3ZBDA

Structure of tgev nsp1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
HHHHHMSSKQFKILVNEDYQVNVPSLPIRDVLQEIKYCYRNGFEGYVFVPEYCRDLVDCDRKDHYVIGVLGNGVSDLKPVLLTEPSVMLQGFIVRANCNGVLEDFDLKIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-STRUCTURAL PROTEIN 1
publication title Structure of Alphacoronavirus Tgev Nsp1 Has Implications for Coronavirus Nsp1 Function and Evolution.
pubmed doi rcsb
source organism Porcine transmissible gastroenteritis coronavirus
molecule tags Viral protein
total genus 29
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1000 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3zbdA00
3ZBDA
chains in the Genus database with same CATH superfamily
1U3OA 3PFSA 1TG0A 3NPFA 2DTOA 2M16A 3V7CA 1NEGA 3VS2A 4LDVA 2J7IA 3OQ5A 4J9FA 2E6ZA 5FWBA 4A4FA 4KGVB 1VQ6A 4JRKA 2WSFE 4PJOB 1RACB 2A37A 2CT3A 2KRMA 2P84A 4VUBA 1D09B 2YXYA 2L5QA 2PNIA 1UGVA 5IXBA 4C92A 2P0KA 1KJWA 2E5KA 3M53A 2DXTA 4PJMA 5GJWB 2HL5C 1KD1R 3TSZA 2ENMA 4II1A 3I5RA 5IHNA 2HBPA 1OEBA 3CPFA 3FEOA 3SD4A 1AWOA 4M7DE 4PJNA 4DEYA 2KXCA 3BDLA 4GLMA 2E65A 1Q86R 3NTHA 5FU7C 4N4GA 1Q82C 1X2KA 1ZSZB 1I81A 4QQDA 1S72Q 3L1AA 3CMAT 2H3JA 4D6WA 4EMKB 1T0JA 5HK3A 4GBQA 4JRQA 1S72A 1VQNT 1K9AA 4C8QG 4EIKA 2YLCA 1X69A 4JRIA 2E3HA 2P4TA 4J9DA 3FB9A 1NM7A 3S3NA 2HD0A 4B9XA 3CCET 2FZKB 4MZTA 2F5KA 3KUFA 5KCOA 2COYA 3X28B 1GXIE 3CPWS 2PZ1A 2EWNA 3JCMd 2PQWA 3QYGB 1BBZA 3BW1A 4QQ6A 4C0DB 4JRPA 1K9MC 3G7ZA 4X9DA 4OMFB 1U1TA 1RAIB 1TWBA 4PJOE 2D6FA 2K5IA 1WGSA 4M78G 3RERA 3LH5A 2Y90A 2C0IA 4OMPA 2F1LA 3EHQA 4V2SA 1NBEB 4FU6A 3HRSA 3EG2A 1ZSZC 2CYZB 2DXCA 3FJ5A 2JNGA 1BK2A 1N9SA 2DERA 4M75A 4HXJA 3CBPA 2K2VA 5DLOA 4C5HA 