3ZBDA

Structure of tgev nsp1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
b'HHHHHMSSKQFKILVNEDYQVNVPSLPIRDVLQEIKYCYRNGFEGYVFVPEYCRDLVDCDRKDHYVIGVLGNGVSDLKPVLLTEPSVMLQGFIVRANCNGVLEDFDLKIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-STRUCTURAL PROTEIN 1
publication title Structure of Alphacoronavirus Tgev Nsp1 Has Implications for Coronavirus Nsp1 Function and Evolution.
pubmed doi rcsb
source organism Porcine transmissible gastroenteritis coronavirus
molecule tags Viral protein
total genus 29
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1000 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3zbdA00
3ZBDA
chains in the Genus database with same CATH superfamily
3M0PA 4M75E 4C5IA 4IUVA 5HK3A 3OYJA 1VIFA 2CYZB 4MZTA 2CZ1B 3A8GB 4EDUA 1M1KC 4PJOB 1N8RC 4AFSC 2R5MA 1JBMA 2F2XA 1I8FA 3CCVT 4Y92A 1QVGS 2DTIA 3QYHB 3C0CA 5GAN2 5J26A 3CCUQ 2X51A 2K5IA 1X01A 5LJ5f 3PMIA 1ARKA 2J6FA 3ULRB 2DNUA 3I9QA 2X9HA 3SWNC 4A4HA 2MWPA 2K3XA 2DYIA 2RPNA 2RB6A 1FMKA 2DA9A 2COWA 2MMPA 1VQ8T 1RLPC 2KI7A 4RUGA 2KT8A 2B86A 3UPUA 4DEXA 2PUOB 1T0JA 4B6MA 4M75B 2CP7A 4HVWA 1SEMA 5J39A 4OP0A 3QJ6A 4BDZA 2V8IA 2GBQA 4TVRA 4BI8B 2DZ9A 1M3CA 4K11A 1JEGA 2ZPFB 2GFAA 2K6DA 4X1VA 1S72T 2QQBA 5CAIA 3G4ST 5GAOp 3NPFA 2VKNA 3OYCA 2X4YA 4ZTFA 5LJ3d 2HSPA 2XICA 2DZCA 4E7HA 2DAQA 2XU8A 3EGXB 3PT9A 2EKOA 4DBFA 4FM4B 2CSIA 4C5EA 1C6VX 1QLYA 2Z0WA 4CC7A 2X4WA 4RTTA 2JS0A 2A0FB 2XHCA 3H0HA 1YHQT 3FIFA 1RAIB 5IT9E 2DKGA 4IIMA 1GBQA 1YJNA 2J05A 3QJYA 2F69A 1TU0B 4QVZA 2EYXA 3ZFJA 3E2UA 3KFVA 1MGQA 1UJYA 1YJWQ 1LCKA 2COZA 4N4GA 3LWIA 1K73C 1EFNA 4EIKA 1ZUKA 2GTJA 1GBRA 3V7SA 2CUDA 4XTYA 4RTWA 4WF2A 2C06A 5KYUB 1VQNA 3JSCA 3H6ZA 5KYYA 4B9WA 1MMDA 3FLGA 3M54A 1KC8U 1ZBJA 3FJ5A 4M77G 3OQ5A 4E7KA 3OYLA 4Q5WA 2KXCA 4IUQA 3EG9A 2RHUA 1NYFA 2RJCA 4LNPA 3UT1A 2ZPHB 3M59A 1BIBA 1K4US 4LXCA 1I5OB 2LRQA 2VXFA 4HVUA 5FRNA 3OS2A 2YRDA 1KHIA 1VQ9Q 4J6WA 1X6GA 2E1HA 3CCMA 3VS0A 2R5AA 1ZUYA 3M4GA 4M78D 4M78G 4PJLA 4JRPA 3JRZA 1GXIE 2OTLQ 3QG1A 3PFSA 2HKQB 1Q7YR 3QBYA 2ATCB 4C0DC 4DEYA 1Q81C 1NJIU 3L2VA 1OU9A 3MP8A 1AHJB 5AYFA 3O5ZA 4F7UE 3O8VA 1K9AA 3M0UA 3HFOA 1MUZA 1XNIA 3RKWA 1N5ZA 4KUIA 1I5LA 1B34A 3CQTA 1GFCA 3THKA 4C8QD 1QVPA 2OTJT 2PTKA 2CP0A 4BDYA 1VQ5A 3PVLA 2DL7A 3N5BB 5KYXB 5LJ3e 1QP2A 2Y90A 1T3LA 3CMEA 3EAEA 2E3HA 3JCMJ 5LJ5h 4BD3A 4L59A 1KFZA 2LX9A 1G83A 2RHIA 3SHWA 2E41A 4PJOC 2LZ6B 3R6NA 3MKDA 3TSZA 4LD6A 4F7UB 1JO8A 5CKEA 3CCEA 2E64A 4QQGA 1QQJA 2DPPB 2FZKB 1VQOA 2RHYA 4PFOA 2DRMA 1OX9A 4LDVA 4OB2B 2DBKA 3VV0A 1OV3A 2ROTA 4M75F 2E3IA 4P5NA 3CBMA 2FO0A 3CMAQ 1TS9A 1IREB 4M7DA 2EYWA 1RAGB 2E5QA 4FYYB 4LUDA 1C0MA 1OI1A 1BBZA 2O31A 1NG2A 2FYKA 2RO0A 3S6WA 1UTIA 2RJFA 4KT0E 2QAZA 3REBB 1ZUUA 1P92A 3OYGA 2ZCFB 4M75C 1Q86U 1WYXA 4C0GA 4PFPA 5GAOl 4ZGJB 2YUQA 1PD1A 1LNXA 3E9FA 2IVWA 1I4K1 4NL2A 2A08A 1OOTA 3MJXA 4II1A 1D0XA 4M7AE 3UF4A 2X35A 1HYOA 5CO7A 1HSQA 1G8XA 2RI3A 3LH5A 2AIRB 4D8KA 3S3NA 4RTYA 2NUPB 2SRCA 2DL5A 2X3WD 2RM4A 3CC4T 3EG3A 5GJVB 2O88A 3L2UA 3ASKA 3I5RA 2FPDA 1W6XA 3JCMg 2E4HA 2BE9B 4C92D 1YIJQ 3RMSA 5KH6A 3J80E 5IHIA 2ZPGB 1M5Q1 2QA4Q 1Y96A 2D8JA 2EYQA 4LE9A 1M30A 2DETA 2MWOA 2ZPBB 2F2VA 1WLPB 3L1AA 3VUBA 1NPRA 1K0SA 3VKIA 1G3YA 1VYVA 2HBPA 4CRIA 4N4HA 1IHWA 1KD1C 1ZX6A 3BE3A 1YJNT 4M7AB 1K1ZA 2DK3A 2YUOA 2OX7A 5GAMh 2ROLA 1R8OB 2QQRA 3BFMA 3C95A 3GLXA 5DM7R 2P0KA 4ELZC 1UDLA 5FU7B 1S1NA 1VQKT 1BI1A 2M1HA 4RCCA 2KRNA 1E7OA 4J9CA 3HP9A 2EKHA 2HQEA 8AT1B 5LJ5j 3PNWC 1GRIA 1A0NB 3PGGA 1VQNT 4O5VA 1QKWA 1TTHB 5LJ5d 1S72A 4PJMA 4QVDA 2FPEA 1WXTA 2CDTA 1N9SA 3G4SA 4PLIA 2CT4A 3QIIA 3CCVQ 2DILA 5D6XA 4X34A 3M53A 1RI0A 5D7UA 3VJPA 1BU1A 4UC4A 4J9EA 4RTUA 1KC8R 1WNLA 2ED1A 1Y57A 4DBHA 2K5LA 5GANg 3DB3A 2FEIA 5IXBA 1VQ7A 1CKAA 2E70A 5L8RE 1Q82U 3CBOA 1N9RA 3A8OB 4C8QA 1PHTA 2EVRA 3PIOA 3LWHA 2RD1A 3LGFA 1QWEA 2DE0X 2I0NA 2A36A 1KSWA 2KEAA 1LOJA 5J3BA 1JRIA 3VRYA 3RKYA 2BTTA 1QCOA 3EFOB 2BKDN 1YWPA 3NTKA 3V8LA 4MDWA 2EPDA 1NJIR 2LJ3A 2FL7A 5HKCA 5GMKe 1UGRB 1VQLA 3L2ZA 4F7UF 3SEMA 2NLUA 2O2OA 1YI2Q 3AHUA 2HQHA 1VQ5T 2PZ1A 4NL3A 2O4XB 2R57A 1NBEB 2DTOA 2KR3A 4DA4A 3CMET 3QUIA 1KJWA 2DL8A 2LC4A 3L2QA 2Y4XA 2D1XA 1PC0A 1ZSZB 3LH0A 1UGQB 3QDFA 2LJ0A 2EJGA 2X4JA 1ZBXA 5GAMg 1RAFB 1UJ0A 1Z9QA 3JCMV 4J7FA 3HSBA 5FU6B 2RQVA 4MDXA 5DLOA 2DXBA 2FG0A 1W2BA 1RLQC 1PKTA 4AMCA 3VS2A 3OW2A 2K2VA 3CD6Q 3HKSA 1M3AA 2R58A 1GCQC 4IUTA 1ABQA 1I1JA 3L2WA 2FRWA 3G71Q 1W2BP 2J6KA 2VVKA 3HFNA 2JM9A 2KQWA 2L8DA 5LJ5e 2CUBA 4C92A 1MMNA 3OW2P 2M9UA 2LVMA 3UA7A 2EFIA 1UGSB 1PG5B 2OTJA 3OS1A 2RQUA 3I55Q 3CC7A 1G5VA 1U1TA 1K9MU 4JRIA 1M2VB 5A0LA 5A2QE 2QEXT 1Q86R 3CCLT 1M9SA 2FHDA 3DLLA 1H92A 1M1KU 3TSWA 1N8RU 4J83A 1HJDA 4LDYA 2M02A 4XU0A 1YCSB 3CPWA 2DXCA 2CT3A 2ECZA 3JCMQ 3CCRT 4PJNA 4M7AF 1MHNA 4JDSA 4CC4B 5GAN4 3I56Q 1VQMT 1KHCA 3CC2T 3SDZA 3OYBA 2K3BA 3CPWP 5HY6A 2EGEA 1WJRA 3G7ZA 3BDUA 1IZ6A 2QDYB 4LD9K 1TSFA 4XU1A 4M7AC 4M77B 3H9NA 4ZNXA 2EGAA 3TREA 2E5KA 1BI3A 2LQKA 1KD1R 1BI2A 3RR6A 3X28B 1NPPA 2EIFA 2QQSA 4F16A 2HZYA 4OMOA 4AG1C 1G2BA 4NOYA 4A63B 5GAN3 5FU7C 2RI2A 5LL6S 4OF1A 3RDVA 3LLRA 3FB9A 4DOVA 5CQXA 1VQPT 2JVVA 3EHRA 3OW2S 4ZN1A 2BUDA 2LT1A 2K57A 3MP1A 1X75C 3RKXA 5D6WA 1YJ9Q 3CCJT 3H8ZA 1V1CA 4M78B 4JZ3A 2COYA 2ED0A 4QT7A 4M7DG 1FMWA 4M7DD 1Q95G 4QQ6A 4RG2A 3EGDB 1V76A 2YHTA 3HL8A 3G6EQ 3CC4A 4ATOA 3OSVA 2DO3A 1WZOA 2ZPIB 2KMTA 2CH4W 1YJWA 4FYWB 4JPBW 1WJSA 2EQJA 4JS5A 5FROA 1DJ7B 2KXDA 3MEVA 5LJ3g 3MEAA 1NE8A 1CSKA 2DLPA 3SD4A 5IHKA 2H8HA 3CPWS 1X43A 2AKLA 2GGRA 3OSSC 5IXFA 4C0FA 1TXQA 2RQRA 1VQ7T 4YTLA 1AWXA 2NYSA 1K73U 1AZEA 1U5SA 1I07A 2V8KA 3UA6A 1RACB 3QSUA 5EG2A 3G1JA 3E1SA 3OMGA 3URGA 2AZSA 4D6WA 2K7AA 1G3TA 1Q82R 1O75A 1SG5A 4ANJA 3CCQT 1VQKA 4OMNA 2PNIA 2HMAA 2FZGB 3OYKA 4JLGA 1E6GA 2YXYA 2K9GA 2CZ7B 2L3QA 2DD4A 1M2OA 4EMGA 5DLQE 1LJOA 1D3BA 3CCST 3GNGA 1MNDA 2D8HA 3SWNA 1VQLT 1JQQA 5A0DA 3JCMW 4EPCA 2KY9A 1H8KA 4AG2C 5GAMf 4E7SA 5IHNA 3JB9G 3JB9D 3OYMA 4PJOD 2NUTB 4J6XA 2ABLA 2CREA 1PSFA 2RNAA 4KGVB 1ZSZC 4XQ3A 4BE0A 2WSEE 5ECAA 2L3PA 4ZTJA 2J7IA 2KGTA 3SB2A 4J8OA 1WX6A 2ZZDA 2DIGA 1JJ2A 3Q1JA 2EJFA 1Q81U 5FU6C 4Y91A 3M56A 5KCOA 5M9OA 2V26A 3V8JA 1M1FA 