HURA 1PCAA 2F8EX 1NDPA 1EP4B 2R7XA 1N34F 3DOLB 3ILJA 3BSCA 4A8MP 1NB2A 1VQ8S 5BXIA 3HCXA 5MAOA 4URGA 1IBMJ 1SKRA 3O5TB 5GAEU 3M7VA 3K58A 3RYLA 4ID8A 3DLGA 3A8EA 5L9XA 2XGPA 1C4AA 1FE0A 4HR2A 5HI7A 3EX7B 4WE1B 3DI6B 2H51B 4B3SJ 2XMUA 2IVYA 3I82A 5KG1A 1TKZA 3PRBA 2HZCA 4WIIA 4NLPA 3QSIA 2CJKA 1RWMB 1FA0A 2KZMA 3HHDA 1NSQA 3PHEA 5J2MB 1KKHA 2G1HA 3Q22A 1TKTB 3OQ2A 3T1HF 2XULA 3POTA 2DO4A 1QAXA 1PJ5A 2ZH4A 3EVWA 2AJ2A 2RDIA 3TJ8A 5D4OA 4C8MA 5A8WA 4YY3F 3C19A 4EMDA 2R9LA 4ZIVA 4OZ1A 3WQPA 1RISA 2N82B 2DNQA 3KHGA 4WP9A 3W5XA 1S6UA 1X5SA 1HI8A 2D3UA 4ZVEA 1V6HA 1H0HB 1V9OA 4O44A 1CJTB 1ITPA 2QSFA 4U7UD 1RT1A 1JLCB 2J8SA 1KFDA 2CZVC 2QA4S 2B0GA 1JLBB 2WW4A 2HBQB 1Z1ZA 2DNOA 1FRXA 3E2EA 1RAAB 1WHVA 1X60A 3QWUA 1EAYC 4FKYA 1BQMA 2OIHA 5D0RA 4OHXA 4ED1A 2UXDF 3R27A 2CQ2A 4TLQA 3RRKA 2OH2A 2EKYA 4DG1B 4ZMMA 3FMWA 4FN5A 2B5JA 3DRYA 4DEZA 1JLAB 5A76A 3VGUA 4CI0B 2M52A 4FZVA 3I6PA 1TK0A 2LKZA 4B02A 1N54B 3O1LA 2HZAA 1CULA 1HBNB 1I5OB 2DCUB 2ZC4A 4DFMA 1S6QB 1FESA 1U1LA 2IJRA 4P72A 1X4EA 2WVBA 1OY9A 3CCQS 4RW6B 2FJWA 1NZAA 4AYBD 2C2KB 3ZZPA 4ID5B 3G71S 1S1VA 1GT8A 2IRUA 5FDLB 5DQHA 3IG1A 1JXEA 4ES1A 4OYIA 2XI2A 5DRKA 2P6TA 3QFWA 7FDRA 5D4PA 5CD4H 4OZLA 4R5PA 1Y3JA 5E41A 2VU5A 4FYXB 1EJ7L 3J7ZT 1OPZA 4B3TJ 3LAKA 3NCPA 3AOBA 1FK9A 3EM1A 2C3YA 1VI7A 4DSKA 2DR8A 5CYQB 1MMNA 2KYZA 1UKUA 3T1YF 4Q8EA 2V9WA 1PSDA 1NJYA 1LXJA 2N4DA 2B9WA 1WACA 4OYMA 5B0AA 2KFZA 2DGQA 4C8LA 1RWXB 4QU7A 2HEKA 3KLEA 1NK4A 3HF5A 4DV6J 3IC1A 3ZZOA 1LW0B 1JNZB 5AE2A 1XR5A 1HI1A 2BJ3A 2DNRA 2MLXA 1TP7A 4O4GA 4C8NA 2N4CA 3MR6A 2DNNA 2CVEA 5CHCB 4G1QB 1UCNA 5LT5A 4HHHA 2IYGA 2VONA 3OR1B 4OHVA 1Z4UA 1M90T 2WVDA 4USIA 3RUBL 1SKWA 2V2KA 1T03A 2GS8A 4ZDNA 1NK8A 2I6WA 4WP8A 4KPYA 5CZXA 3AXMA 2DHAA 3I4PA 4OJGA 1NNDA 2ZWPA 1JLFB 4LF8J 3FBCA 5E5NA 2WZ1A 4CIOA 1SV5B 4NLDA 2YH0A 2FY1A 2BJDA 2V4JB 3M2UA 1NHUA 3ZFVA 4CO5A 2RU9A 4DR3F 2OP5A 4CM0A 3JYTB 1R8CA 1RWVB 2H5EA 2I1RA 4OZ3A 3HP6A 4QIFA 3VAGA 1FRJA 2VIHA 1U45A 5KFQA 3HJFA 2DNMA 2W7OA 2FVCA 4MKBA 3NWRA 5KFYA 3UVJA 3MMBB 3TYTA 3NGKA 2AYMA 3SDEB 4UOFA 3Q2SC 2R8KA 3MM7B 3A1YG 2PA8D 4DS5A 4P73A 3QRRA 4PXDA 1L3TA 2BACA 2UUCF 1E6VA 1FFGB 2FGCA 1IBLJ 4ZVFA 1ACMB 3DC2A 2JX2A 3PDNA 1PIEA 4X62J 2ZHAA 1DFDA 2MKJA 5FIIA 1TFWA 5T7LB 4CLFA 1RHUB 4N47A 2IVMA 1MLAA 1F2HA 2IDEA 1JKHA 4OJHA 5I3PA 2DIUA 3US5A 1OQ6A 2GVZA 1RTDB 4CM2A 5A8KB 3Q8UA 3I0RA 2MMYA 5KFBA 4KR0B 3ISND 1Q7YT 1S4EA 4WYLA 1RUSA 5KFJA 4CO0A 2FIUA 1X4FA 4JI6F 1S79A 4M5DB 3L3CA 4C8ZA 2U2FA 1Y5LB 4ELUA 4Q43A 4TU8A 4NXNF 3JTPA 1X0PA 1NDKA 5K20B 1VRUA 2Z2ZA 2RKIA 1X8DA 4M5KA 3MCMA 4KQZA 2BE2A 1C1CA 1S7HA 5IXUA 4USWA 2QGFB 5HSPA 4CO2A 1RCXB 4LVOP 5C5JA 1FERA 2XEXA 3GU0A 