3OYIA 3J80E 2EVRA 3NFCA 2JTEA 4FW2A 3M9QA 1WQWA 1BB9A 2QDYB 4UC4A 3TU4K 3QZ9B 3HTRA 4JDSA 2KDSA 2FL7A 3VS3A 2D8HA 2E3IA 4AFUC 4KBMB 4ATOA 4QVZA 1KD1C 5A0GA 4J83A 4E7SA 1RAGB 2CSQA 1QP3A 2QG9B 2RN8A 1Q86C 5CKDA 2FVUA 2K7AA 3MO8A 2D1XA 1WI7A 2BTTA 3CXCP 3OYJA 5A2QE 1VQ4Q 2R57A 2DL5A 1B7TA 1NYGA 4HT8A 4E47A 1VQ4A 4C92B 1VQ5T 1G5VA 1OPKA 3H0FA 5CQYA 3OW2P 3JB9H 1IHWA 3QDRB 2G3RA 2ZZDA 1QW1A 2SRCA 4JJBA 5KCHA 4XTZA 3JCMb 1LPLA 1ZUKA 2CZ7B 4J9CA 3EFRA 3QIIA 1N6AA 4E7LA 4M78A 2DBKA 3I9QA 3CCRT 1J3TA 5KYYA 2GGRA 3PVQA 3GNFB 3EHRA 4RUGA 2L3PA 2YSQA 2RHIA 1WHKA 1WHLA 1OULA 3M0RA 1K76A 1Y71A 3VS5A 2M0YA 1PC0A 2ZGWA 1CKBA 4R0KA 3OSSC 1D3BB 1UGPB 2ZPGB 4M7DG 1VIFA 4J9EA 2K5FA 1VQ7T 4Z88A 3PMIA 3VUBA 4QVDA 3RKYA 4FL6A 1VQOQ 2QEXT 3CC7Q 1VA7A 2R5AA 2A7YA 5GAN5 2CDTA 1B34A 1VQOA 3M57A 2KAFA 1JU5C 4A4KA 1W2BS 3A8GB 4KH0B 1FWZA 1RAHB 4PL6A 3J7AF 4J6XA 2DVEA 4C92E 1D0YA 1RI0A 4MDXA 4C8QF 2A08A 3CCQQ 2ZPHB 1OX8A 5LL6S 1LJOA 2DF6A 1Q7YR 1RADB 3CCQA 4BD3A 3OYEA 5KH6A 3OYGA 2OTLT 1QQJA 4J7FA 2HQEA 4CC3A 2E10A 1YI2A 5L8RE 2R58A 1WFWA 1NPRA 2ESWA 3AHUA 1WHHA 4F7UA 3CPWP 4HCBA 1UG1A 5LJ5j 2YDLA 4PJOG 4XAXB 2GCXA 1JXOA 3A8OB 3CBOA 4ELYC 3RKXA 3CCVA 2RQTA 5IT9E 3R6NA 2HNIA 2DTIA 2XDDA 1M90U 1C6VX 2OI3A 1WA7A 1JQQA 5LJ5g 3FDRA 5KYNA 2GQVA 4M78F 4OMOA 5GAN6 1FMKA 4F16A 2DD4A 4OGEA 2M1HA 1W4SA 2X51A 4Y28E 2HMAA 4ZTFA 1QKWA 3DLMA 2XD0A 2DBMA 2FPDA 4FSXA 1K1ZA 2NYSA 2MF2A 5KYXB 3CMAQ 4LDXA 4J9GA 2L2PA 3D7SB 2YUNA 4Q5WA 4ZN3A 1VQNQ 1TH7A 1YCSB 3CMAA 2DM1A 2CH4A 3OYNA 2VYTA 2E64A 1VQNA 1V76A 4MDWA 3WXMB 2J6OA 3CCEQ 1AT1B 5J26A 2EQIA 4M7DA 2CP0A 2MK5A 2EJFA 3C4SA 2QXFA 4JJCA 4KRTA 4N4HA 3SWNA 5DY9A 5IAYA 1VQLQ 5FU6C 4M75E 