3S3OA 5D6YA 2RA2A 4XTWA 2PQWA 2A37A 4BY6B 1G3SA 2IG0A 5CVIA 3JCMh 3WVEB 5GMKm 1HD3A 5GJWB 1JJ2P 2KDSA 1M8MA 1WDXA 4ME7A 2RK2A 1WQ7A 3JCMc 4M75D 2CP3A 3EH1A 1TUCA 2QK0A 1PNJA 5CCAA 2VV5A 4ZGEB 3RESA 3RMQA 2VASA 5I11A 3P8BB 1SHGA 2CP5A 4IKFA 3A98A 4J9BA 2MI6A 4C8QG 3CC7T 4ZGDB 5GAOn 1I0CA 2WACA 3EFOA 4F04B 4WTOB 4KUDK 1BYMA 4KGXB 2LCLA 5CKBA 3M0RA 5GAN6 4WCIA 4JRKA 1YN8A 3J7AF 4J9GA 4RCBA 6AT1B 2HSEB 4M77F 1Y71A 2DL3A 3M55A 2DL4A 1K9MR 3CCMQ 4B9XA 3RNJA 1BIAA 2QASA 3M4YA 4EMKC 5CKFA 1M1KR 2XDBA 1R0BG 3WXMB 1VIEA 4MZMA 1N8RR 1NZ9A 2DERA 1RAAB 2DYBA 3CPFA 2RMOA 1NLPC 3GPLA 1YNZA 4OMPA 4M77C 1UGVA 1FYNA 3QYGB 3L42A 4FYXB 3CEYA 2KVQG 2LCSA 1RAEB 3M0QA 2C0IA 4M78F 3META 1UGPB 2M0OA 5GANh 2ZAEA 1W1FA 1TUDA 3FJPA 4A54A 2J6OA 4FL6A 1VQ4Q 4V2SA 2QYZA 4JUVA 1SRMA 1GFDA 2KBTA 1XOVA 2JS2A 5FWCA 1VQ6Q 1LPLA 5L23A 3EFRA 2DXTA 4M78C 2HBWA 5CIUA 2E12A 2QEXA 1AVZC 2GQVA 3LW5E 3CCLA 4AFQC 3PMTA 2JT4A 2RJDA 4FSXA 4N0AC 3FC3A 2V8JA 2OJ2A 2E65A 2DMOA 3TEEA 4C8QF 3H41A 4L6V5 5GAN8 3CCEQ 3JB9I 1Y07A 3CCRA 1AOJA 3A1PA 1VQOQ 1JB0E 2RQTA 3VYHB 2K79A 1YJWT 4C92G 1VQMA 2DVEA 3X26B 2FZCB 3CC2A 3PIPA 2MIOA 2PU9B 1M90C 7AT1B 1M8VA 1U06A 1KD1U 1WA7A 3JCMd 1K8AC 2GCXA 2HD0A 1X69A 2CP6A 5FW9A 3NGPA 2XI9A 2CP2A 2VC8A 2CZ0B 1M27C 2JZ2A 2MF2A 3VRZA 1H641 1K76A 2B8AA 4OMMA 2JTEA 4Y28E 1WJQA 2VYTA 3PTAA 4JLIA 4PJOA 4J9HA 1BKBA 3QXEB 4MZPA 5A0GA 1VQPA 1SRLA 1K73R 1XJWB 1WGSA 4BE1A 4MMLA 2KAFA 3M9QA 1LVKA 3P8DA 2DIQA 2HCKA 3CCJA 1FX7A 5KYYB 1WFWA 3OBYA 4XTUA 1U1SA 2GFUA 2SEMA 4A53A 4GLMA 2F5KA 4PNOA 1VQ9T 2KRMA 4XTXA 1PKSA 3A8LB 4IURA 1YITA 2HL3A 3OYHA 2HDAA 2OTLT 2VXEA 1ABOA 3HRUA 3EG9B 4M75A 5C6SA 2LNHB 4J9IA 4CI0C 4F14A 3UDCA 4OGEA 4ELYC 2JTMA 1SSHA 1U3OA 1EIFA 1QCFA 1TH7A 1T0HA 2K4YA 1VQ8Q 5GANj 4BY6C 1D1AA 1OU8A 1BCOA 5GANd 2KYBA 2L5QA 1UHFA 3GBQA 3UATA 4HT9A 5KE3A 4BI4A 2WSCE 3EGXA 1Q81R 1IHVA 3CCQA 4JJDA 4JJBA 3C94A 2EGCA 1B07A 2DJQA 1S72Q 1QWFA 3F70A 3EHQA 2XDDA 3CCSA 2BE7D 2CS7A 2M0YA 3G4SQ 2DM1A 1B34B 1I81A 2P4RA 1OPKA 4M4ZA 2D0NA 2L3RA 2RF0A 4J5YA 1PSEA 1F1BB 1WHKA 1PD0A 4AFUC 3CMAT 1QVFA 1YHQQ 2AZVA 5C0MA 2HEQA 5KYUA 2MK5A 4KH1B 1WPYA 2DF6A 3QHSA 5DY9A 2GNCA 2AKKA 2QI2A 2DEQA 5I2MA 4E7ZA 3A5ZB 4CC2A 4M7AD 2E6NA 2L2PA 1NYGA 5GAMj 2YSQA 1MMGA 2MPXC 2XIDA 1B7TA 5GAMd 2LX7A 1D1CA 4M7DB 2LQ8A 2FPFA 3MCAB 1RI9A 3LYIA 4JZ4A 4GY5A 2QGFB 4R56A 3KUFA 3GF5A 2HNIA 2A28A 2EYYA 5LJ3h 5CR2A 4BE2A 5FRMA 1SF9A 1D09B 2A3LA 4HCCA 2LT4A 1BCMA 3MPUB 1Q7YC 4J6YA 3I5SA 3FDRA 3ME9A 1YIJT 4C5GA 1FWZA 3JCMf 3VUZA 4JJCA 4M77E 2HQXA 4HCKA 2MAMA 1E6HA 1W4SA 1X6BA 4GLKA 1KIKA 2AT1B 2V1QA 3MEUA 2QA4T 3CCUA 1RL2A 2LNVA 1YP5A 3NTHA 3PVQA 3VS5A 2JUFA 2QG9B 2X3XD 3BY7A 3HRTA 4LDWA 4PL6A 2MCNA 3D7SB 3NTIA 2OAUA 3INZA 3HPWA 1SHFA 5KYXA 1K0XA 9ATCB 4EMHA 3J81E 4M78E 1MMAA 3HHTB 4EMKB 4JRQA 3ER0A 2FVUA 5GAN5 2BZXA 3ZEHA 4QW2A 1D1BA 1Y96B 2ESWA 5KYNA 3QZ9B 3FRNA 5GAOq 2DX1A 5IN1A 2NWMA 5KE2A 3A8MB 3C4SA 3G6EA 1VA7A 2M51A 4F7UA 4Z02A 2OTJQ 1IXDA 5GMKi 3UWNA 3CC7Q 1MV0B 2LQNA 2GQIA 4XU2A 1W2BS 3NFCA 4C8QE 1Y0MA 4DBRA 3QWYA 4A4FA 3REAB 2G6FX 4KGZB 2KYMA 4FU6A 2P84A 4FT4A 4MMKA 3RUXA 4E7JA 4XAXB 5GANf 4ESRA 3X20B 3EH2A 4Z8AA 1GCQA 3M57A 2PVGB 1OULA 3MP6A 3E19A 2IPOB 2OI3A 4A4EA 4FT2A 2EJ9A 4D8DA 3R6OA 2EQMA 2QQAA 5IH2A 2AHJB 3OB9A 2JMCA 1YITT 2PVDB 2JN0A 1M4ZA 2RH2A 4BI3A 1TWBA 1GL5A 1IGUA 1OYXA 4J9FA 3M58A 5GAMe 2KE9A 3EG1A 3M0TA 4CC3A 1RAHB 3JB9J 5CQYA 4JJNK 1C1AA 4AT1B 1NEBA 1TOVA 1M3BA 2D6FA 4QVCA 5CKDA 3MO8A 4C8QB 2NUPA 1O9SA 1AZGB 5LJ3j 1AWJA 4FW1A 1N27A 3OY9A 5CK9A 3OYFA 5HK0A 4KBMB 2YLBA 3VS7A 1BI0A 1YI2T 3M0SA 1AWWA 3OBWA 2H3EB 2DBMA 1OQKA 1XQHA 5I22A 4BB7A 4DOWA 3OYDA 1PRLC 3CC4Q 5KYWB 1RUWA 1WHGA 2O9SA 2VGNA 1VQ9A 1M1GA 2DTHA 4M7AA 4PJJA 5CKHA 3T9NA 1U8RA 3QPHA 2KK4A 3DKMA 2MYSA 2OTLA 4N4IA 3X24B 4LDUA 3JB9H 4XK8E 1GCPA 1QKXA 2MOXA 3EFSA 2JW4A 2D0QB 4PJOG 4HXJA 4C92E 2X4XA 3TQ7P 4RMOA 4M7DF 2VWFA 3KBGA 3CD6T 1KQ1A 4C5HA 1H3HA 2DFUA 1HXDA 1YJNQ 3EGUA 5KCHA 3FEOA 3G71T 3S3MA 2A7YA 1YFNA 3QZ5B 2BZYA 4KH0B 4M77D 5I21A 1D0YA 2XK0A 5GAOm 2QDLA 4M7DC 1PCXA 3QKJA 3I55T 1VQKQ 2OAWA 4PK4A 2LCCA 3CXCA 1KC8C 1YWOA 5GMKh 1TG0A 2EWNA 2K5FA 4OMQA 2RHZA 4E6RA 2XDPA 2KT1A 4M75G 3TU4K 2DVJA 5GAOr 1VQNQ 4LUEA 4BUGA 4FCYA 5FWBA 4RG8A 4RKUE 2JMAA 4C92B 3VS3A 3CXCP 3V8KA 3VS4A 4PFZA 3PE0A 3QDRB 2WSFE 2RJEA 4FSSA 3DLMA 3V7RA 1PM3A 4L5GA 5EC7A 3I56T 1FXXA 5IAYA 3OYNA 3BW1A 4X9DA 2LQWA 3OA6A 3CMAA 1X6OA 4E7IA 2JOYA 5FLXE 4FW2A 4F17A 1NJIC 3CCUT 3GNFB 3JCMX 4DQ2A 3TCJA 1AWOA 3JB9F 3JAME 1AT1B 4PJOF 1VQ4A 1WHHA 2YRCA 3LGLA 1QW1A 3P8HA 2KNBB 4C0ZA 2PVOB 1UECA 3VU3C 2YLCA 1VQ6A 2YWWA 3H0FA 2O4XA 1ZQ1A 2VUBA 4HT8A 4RTXA 2L3SA 4OMFB 2EQKA 1SPKA 2CKKA 1YJ9T 1G3WA 4XTVA 2JXBA 3EG0A 2RK1A 4RTVA 4IUUA 1ZSZA 1JJ2S 3JV3A 2LMJA 1X27A 3G6ET 2M16A 2QQ9A 1W70A 2P0QA 2QTVA 2LTOA 1VQ5Q 2C0TA 1IO6A 3X25B 3E9GA 3CXCS 3V7CA 1YIJA 1VUBA 3CMEQ 3A8HB 2P4TA 2PUKB 4O6JA 3GOXA 2XKOC 2QA4A 3HTRA 1IGQA 2LP5A 2VB6A 5LJ3f 1M90U 1ZLMA 2ENMA 1K8AU 2RHXA 4HA8A 4HCZA 5GMKl 2DJZA 3OMCA 1OEBA 2VGMA 4BACA 2YDLA 3IQLA 1Q86C 1M2VA 2JM8A 2YT6A 1XTDA 5GMKj 1KQSA 4C8QC 3BDLA 1ZA2B 4LN2A 4VUBA 2W10A 4E2FB 3WVDB 2DD5A 2BZ8A 2RN8A 2CSQA 3ZBDA 1J3TA 1KQSP 2GF7A 3CCVA 1FMVA 4GBQA 4EMKA 3OS5A 1PRMC 4A4KA 1ZA1B 2CGHA 3GIBA 2QEXQ 2F5TX 1JXOA 4XU3A 3CCLQ 3RERA 1JXMA 4NS5A 2NUZA 3OYEA 1IB8A 1UHCA 2P0PA 2KROA 1ZHIA 1D3BB 2FB7A 4M77A 2JNGA 1BK2A 1SSFA 1VQ8A 3M5AA 2FRYA 3CCRQ 1ZSGA 3SWNB 4J7IA 4DBQA 2L0AA 4IUPA 2C0OA 2V1RA 2DXUA 1AD5A 2QTXA 2J06A 3U23A 1D0ZA 1YCYA 1VQMQ 3CC2Q 1QMCA 2G3RA 1YBYA 2ZPEB 1QP3A 4OB1B 4F7UG 4Z88A 4AFZC 2O9VA 1NM7A 5LJ5g 1R0CB 1WHMA 2JJ9A 2YUNA 2DEUA 2XD0A 4J9DA 2LDMA 2KSSA 4M78A 1WI7A 1B3QA 4Z89A 2YUPA 1WIEA 3EGDA 4N0AA 2EAYA 3OYYA 4C92F 1MNEA 1NEGA 3JCMb 1N6AA 4A4GA 2RQWA 4HCBA 1VQPQ 5AT1B 4HKEA 1HK9A 2HL5C 1IRXA 1YI2A 4PKCC 3LX7A 2E6ZA 4E47A 2YRVA 4HVVA 1KQSS 3TVTA 3CCJQ 2RI5A 1KG1A 3MEWA 1YHQA 2L89A 1EZZB 3VS1A 4QQDA 2ZGWA 4C92C 3CBPA 2F2WA 1RABB 1RADB 2E10A 2HKNA 4ZN3A 2EYZA 1KK7A 1VYTA 3QO3A 3CCMT 1WHLA 1YITQ 3NMZC 2CH4A 4FIBA 1UE9A 4PLLA 4M7DE 1Q82C 1MV3A 2QGGA 4ORZA 1PWTA 2W0ZA 1UG1A 1TUGB 3VYGA 2K2MA 2F1LA 1WXBA 2AK5A 2GTOA 3CD6A 2HAXA 2KRSA 4XTZA 5GAN7 1H3ZA 3JCMe 1VQ7Q 1OZ3A 8ATCB 5KYWA 1UUEA 3AT1B 1UEBA 4OB0B 3G71A 4X9CA 5I2SA 1NLOC 1Z9ZA 1VQ4T 1QVFP 4QKUA 1JU5C 3HRSA 1UB4A 1X2KA 2Y4YA 1R77A 2O01E 4M7AG 4RTZA 3CCQQ 1T3SA 3I55A 1VQ6T 4JS4A 2NUTA 4FYVB 1OX8A 2D9TA 1ACMB 1SKUB 1VOMA 1QVGA 3DB4A 2XMFA 1WXUA 1BB9A 3CCSQ 1EX4A 1Q7YU 1VQLQ 1KQ2A 3VS6A 3ZL7C 1AEYA 3CCET 4IIOA 3RIRA 1QVGP 2LJ1A 2BIVA 4KULA 1VQOT 4LDXA 4R0KA 3GP8A 3NHNA 1V29B 1X2QA 1UFFA 2H3JA 3I56A 3SFMA 1OZ2A 3H0IA 1Y7XA 1VYUA 2JTFA 2EBPA 2EQUA 4C0DB 3JCMP 4OB3B 4PJOE 2IIMA 4OVAA 2DRKA 3KXTA 3C12A 2K3YA 4E7LA 2XG8D 1WQWA 3MHXA 2CZ6B 4OMLA 2EQIA 3RBBB 1QCNA 5GANe 3OS0A 4KRTA 2QXFA 1WHJA 3I35A 1CKBA 1OPLA 4R55A 3OYAA 3OYIA 3L2RA 1M90R 1QVFS 2I2LA 1K8AR 3QWXX 1YJ9A 3EG2A 4OGCA 2EW3A 1K9MC 5HCKA