4ZS6A 4E2FB 1RWPB 2HQDA 5AT1B 2ZH1A 2ZBPA 3TAMA 2Z30B 1X9MA 2H54B 2C2ZB 2ZH9A 4PR6A 3DXBA 2CG4A 3NOGA 1R0AA 2UVUA 2DIVA 4KSEB 4WXWA 2B51A 2QL5B 3H5XA 1S0MA 4U7CA 1QVFR 2CPDA 4F8RA 1XMBA 2ATLA 1J5EJ 2FPHX 3VAKA 3FSYA 2ROPA 3R2CJ 4BWMA 3GP9A 3RG6A 2DH9A 2NSCA 1D1UA 4F4KA 2Y9HA 1DY3A 4DR6J 2IAJA 4O3SA 1R27B 4F4AA 2IA6A 2D9OA 4TXSA 3ZNJ1 1WC4A 8ATCB 1VBKA 3PEHA 1WOSA 1CC7A 1S10A 1S6PB 3Q89A 3W2VA 2ZM6J 4HI2A 4LR8A 1IKVB 3SFUA 3PCOB 2HWTA 4QOTA 5E3RA 3BKUA 3OLAA 5GADU 3AA9A 4J91A 3MF5A 2XGQA 1KLMA 1GNKA 1WUUA 1AFJA 4V19J 2EK1A 1UA0A 4RZRA 2ZH2A 3A13A 3QWPA 3D2WA 1DQ8A 3HLUA 4QZVB 1HR0F 1AZSB 2F65A 1H7WA 2NYIA 1G7CB 4F3OA 5IM0B 3DMJA 2HQ3A 5HLFB 2GA7A 2J0XA 4EO8A 1HD1A 4P52A 2D3ZA 1N5YA 1XMQF 1HNWF 2JSXA 3DLKA 3RBEA 2VOPA 3CW2C 4GVLA 1VQ5S 1UPMB 1DTQA 1WOOA 4FVMA 4LF9F 4PG4A 1UWBB 4MKVA 4LSNB 1SJ1A 5DDQC 1F0XA 1KP6A 3CCZA 2ZHBA 2YX1A 1S49A 2YNFB 5J1EA 1MN9A 4TY8B 2DJWA 3KLIB 1JLQA 3M8PA 1FFWB 3D6TB 3NAIA 3HPOA 5E7OB 4KO0B 3Q2TC 1HWIA 5E33A 2IM3A 4JV2A 4WTYA 3CJTA 5FJ4A 3DLEA 1S9GB 4I6AA 4DQQA 1KEKA 1MU2B 3MAAA 5AXNA 5DG7A 4URSA 3LO3A 4A8QA 4CTAB 1WEZA 1V5IB 2X3DA 3R7NB 2YNHA 4LIRA 2HVHA 3P49B 3KMQA 4DPYA 3FJ2A 5KT3A 2ZNYA 3IN5A 3GJQB 4KAIA 3G96A 2KI2A 2OSRA 4A46A 1AUSL 4FF2A 2F4VJ 4DQIA 5LSOA 2A10A 1FJCA 4NLTA 3HHLD 1DLOA 2Z2YB 2V8PA 2UXCF 2NREA 2LU1A 3M32B 1IKYB 1CJVA 2JJ4D 1Q7LB 2CADA 5KFHA 5AJ3J 1UW4A 1P27B 1LFPA 3OR2A 2PE8A 3D7SB 4ICLA 4DV5F 1UVIA 1JJ4A 3CDBA 3QLHB 4ZPTR 1GX5A 4O0IA 4ED4A 4RNHA 1CS4B 1JLGB 3M1VB 2E7VA 5CAAA 2GMHA 4N41A 2EBEA 3FQKA 4O3QA 4DPWA 1RWWB 4K4UA 1IBMF 1TL7A 3OJUA 1RT3A 5DQIA 3C66A 3S8SA 1HQEA 2BABA 2MZQA 3LP1B 2UUWA 2LFVA 2WBMA 4DR2F 4DL5A 3I5BA 1CJKB 3TJ9A 1HIYA 4LT6A 2FTRA 4ZIWA 4B3SF 4DF8A 3BGFA 3X3UA 3F44A 2MKSA 4K4VA 2GNKA 4GVBB 1VRTA 2VG5B 2IBOA 2B9EA 4NEYA 3ITHB 2VH7A 4NLQA 2D74B 2DTJA 1I94F 4YS2A 2QG9B 4CLSA 2XMMA 2BMBA 2DEIA 2ZHOA 4K59A 2GO9A 5B0BA 4BCAA 3OTOJ 2R2TA 3JQMA 3NL0A 2HNYB 2MEWA 2NXCA 2XY5A 2CQDA 4IDKB 4GKKJ 1PC4A 4OI3A 2G4BA 1XEZA 2CQ4A 4ZVHA 3CJKA 2JEFA 3ZTQA 2G0IA 1PYTA 3DU6A 2HFVA 2CDQA 1CLFA 3QRQA 1D09B 3MR7A 2G2OA 3QGPA 3H4BA 2XMKA 2NPFA 1HD0A 3V4IB 2HHHJ 2OTLS 4V19X 2XS7A 5B7WA 4LSZB 1XN9A 2CQBA 2HLUA 3W1YC 1P1TA 2F4FA 3CEDA 2ZD1B 3M8QB 3UD3P 5K8OA 3TVYA 3HD2A 2KM8C 3LGNA 4UUWA 2BBEA 4LRDA 4TQSA 1IJFB 3MD1A 1SIZA 1Y9OA 2VQFJ 2MZTA 5BYSA 2EEYA 4QYZK 1RHJB 4NZ0A 2VQEJ 5LMNF 3V6DA 4ANEA 3MCSA 4LVNP 3MR5A 4CNZA 3T5LA 5THWA 3DI6A 1ZM9A 4G6VB 4IFYB 2XYGB 2IA0A 1U48A 1K0VA 4CQ1A 1U1NA 3KNGA 3WHIA 4PABA 4ZCLA 2XQCA 1M5VC 1W26A 3PVXA 3RR7A 4ZVQB 2FYXA 3U1MA 1UEKA 1RAGB 1S1UA 4B3TF 4ES3A 2HPUA 5T14A 2IPOB 1AW0A 1J5OA 4X84A 4WKRA 3LWLA 3C16B 1LXNA 3MM5A 4NI2A 5ETTA 1U6ZA 2F1FA 