3EGDA 6AT1B 3EG0A 2KRNA 3SEMA 4GLKA 5LJ5f 2EQJA 2YHTA 5LJ3e 1K8AR 2EBPA 2NUZA 1H92A 3UWNA 5AT1B 3CCLQ 4FYXB 3EFSA 3ZEHA 3ER0A 3P8HA 2DFUA 3CCMT 3QKJA 2MI6A 1SSFA 2CP5A 1KFZA 4M7AD 4XU2A 3FRNA 1M1KC 5KYUB 1ZLMA 2O88A 3QYHB 3LX7A 4HA8A 2YRCA 1C0MA 3EGXB 2O4XB 1MNEA 3VS0A 2GFAA 2DIQA 3OYLA 3OS2A 2H3EB 1G3YA 2O01E 1W1FA 3MP8A 2BZ8A 1K73U 3RUXA 3GP8A 3A5ZB 4C8QC 1T0HA 1SHGA 3L2RA 5KE3A 4BE2A 2QTVA 3REBB 4J6WA 2LZ6B 5HKCA 3WVDB 1N9RA 2EPDA 4J9HA 4HVWA 3HSBA 2NUPB 4RTXA 2I2LA 2D0NA 1HD3A 2HBWA 2A36A 5I2MA 2O2OA 1OX9A 2DRMA 1GCQA 2XICA 3RKWA 1BIAA 1Q81C 3C12A 2NWMA 1ZSZA 1MMAA 1BI2A 1SRMA 2J06A 2XDPA 1XOVA 3LGFA 4EMKA 2F2XA 3QSUA 4A63B 4O6JA 4RTYA 2JVVA 1RAAB 2DPPB 4RCBA 4DA4A 1LVKA 1NG2A 4D8KA 3CCUT 1NJIU 4M7DF 1IB8A 1TUGB 2DVJA 4DQ2A 3JCMc 1ZUUA 4PKCC 5EC7A 5C0MA 1N27A 3F70A 2RJCA 3X25B 5CO7A 4RG2A 4X9CA 2DYIA 4LDWA 3OB9A 4M77D 1VQ5A 2KVQG 4XTXA 2MIOA 4C92G 4FYWB 3JB9I 1QVFP 4JZ3A 3THKA 2XK0A 2FEIA 1W2BP 1Q82R 1WJSA 2QYZA 2MCNA 1QCFA 2DL3A 3KFVA 4IIMA 2EKHA 1VUBA 4JJNK 1IZ6A 2EGCA 1EX4A 1KHCA 1XTDA 2QAZA 1O75A 1UEBA 1K4US 2KT8A 4E7ZA 1K8AC 1UDLA 4CC4B 3JCMJ 3G6ET 4KUDK 2VXFA 4IUUA 3CCRA 2M0OA 5LJ3d 4OB1B 2K79A 1YJ9A 2L8DA 4RTVA 3E19A 5AYFA 5D7UA 2KY9A 2JS0A 4LD6A 4PJOF 4BB7A 1ZA2B 1UGRB 3MPUB 2EYZA 2RA2A 1T3SA 1VQ7Q 3INZA 3OA6A 4YTLA 3V7RA 4FYVB 2DEQA 2KK4A 3CC7T 4F14A 2BZYA 2QEXQ 1IO6A 1GFDA 3M0PA 2ZPFB 3OY9A 1ZQ1A 3OBYA 3VS6A 1UFFA 1KIKA 4PJJA 2QEXA 2IVWA 3OYFA 5GANe 3MJXA 1SPKA 2BKDN 4DOVA 1YJWQ 3S6WA 3CCJQ 4BDZA 1NLOC 4MMLA 3OYKA 4ELZC 1KQSP 5FWCA 4NL2A 2MYSA 2VGNA 2JMAA 2K4YA 1HK9A 3VU3C 2RF0A 4OGCA 1WIEA 2GTOA 2V8IA 2OTLQ 2P0PA 2RB6A 1ZUYA 3QWXX 4IUVA 1N8RU 4JPBW 4M75G 5GAMf 4BACA 2VASA 