chains in the Genus database with same CATH topology
4M75E 4C5IA 4IUVA 5HK3A 3OYJA 3CD6T 1LOJA 3EFRA 2DXTA 4M78C 1KQ1A 1VIFA 4C5HA 5J3BA 2CYZB 2E12A 2CZ1B 3A8GB 4MZTA 5CIUA 4EDUA 2QEXA 2GQVA 3LW5E 1M1KC 3CCLA 1HXDA 4PJOB 3PMTA 1JRIA 2RJDA 4FSXA 4N0AC 2V8JA 5KCHA 3FEOA 3RKYA 3FC3A 2E65A 2A7YA 2R5MA 3QZ5B 4M77D 3G71T 1JBMA 3S3MA 3TEEA 2BKDN 1I8FA 4C8QF 5I21A 3CCVT 4L6V5 3NTKA 2XK0A 3V8LA 5GAN8 5GAOm 3JB9I 1QVGS 2DTIA 1Y07A 3QYHB 4MDWA 3CCRA 4M7DC 5GAN2 5J26A 2K5IA 1X01A 3QKJA 5LJ5f 3I55T 3PMIA 2FL7A 5HKCA 5GMKe 1JB0E 1UGRB 1VQLA 2LCCA 3VYHB 3L2ZA 3CXCA 5GMKh 3SWNC 2EWNA 1YJWT 1KC8C 2K5FA 4A4HA 2MWPA 2K3XA 4C92G 2RHZA 4F7UF 1VQMA 2RB6A 2DVEA 3X26B 2XDPA 3CC2A 3PIPA 2NLUA 4M75G 2MMPA 1VQ8T 2PU9B 3TU4K 1M90C 1M8VA 5GAOr 3AHUA 1KD1U 1VQ5T 4BUGA 3JCMd 1K8AC 4NL3A 2GCXA 2O4XB 2HD0A 2R57A 4RG8A 4RKUE 3UPUA 2DTOA 4C92B 2XI9A 2PUOB 4DA4A 3V8KA 3CMET 3QUIA 2VC8A 2CZ0B 4M75B 3QDRB 2LC4A 2RJEA 2WSFE 2JZ2A 5J39A 3DLMA 3V7RA 2MF2A 1H641 3L2QA 2B8AA 2Y4XA 4L5GA 4OP0A 4Y28E 3QJ6A 1WJQA 3LH0A 2V8IA 1UGQB 4BDZA 4TVRA 2VYTA 3PTAA 4JLIA 4BI8B 3I56T 1FXXA 4PJOA 2DZ9A 5IAYA 2EJGA 1BKBA 2X4JA 3QXEB 3OYNA 2ZPFB 1ZBXA 2GFAA 3BW1A 4MZPA 5GAMg 4X9DA 5A0GA 3OA6A 1S72T 3JCMV 3CMAA 1VQPA 2QQBA 4J7FA 3HSBA 1X6OA 4E7IA 5FU6B 4MDXA 1WGSA 2JOYA 5FLXE 5CAIA 5DLOA 3G4ST 2DXBA 4MMLA 4BE1A 3CCUT 3GNFB 2KAFA 3M9QA 5GAOp 1NJIC 3P8DA 3OYCA 1W2BA 2DIQA 2X4YA 3JCMX 1FX7A 3CCJA 4ZTFA 4DQ2A 5LJ3d 3TCJA 3JB9F 3JAME 2XICA 2DZCA 3OW2A 2K2VA 3OBYA 4E7HA 4XTUA 2DAQA 2XU8A 4PJOF 1VQ4A 3LGLA 3HKSA 3PT9A 1U1SA 2GFUA 2EKOA 2R58A 4A53A 4FM4B 1QW1A 3P8HA 4C5EA 4C0ZA 2F5KA 2PVOB 4IUTA 4PNOA 1VQ9T 4XTXA 3VU3C 3L2WA 2YLCA 1VQ6A 2X4WA 2O4XA 3A8LB 4IURA 2XHCA 1YITA 1ZQ1A 3HFNA 2VUBA 2KQWA 2L8DA 3OYHA 3FIFA 5LJ5e 1YHQT 4HT8A 4C92A 5IT9E 2OTLT 2VXEA 2DKGA 2M9UA 4OMFB 3HRUA 4M75A 2EQKA 2CKKA 2LVMA 5C6SA 2EFIA 1YJNA 1UGSB 1YJ9T 4CI0C 1G3WA 4XTVA 2OTJA 3OS1A 3QJYA 2F69A 4QVZA 3CC7A 2RK1A 3UDCA 3ZFJA 4OGEA 4IUUA 4ELYC 2JTMA 1MGQA 1JJ2S 1G5VA 1U1TA 1K9MU 4JRIA 1EIFA 5A0LA 5A2QE 2QEXT 1TH7A 4N4GA 3LWIA 3G6ET 2M16A 2K4YA 3CCLT 1K73C 1M9SA 2FHDA 2QQ9A 3DLLA 2P0QA 5GANj 2LTOA 1M1KU 4BY6C 1N8RU 3X25B 3E9GA 4J83A 3V7CA 5GANd 3CXCS 4LDYA 2L5QA 3V7SA 4XU0A 3CPWA 1YIJA 1VUBA 4XTYA 2DXCA 4WF2A 3A8HB 4HT9A 2C06A 3JCMQ 3CCRT 2P4TA 3JSCA 1VQNA 3H6ZA 2PUKB 4O6JA 5KE3A 1MHNA 4M7AF 3GOXA 4BI4A 4B9WA 2WSCE 2XKOC 4JDSA 2QA4A 3FLGA 3M54A 3CCQA 5GAN4 1VQMT 1KHCA 1KC8U 3CC2T 3SDZA 3C94A 4M77G 3OYBA 3OQ5A 5LJ3f 5HY6A 4E7KA 1WJRA 3F70A 3OYLA 4Q5WA 3G7ZA 3BDUA 1M90U 2XDDA 1IZ6A 2QDYB 4IUQA 3CCSA 4LD9K 2CS7A 2RHUA 4XU1A 2RHXA 2RJCA 1K8AU 1B34B 4M7AC 1I81A 4M77B 3UT1A 2ZPHB 4HA8A 4HCZA 3TREA 5GMKl 1BI3A 2LQKA 1BIBA 3M59A 1BI2A 2DJZA 3OMCA 2LRQA 2VXFA 3X28B 2VGMA 2L3RA 4BACA 5FRNA 1Q86C 1NPPA 2EIFA 2QQSA 1XTDA 4J5YA 1PSEA 3OS2A 5GMKj 1KHIA 4C8QC 3BDLA 4NOYA 4J6WA 5GAN3 1KQSA 5FU7C 2E1HA 2RI2A 5LL6S 4OF1A 3LLRA 4VUBA 3FB9A 4DOVA 3CCMA 5CQXA 2R5AA 3M4GA 4M78D 4M78G 1VQPT 3CMAT 2JVVA 1QVFA 4JRPA 3JRZA 3WVDB 2DD5A 3OW2S 4ZN1A 1GXIE 2BUDA 2LT1A 5C0MA 2K57A 3QG1A 3PFSA 3MP1A 1X75C 3RKXA 3ZBDA 5D6WA 1WPYA 3QBYA 4C0DC 1Q81C 3QHSA 1NJIU 3CCJT 3H8ZA 5DY9A 3L2VA 3MP8A 2GF7A 4M78B 1AHJB 3CCVA 5AYFA 2QI2A 4F7UE 4EMKA 3OS5A 3O8VA 2DEQA 4M7DD 4A4KA 4M7DG 4QQ6A 4RG2A 3HFOA 5I2MA 2CGHA 3GIBA 2YHTA 3HL8A 3A5ZB 2F5TX 4M7AD 4XU3A 3CC4A 3RERA 1XNIA 3RKWA 4ATOA 2E6NA 4NS5A 3OSVA 2DO3A 5GAMj 4KUIA 2ZPIB 2KMTA 2XIDA 3OYEA 1I5LA 1YJWA 2P0PA 5GAMd 1ZHIA 1B34A 1D3BB 4M7DB 2FB7A 2LQ8A 1WJSA 2EQJA 3MCAB 4M77A 2JNGA 1N8RC 3LYIA 1SSFA 4C8QD 3M5AA 4JS5A 1VQ8A 1QVPA 2OTJT 5FROA 4GY5A 4BDYA 3SWNB 4J7IA 3N5BB 4R56A 1DJ7B 1VQ5A 3KUFA 3GF5A 5LJ3e 1QP2A 2HNIA 2Y90A 4IUPA 5FRMA 5LJ3h 5CR2A 4BE2A 2DXUA 3MEVA 2QTXA 5LJ3g 3MEAA 1NE8A 1YCYA 3CMEA 3SD4A 3CPWS 2G3RA 2A3LA 1YBYA 2ZPEB 4HCCA 3EAEA 3OSSC 1QP3A 4OB1B 4C0FA 2LT4A 4F7UG 1VQ7T 3JCMJ 5LJ5h 4YTLA 4BD3A 1K73U 5LJ5g 1Q7YC 4L59A 4J6YA 2V8KA 3QSUA 2LX9A 3FDRA 3ME9A 5EG2A 2XD0A 1YIJT 2RHIA 4C5GA 1FWZA 2E41A 4PJOC 2LDMA 3JCMf 3VUZA 3E1SA 4M77E 2KSSA 2HQXA 2MAMA 3OMGA 4LD6A 1W4SA 4M78A 3URGA 4D6WA 4F7UB 1G3TA 4GLKA 5CKEA 3CCEA 1O75A 2E64A 4QQGA 2QA4T 3MEUA 3CCUA 4N0AA 1RL2A 2DPPB 2LNVA 3CCQT 2EAYA 3OYYA 4C92F 2RHYA 3NTHA 1VQOA 1VQKA 3JCMb 4LDVA 1N6AA 4OB2B 3VV0A 3OYKA 4JLGA 4M75F 4A4GA 4P5NA 3CBMA 2JUFA 2CZ7B 4HCBA 2DD4A 4EMGA 4HKEA 5DLQE 1IREB 1HK9A 3BY7A 1LJOA 1D3BA 3CCST 4M7DA 3HRTA 4LDWA 4PL6A 1YI2A 2E5QA 3GNGA 4PKCC 3LX7A 1OI1A 2E6ZA 4E47A 2YRVA 3NTIA 2OAUA 3INZA 3HPWA 1KQSS 3SWNA 1VQLT 2RI5A 1KG1A 2FYKA 3MEWA 2RO0A 1YHQA 3S6WA 4EMHA 5A0DA 2L89A 3J81E 4EPCA 2KY9A 3JCMW 4QQDA 4M78E 4JRQA 3HHTB 4EMKB 5GAMf 3ER0A 2ZGWA 2FVUA 4C92C 5GAN5 2RJFA 3CBPA 4KT0E 3JB9G 3JB9D 1P92A 3ZEHA 4QW2A 1Y96B 3OYMA 2ZCFB 2E10A 4M75C 3OYGA 4ZN3A 4PJOD 1Q86U 4C0GA 4J6XA 5GAOl 3QO3A 1PSFA 3QZ9B 4ZGJB 3FRNA 5GAOq 3CCMT 1LNXA 3E9FA 4XQ3A 5IN1A 4BE0A 2IVWA 1I4K1 4FIBA 3A8MB 2WSEE 3C4SA 4PLLA 5KE2A 4NL2A 4M7DE 3G6EA 4ZTJA 4II1A 1Q82C 4F7UA 4Z02A 3SB2A 4M7AE 4J8OA 2ZZDA 5GMKi 2DIGA 1JJ2A 3UWNA 2X35A 5CO7A 3Q1JA 2EJFA 1Q81U 2RI3A 5FU6C 3VYGA 4Y91A 4XU2A 3M56A 5KCOA 5M9OA 3S3NA 3V8JA 1M1FA 1W2BS 2RM4A 3S3OA 5D6YA 2RA2A 3NFCA 4XTWA 2PQWA 4C8QE 3CD6A 2HAXA 3CC4T 4XTZA 4BY6B 5GAN7 1H3ZA 3JCMe 1G3SA 2IG0A 1OZ3A 5CVIA 3JCMh 3WVEB 4A4FA 3L2UA 3ASKA 4FU6A 4FT4A 5GMKm 1UEBA 3JCMg 4OB0B 4C92D 2KDSA 4ME7A 2RK2A 4MMKA 1WQ7A 3G71A 3JCMc 