3S1TA 3KG4A 4OHWA 2BW2A 4KH0B 2AX1A 1LWFB 1RE1B 3I4HX 1O6XA 3GILA 4RPFA 4DV6F 2G0CA 3VALA 4DCOB 3RW7A 3CDAA 4PZVA 3VAFA 4L3NA 1T05A 3G6YA 3NMAA 1TL4A 4KKOB 2KN4A 1M1GA 1WG1A 4X4TA 2NXJA 3GB0A 3SMZA 3ENAA 3CD6S 4HKQA 4QPXA 4UY8T 3MM6B 3ILOA 4K2JA 2I8EA 5H9FK 3K8WA 1HBUA 3FC9A 3PEJA 3DOMB 3GWCA 5CCMA 4GKJF 2YWGA 4F4ZA 1UVLA 3ET6B 1OIAA 4PWWA 2CYYA 3PRVA 3W9HA 2HVIA 3KK1B 2CNKB 2YWKA 4YDXA 1HBNA 4LF8F 2DNKA 2CPFA 4UUXA 3DM2B 4TYBA 5C25B 3UN5A 4RW6A 3HM9A 3KLFB 4J9PA 1RAJA 1F1BB 2LQ9A 4NLOA 4O3NA 4K4XA 4M5IA 3UWTA 2LEPA 4HACB 4USJC 2ILZA 2DGTA 1UW9A 1O8BA 3M8WA 1ZH5A 2YKMB 3TUZC 1QSYA 1U49A 4B9MA 2KJVA 3MFHA 3MEEA 3OPKA 2W8KA 4K0KJ 5GAHU 4LRCA 1VISA 3PFOA 3GIKA 4X4OA 1FXRA 4ER8A 2BOPA 3AXKA 1XERA 3I5CA 4U8YA 1WJ9A 3CF5Q 3R6GB 3ETOA 3W8GA 1RT2A 5KFMA 1DJ0A 1EKRA 4ECSA 1XJWB 2APOA 3SSSA 3VAIA 2KHDA 3IMQJ 1VIOA 1F60B 3MDFA 2DGSA 2DRBA 3TEGA 1KONA 3TVZA 3OUYA 4MKYA 3TAPA 3NP5A 1PAEX 4DU8A 2FVQA 3G4SS 4WU2A 3CJ4A 2OJ3A 5IFMA 2CQ3A 4AE5A 1OY8A 3GFYA 1LWXA 4QWDA 5A8RB 1F2GA 1C1BA 4OJ1A 2PFDA 3V6KA 2ACYA 4TU9A 2R7UA 4CP5A 5ADZA 1OY6A 4OJ3A 2A6OA 4DPXA 2KRBA 4LF4J 1C4CA 3D0GE 1ZETA 1GQEA 1YJVA 5KT2A 3OXLA 4DV3F 1TL5A 1FF2A 1Y00A 3RR8A 3SBMA 5ETVA 1CG2A 1VQOS 2G9OA 2H3EB 3P5BP 2BE7D 3D68A 4NEZA 1LFWA 3R5BA 3ENQA 2MQLA 2UVVA 4J9KA 2KZZA 2BM0A 2D3O1 4EO6A 2UUBJ 1IKWB 3MMBA 3BN7A 2I9SA 1S9EA 3H2LA 2QIFA 2HGNA 5KFFA 2X1AA 1K0TA 3NGRA 1RYRA 1NPPA 3PX0A 3QRPA 4Q44A 2QTWA 4DSEA 1CVJA 3AB4B 4NLYA 4NA3A 2QLXA 3QIPA 2O01C 2ZE2A 4ED6A 1WKKA 1S7IA 3UD5A 2LA6A 2VFTA 1PYSB 4J90A 4DL4A 3KHRA 2YKNA 3IM8A 3KHLA 3DHWC 1M1KT 1SJQA 2FDNA 1N56A 5KG5A 1JB0C 2WB1D 4A8FA 2KJWA 1AA1B 3KJNB 3NAHA 3WC0A 3ZTSA 4NPOA 2EI5A 1KWMA 2AGQA 3KK2B 4M5DA 4Y00A 3HULA 5KFDA 3PJXA 3I9ZA 2L08A 4HH1A 1RTJB 2HHVA 4WFYA 2B6AB 1LWEA 2BVZA 1TL3B 3MTKA 4JI3F 1YBUA 2J6SA 2KT3A 5LOQA 1QE1B 1YJNS 2WVEA 1GTEA 3MPUB 4YR3A 2Z58B 1FEHA 3MM9B 4Q5VA 2FHMA 2Q3PA 4L72B 4NCAA 3CCWA 1CSJA 3H25A 1RQ0A 2BJ8A 3A8IA 3BQ1A 2KVIA 2JC0A 2JVOA 1JJHA 1FWKA 5HROA 1O51A 4WKYA 3E01B 2FJXA 3CMES 4WFZA 4WFNQ 1R8HA 2EFPA 4JV0A 1C0TB 2A2DA 1X9SA 3HMJG 3RTVA 3T6JA 5DS7A 3LALA 2LXIA 5KFSA 2O66A 1KFSA 1X4CA 3PO4A 2F8HA 3B6BA 4URQU 4O3OA 5CABA 3BJYA 3GYXB 2DGXA 4LSLB 1RWOB 3SI8A 2DGOA 3PKMA 4ECWA 1F3VA 2MZ1A 3IWLA 5I3UB 4DUYF 2FVSA 3KJFB 3CE8A 4ED0A 1JNRB 5IT4A 1S77D 2VODA 3FZBA 1SVDA 4DV1J 1HQ2A 1B0TA 1IKVA 1K73T 4RW4B 3ZZRA 2XHWA 1JJCB 5CZVA 2LCWA 3GYNA 1NH8A 1A0OB 4H54A 3FK4A 4OX9F 4WK3A 4PWDB 3BSAA 1ZPVA 3K2YA 1S1XB 1MWQA 3K5MA 1RCOB 4B3MJ 3ZTRA 4P74A 3FNNA 4IUFA 2OTJS 3W61A 1AFIA 3K89A 2BJ9A 3WBZA 3H5UA 3PW4A 4Y2KA 2BRKA 4DPUA 3OFHA 3BM7A 4L3KA 2QYGA 4IG0A 2CPYA 3JXOA 1U8WA 2GQ2A 1B4SA 1CJUB 1KTVA 