2RQVA 4OF1A 1AZGB 2A0FB 2XHCA 2JTFA 2JTMA 3VS7A 3AT1B 3EH1A 2XKOC 4E7HA 5FRMA 5GMKe 1XQHA 4QT7A 3RBBB 4M7AC 2EYYA 5GAOq 3BDUA 5D6XA 2EW3A 2LCCA 2GFUA 4OB0B 1UTIA 4J8OA 1JB0E 3EFOB 4ANJA 1OQKA 2COWA 1OV3A 3FIFA 1AWXA 1U06A 3H0IA 2LQNA 4C5EA 1R8OB 1Y57A 4R56A 1M1GA 2YT6A 3I5SA 1RI9A 2RQWA 2DK3A 1PHTA 4BDYA 1VQ9T 1IRXA 4IURA 3GIBA 1WJQA 4ESRA 2CP7A 1YITQ 1WPYA 2RI3A 2HKNA 1PSFA 3CBMA 1D3BA 1FX7A 3SHWA 1D1BA 1VQLT 1G3TA 3I56T 1YCYA 5FW9A 1PSEA 1OYXA 2FRYA 2KXDA 2PUKB 4AT1B 1ZSGA 3EG9B 3JB9J 4NOYA 3CCLT 1YWOA 4PLIA 3RMSA 2WSCE 1NEBA 3TVTA 3CCMQ 4QVCA 4PK4A 4N0AC 1M2VB 1QWEA 2DD5A 5J3BA 4DBHA 2HSEB 5FROA 5LJ3h 4IIOA 2EKOA 2O9SA 4QW2A 1G8XA 4A4EA 5GANd 4M77C 3RR6A 4E7KA 2KRSA 4PJLA 3RMQA 1D1CA 4L5GA 2AKKA 2PVGB 1QVGA 2MMPA 4C92F 1N5ZA 4FSSA 2GTJA 2XU8A 4JLIA 2YUOA 1M27C 2DJZA 3G4ST 3QPHA 1QKXA 5EG2A 4AMCA 1YIJT 3JCMg 3FLGA 2OTJT 2DE0X 4CI0C 3OMGA 3JCMQ 1HYOA 3M5AA 5GAOp 2K3BA 3VS4A 5KYXA 4LN2A 5CAIA 4OMQA 1VOMA 3Q1JA 3FC3A 2IIMA 4ZGJB 2V1RA 2Y4YA 3CCUQ 3MKDA 1K9MU 4FIBA 4L6V5 3GLXA 2LDMA 1WX6A 3EG3A 3CCUA 4F7UG 4JZ4A 2AZVA 1GBRA 3I35A 1VIEA 2RHZA 4AFSC 2K5LA 1YWPA 4BUGA 3HL8A 4IUTA 2ED0A 1YJNT 3QXEB 2JXBA 1UECA 4KGZB 3VRZA 1DJ7B 3SB2A 3L2UA 1O9SA 1E7OA 3MEAA 2VVKA 3O5ZA 4C8QD 1VQMT 3JB9G 2SEMA 3HKSA 3M59A 2XMFA 4E2FB 4OB2B 4LUDA 3E9GA 8ATCB 4ORZA 2AIRB 3I55T 2KYMA 3UATA 4C5GA 3G6EQ 5KYUA 1FMWA 2QA4T 4J6YA 2D9TA 4M75F 2LC4A 1VYVA 3PIPA 3MHXA 3C94A 2E6NA 3EH2A 3VUZA 3G6EA 3PT9A 2DNUA 1MGQA 3EGXA 2VB6A 2O4XA 2RHYA 5I21A 1WQ7A 2DETA 3E1SA 1QVGS 2B86A 2MOXA 3JCMh 3QDFA 3M0TA 2RK1A 1KD1U 1ARKA 1SRLA 3ASKA 4LUEA 4M78D 3VV0A 2MWPA 4JUVA 1F1BB 1Q86U 2EJGA 2D8JA 2FYKA 4JJDA 3VYGA 5I11A 7AT1B 1VQPT 1KC8R 