4X9CA 4M75D 5I2SA 3RMSA 3RUXA 5KH6A 4E7JA 4XAXB 5GANf 3J80E 3X20B 2ZPGB 1VQ4T 3HRSA 3M57A 1UB4A 2PVGB 5CCAA 1M5Q1 2Y4YA 2VV5A 3MP6A 4ZGEB 2O01E 3E19A 3RESA 4M7AG 1Y96A 2EYQA 4A4EA 4FT2A 2EJ9A 3RMQA 3I55A 1VQ6T 3R6OA 2EQMA 2QQAA 4JS4A 2AHJB 2MWOA 3OB9A 2ZPBB 3P8BB 1YITT 2D9TA 2PVDB 3L1AA 3VUBA 1NPRA 2JN0A 4IKFA 3VKIA 1G3YA 1QVGA 3DB4A 2HBPA 1M4ZA 4N4HA 4CRIA 2RH2A 1KD1C 4BI3A 2MI6A 4C8QG 1YJNT 1OYXA 4M7AB 3M58A 5GAMe 2DK3A 5GAMh 1Q7YU 3JB9J 5CQYA 1R8OB 4JJNK 3CC7T 4ZGDB 2QQRA 3BFMA 5GAOn 3C95A 1KQ2A 2WACA 3GLXA 5DM7R 2P0KA 4KUDK 3CCET 2D6FA 4QVCA 5CKDA 3MO8A 1BYMA 3RIRA 2LCLA 5CKBA 4C8QB 4ELZC 5GAN6 2BIVA 1O9SA 5FU7B 4KULA 4JRKA 1VQOT 5LJ3j 1VQKT 4LDXA 3J7AF 1N27A 3GP8A 4RCBA 3OY9A 1BI1A 1V29B 2M1HA 4M77F 1Y71A 4RCCA 3M55A 5CK9A 3OYFA 3HP9A 4B9XA 5HK0A 2H3JA 3I56A 3SFMA 1OZ2A 2HQEA 1Y7XA 2JTFA 4KBMB 1BIAA 2YLBA 5LJ5j 3M4YA 3PNWC 4EMKC 2EQUA 1BI0A 1YI2T 3PGGA 5CKFA 4C0DB 1VQNT 4O5VA 3JCMP 1S72A 5LJ5d 3OBWA 4OB3B 2XDBA 4QVDA 3WXMB 1VIEA 4MZMA 4PJOE 4OVAA 1NZ9A 1N9SA 1XQHA 3G4SA 4PLIA 3CPFA 3KXTA 4BB7A 4DOWA 3QIIA 5D6XA 4X34A 3OYDA 3GPLA 3M53A 3C12A 1RI0A 2K3YA 4M77C 4E7LA 2XG8D 1WQWA 3MHXA 2CZ6B 3QYGB 3VJPA 3L42A 3CEYA 2KVQG 2VGNA 4UC4A 5GANe 3OS0A 4M78F 4M7DF 3META 1M1GA 1WNLA 1UGPB 2DTHA 2M0OA 5GANh 5CKHA 1VQ9A 4M7AA 2QXFA 3T9NA 2K5LA 5GANg 3FJPA 4R55A 4A54A 3OYAA 1U8RA 3OYIA 3QPHA 3L2RA 2KK4A 3DB3A 3DKMA 1VQ7A 1QVFS 2E70A 5L8RE 4N4IA 3X24B 4FL6A 4LDUA 2OTLA 4V2SA 3JB9H 4XK8E 2I2LA 1Q82U 3CBOA 1N9RA 3A8OB 3EFSA 4C8QA 4JUVA 2D0QB 1YJ9A 3PIOA 3LWHA 4PJOG 1XOVA 4OGCA 4C92E 2X4XA 2RD1A 4RMOA 3LGFA 1K9MC 3KBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZBD A; 
#chains in the Genus database with same CATH topology
 3M0P A;  4M75 E;  4C5I A;  4IUV A;  5HK3 A;  3OYJ A;  1VIF A;  2CYZ B;  4MZT A;  2CZ1 B;  3A8G B;  4EDU A;  1M1K C;  4PJO B;  1N8R C;  4AFS C;  2R5M A;  1JBM A;  2F2X A;  1I8F A;  3CCV T;  4Y92 A;  1QVG S;  2DTI A;  3QYH B;  3C0C A;  5GAN 2;  5J26 A;  3CCU Q;  2X51 A;  2K5I A;  1X01 A;  5LJ5 f;  3PMI A;  1ARK A;  2J6F A;  3ULR B;  2DNU A;  3I9Q A;  2X9H A;  3SWN C;  4A4H A;  2MWP A;  2K3X A;  2DYI A;  2RPN A;  2RB6 A;  1FMK A;  2DA9 A;  2COW A;  2MMP A;  1VQ8 T;  1RLP C;  2KI7 A;  4RUG A;  2KT8 A;  2B86 A;  3UPU A;  4DEX A;  2PUO B;  1T0J A;  4B6M A;  4M75 B;  2CP7 A;  4HVW A;  1SEM A;  5J39 A;  4OP0 A;  3QJ6 A;  4BDZ A;  2V8I A;  2GBQ A;  4TVR A;  4BI8 B;  2DZ9 A;  1M3C A;  4K11 A;  1JEG A;  2ZPF B;  2GFA A;  2K6D A;  4X1V A;  1S72 T;  2QQB A;  5CAI A;  3G4S T;  5GAO p;  3NPF A;  2VKN A;  3OYC A;  2X4Y A;  4ZTF A;  5LJ3 d;  2HSP A;  2XIC A;  2DZC A;  4E7H A;  2DAQ A;  2XU8 A;  3EGX B;  3PT9 A;  2EKO A;  4DBF A;  4FM4 B;  2CSI A;  4C5E A;  1C6V X;  1QLY A;  2Z0W A;  4CC7 A;  2X4W A;  4RTT A;  2JS0 A;  2A0F B;  2XHC A;  3H0H A;  1YHQ T;  3FIF A;  1RAI B;  5IT9 E;  2DKG A;  4IIM A;  1GBQ A;  1YJN A;  2J05 A;  3QJY A;  2F69 A;  1TU0 B;  4QVZ A;  2EYX A;  3ZFJ A;  3E2U A;  3KFV A;  1MGQ A;  1UJY A;  1YJW Q;  1LCK A;  2COZ A;  4N4G A;  3LWI A;  1K73 C;  1EFN A;  4EIK A;  1ZUK A;  2GTJ A;  1GBR A;  3V7S A;  2CUD A;  4XTY A;  4RTW A;  4WF2 A;  2C06 A;  5KYU B;  1VQN A;  3JSC A;  3H6Z A;  5KYY A;  4B9W A;  1MMD A;  3FLG A;  3M54 A;  1KC8 U;  1ZBJ A;  3FJ5 A;  4M77 G;  3OQ5 A;  4E7K A;  3OYL A;  4Q5W A;  2KXC A;  4IUQ A;  3EG9 A;  2RHU A;  1NYF A;  2RJC A;  4LNP A;  3UT1 A;  2ZPH B;  3M59 A;  1BIB A;  1K4U S;  4LXC A;  1I5O B;  2LRQ A;  2VXF A;  4HVU A;  5FRN A;  3OS2 A;  2YRD A;  1KHI A;  1VQ9 Q;  4J6W A;  1X6G A;  2E1H A;  3CCM A;  3VS0 A;  2R5A A;  1ZUY A;  3M4G A;  4M78 D;  4M78 G;  4PJL A;  4JRP A;  3JRZ A;  1GXI E;  2OTL Q;  3QG1 A;  3PFS A;  2HKQ B;  1Q7Y R;  3QBY A;  2ATC B;  4C0D C;  4DEY A;  1Q81 C;  1NJI U;  3L2V A;  1OU9 A;  3MP8 A;  1AHJ B;  5AYF A;  3O5Z A;  4F7U E;  3O8V A;  1K9A A;  3M0U A;  3HFO A;  1MUZ A;  1XNI A;  3RKW A;  1N5Z A;  4KUI A;  1I5L A;  1B34 A;  3CQT A;  1GFC A;  3THK A;  4C8Q D;  1QVP A;  2OTJ T;  2PTK A;  2CP0 A;  4BDY A;  1VQ5 A;  3PVL A;  2DL7 A;  3N5B B;  5KYX B;  5LJ3 e;  1QP2 A;  2Y90 A;  1T3L A;  3CME A;  3EAE A;  2E3H A;  3JCM J;  5LJ5 h;  4BD3 A;  4L59 A;  1KFZ A;  2LX9 A;  1G83 A;  2RHI A;  3SHW A;  2E41 A;  4PJO C;  2LZ6 B;  3R6N A;  3MKD A;  3TSZ A;  4LD6 A;  4F7U B;  1JO8 A;  5CKE A;  3CCE A;  2E64 A;  4QQG A;  1QQJ A;  2DPP B;  2FZK B;  1VQO A;  2RHY A;  4PFO A;  2DRM A;  1OX9 A;  4LDV A;  4OB2 B;  2DBK A;  3VV0 A;  1OV3 A;  2ROT A;  4M75 F;  2E3I A;  4P5N A;  3CBM A;  2FO0 A;  3CMA Q;  1TS9 A;  1IRE B;  4M7D A;  2EYW A;  1RAG B;  2E5Q A;  4FYY B;  4LUD A;  1C0M A;  1OI1 A;  1BBZ A;  2O31 A;  1NG2 A;  2FYK A;  2RO0 A;  3S6W A;  1UTI A;  2RJF A;  4KT0 E;  2QAZ A;  3REB B;  1ZUU A;  1P92 A;  3OYG A;  2ZCF B;  4M75 C;  1Q86 U;  1WYX A;  4C0G A;  4PFP A;  5GAO l;  4ZGJ B;  2YUQ A;  1PD1 A;  1LNX A;  3E9F A;  2IVW A;  1I4K 1;  4NL2 A;  2A08 A;  1OOT A;  3MJX A;  4II1 A;  1D0X A;  4M7A E;  3UF4 A;  2X35 A;  1HYO A;  5CO7 A;  1HSQ A;  1G8X A;  2RI3 A;  3LH5 A;  2AIR B;  4D8K A;  3S3N A;  4RTY A;  2NUP B;  2SRC A;  2DL5 A;  2X3W D;  2RM4 A;  3CC4 T;  3EG3 A;  5GJV B;  2O88 A;  3L2U A;  3ASK A;  3I5R A;  2FPD A;  1W6X A;  3JCM g;  2E4H A;  2BE9 B;  4C92 D;  1YIJ Q;  3RMS A;  5KH6 A;  3J80 E;  5IHI A;  2ZPG B;  1M5Q 1;  2QA4 Q;  1Y96 A;  2D8J A;  2EYQ A;  4LE9 A;  1M30 A;  2DET A;  2MWO A;  2ZPB B;  2F2V A;  1WLP B;  3L1A A;  3VUB A;  1NPR A;  1K0S A;  3VKI A;  1G3Y A;  1VYV A;  2HBP A;  4CRI A;  4N4H A;  1IHW A;  1KD1 C;  1ZX6 A;  3BE3 A;  1YJN T;  4M7A B;  1K1Z A;  2DK3 A;  2YUO A;  2OX7 A;  5GAM h;  2ROL A;  1R8O B;  2QQR A;  3BFM A;  3C95 A;  3GLX A;  5DM7 R;  2P0K A;  4ELZ C;  1UDL A;  5FU7 B;  1S1N A;  1VQK T;  1BI1 A;  2M1H A;  4RCC A;  2KRN A;  1E7O A;  4J9C A;  3HP9 A;  2EKH A;  2HQE A;  8AT1 B;  5LJ5 j;  3PNW C;  1GRI A;  1A0N B;  3PGG A;  1VQN T;  4O5V A;  1QKW A;  1TTH B;  5LJ5 d;  1S72 A;  4PJM A;  4QVD A;  2FPE A;  1WXT A;  2CDT A;  1N9S A;  3G4S A;  4PLI A;  2CT4 A;  3QII A;  3CCV Q;  2DIL A;  5D6X A;  4X34 A;  3M53 A;  1RI0 A;  5D7U A;  3VJP A;  1BU1 A;  4UC4 A;  4J9E A;  