1UPPA 1DZ5A 1RTIA 3D1OA 2VJUA 2DRDA 2UXBF 3LGHA 3AQOA 4JBCA 1TVRB 4DZDA 3CCRS 1YZ6A 1ZM4A 2XM3A 4F3QA 3TJAA 3KNAA 1L3KA 3RAXA 4QCLA 4KFBA 2ZH8A 5CH7B 2MQNA 2PA3A 1YJUA 4LJMA 4ZA1A 4OZJA 4JI8F 1UFLA 1S9GA 2DPJA 1Z2LA 1H38A 1X5PA 4CLKA 4IRCA 1OPIA 3HHLB 4GKKF 1JQGA 3MURP 5F3ZA 5HP1A 1HFEL 4ZVRB 2JLEA 2G0JA 5KFZA 3DLGB 1IWGA 3BGOP 3DFEA 1Y10A 3GTYX 1TKZB 6FDRA 4M5NA 4Q2MA 3QT7A 3C6TA 3Q23A 1FEEA 4P7TA 2B4VA 7FD1A 1TUGB 3UE2A 3D1HA 1F9EB 2DNHA 4F67A 4K4WA 3MXHP 2P5VA 1P1LA 3NGDA 2HHHF 1Q53A 2OEKA 2VG6A 4BBYA 3M32A 2CPEA 3POTB 4N77A 3WC2A 1N6QB 3I32A 4IG3B 3IAM9 3HSJA 5A8WB 3EYZA 3SFGA 2L41A 2KFNA 2E5LF 2G2ZA 3DKDA 3EWGA 1RZMA 1SB6A 2ZJPQ 4M8LA 3TZZA 5EX0A 3A4TA 2QC3A 1VK3A 3UCUP 3DN9A 3D0IE 3QJJA 3IGNA 2HS4A 4KB7A 3EPIA 2CJAA 2VQFF 4PPDA 5EHHA 1F5AA 2ZOFA 4O44B 2OKQA 2VQEF 1RT1B 4OZ0A 4YP3A 3BO3A 4EBDA 3CO0P 3JB9k 1D0EA 3TANA 3H90A 2L9DA 3BEGB 4KYZA 3OVBA 4OFZA 3H0PA 3BYRA 4EI2A 3BBFA 2J9DA 2AJ1A 1U6FA 4FXVA 1HWJA 5EWEA 2VG5A 4ZPWR 1JXVA 1HHQA 4ZPVR 2CWKA 1R3NA 2B5JB 3HVTA 3O8WA 3FBEA 4NRTA 1ZS6A 1PILA 1VR6A 2VA3A 4ED5A 3MAHA 4F2SA 4M94A 1FFSB 3BZQA 4DFPA 5BR8J 1CULB 3HVRA 3NNHA 4M5MA 2NXUA 2OGUA 3B4DA 4KIAA 4KHPF 3EICA 2UU9J 1FJEB 1FTRA 3TARA 2FQQB 2BKOA 4WPAA 2MPUA 3KLHA 1WORA 2L9NA 1S1VB 2CDRB 2Q43A 3T19A 3UPFA 4WP3A 3IG1B 2ZBRA 3S01A 3THPA 1N36F 2ASLA 2YKAA 1Q4RA 3ONQA 1YGYA 1RHMB 4O0NA 4R5PB 3MZIA 3NCRA 2EPIA 1YBTA 3MD3A 3VQTA 3PY8A 3GIIA 4N56A 2KVQE 1TKXA 4XPCA 3L7OA 4EZ9A 3HVWA 4CT8A 1ZA2B 5KFGA 4C3KA 2AJFE 1UFKA 2K7JA 3KLEB 3QT8A 2C3OA 5M2PA 3N01A 3FCWA 5E3AA 5L46A 4P10A 2LVWA 3GV5B 4O4GB 2V0NA 2CZ9A 4IR9A 4LBIA 2CJXB 1BUXA 1TTHB 1X5OA 3MPVA 2BQ3A 1T0TV 1NLKL 2MYFA 2KXNB 2Y0SD 3OTCA 3BQ2A 2DR6A 2AT1B 2DXFA 3NOCA 1S1WB 1T03B 3U27A 2Z2LA 4ECYA 4B3RF 1TUWA 3BN4A 3CMAS 3NLCA 1H72C 4TYAA 1VOMA 5KTQA 3T9NA 1LWCA 3JSMA 4HVZA 4K0KF 2IVFB 1FJGJ 3EXYA 4WYWA 1VQ4S 4JV1A 3D4JA 2EK6A 3TNVA 3M2UB 5IQ6A 3Q8SB 4XPEA 4FF4A 4ALZA 1WI6A 1HQUA 4IKAA 1RAFB 3JSYA 4K50A 2H5JB 1U2RA 1UJ4A 3HI9A 2K7KA 5ETNA 4U7UK 3OBIA 4PRFA 3UVJB 1SKSA 3M2RA 2RRNA 3WDOA 2W8LA 1U1KA 2QA4G 3QYYA 4RNOA 2BZ2A 2IMOA 5B08A 3EMTA 2C2EA 3L09A 1RU1A 3BDEA 3VZHA 2R8GA 3W2WA 1E6VB 2F9DA 3D66A 1J2VA 4CLLA 4DL3A 4NMXA 3KK1A 1WTFA 5KFOA 3DXSX 2CPHA 2RH3A 4IFVA 4J9SA 2DY9A 5H1SV 2DHSA 1LW2B 1DAXA 1SJRA 2AIRB 2R8HA 3GIMA 3KKFA 4BC9A 4AQYF 1R89A 4TN2A 1JKHB 4OX6A 4JI5F 2RS2A 3U1NA 2NSBA 3PYGA 2HHTA 3QATA 1ZTWA 3AJDA 2GVZB 2AV5A 1LKZA 3TZWA 5J2PA 3FMBA 4ES2A 3B8HA 3TQEA 3CIMA 5BYRA 1WDTA 2E1PA 4HACA 3NS6A 2M8HA 4P71A 1NK5A 3D6FB 4LF6J 2YQ0A 2YY3A 1UJ6A 2CJBA 3IBWA 5L38A 3FCVA 3EUNA 2YNIA 3U7JA 3MPWA 4PQAA 4XK8C 1HNZF 5DM6Q 3K7RA 1WF0A 1VRUB 2RKIB 2BE2B 1C1CB 4DV4J 