1OZ3A 2ZPIB 1GRIA 2LJ0A 2ABLA 4N4IA 2B8AA 4M4ZA 2BE9B 2GBQA 3URGA 3CC7A 1VQ8T 2NUPA 4P5NA 2LRQA 4XTUA 3V8KA 1M1KR 2L0AA 4XTYA 1SEMA 1YJWT 2HSPA 4AG1C 3CCJT 3M4YA 4DEXA 2K57A 1ABOA 4RCCA 3HPWA 5GANh 1UGQB 3N5BB 1KQ1A 2OAWA 1KK7A 3DLLA 2CZ6B 2V8KA 5FU6B 3PIOA 2ED1A 3OSVA 4KULA 2M02A 4JLGA 2EYWA 2LX9A 2DZCA 3JV3A 1VQ6T 2R5MA 3QBYA 5D6WA 1JEGA 4NL3A 1UJ0A 2W10A 1ZX6A 1Q81R 2GQIA 2PTKA 1UGSB 2KE9A 2EQKA 5CKBA 2EYXA 3JRZA 4RTWA 3OYDA 3U23A 2O31A 4EMHA 3H0HA 4ZTJA 5I22A 3M0UA 3EGUA 5GAMe 4C0ZA 3TREA 2AK5A 4CC7A 2DXUA 4OP0A 2X4WA 2CGHA 3GOXA 2J6KA 3MEVA 1VQ9Q 2VWFA 3P8BB 2DX1A 3LLRA 4PNOA 4C8QB 1HJDA 4XQ3A 2DJQA 1YITT 1PM3A 1VQ9A 1BCOA 3A8LB 2A3LA 3QHSA 3CCEA 3UA7A 4E6RA 1Y0MA 1SKUB 2DL4A 3GBQA 4J9BA 1IREB 3OYYA 3LW5E 4M7AA 1NLPC 3I56Q 2FZCB 2CZ1B 2RPNA 4IUQA 1VQLA 2AT1B 5D6YA 1AOJA 1QMCA 3I56A 1M2OA 2FRWA 2QGFB 2FB7A 3VYHB 5ECAA 2K6DA 2QK0A 1KC8C 2X4XA 1B07A 3MP6A 2KNBB 2RJDA 1UUEA 2KI7A 3CCLA 2VGMA 2IPOB 4L59A 1HSQA 1AZEA 1H3ZA 4M7DD 3M4GA 2QTXA 2E5QA 2LX7A 2MWOA 3LWHA 5A0DA 2L89A 1UJYA 4F7UF 2BE7D 2KBTA 2OJ2A 4ZN1A 1EIFA 5HCKA 3VKIA 2QASA 3OYMA 4KH1B 2WSEE 3G4SQ 3CXCA 1YIJQ 3JB9F 2OTJQ 4C8QE 2AZSA 3M54A 5HY6A 4XTWA 3BFMA 1NYFA 3G4SA 3A1PA 2ATCB 2DRKA 3CEYA 1YIJA 2ECZA 3EFOA 1PD0A 4N0AA 1PG5B 1H641 2V1QA 3OW2A 2HQHA 2RJEA 5CVIA 4OMNA 3RNJA 1M4ZA 4PJOD 2LT1A 4M77A 2YLBA 2COZA 1RL2A 4M78C 5GJVB 1TUDA 1SSHA 1QVGP 1I8FA 1AEYA 1IXDA 2EAYA 2CSIA 4KT0E 5IH2A 1PD1A 2CUBA 4ZGDB 2CP2A 5GAMd 1X43A 3CCST 4C5IA 1MV0B 3C0CA 3DB4A 3HHTB 1H8KA 5KE2A 3A8HB 1YJNQ 1YFNA 1YNZA 1BYMA 1ZHIA 4D8DA 3VRYA 4XU0A 4DBRA 3M55A 1TUCA 3EG9A 1YJNA 2DL8A 1VQMQ 4XK8E 3QO3A 1X6GA 1Q7YU 1G3SA 3IQLA 2F69A 1OI1A 4F04B 2RD1A 2RNAA 