4RTU A;  1KC8 R;  1WNL A;  2ED1 A;  1Y57 A;  4DBH A;  2K5L A;  5GAN g;  3DB3 A;  2FEI A;  5IXB A;  1VQ7 A;  1CKA A;  2E70 A;  5L8R E;  1Q82 U;  3CBO A;  1N9R A;  3A8O B;  4C8Q A;  1PHT A;  2EVR A;  3PIO A;  3LWH A;  2RD1 A;  3LGF A;  1QWE A;  2DE0 X;  2I0N A;  2A36 A;  1KSW A;  2KEA A;  1LOJ A;  5J3B A;  1JRI A;  3VRY A;  3RKY A;  2BTT A;  1QCO A;  3EFO B;  2BKD N;  1YWP A;  3NTK A;  3V8L A;  4MDW A;  2EPD A;  1NJI R;  2LJ3 A;  2FL7 A;  5HKC A;  5GMK e;  1UGR B;  1VQL A;  3L2Z A;  4F7U F;  3SEM A;  2NLU A;  2O2O A;  1YI2 Q;  3AHU A;  2HQH A;  1VQ5 T;  2PZ1 A;  4NL3 A;  2O4X B;  2R57 A;  1NBE B;  2DTO A;  2KR3 A;  4DA4 A;  3CME T;  3QUI A;  1KJW A;  2DL8 A;  2LC4 A;  3L2Q A;  2Y4X A;  2D1X A;  1PC0 A;  1ZSZ B;  3LH0 A;  1UGQ B;  3QDF A;  2LJ0 A;  2EJG A;  2X4J A;  1ZBX A;  5GAM g;  1RAF B;  1UJ0 A;  1Z9Q A;  3JCM V;  4J7F A;  3HSB A;  5FU6 B;  2RQV A;  4MDX A;  5DLO A;  2DXB A;  2FG0 A;  1W2B A;  1RLQ C;  1PKT A;  4AMC A;  3VS2 A;  3OW2 A;  2K2V A;  3CD6 Q;  3HKS A;  1M3A A;  2R58 A;  1GCQ C;  4IUT A;  1ABQ A;  1I1J A;  3L2W A;  2FRW A;  3G71 Q;  1W2B P;  2J6K A;  2VVK A;  3HFN A;  2JM9 A;  2KQW A;  2L8D A;  5LJ5 e;  2CUB A;  4C92 A;  1MMN A;  3OW2 P;  2M9U A;  2LVM A;  3UA7 A;  2EFI A;  1UGS B;  1PG5 B;  2OTJ A;  3OS1 A;  2RQU A;  3I55 Q;  3CC7 A;  1G5V A;  1U1T A;  1K9M U;  4JRI A;  1M2V B;  5A0L A;  5A2Q E;  2QEX T;  1Q86 R;  3CCL T;  1M9S A;  2FHD A;  3DLL A;  1H92 A;  1M1K U;  3TSW A;  1N8R U;  4J83 A;  1HJD A;  4LDY A;  2M02 A;  4XU0 A;  1YCS B;  3CPW A;  2DXC A;  2CT3 A;  2ECZ A;  3JCM Q;  3CCR T;  4PJN A;  4M7A F;  1MHN A;  4JDS A;  4CC4 B;  5GAN 4;  3I56 Q;  1VQM T;  1KHC A;  3CC2 T;  3SDZ A;  3OYB A;  2K3B A;  3CPW P;  5HY6 A;  2EGE A;  1WJR A;  3G7Z A;  3BDU A;  1IZ6 A;  2QDY B;  4LD9 K;  1TSF A;  4XU1 A;  4M7A C;  4M77 B;  3H9N A;  4ZNX A;  2EGA A;  3TRE A;  2E5K A;  1BI3 A;  2LQK A;  1KD1 R;  1BI2 A;  3RR6 A;  3X28 B;  1NPP A;  2EIF A;  2QQS A;  4F16 A;  2HZY A;  4OMO A;  4AG1 C;  1G2B A;  4NOY A;  4A63 B;  5GAN 3;  5FU7 C;  2RI2 A;  5LL6 S;  4OF1 A;  3RDV A;  3LLR A;  3FB9 A;  4DOV A;  5CQX A;  1VQP T;  2JVV A;  3EHR A;  3OW2 S;  4ZN1 A;  2BUD A;  2LT1 A;  2K57 A;  3MP1 A;  1X75 C;  3RKX A;  5D6W A;  1YJ9 Q;  3CCJ T;  3H8Z A;  1V1C A;  4M78 B;  4JZ3 A;  2COY A;  2ED0 A;  4QT7 A;  4M7D G;  1FMW A;  4M7D D;  1Q95 G;  4QQ6 A;  4RG2 A;  3EGD B;  1V76 A;  2YHT A;  3HL8 A;  3G6E Q;  3CC4 A;  4ATO A;  3OSV A;  2DO3 A;  1WZO A;  2ZPI B;  2KMT A;  2CH4 W;  1YJW A;  4FYW B;  4JPB W;  1WJS A;  2EQJ A;  4JS5 A;  5FRO A;  1DJ7 B;  2KXD A;  3MEV A;  5LJ3 g;  3MEA A;  1NE8 A;  1CSK A;  2DLP A;  3SD4 A;  5IHK A;  2H8H A;  3CPW S;  1X43 A;  2AKL A;  2GGR A;  3OSS C;  5IXF A;  4C0F A;  1TXQ A;  2RQR A;  1VQ7 T;  4YTL A;  1AWX A;  2NYS A;  1K73 U;  1AZE A;  1U5S A;  1I07 A;  2V8K A;  3UA6 A;  1RAC B;  3QSU A;  5EG2 A;  3G1J A;  3E1S A;  3OMG A;  3URG A;  2AZS A;  4D6W A;  2K7A A;  1G3T A;  1Q82 R;  1O75 A;  1SG5 A;  4ANJ A;  3CCQ T;  1VQK A;  4OMN A;  2PNI A;  2HMA A;  2FZG B;  3OYK A;  4JLG A;  1E6G A;  2YXY A;  2K9G A;  2CZ7 B;  2L3Q A;  2DD4 A;  1M2O A;  4EMG A;  5DLQ E;  1LJO A;  1D3B A;  3CCS T;  3GNG A;  1MND A;  2D8H A;  3SWN A;  1VQL T;  1JQQ A;  5A0D A;  3JCM W;  4EPC A;  2KY9 A;  1H8K A;  4AG2 C;  5GAM f;  4E7S A;  5IHN A;  3JB9 G;  3JB9 D;  3OYM A;  4PJO D;  2NUT B;  4J6X A;  2ABL A;  2CRE A;  1PSF A;  2RNA A;  4KGV B;  1ZSZ C;  4XQ3 A;  4BE0 A;  2WSE E;  5ECA A;  2L3P A;  4ZTJ A;  2J7I A;  2KGT A;  3SB2 A;  4J8O A;  1WX6 A;  2ZZD A;  2DIG A;  1JJ2 A;  3Q1J A;  2EJF A;  1Q81 U;  5FU6 C;  4Y91 A;  3M56 A;  5KCO A;  5M9O A;  2V26 A;  3V8J A;  1M1F A;  3S3O A;  5D6Y A;  2RA2 A;  4XTW A;  2PQW A;  2A37 A;  4BY6 B;  1G3S A;  2IG0 A;  5CVI A;  3JCM h;  3WVE B;  5GMK m;  1HD3 A;  5GJW B;  1JJ2 P;  2KDS A;  1M8M A;  1WDX A;  4ME7 A;  2RK2 A;  1WQ7 A;  3JCM c;  4M75 D;  2CP3 A;  3EH1 A;  1TUC A;  2QK0 A;  1PNJ A;  5CCA A;  2VV5 A;  4ZGE B;  3RES A;  3RMQ A;  2VAS A;  5I11 A;  3P8B B;  1SHG A;  2CP5 A;  4IKF A;  3A98 A;  4J9B A;  2MI6 A;  4C8Q G;  3CC7 T;  4ZGD B;  5GAO n;  1I0C A;  2WAC A;  3EFO A;  4F04 B;  4WTO B;  4KUD K;  1BYM A;  4KGX B;  2LCL A;  5CKB A;  3M0R A;  5GAN 6;  4WCI A;  4JRK A;  1YN8 A;  3J7A F;  4J9G A;  4RCB A;  6AT1 B;  2HSE B;  4M77 F;  1Y71 A;  2DL3 A;  3M55 A;  2DL4 A;  1K9M R;  3CCM Q;  4B9X A;  3RNJ A;  1BIA A;  2QAS A;  3M4Y A;  4EMK C;  5CKF A;  1M1K R;  2XDB A;  1R0B G;  3WXM B;  1VIE A;  4MZM A;  1N8R R;  1NZ9 A;  2DER A;  1RAA B;  2DYB A;  3CPF A;  2RMO A;  1NLP C;  3GPL A;  1YNZ A;  4OMP A;  4M77 C;  1UGV A;  1FYN A;  3QYG B;  3L42 A;  4FYX B;  3CEY A;  2KVQ G;  2LCS A;  1RAE B;  3M0Q A;  2C0I A;  4M78 F;  3MET A;  1UGP B;  2M0O A;  5GAN h;  2ZAE A;  1W1F A;  1TUD A;  3FJP A;  4A54 A;  2J6O A;  4FL6 A;  1VQ4 Q;  4V2S A;  2QYZ A;  4JUV A;  1SRM A;  1GFD A;  2KBT A;  1XOV A;  2JS2 A;  5FWC A;  1VQ6 Q;  1LPL A;  5L23 A;  3EFR A;  2DXT A;  4M78 C;  2HBW A;  5CIU A;  2E12 A;  2QEX A;  1AVZ C;  2GQV A;  3LW5 E;  3CCL A;  4AFQ C;  3PMT A;  2JT4 A;  2RJD A;  4FSX A;  4N0A C;  3FC3 A;  2V8J A;  2OJ2 A;  2E65 A;  2DMO A;  3TEE A;  4C8Q F;  3H41 A;  4L6V 5;  5GAN 8;  3CCE Q;  3JB9 I;  1Y07 A;  3CCR A;  1AOJ A;  3A1P A;  1VQO Q;  1JB0 E;  2RQT A;  3VYH B;  2K79 A;  1YJW T;  4C92 G;  1VQM A;  2DVE A;  3X26 B;  2FZC B;  3CC2 A;  3PIP A;  2MIO A;  2PU9 B;  1M90 C;  7AT1 B;  1M8V A;  1U06 A;  1KD1 U;  1WA7 A;  3JCM d;  1K8A C;  2GCX A;  2HD0 A;  1X69 A;  2CP6 A;  5FW9 A;  3NGP A;  2XI9 A;  2CP2 A;  2VC8 A;  2CZ0 B;  1M27 C;  2JZ2 A;  2MF2 A;  3VRZ A;  1H64 1;  1K76 A;  2B8A A;  4OMM A;  2JTE A;  4Y28 E;  1WJQ A;  2VYT A;  3PTA A;  4JLI A;  4PJO A;  4J9H A;  1BKB A;  3QXE B;  4MZP A;  5A0G A;  1VQP A;  1SRL A;  1K73 R;  1XJW B;  1WGS A;  4BE1 A;  4MML A;  2KAF A;  3M9Q A;  1LVK A;  3P8D A;  2DIQ A;  2HCK A;  3CCJ A;  1FX7 A;  5KYY B;  1WFW A;  3OBY A;  4XTU A;  1U1S A;  2GFU A;  2SEM A;  4A53 A;  4GLM A;  2F5K A;  4PNO A;  1VQ9 T;  2KRM A;  4XTX A;  1PKS A;  3A8L B;  4IUR A;  1YIT A;  2HL3 A;  3OYH A;  2HDA A;  2OTL T;  