2X51A 3Q8VA 2H65B 1EIYB 1T7PA 2XO6A 4DR4F 3CJSA 4DR1F 1UTAA 1T95A 3J7A1 4FBUA 4TLRA 3OT9A 3GIRA 3TAMB 3OSNA 4ZVPB 3ZZUA 3KYLA 3O44A 3LANA 2BA9A 2K3IA 1RGVA 2DXDA 1FDNA 1R0AB 1ZAXA 3DDNA 1WKJA 4ANCA 3L95X 2LYVA 1JJ2R 2B7CB 1MNEA 5EWFA 5IT9Y 1Y5IB 2H4YB 2IHR1 5IOLA 2ADCA 3A3PB 3NMRA 3J80U 4MIBA 2MSSA 3E3XA 3LTOA 2C2RA 1KVIA 4USHA 3KDNA 2IAJB 2CQGA 1U1PA 1B0VA 1VQSA 1VQNS 1GMWA 4JI0J 2QMUB 2LEBA 1C2PA 1R0BG 4ZLJA 1H6KX 2RUSA 2RQKA 4B9SA 1U47A 3W2VB 4OYOA 4I2QA 1FJ7A 3GPAA 3C14A 3P96A 2HWIA 2WOMB 2E1RA 1HNVA 2A3JA 1KLMB 3G6XA 3VV2B 2FLPA 3BSOA 4EBCA 2KM8B 3KWMA 4A8OA 1SL1A 5HL7Q 2IDLA 2V9KA 3W65A 3MPDA 2BW7A 1KD1T 5KFAA 4WFXA 2FC8A 3DMJB 1T9TA 4ETXA 1NK9A 4DL0C 2GHPA 4M1KA 2VFVA 4EUVA 1GXLA 1N5YB 3QZ8A 1G6BA 2O5DA 4DFJA 2Z4PA 3O3LA 1FO1A 1RAEB 2MKKA 4NASA 2MKHA 4EGLA 2HYIB 2HLTA 1XBWA 3NNCA 1AROP 4KGZB 4JI1F 2BRLA 2ZOGA 5DG9A 4RW8B 5J1EB 3QMQA 2E9ZA 1KC8T 3J81U 2QMXA 2R4FA 3CC7S 3AH6A 1JLQB 3M8PB 3CUNA 2WSEC 1WC0A 2KO1A 4ECVA 1RAHB 5F8GA 2HK2A 4LFBF 4O23A 3FRZA 3MAAB 2LECA 5K14A 1UVMA 1HI0P 1UWAA 3NS7B 5D77A 1H2TZ 4KHRA 4AXJA 1FXLA 1TL3A 2EC2A 2RVJA 4Y28C 4I2PA 1QE1A 5BJRA 3HHKA 2F5GA 2KRRA 1RA7A 1RHQB 2AEJA 4I56A 2PN6A 2HGLA 2MQMA 1IBKJ 4MTPA 3TX0A 2YX4A 3ZZ0A 3CJRA 3FSXA 4FBTA 4AL6A 1CJVB 1YIJS 1JMTA 3CB4A 2PEHA 3E01A 4IH7A 1YJ7A 2HGMA 4ICLB 3GQCA 4RWWA 3OVAA 4DV0J 4EK2A 3BB5A 1WG5A 3UDLA 4Y0FA 5GAGI 4PQUA 3OL8A 2XYHB 1TL7B 1RT3B 5ETPA 2WVFA 4HTJA 3CO9A 4C8YA 2CPIA 3M8RA 3LUYA 1D9AA 2FJDB 3CSKA 1F9HA 3RB6A 5C42A 2OO4A 2YXLA 4MAKA 2M70A 3C6UA 1F5CA 1YRXA 2QSWA 4ZJOA 2YKOA 1B0PA 4ZCMA 2WB4A 2W2NP 1WTBA 2D9PA 1D8YA 4W92B 1VRTB 3CJQA 2AEMA 1CEZA 2DPIA 2EC0A 4RW4A 4QWEA 1KSPA 2YKQA 1PAUB 3AD7C 2GC8A 1MROA 2Q1LA 2KYXA 1IM6A 2MB0B 2J9CA 2DNYA 3PW0A 2CJ9A 1Q5YA 4JYAJ 5L9NA 2IIHA 3BH7B 5JVHQ 2GMLA 3M9NB 4ZPBA 3CJKB 2OI2A 2IC3A 2PEBA 3H98A 3M9OB 3PM9A 2J0QD 4NYOA 1QTNB 3CCUS 3O2IA 1T9VA 1LK7A 1W2BR 3AT1B 4MK9A 4R8UA 3MEKA 2OPPA 2PMHA 4ZJQA 4C97A 2ZJRQ 2VDHA 3NKYA 1SIWB 1VJWA 2D1CA 1RT4A 1QY7A 3AB2B 2BM1A 1NJZA 5G0RB 4F3MA 4KT0C 4ZN3A 2B9XA 5CA5A 3K5NA 3R2DJ 2QX0A 3GJSB 4CH1A 4LF5J 1S59A 1EX8A 4JI7J 2OPRB 3D28A 2MDAA 3S6EA 1MMDA 2W2PP 3PYEA 3V4MA 1LV5A 1WC1A 1VBZA 3HHLA 3V6DB 2OEMA 2EXUA 2RS8A 4DV7F 3TUPA 3R5GA 3ISNC 4X65J 2MTLA 2V2QA 5A2QU 5DGBA 3A8KA 2RMLA 2B4PA 4QQBA 5ETKA 2VJVA 2MGZA 3FBFA 3TQ1A 2MHEA 1FI4A 3QGHA 3WX8A 3DCAA 3N6MA 1LQ9A 1S99A 4BHQA 1N6QA 4IG3A 1S1UB 3RB3A 2C22A 4NLRA 1HA1A 4LR9A 5D78A 4Z37A 2FJEB 4QW8A 2J0SD 1J5OB 3SV4A 3NNAA 1WC6A 3MM5B 4NI2B 3R5JB 4H4OB 4J9QA 2HW3A 1LNQA 2QFJA 2FGOA 4PG7A 5EWGA 3DLHA 3C2PA 2HIQA 2I0XA 1GMUA 5H9FJ 5KT4A 2IM1A 3N9UC 2YKPA 2J9EA 1X4HA 1T05B 1U24A 5LSRA 2E1MC 1S72S 3PIPQ 3PW7A 3IM9A 2C28A 2AZ1A 1BLUA 2KG1A 4NRUA 4ZHRB 3EGWB 2N3OA 1X4GA 5CCLA 2CJYB 1HBUB 5JUMA 4LF7J 2WRMA 4ECTA 4TVAB