4Y92A 4J5YA 1M3AA 2KMTA 4RKUE 1FYNA 2I0NA 3I55Q 1M2VA 1RUWA 5IHIA 4HT9A 2QA4Q 1BU1A 2XDBA 3X26B 3I55A 1SHFA 4WCIA 1MHNA 1M3BA 1UE9A 3HRUA 2CKKA 4AFZC 2QA4A 1U8RA 4FCYA 2P4RA 2DKGA 1QLYA 1XNIA 2BZXA 1GCPA 1X6OA 3V8LA 1D0ZA 4M7AB 2LVMA 1H3HA 1E6HA 5GAOn 1ZBJA 1VQ7A 2XI9A 3RESA 1I1JA 1MMNA 1VYUA 3CXCS 2BUDA 2KR3A 1VQPQ 2C0OA 1Y96B 2H8HA 3UA6A 1VQ8Q 5FRNA 1M30A 4E7IA 4BI8B 2X3XD 1VQPA 2KROA 3OW2S 1VQ8A 1X01A 1EFNA 2WACA 1YJWA 3CCJA 5LJ3j 2X4YA 2AKLA 3H9NA 3NGPA 4J9IA 3OYBA 2HDAA 1Q95G 2OTLA 3EAEA 2FPEA 2KEAA 5LJ3g 2VC8A 4EDUA 1WZOA 3QZ5B 5GAN8 2QQAA 1K0XA 3OMCA 1YI2T 3M0SA 1VQ6Q 3CQTA 4QQGA 2YRDA 4XTVA 5KYWB 1K8AU 3NMZC 2FPFA 1YHQT 2F2WA 2YUQA 2DA9A 2F2VA 4PFOA 3CCVT 4M7DC 2E4HA 3C95A 2JZ2A 1C1AA 3MEWA 3SWNC 3QJYA 3X24B 3OYCA 4M7AE 1M5Q1 1FXXA 1IGUA 4M77B 3H41A 4WF2A 4PFPA 1VQKT 5GMKl 5I2SA 2CH4W 1V1CA 1GFCA 3G71T 2AHJB 4C92D 1TSFA 2F5TX 1QCOA 5LJ3f 1WDXA 4ZGEB 1I5OB 1W70A 5GAMh 2JN0A 1YITA 3DKMA 4KGXB 1AVZC 2CT4A 1I07A 1W6XA 5M9OA 2DIGA 2X9HA 2JM8A 3OYAA 3KBGA 3M0QA 1X75C 2KGTA 4WTOB 4DBQA 5L23A 4PJOC 1FMVA 2EYQA 1NZ9A 4LD9K 1KHIA 1AHJB 3R6OA 3S3OA 2E12A 1XJWB 3PNWC 3CCMA 1QCNA 1D0XA 4OMLA 1ZA1B 2A28A 4E7JA 4RTTA 2QQSA 2YUPA 1M3CA 2NUTB 4A4HA 5GAN4 1M90R 2K2MA 1OU9A 5HK0A 3UDCA 1RLPC 1KG1A 1GCQC 2XIDA 3E9FA 3OYHA 1RAEB 2Z0WA 1TTHB 4HCKA 3CC4T 1PCXA 5IXFA 2RI5A 1P92A 1LOJA 5LJ5e 4BE0A 1Q82U 3CD6T 5GAN2 4M77E 2OAUA 4EMKC 3TEEA 1SG5A 5IN1A 1Y7XA 2LQWA 3V7SA 1NE8A 2K3YA 4GY5A 1TXQA 1YP5A 4HCCA 2CUDA 3TSWA 2HCKA 3LYIA 3META 4A54A 2DAQA 2VV5A 2ROLA 1SF9A 4M75D 4LE9A 1WHGA 4EPCA 3CMET 2PU9B 5GANj 5DLQE 1QVFA 4C0DC 4HVUA 1W2BA 4B9WA 3ZBDA 1PWTA 5CCAA 5GAOr 2CP3A 1YN8A 4AG2C 3CC2T 2JUFA 1PRMC 3J81E 