2VXE A;  1ABO A;  3HRU A;  3EG9 B;  4M75 A;  5C6S A;  2LNH B;  4J9I A;  4CI0 C;  4F14 A;  3UDC A;  4OGE A;  4ELY C;  2JTM A;  1SSH A;  1U3O A;  1EIF A;  1QCF A;  1TH7 A;  1T0H A;  2K4Y A;  1VQ8 Q;  5GAN j;  4BY6 C;  1D1A A;  1OU8 A;  1BCO A;  5GAN d;  2KYB A;  2L5Q A;  1UHF A;  3GBQ A;  3UAT A;  4HT9 A;  5KE3 A;  4BI4 A;  2WSC E;  3EGX A;  1Q81 R;  1IHV A;  3CCQ A;  4JJD A;  4JJB A;  3C94 A;  2EGC A;  1B07 A;  2DJQ A;  1S72 Q;  1QWF A;  3F70 A;  3EHQ A;  2XDD A;  3CCS A;  2BE7 D;  2CS7 A;  2M0Y A;  3G4S Q;  2DM1 A;  1B34 B;  1I81 A;  2P4R A;  1OPK A;  4M4Z A;  2D0N A;  2L3R A;  2RF0 A;  4J5Y A;  1PSE A;  1F1B B;  1WHK A;  1PD0 A;  4AFU C;  3CMA T;  1QVF A;  1YHQ Q;  2AZV A;  5C0M A;  2HEQ A;  5KYU A;  2MK5 A;  4KH1 B;  1WPY A;  2DF6 A;  3QHS A;  5DY9 A;  2GNC A;  2AKK A;  2QI2 A;  2DEQ A;  5I2M A;  4E7Z A;  3A5Z B;  4CC2 A;  4M7A D;  2E6N A;  2L2P A;  1NYG A;  5GAM j;  2YSQ A;  1MMG A;  2MPX C;  2XID A;  1B7T A;  5GAM d;  2LX7 A;  1D1C A;  4M7D B;  2LQ8 A;  2FPF A;  3MCA B;  1RI9 A;  3LYI A;  4JZ4 A;  4GY5 A;  2QGF B;  4R56 A;  3KUF A;  3GF5 A;  2HNI A;  2A28 A;  2EYY A;  5LJ3 h;  5CR2 A;  4BE2 A;  5FRM A;  1SF9 A;  1D09 B;  2A3L A;  4HCC A;  2LT4 A;  1BCM A;  3MPU B;  1Q7Y C;  4J6Y A;  3I5S A;  3FDR A;  3ME9 A;  1YIJ T;  4C5G A;  1FWZ A;  3JCM f;  3VUZ A;  4JJC A;  4M77 E;  2HQX A;  4HCK A;  2MAM A;  1E6H A;  1W4S A;  1X6B A;  4GLK A;  1KIK A;  2AT1 B;  2V1Q A;  3MEU A;  2QA4 T;  3CCU A;  1RL2 A;  2LNV A;  1YP5 A;  3NTH A;  3PVQ A;  3VS5 A;  2JUF A;  2QG9 B;  2X3X D;  3BY7 A;  3HRT A;  4LDW A;  4PL6 A;  2MCN A;  3D7S B;  3NTI A;  2OAU A;  3INZ A;  3HPW A;  1SHF A;  5KYX A;  1K0X A;  9ATC B;  4EMH A;  3J81 E;  4M78 E;  1MMA A;  3HHT B;  4EMK B;  4JRQ A;  3ER0 A;  2FVU A;  5GAN 5;  2BZX A;  3ZEH A;  4QW2 A;  1D1B A;  1Y96 B;  2ESW A;  5KYN A;  3QZ9 B;  3FRN A;  5GAO q;  2DX1 A;  5IN1 A;  2NWM A;  5KE2 A;  3A8M B;  3C4S A;  3G6E A;  1VA7 A;  2M51 A;  4F7U A;  4Z02 A;  2OTJ Q;  1IXD A;  5GMK i;  3UWN A;  3CC7 Q;  1MV0 B;  2LQN A;  2GQI A;  4XU2 A;  1W2B S;  3NFC A;  4C8Q E;  1Y0M A;  4DBR A;  3QWY A;  4A4F A;  3REA B;  2G6F X;  4KGZ B;  2KYM A;  4FU6 A;  2P84 A;  4FT4 A;  4MMK A;  3RUX A;  4E7J A;  4XAX B;  5GAN f;  4ESR A;  3X20 B;  3EH2 A;  4Z8A A;  1GCQ A;  3M57 A;  2PVG B;  1OUL A;  3MP6 A;  3E19 A;  2IPO B;  2OI3 A;  4A4E A;  4FT2 A;  2EJ9 A;  4D8D A;  3R6O A;  2EQM A;  2QQA A;  5IH2 A;  2AHJ B;  3OB9 A;  2JMC A;  1YIT T;  2PVD B;  2JN0 A;  1M4Z A;  2RH2 A;  4BI3 A;  1TWB A;  1GL5 A;  1IGU A;  1OYX A;  4J9F A;  3M58 A;  5GAM e;  2KE9 A;  3EG1 A;  3M0T A;  4CC3 A;  1RAH B;  3JB9 J;  5CQY A;  4JJN K;  1C1A A;  4AT1 B;  1NEB A;  1TOV A;  1M3B A;  2D6F A;  4QVC A;  5CKD A;  3MO8 A;  4C8Q B;  2NUP A;  1O9S A;  1AZG B;  5LJ3 j;  1AWJ A;  4FW1 A;  1N27 A;  3OY9 A;  5CK9 A;  3OYF A;  5HK0 A;  4KBM B;  2YLB A;  3VS7 A;  1BI0 A;  1YI2 T;  3M0S A;  1AWW A;  3OBW A;  2H3E B;  2DBM A;  1OQK A;  1XQH A;  5I22 A;  4BB7 A;  4DOW A;  3OYD A;  1PRL C;  3CC4 Q;  5KYW B;  1RUW A;  1WHG A;  2O9S A;  2VGN A;  1VQ9 A;  1M1G A;  2DTH A;  4M7A A;  4PJJ A;  5CKH A;  3T9N A;  1U8R A;  3QPH A;  2KK4 A;  3DKM A;  2MYS A;  2OTL A;  4N4I A;  3X24 B;  4LDU A;  3JB9 H;  4XK8 E;  1GCP A;  1QKX A;  2MOX A;  3EFS A;  2JW4 A;  2D0Q B;  4PJO G;  4HXJ A;  4C92 E;  2X4X A;  3TQ7 P;  4RMO A;  4M7D F;  2VWF A;  3KBG A;  3CD6 T;  1KQ1 A;  4C5H A;  1H3H A;  2DFU A;  1HXD A;  1YJN Q;  3EGU A;  5KCH A;  3FEO A;  3G71 T;  3S3M A;  2A7Y A;  1YFN A;  3QZ5 B;  2BZY A;  4KH0 B;  4M77 D;  5I21 A;  1D0Y A;  2XK0 A;  5GAO m;  2QDL A;  4M7D C;  1PCX A;  3QKJ A;  3I55 T;  1VQK Q;  2OAW A;  4PK4 A;  2LCC A;  3CXC A;  1KC8 C;  1YWO A;  5GMK h;  1TG0 A;  2EWN A;  2K5F A;  4OMQ A;  2RHZ A;  4E6R A;  2XDP A;  2KT1 A;  4M75 G;  3TU4 K;  2DVJ A;  5GAO r;  1VQN Q;  4LUE A;  4BUG A;  4FCY A;  5FWB A;  4RG8 A;  4RKU E;  2JMA A;  4C92 B;  3VS3 A;  3CXC P;  3V8K A;  3VS4 A;  4PFZ A;  3PE0 A;  3QDR B;  2WSF E;  2RJE A;  4FSS A;  3DLM A;  3V7R A;  1PM3 A;  4L5G A;  5EC7 A;  3I56 T;  1FXX A;  5IAY A;  3OYN A;  3BW1 A;  4X9D A;  2LQW A;  3OA6 A;  3CMA A;  1X6O A;  4E7I A;  2JOY A;  5FLX E;  4FW2 A;  4F17 A;  1NJI C;  3CCU T;  3GNF B;  3JCM X;  4DQ2 A;  3TCJ A;  1AWO A;  3JB9 F;  3JAM E;  1AT1 B;  4PJO F;  1VQ4 A;  1WHH A;  2YRC A;  3LGL A;  1QW1 A;  3P8H A;  2KNB B;  4C0Z A;  2PVO B;  1UEC A;  3VU3 C;  2YLC A;  1VQ6 A;  2YWW A;  3H0F A;  2O4X A;  1ZQ1 A;  2VUB A;  4HT8 A;  4RTX A;  2L3S A;  4OMF B;  2EQK A;  1SPK A;  2CKK A;  1YJ9 T;  1G3W A;  4XTV A;  2JXB A;  3EG0 A;  2RK1 A;  4RTV A;  4IUU A;  1ZSZ A;  1JJ2 S;  3JV3 A;  2LMJ A;  1X27 A;  3G6E T;  2M16 A;  2QQ9 A;  1W70 A;  2P0Q A;  2QTV A;  2LTO A;  1VQ5 Q;  2C0T A;  1IO6 A;  3X25 B;  3E9G A;  3CXC S;  3V7C A;  1YIJ A;  1VUB A;  3CME Q;  3A8H B;  2P4T A;  2PUK B;  4O6J A;  3GOX A;  2XKO C;  2QA4 A;  3HTR A;  1IGQ A;  2LP5 A;  2VB6 A;  5LJ3 f;  1M90 U;  1ZLM A;  2ENM A;  1K8A U;  2RHX A;  4HA8 A;  4HCZ A;  5GMK l;  2DJZ A;  3OMC A;  1OEB A;  2VGM A;  4BAC A;  2YDL A;  3IQL A;  1Q86 C;  1M2V A;  2JM8 A;  2YT6 A;  1XTD A;  5GMK j;  1KQS A;  4C8Q C;  3BDL A;  1ZA2 B;  4LN2 A;  4VUB A;  2W10 A;  4E2F B;  3WVD B;  2DD5 A;  2BZ8 A;  2RN8 A;  2CSQ A;  3ZBD A;  1J3T A;  1KQS P;  2GF7 A;  3CCV A;  1FMV A;  4GBQ A;  4EMK A;  3OS5 A;  1PRM C;  4A4K A;  1ZA1 B;  2CGH A;  3GIB A;  2QEX Q;  2F5T X;  1JXO A;  4XU3 A;  3CCL Q;  3RER A;  1JXM A;  4NS5 A;  2NUZ A;  3OYE A;  1IB8 A;  1UHC A;  2P0P A;  2KRO A;  1ZHI A;  1D3B B;  2FB7 A;  4M77 A;  2JNG A;  1BK2 A;  1SSF A;  1VQ8 A;  3M5A A;  2FRY A;  3CCR Q;  1ZSG A;  3SWN B;  4J7I A;  4DBQ A;  2L0A A;  4IUP A;  2C0O A;  2V1R A;  2DXU A;  1AD5 A;  2QTX A;  2J06 A;  3U23 A;  1D0Z A;  1YCY A;  1VQM Q;  3CC2 Q;  1QMC A;  2G3R A;  1YBY A;  2ZPE B;  1QP3 A;  4OB1 B;  4F7U G;  4Z88 A;  4AFZ C;  2O9V A;  1NM7 A;  5LJ5 g;  1R0C B;  1WHM A;  2JJ9 A;  2YUN A;  2DEU A;  2XD0 A;  4J9D A;  2LDM A;  2KSS A;  4M78 A;  1WI7 A;  1B3Q A;  4Z89 A;  2YUP A;  1WIE A;  3EGD A;  4N0A A;  2EAY A;  3OYY A;  4C92 F;  1MNE A;  1NEG A;  3JCM