chains in the Genus database with same CATH topology
1Q8IA 5CXTA 4Q7AA 1OS5A 3CF5Q 5U47A 3J80Y 2E5HA 1YTYA 3ETOA 1RT2A 3WX4A 5KFMA 5D4NA 3HHEA 2E5IA 5D3GA 1K1SA 2K8GA 1DJ0A 2DHGA 3I0SA 4L6V3 3BGUA 4UQTA 5B0FA 3RB0A 4K5RA 4IQMA 4IOBA 1XTZA 2XSJB 4ECSA 5EDWA 2APOA 5F0WA 3SSSA 1F5BA 3VAIA 3NRBA 2KHDA 1T02A 3R3TA 2XB2D 3P6YC 1NHVA 1VIOA 1CQNA 4WJBA 1F60B 3MDFA 4MIAA 5LJ5Y 2BANA 3SQGB 2WCXA 5L8RC 2BUNA 2DT9A 2DGSA 2DRBA 5KFUA 1YRUA 3H8YA 1KONA 3TVZA 1V3ZA 3OUYA 4MKYA 2OMOA 3TAPA 3NP5A 1IKWA 2BYCA 2LQJA 2IRYA 1ZZFA 2J76E 2HFZA 3PO5A 2KU7A 2Q6BA 4JOUA 3G4SS 4WU2A 2FVQA 2VFSA 3CJ4A 2Z8QA 1VIXA 4Y2AA 2OJ3A 5IFMA 5J2QA 3SV3A 3LP2A 2CQ3A 4AE5A 3PR5B 2ZC3A 3OW2R 1OSDA 3GFYA 1N5QA 5DDPC 3H4DA 2AP6A 3TP2A 1O0PA 1YJRA 4QWDA 2AJQA 3OLBA 5A8RB 2VOOA 3QGGA 1F2GA 1A6LA 1C1BA 1T8EA 2HMIB 2LLZA 4ITSA 3LWMA 4X2BA 5F3TA 4OJ1A 1X0FA 4JYAF 5GMKa 3V6KA 2ACYA 4TU9A 3T5KA 2R7UA 2XO7A 3P5TL 4K4YA 1N0VC 2XZWA 3RAMA 5ADZA 3KHHA 2A1BA 4G1PA 1EETB 4QWAA 2XMWA 3DLKB 4OJ3A 1XNQF 2EG2A 3UNGC 1X4BA 2GIQA 1WHWA 1YBAA 5I42A 2OPQA 2KRBA 5AE1A 3MEEB 2GMJA 3T9ZA 4HI1A 5EX3A 1DTQB 5KFXA 4NWBA 3HKZD 4C0OC 1HBMA 1C4CA 2E7XA 3D0GE 3FFIA 1UAWA 1Y5NB 3ZZYA 3CCSS 1ZETA 1SL0A 3C46A 4C3MA 1GQEA 3GFHA 4PPZA 1YJVA 5KT2A 1KQSR 3OXLA 3SCIE 3CD5A 4DV3F 2F9JA 1TL5A 3VWSA 5KT7A 1NK7A 3W3SA 3IFEA 1FT8A 1NH7A 3G86A 2XY6A 1FF2A 4WK1A 3PKYA 6FD1A 5K5MA 4F4WA 1LOUA 3DRSA 3HVAA 1KLNA 4ILLA 2DGWA 2EFOA 3G8TA 1RT2B 3SSQA 4C7QA 3DOKA 3OTDA 2QT7A 2V4RA 4K4ZA 3K0JA 4WXOA 2IRXA 1Y00A 3RR8A 5AXLA 2Z0GA 2XWXA 3KG0A 1NJXA 2JLFA 2JLGA 1CG2A 1N5TA 1U09A 3R5CA 1VQOS 2G9OA 3Q0AA 5IWAF 2ABYA 2ZITA 4OHYA 3U1LA 3CJ5A 3PX4A 1C0UA 4WFAQ 2U1AA 2MZRA 4IO1A 1LFWA 3R5BA 3KK2A 1N5SA 1UEUA 2KG0A 2QRRA 3CCJS 3ENQA 2BANB 3SXLA 3OXGA 2MQLA 1Q78A 2UVVA 4J9KA 4YR2A 3UD4P 2KZZA 2VBYA 3DLEB 1VHFA 2BM0A 2EFGA 1H2UX 2YNGA 4QR2A 3EPGA 1P8GA 4RBVA 3VAMA 3GZ7A 2NS1B 2RU3A 1SUQA 1RTJA 3LQVA 1RKIA 3OUYB 4EO6A 3CGIA 1OO0B 2W7PA 3GV7B 3J81Y 1IKWB 3MMBA 2YNHB 3BN7A 1HNIA 2B6AA 4LF5F 1WD6A 1S76D 2I9SA 4I7FA 1CC8A 1S9EA 1UMJA 5D4LA 3AJ2A 3H2LA 4U9RA 2QIFA 2HGNA 4HDHA 5J2QB 3LP2B 4RUHA 5KFFA 2CPJA 2X1AA 2W9CA 4ELVA 1K0TA 1TL1A 3GFXA 4EU0A 5L1KA 4AL5A 3D54A 1RYRA 4NLSA 1RT7B 1A9NB 4A4JA 4DQRA 3SEOA 3PX0A 2ZDPA 2CVIA 1GTHA 1C1BB 3MM9A 1S1WA 4Q44A 4IRDA 2HHSA 1QUPA 2RT3A 1K9MT 1SJ4P 4HHJA 1KN6A 1G2EA 2CJQA 4JI2F 4DSEA 1NKBA 2MQPA 3IR6B 3OV7A 5KG7A 2CPZA 4BS2A 1DLOB 4QU6A 1CVJA 3AB4B 3LP0A 3UW1A 2OPQB 4QJVA 3THVA 4NLYA 3ZC4A 1Y7PA 4NA3A 2QLXA 2JEGA 3QIPA 2O01C 2ZE2A 1HBMB 4ED6A 2RUGA 2XBPA 3KK3A 3FFIB 2CQCA 