b;  1N6A A;  4A4G A;  2RQW A;  4HCB A;  1VQP Q;  5AT1 B;  4HKE A;  1HK9 A;  2HL5 C;  1IRX A;  1YI2 A;  4PKC C;  3LX7 A;  2E6Z A;  4E47 A;  2YRV A;  4HVV A;  1KQS S;  3TVT A;  3CCJ Q;  2RI5 A;  1KG1 A;  3MEW A;  1YHQ A;  2L89 A;  1EZZ B;  3VS1 A;  4QQD A;  2ZGW A;  4C92 C;  3CBP A;  2F2W A;  1RAB B;  1RAD B;  2E10 A;  2HKN A;  4ZN3 A;  2EYZ A;  1KK7 A;  1VYT A;  3QO3 A;  3CCM T;  1WHL A;  1YIT Q;  3NMZ C;  2CH4 A;  4FIB A;  1UE9 A;  4PLL A;  4M7D E;  1Q82 C;  1MV3 A;  2QGG A;  4ORZ A;  1PWT A;  2W0Z A;  1UG1 A;  1TUG B;  3VYG A;  2K2M A;  2F1L A;  1WXB A;  2AK5 A;  2GTO A;  3CD6 A;  2HAX A;  2KRS A;  4XTZ A;  5GAN 7;  1H3Z A;  3JCM e;  1VQ7 Q;  1OZ3 A;  8ATC B;  5KYW A;  1UUE A;  3AT1 B;  1UEB A;  4OB0 B;  3G71 A;  4X9C A;  5I2S A;  1NLO C;  1Z9Z A;  1VQ4 T;  1QVF P;  4QKU A;  1JU5 C;  3HRS A;  1UB4 A;  1X2K A;  2Y4Y A;  1R77 A;  2O01 E;  4M7A G;  4RTZ A;  3CCQ Q;  1T3S A;  3I55 A;  1VQ6 T;  4JS4 A;  2NUT A;  4FYV B;  1OX8 A;  2D9T A;  1ACM B;  1SKU B;  1VOM A;  1QVG A;  3DB4 A;  2XMF A;  1WXU A;  1BB9 A;  3CCS Q;  1EX4 A;  1Q7Y U;  1VQL Q;  1KQ2 A;  3VS6 A;  3ZL7 C;  1AEY A;  3CCE T;  4IIO A;  3RIR A;  1QVG P;  2LJ1 A;  2BIV A;  4KUL A;  1VQO T;  4LDX A;  4R0K A;  3GP8 A;  3NHN A;  1V29 B;  1X2Q A;  1UFF A;  2H3J A;  3I56 A;  3SFM A;  1OZ2 A;  3H0I A;  1Y7X A;  1VYU A;  2JTF A;  2EBP A;  2EQU A;  4C0D B;  3JCM P;  4OB3 B;  4PJO E;  2IIM A;  4OVA A;  2DRK A;  3KXT A;  3C12 A;  2K3Y A;  4E7L A;  2XG8 D;  1WQW A;  3MHX A;  2CZ6 B;  4OML A;  2EQI A;  3RBB B;  1QCN A;  5GAN e;  3OS0 A;  4KRT A;  2QXF A;  1WHJ A;  3I35 A;  1CKB A;  1OPL A;  4R55 A;  3OYA A;  3OYI A;  3L2R A;  1M90 R;  1QVF S;  2I2L A;  1K8A R;  3QWX X;  1YJ9 A;  3EG2 A;  4OGC A;  2EW3 A;  1K9M C;  5HCK A; 
#chains in the Genus database with same CATH homology
 4M75 E;  4C5I A;  4IUV A;  5HK3 A;  3OYJ A;  3CD6 T;  1LOJ A;  3EFR A;  2DXT A;  4M78 C;  1KQ1 A;  1VIF A;  4C5H A;  5J3B A;  2CYZ B;  2E12 A;  2CZ1 B;  3A8G B;  4MZT A;  5CIU A;  4EDU A;  2QEX A;  2GQV A;  3LW5 E;  1M1K C;  3CCL A;  1HXD A;  4PJO B;  3PMT A;  1JRI A;  2RJD A;  4FSX A;  4N0A C;  2V8J A;  5KCH A;  3FEO A;  3RKY A;  3FC3 A;  2E65 A;  2A7Y A;  2R5M A;  3QZ5 B;  4M77 D;  3G71 T;  1JBM A;  3S3M A;  3TEE A;  2BKD N;  1I8F A;  4C8Q F;  5I21 A;  3CCV T;  4L6V 5;  3NTK A;  2XK0 A;  3V8L A;  5GAN 8;  5GAO m;  3JB9 I;  1QVG S;  2DTI A;  1Y07 A;  3QYH B;  4MDW A;  3CCR A;  4M7D C;  5GAN 2;  5J26 A;  2K5I A;  1X01 A;  3QKJ A;  5LJ5 f;  3I55 T;  3PMI A;  2FL7 A;  5HKC A;  5GMK e;  1JB0 E;  1UGR B;  1VQL A;  2LCC A;  3VYH B;  3L2Z A;  3CXC A;  5GMK h;  3SWN C;  2EWN A;  1YJW T;  1KC8 C;  2K5F A;  4A4H A;  2MWP A;  2K3X A;  4C92 G;  2RHZ A;  4F7U F;  1VQM A;  2RB6 A;  2DVE A;  3X26 B;  2XDP A;  3CC2 A;  3PIP A;  2NLU A;  4M75 G;  2MMP A;  1VQ8 T;  2PU9 B;  3TU4 K;  1M90 C;  1M8V A;  5GAO r;  3AHU A;  1KD1 U;  1VQ5 T;  4BUG A;  3JCM d;  1K8A C;  4NL3 A;  2GCX A;  2O4X B;  2HD0 A;  2R57 A;  4RG8 A;  4RKU E;  3UPU A;  2DTO A;  4C92 B;  2XI9 A;  2PUO B;  4DA4 A;  3V8K A;  3CME T;  3QUI A;  2VC8 A;  2CZ0 B;  4M75 B;  3QDR B;  2LC4 A;  2RJE A;  2WSF E;  2JZ2 A;  5J39 A;  3DLM A;  3V7R A;  2MF2 A;  1H64 1;  3L2Q A;  2B8A A;  2Y4X A;  4L5G A;  4OP0 A;  4Y28 E;  3QJ6 A;  1WJQ A;  3LH0 A;  2V8I A;  1UGQ B;  4BDZ A;  4TVR A;  2VYT A;  3PTA A;  4JLI A;  4BI8 B;  3I56 T;  1FXX A;  4PJO A;  2DZ9 A;  5IAY A;  2EJG A;  1BKB A;  2X4J A;  3QXE B;  3OYN A;  2ZPF B;  1ZBX A;  2GFA A;  3BW1 A;  4MZP A;  5GAM g;  4X9D A;  5A0G A;  3OA6 A;  1S72 T;  3JCM V;  3CMA A;  1VQP A;  2QQB A;  4J7F A;  3HSB A;  1X6O A;  4E7I A;  5FU6 B;  4MDX A;  1WGS A;  2JOY A;  5FLX E;  5CAI A;  5DLO A;  3G4S T;  2DXB A;  4MML A;  4BE1 A;  3CCU T;  3GNF B;  2KAF A;  3M9Q A;  5GAO p;  1NJI C;  3P8D A;  3OYC A;  1W2B A;  2DIQ A;  2X4Y A;  3JCM X;  1FX7 A;  3CCJ A;  4ZTF A;  4DQ2 A;  5LJ3 d;  3TCJ A;  3JB9 F;  3JAM E;  2XIC A;  2DZC A;  3OW2 A;  2K2V A;  3OBY A;  4E7H A;  4XTU A;  2DAQ A;  2XU8 A;  4PJO F;  1VQ4 A;  3LGL A;  3HKS A;  3PT9 A;  1U1S A;  2GFU A;  2EKO A;  2R58 A;  4A53 A;  4FM4 B;  1QW1 A;  3P8H A;  4C5E A;  4C0Z A;  2F5K A;  2PVO B;  4IUT A;  4PNO A;  1VQ9 T;  4XTX A;  3VU3 C;  3L2W A;  2YLC A;  1VQ6 A;  2X4W A;  2O4X A;  3A8L B;  4IUR A;  2XHC A;  1YIT A;  1ZQ1 A;  3HFN A;  2VUB A;  2KQW A;  2L8D A;  3OYH A;  3FIF A;  5LJ5 e;  1YHQ T;  4HT8 A;  4C92 A;  5IT9 E;  2OTL T;  2VXE A;  2DKG A;  2M9U A;  4OMF B;  3HRU A;  4M75 A;  2EQK A;  2CKK A;  2LVM A;  5C6S A;  2EFI A;  1YJN A;  1UGS B;  1YJ9 T;  4CI0 C;  1G3W A;  4XTV A;  2OTJ A;  3OS1 A;  3QJY A;  2F69 A;  4QVZ A;  3CC7 A;  2RK1 A;  3UDC A;  3ZFJ A;  4OGE A;  4IUU A;  4ELY C;  2JTM A;  1MGQ A;  1JJ2 S;  1G5V A;  1U1T A;  1K9M U;  4JRI A;  1EIF A;  5A0L A;  5A2Q E;  2QEX T;  1TH7 A;  4N4G A;  3LWI A;  3G6E T;  2M16 A;  2K4Y A;  3CCL T;  1K73 C;  1M9S A;  2FHD A;  2QQ9 A;  3DLL A;  2P0Q A;  5GAN j;  2LTO A;  1M1K U;  4BY6 C;  1N8R U;  3X25 B;  3E9G A;  4J83 A;  3V7C A;  5GAN d;  3CXC S;  4LDY A;  2L5Q A;  3V7S A;  4XU0 A;  3CPW A;  1YIJ A;  1VUB A;  4XTY A;  2DXC A;  4WF2 A;  3A8H B;  4HT9 A;  2C06 A;  3JCM Q;  3CCR T;  2P4T A;  3JSC A;  1VQN A;  3H6Z A;  2PUK B;  4O6J A;  5KE3 A;  1MHN A;  4M7A F;  3GOX A;  4BI4 A;  4B9W A;  2WSC E;  2XKO C;  4JDS A;  2QA4 A;  3FLG A;  3M54 A;  3CCQ A;  5GAN 4;  1VQM T;  1KHC A;  1KC8 U;  3CC2 T;  3SDZ A;  3C94 A;  4M77 G;  3OYB A;  3OQ5 A;  5LJ3 f;  5HY6 A;  4E7K A;  1WJR A;  3F70 A;  3OYL A;  4Q5W A;  3G7Z A;  3BDU A;  1M90 U;  2XDD A;  1IZ6 A;  2QDY B;  4IUQ A;  3CCS A;  4LD9 K;  2CS7 A;  2RHU A;  4XU1 A;  2RHX A;  2RJC A;  1K8A U;  1B34 B;  4M7A C;  1I81 A;  4M77 B;  3UT1 A;  2ZPH B;  4HA8 A;  4HCZ A;  3TRE A;  5GMK l;  1BI3 A;  2LQK A;  1BIB A;  3M59 A;  1BI2 A;  2DJZ A;  3OMC A;  2LRQ A;  2VXF A;  3X28 B;  2VGM A;  2L3R A;  4BAC A;  5FRN A;  1Q86 C;  1NPP A;  2EIF A;  2QQS A;  1XTD A;  4J5Y A;  1PSE A;  3OS2 A;  5GMK j;  1KHI A;  4C8Q C;  3BDL A;  4NOY A;  4J6W A;  5GAN 3;  1KQS A;  5FU7 C;  2E1H A;  2RI2 A;  5LL6 S;  4OF1 A;  3LLR A;  4VUB A;  3FB9 A;  