4XDDA 1VBXA 5KFCA 1RK8A 2Q79A 2VBXA 3EXCX 3THTA 2LA6A 2VFTA 1HL6A 1R8AA 4DL4A 5KFNA 2XMTA 3N5BA 3IA0A 2YKNA 3KHRA 3VAJA 1UA1A 2BDPA 1U1QA 5KFTA 3Q8PB 3OR2B 1U6BA 3KHLA 3HHLC 4NZ7A 3DHWC 1M1KT 4K4SA 1Q8LA 3DRSB 5K8MA 4C9DA 4U6PA 2R7OA 1SJQA 2FDNA 1N56A 5KG5A 4DHVA 4ED3A 1JB0C 2WB1D 3DOKB 2C42A 2KJWA 5T41A 4YB6A 4A8FA 4FVCA 4QYRA 3NAHA 1C0TA 3WC0A 5F8IA 1TAQA 5HMYA 3C3LA 3G6ES 2F40A 1JLEB 3H5YA 3D0HE 5E0OA 1B64A 4PG6A 1C0UB 4NPOA 3PW2A 2EI5A 2AGQA 3BGRA 4A8SA 1O5JA 3BREA 3QGIA 3D5MA 1XK8A 3B82A 3KK2B 3CC2S 4M5DA 4Y00A 4HTIA 2HHXA 5KFDA 1B7FA 1JX4A 3PJXA 2GJ2A 3I9ZA 4QIVA 4PUOA 2FLLA 2YNGB 4ZPAA 1UETA 1SUQB 1VMBA 1HQEB 2L08A 2RF2A 4HH1A 2G1DA 1RTJB 3TUJC 2MXYA 2HHVA 4LSLA 3BR9A 1WEYA 4N5SA 3FEZA 1QSSA 2IFXA 4WFYA 1HNIB 2B6AB 3M6UA 2P6SA 4I7FB 1LWEA 1S9EB 3DU5A 2BVZA 4YB1P 1TL3B 1Q1KA 3PACA 2POKA 3MTKA 5B0EA 4ED7A 3CULA 4K2XA 1YSJA 5K8PA 2VKZG 4JI3F 2W9CB 1UVNA 5I3UA 2RNEA 1TL1B 4ZP8A 2J6SA 2FHOB 4DN9A 3EZUA 2KT3A 4RW7A 1QE1B 2C3UA 3LOUA 1YJNS 2KTQA 1QM9A 5CYMB 1GTEA 3KFWX 4IH6A 1L5UA 4YR3A 4TY9A 4J9NA 3H20A 3OL7A 3FVYA 2JDJA 1FEHA 3G8QA 3MM9B 4U67Q 4Q5VA 4NCGA 4XAKA 2ZH5A 2FHMA 2Q3PA 2SXLA 4L72B 4NCAA 3CCWA 3R1LA 4CCHA 1VGYA 1V3SA 4N8NA 4I64A 2FLOA 1FTCA 2KFYA 1CSJA 3LP0B 3H25A 4LFCF 1RQ0A 3BQ1A 1EP4A 3OHAA 2KVIA 2JC0A 2R8IA 3DOLA 3LGMA 2JVOA 3TA1A 4X64F 3QIPB 2ZE2B 2VFUA 3F41A 4I1TA 3I56S 1LW2A 3QAEA 3KK3B 3H40A 4IOCQ 1URNA 2R7TA 2E9TA 1JJHA 5HROA 2YWFA 4JI0F 2AQ4A 2DISA 3GR1A 1O51A 3PRDA 4WKYA 2YKNB 1I1GA 3MR2A 4YDDB 2NZ4A 5DETA 5KOWA 1YHQS 4FP9A 3BF4A 3OTEA 4PWDA 2ZBIA 4PG5A 1JWWA 1S1XA 3E01B 4UQGA 1D9FA 2FJXA 5MLCV 3OFEA 3CMES 3EZ5A 4WFZA 1JIHA 2ZFHA 3I9V9 2ILYA 2W24A 2GJIA 1T3OA 3CCVS 4WFNQ 1R8HA 3TOQA 2EFPA 1SI9A 4JV0A 1ZYQA 2XY7A 1C0TB 2RRAA 2A2DA 3FEXB 1X9SA 2BQRA 2LQ5A 1FNOA 2F8MA 3HMJG 3RTVA 1V3RA 4NL5A 3OFGA 3T6JA 4Q0BA 1VS3A 4WE1A 5DS7A 4DR5F 2FC9A 2PI4A 4DPOA 4M63A 1U1RA 1N48A 3QJPA 3LALA 5DJBA 1M0SA 4R0JA 2LXIA 5KFSA 4MJKA 3DHXA 1FD8A 3BGRB 2YQ3A 2M88A 5GAGU 4PWUA 4A8XA 2D3OR 2O66A 1BQNA 3FDSA 1QJHA 1KFSA 1X4CA 3V5RA 3PNIA 3PO4A 1HWKA 4DR7F 3OL9A 2F8HA 3HZGA 1WELA 1VQ7S 4PUOB 4FNIA 4URQU 2M4MA 1ZTTA 1RI7A 1FDAA 4O3OA 2RF2B 5J2MA 3BJYA 1H3DA 3GYXB 2DGXA 3QIDA 2WAQD 5F8HA 1N32F 1U2FA 4LSLB 3SI8A 2F3JA 1M5HA 2DGOA 3PKMA 2DH7A 4ECWA 3I55S 1TKTA 4ILRA 1LWEB 4JI4F 1HPZA 2MZ1A 4QIGA 3IWLA 5J2NA 5I3UB 4PXCA 4K5SA 3MMJA 4DUYF 2FVSA 2NUUG 3P3DA 4YMEA 2ZOMA 3CIZA 2QMWA 4RW7B 5KG2A 1N5VA 1U26A 3CE8A 4LFAF 4ED0A 1FHTA 4AFFA 3H5SA 4RUCA 4M95A 3LAMA 2KH9A 1JNRB 5KFKA 1T3NA 2PMZD 3Q8QB 1IKXA 4FXWA 5IT4A 1S77D 1TVRA 1BQXA 5EN1A 2HAIA 4NCGB 2VODA 2JVRA 2W4PA 3FZBA 2AGOA 3F56A 3GSDA 5G4DA 2XCAA 3H59A 1B0TA 1PO6A 3IS9A 4EYHB 1SC6A 3CCMS 1QLNA 1D3WA 1IKVA 2F8EX 1K73T 4RW4B 1OQ3A 3ZZRA 1EP4B 5LXYA 2QO3A 2XHWA 4LF4F 2R7XA 1N34F 5CZVA 2L48A 2LCWA 3DOLB 5J1NA 3RZAA 1PGZA 1AXQA 3MFIA 3BSCA 2ROEA 1F9FA 1WHXA 4A8MP 5GADI 3GYNA 1VQ8S 4C8KA 3HZEA 4QPTA 1NH8A 1URRA 4H54A 4E0DA 5HROB 5JXSA 2OD4A 2J7KA 2FVPA 4OX9F 4YQWA 3BR8A 4AXIA 4WK3A 5MAOA 4URGA 4J9MA 1R8BA 4J9RA 4PWDB 2LMIA 3BSAA 1ZPVA 3K2YA 1SKRA 1S1XB 1JLCA 1FRHA 4B9TA 3O5TB 3K5MA 5KG3A 2DR9A 1NRKA 2XC9A 5HBMA 1JLBA 2V4QA 3BSNA 5GAEU 4MKAA 1YJTA 4CT9A 2IM2A 2M8DB 1ZBTA 4NX9A 3FNNA 3GR0A 3K58A 1TV6B 3CXCR 1OWXA 2B43A 3RYLA 4ID8A 2DNLA 3DLGA 2AYEA 3A8EA 4IUFA 4B9UA 2AW0A 5L9XA 2XGPA 2OTJS 1C4AA 1FE0A 3EX7B 5HI7A 1AFIA 4Q0BB 4WE1B 3DI6B 5CQGA 3WBZA 2XMUA 3H5UA 4ECQA 2R8JA 3PW4A 2IVYA 1KQFB 3I82A 5KG1A 2R7SA 4OI6A 1TKZA 4IRKA 2J6UA 1YWXA 4Y2KA 2RRBA 4I0WA 4HYKA 2BRKA 3PRBA 1XNRF 2HZCA 1DARA 1BQNB 4Q45A 1OSCA 1SL2A 3OFHA 2I38A 4YHHF 3W7BA 4WIIA 4NLPA 4DG1A 3BM7A 3I96A 5A0YB 4GC6A 3KOAA 2CJKA 1FA0A 4IG0A 5IS2A 1ZZNA 3HHDA 2KZMA 4OL8A 2CPYA 3PHEA 5J2MB 2GQ2A 2L3MA 1D9DA 2UUBF 3Q22A 3QAUA 1JLAA 3AQPA 4ZKAA 1TKTB 1KTVA 4C3LA 3OQ2A 3BQ0A 2WK4A 1DZ5A 3T1HF 2EFVA 1FKPA 3O6QA 1HPZB 1RTIA 4KGMA 2XULA 4UW2A 1RT6A 2PIIA 2P9GA 3D1OA 3POTA 5H9EJ 1WWHA 5AE3A 5J2NB 2DO4A 2W25A 5A2QY 1QAXA 2UXBF 2ZH4A 3JTNA 2ZKUA 2RDIA 2FUG9 3CDWA 4OI0A 5D4OA 3AQOA 4C8MA 5A8WA 4JBCA 4YY3F 4HT5A 2R9LA 1S6QA 3KG1A 3RAQA 1IKXB 1RP5A 5I4MA 2R7RA 1TVRB 1R43A 4OZ1A 3CCRS 2UV8A 1RISA 1IBKF 2N82B 1ZM4A 2J5AA 2DNQA 4G3IA 5E2QA 3KHGA 4DN0A 1S6UA 1X5SA 4DV2F 1HI8A 2KT2A 4ID5A 2W4CA 4F3QA 3KJVA 3KNAA 2D3UA 3IR5B 4ZVEA 1L3KA 1V6HA 3C8YA 4QBUA 3N6LA 5FDLA 3RAXA 1UFWA 1TUVA 4KFBA 4QCLA 2WOMA 2ZH8A 5CH7B 2MQNA 1H0HB 4ETZA 2PA3A 2EW9A 1YJUA 4WF9Q 4LJMA 3S7RA 4X4RA 1V9OA 1NJWA 4H4KA 4O44A 4ZA1A 4OZJA 5DDOC 5DQGA 3MECB 1XR7A 2EG1A 2JRSA 1DHMA 4JI8F 2QSFA 3SYZA 1UFLA 3CTRA 1GH8A 1RT1A 1JLCB 1S9GA 2NR0A 2W9BA 2XS5A 2DPJA 1Z2LA 1H38A 4KV8A 1KFDA 1X5PA 2CZVC 4IRCA 1OPIA 2QA4S 2B0GA 3HHLB 1JLBB 4GKKF 2B4UA 2FHJA 1X9WA 3MURP 1BY9A 5F3ZA 2QYCA 5L1IA 1HFEL 2XLIA 5HP1A 3ISZA 2JLEA 1S0VA 5KFZA 1Z1ZA 4ZCKA 2DNOA 1IN0A 4DV0F 1FRXA 3DLGB 1NB7A 3E2EA 4F4XA 5B09A 1WHVA 3DFEA 3QWUA 4MYUA 1BQMA 2OIHA 5M2RA 5F41A 4OHXA 4ED1A 2UXDF 2XMVA 1TKZB 2LU2A 3R27A 6FDRA 2CQ2A 4I6WA 3MAQA 3I5AA 4TLQA 4Q2MA 3RRKA 2OH2A 2EKYA 4DG1B 3Q23A 3C6TA 4ECXA 1FEEA 4P7TA 2B4VA 7FD1A 4LUBA 5CYQA 5IT0A 4ECZA 4IH5A 2H9ZA 4RNNA 4IG0B 4WZMA 3UE2A 4YFUA 1QAJA 2M3DA 4NLUA 3FMWA 3D1HA 4ZMMA 5KFEA 4DLEA 1GXTA 2PFFB 1UL3A 4FN5A 2B5JA 5DGAA 2DNHA 4F67A 4DDFA 3DRYA 4K4WA 3MXHP 4DEZA 1JLAB 2P5VA 4CI0B 2FJVA 1P1LA 3NGDA 1Q53A 2HHHF 2M52A 3OL6A 1VQLS 1RTIB 2VG6A 3GG0A 4FZVA 4BBYA 3I6PA 3M32A 1RT6B