4DOV A;  3CCM A;  5CQX A;  2R5A A;  3M4G A;  4M78 D;  4M78 G;  1VQP T;  3CMA T;  2JVV A;  1QVF A;  4JRP A;  3JRZ A;  3WVD B;  2DD5 A;  3OW2 S;  4ZN1 A;  1GXI E;  2BUD A;  2LT1 A;  5C0M A;  2K57 A;  3QG1 A;  3PFS A;  3MP1 A;  1X75 C;  3RKX A;  3ZBD A;  5D6W A;  1WPY A;  3QBY A;  4C0D C;  1Q81 C;  3QHS A;  1NJI U;  3CCJ T;  3H8Z A;  5DY9 A;  3L2V A;  3MP8 A;  2GF7 A;  4M78 B;  1AHJ B;  3CCV A;  5AYF A;  2QI2 A;  4F7U E;  4EMK A;  3OS5 A;  3O8V A;  2DEQ A;  4M7D D;  4A4K A;  4M7D G;  4QQ6 A;  4RG2 A;  3HFO A;  5I2M A;  2CGH A;  3GIB A;  2YHT A;  3HL8 A;  3A5Z B;  2F5T X;  4M7A D;  4XU3 A;  3CC4 A;  3RER A;  1XNI A;  3RKW A;  4ATO A;  2E6N A;  4NS5 A;  3OSV A;  2DO3 A;  5GAM j;  4KUI A;  2ZPI B;  2KMT A;  2XID A;  3OYE A;  1I5L A;  1YJW A;  2P0P A;  5GAM d;  1ZHI A;  1B34 A;  1D3B B;  4M7D B;  2FB7 A;  2LQ8 A;  1WJS A;  2EQJ A;  3MCA B;  4M77 A;  2JNG A;  1N8R C;  3LYI A;  1SSF A;  4C8Q D;  3M5A A;  4JS5 A;  1VQ8 A;  1QVP A;  2OTJ T;  5FRO A;  4GY5 A;  4BDY A;  3SWN B;  4J7I A;  3N5B B;  4R56 A;  1DJ7 B;  1VQ5 A;  3KUF A;  3GF5 A;  5LJ3 e;  1QP2 A;  2HNI A;  2Y90 A;  4IUP A;  5FRM A;  5LJ3 h;  5CR2 A;  4BE2 A;  2DXU A;  3MEV A;  2QTX A;  5LJ3 g;  3MEA A;  1NE8 A;  1YCY A;  3CME A;  3SD4 A;  3CPW S;  2G3R A;  2A3L A;  1YBY A;  2ZPE B;  4HCC A;  3EAE A;  3OSS C;  1QP3 A;  4OB1 B;  4C0F A;  2LT4 A;  4F7U G;  1VQ7 T;  3JCM J;  5LJ5 h;  4YTL A;  4BD3 A;  1K73 U;  5LJ5 g;  1Q7Y C;  4L59 A;  4J6Y A;  2V8K A;  3QSU A;  2LX9 A;  3FDR A;  3ME9 A;  5EG2 A;  2XD0 A;  1YIJ T;  2RHI A;  4C5G A;  1FWZ A;  2E41 A;  4PJO C;  2LDM A;  3JCM f;  3VUZ A;  3E1S A;  4M77 E;  2KSS A;  2HQX A;  2MAM A;  3OMG A;  4LD6 A;  1W4S A;  4M78 A;  3URG A;  4D6W A;  4F7U B;  1G3T A;  4GLK A;  5CKE A;  3CCE A;  1O75 A;  2E64 A;  4QQG A;  2QA4 T;  3MEU A;  3CCU A;  4N0A A;  1RL2 A;  2DPP B;  2LNV A;  3CCQ T;  2EAY A;  3OYY A;  4C92 F;  2RHY A;  3NTH A;  1VQO A;  1VQK A;  3JCM b;  4LDV A;  1N6A A;  4OB2 B;  3VV0 A;  3OYK A;  4JLG A;  4M75 F;  4A4G A;  4P5N A;  3CBM A;  2JUF A;  2CZ7 B;  4HCB A;  2DD4 A;  4EMG A;  4HKE A;  5DLQ E;  1IRE B;  1HK9 A;  3BY7 A;  1LJO A;  1D3B A;  3CCS T;  4M7D A;  3HRT A;  4LDW A;  4PL6 A;  1YI2 A;  2E5Q A;  3GNG A;  4PKC C;  3LX7 A;  1OI1 A;  2E6Z A;  4E47 A;  2YRV A;  3NTI A;  2OAU A;  3INZ A;  3HPW A;  1KQS S;  3SWN A;  1VQL T;  2RI5 A;  1KG1 A;  2FYK A;  3MEW A;  2RO0 A;  1YHQ A;  3S6W A;  4EMH A;  5A0D A;  2L89 A;  3J81 E;  4EPC A;  2KY9 A;  3JCM W;  4QQD A;  4M78 E;  4JRQ A;  3HHT B;  4EMK B;  5GAM f;  3ER0 A;  2ZGW A;  2FVU A;  4C92 C;  5GAN 5;  2RJF A;  3CBP A;  4KT0 E;  3JB9 G;  3JB9 D;  1P92 A;  3ZEH A;  4QW2 A;  1Y96 B;  3OYM A;  2ZCF B;  2E10 A;  4M75 C;  3OYG A;  4ZN3 A;  4PJO D;  1Q86 U;  4C0G A;  4J6X A;  5GAO l;  3QO3 A;  1PSF A;  3QZ9 B;  4ZGJ B;  3FRN A;  5GAO q;  3CCM T;  1LNX A;  3E9F A;  4XQ3 A;  5IN1 A;  4BE0 A;  2IVW A;  1I4K 1;  4FIB A;  3A8M B;  2WSE E;  3C4S A;  4PLL A;  5KE2 A;  4NL2 A;  4M7D E;  3G6E A;  4ZTJ A;  4II1 A;  1Q82 C;  4F7U A;  4Z02 A;  3SB2 A;  4M7A E;  4J8O A;  2ZZD A;  5GMK i;  2DIG A;  1JJ2 A;  3UWN A;  2X35 A;  5CO7 A;  3Q1J A;  2EJF A;  1Q81 U;  2RI3 A;  5FU6 C;  3VYG A;  4Y91 A;  4XU2 A;  3M56 A;  5KCO A;  5M9O A;  3S3N A;  3V8J A;  1M1F A;  1W2B S;  2RM4 A;  3S3O A;  5D6Y A;  2RA2 A;  3NFC A;  4XTW A;  2PQW A;  4C8Q E;  3CD6 A;  2HAX A;  3CC4 T;  4XTZ A;  4BY6 B;  5GAN 7;  1H3Z A;  3JCM e;  1G3S A;  2IG0 A;  1OZ3 A;  5CVI A;  3JCM h;  3WVE B;  4A4F A;  3L2U A;  3ASK A;  4FU6 A;  4FT4 A;  5GMK m;  1UEB A;  3JCM g;  4OB0 B;  4C92 D;  2KDS A;  4ME7 A;  2RK2 A;  4MMK A;  1WQ7 A;  3G71 A;  3JCM c;  4X9C A;  4M75 D;  5I2S A;  3RMS A;  3RUX A;  5KH6 A;  4E7J A;  4XAX B;  5GAN f;  3J80 E;  3X20 B;  2ZPG B;  1VQ4 T;  3HRS A;  3M57 A;  1UB4 A;  2PVG B;  5CCA A;  1M5Q 1;  2Y4Y A;  2VV5 A;  3MP6 A;  4ZGE B;  2O01 E;  3E19 A;  3RES A;  4M7A G;  1Y96 A;  2EYQ A;  4A4E A;  4FT2 A;  2EJ9 A;  3RMQ A;  3I55 A;  1VQ6 T;  3R6O A;  2EQM A;  2QQA A;  4JS4 A;  2AHJ B;  2MWO A;  3OB9 A;  2ZPB B;  3P8B B;  1YIT T;  2D9T A;  2PVD B;  3L1A A;  3VUB A;  1NPR A;  2JN0 A;  4IKF A;  3VKI A;  1G3Y A;  1QVG A;  3DB4 A;  2HBP A;  1M4Z A;  4N4H A;  4CRI A;  2RH2 A;  1KD1 C;  4BI3 A;  2MI6 A;  4C8Q G;  1YJN T;  1OYX A;  4M7A B;  3M58 A;  5GAM e;  2DK3 A;  5GAM h;  1Q7Y U;  3JB9 J;  5CQY A;  1R8O B;  4JJN K;  3CC7 T;  4ZGD B;  2QQR A;  3BFM A;  5GAO n;  3C95 A;  1KQ2 A;  2WAC A;  3GLX A;  5DM7 R;  2P0K A;  4KUD K;  3CCE T;  2D6F A;  4QVC A;  5CKD A;  3MO8 A;  1BYM A;  3RIR A;  2LCL A;  5CKB A;  4C8Q B;  4ELZ C;  5GAN 6;  2BIV A;  1O9S A;  5FU7 B;  4KUL A;  4JRK A;  1VQO T;  5LJ3 j;  1VQK T;  4LDX A;  3J7A F;  1N27 A;  3GP8 A;  4RCB A;  3OY9 A;  1BI1 A;  1V29 B;  2M1H A;  4M77 F;  1Y71 A;  4RCC A;  3M55 A;  5CK9 A;  3OYF A;  3HP9 A;  4B9X A;  5HK0 A;  2H3J A;  3I56 A;  3SFM A;  1OZ2 A;  2HQE A;  1Y7X A;  2JTF A;  4KBM B;  1BIA A;  2YLB A;  5LJ5 j;  3M4Y A;  3PNW C;  4EMK C;  2EQU A;  1BI0 A;  1YI2 T;  3PGG A;  5CKF A;  4C0D B;  1VQN T;  4O5V A;  3JCM P;  1S72 A;  5LJ5 d;  3OBW A;  4OB3 B;  2XDB A;  4QVD A;  3WXM B;  1VIE A;  4MZM A;  4PJO E;  4OVA A;  1NZ9 A;  1N9S A;  1XQH A;  3G4S A;  4PLI A;  3CPF A;  3KXT A;  4BB7 A;  4DOW A;  3QII A;  5D6X A;  4X34 A;  3OYD A;  3GPL A;  3M53 A;  3C12 A;  1RI0 A;  2K3Y A;  4M77 C;  4E7L A;  2XG8 D;  1WQW A;  3MHX A;  2CZ6 B;  3QYG B;  3VJP A;  3L42 A;  3CEY A;  2KVQ G;  2VGN A;  4UC4 A;  5GAN e;  3OS0 A;  4M78 F;  4M7D F;  3MET A;  1M1G A;  1WNL A;  1UGP B;  2DTH A;  2M0O A;  5GAN h;  5CKH A;  1VQ9 A;  4M7A A;  2QXF A;  3T9N A;  2K5L A;  5GAN g;  3FJP A;  4R55 A;  4A54 A;  3OYA A;  1U8R A;  3OYI A;  3QPH A;  3L2R A;  2KK4 A;  3DB3 A;  3DKM A;  1VQ7 A;  1QVF S;  2E70 A;  5L8R E;  4N4I A;  3X24 B;  4FL6 A;  4LDU A;  2OTL A;  4V2S A;  3JB9 H;  4XK8 E;  2I2L A;  1Q82 U;  3CBO A;  1N9R A;  3A8O B;  3EFS A;  4C8Q A;  4JUV A;  2D0Q B;  1YJ9 A;  3PIO A;  3LWH A;  4PJO G;  1XOV A;  4OGC A;  4C92 E;  2X4X A;  2RD1 A;  4RMO A;  3LGF A;  1K9M C;  3KBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...