2CP6A 4C8QA 1VYTA 2DO3A 2FG0A 5GANg 4HKEA 2KQWA 1R0CB 3GF5A 2RI2A 3ME9A 3X20B 4RG8A 5GAN3 3GPLA 1OU8A 2LJ3A 1MNDA 2CREA 3CCSQ 4ME7A 2KYBA 3NTIA 3OS1A 3CCSA 3JCMV 3HFOA 2VXEA 3JCMf 4BE1A 1RAFB 2L3QA 5GMKj 1U5SA 2ZCFB 2RJFA 1K73R 1G3WA 1WJRA 1ABQA 3G1JA 4B6MA 1WXUA 4BY6B 2HQXA 3O8VA 2RH2A 1G2BA 1M8VA 2XG8D 2EFIA 2JJ9A 4F17A 1JBMA 1WXBA 4A4GA 1I4K1 3GNGA 1LNXA 1Z9ZA 1AD5A 1MMGA 2DMOA 2QQ9A 2K3XA 1MUZA 1OZ2A 3H6ZA 3ULRB 4CRIA 2L3RA 5GANf 1M90C 2LQKA 1BI3A 1JJ2A 2DZ9A 2HL3A 3PTAA 4CC2A 5DM7R 1YJ9T 2CS7A 4EMGA 4FW1A 2OX7A 4AFQC 1BI0A 2LP5A 1KQSA 4PFZA 2CZ0B 2DEUA 2DLPA 4M7AG 3LWIA 5GMKm 2RHXA 3A8MB 4Z8AA 1NJIR 3UT1A 1RLQC 4DBFA 5LJ5d 4IUPA 4C92C 4BI4A 2RM4A 2JS2A 1X2QA 2GNCA 4FM4B 4TVRA 3M56A 1QVFS 5J39A 4LDYA 4BY6C 2ZAEA 4C0GA 2E1HA 2X35A 2GF7A 3LH0A 2EIFA 2JM9A 2K9GA 1WLPB 3WVEB 3QG1A 3M58A 3HFNA 2QI2A 2QDLA 1U1SA 4LNPA 4Y91A 9ATCB 1M8MA 4R55A 1PRLC 1I5LA 3L2QA 3MEUA 4M75B 1YI2Q 1E6GA 3BE3A 5CKHA 3E2UA 5C6SA 3DB3A 4JS4A 1CSKA 5IHKA 1Z9QA 1KSWA 8AT1B 2EGAA 2FZGB 4OMMA 1YHQQ 4J7IA 1PKSA 2JOYA 3S3MA 3CCVQ 1R77A 4A53A 1JO8A 5CK9A 1YHQA 3QJ6A 4XU3A 4MMKA 2RMOA 2J05A 5GMKh 3L2ZA 4C0FA 1LCKA 3P8DA 1GBQA 2LNVA 2E41A 2HZYA 4OVAA 1PNJA 2BIVA 1IGQA 2NLUA 2PUOB 3UPUA 1K73C 1VQKQ 3BY7A 2DILA 1I0CA 1YBYA 2D0QB 1B3QA 1OPLA 2LT4A 4M77G 1VQKA 3G71Q 4NS5A 1S72T 2HEQA 3KXTA 1AWWA 1JJ2S 3G71A 1HXDA 2RHUA 2IG0A 1A0NB 2LJ1A 4XU1A 5FLXE 3JB9D 2RQRA 1KQSS 2PVOB 3LGLA 3ZFJA 2QGGA 5GAOl 1TOVA 2RO0A 4M75C 2DYBA 3H8ZA 1JRIA 2LCLA 5CR2A 3JAME 4Z89A 1N8RR 1EZZB 4HVVA 2LNHB 2EJ9A 1AWJA 1Y96A 3FJPA 3PE0A 3MP1A 2M51A 3OS5A 2JMCA 1NJIC 1K0SA 4M78B 2DTHA 3L42A 3RIRA 1WXTA 1R0BG 2LMJA 3V8JA 4ZNXA 4RTUA 4PLLA 1QVPA 1NPPA 1MMDA 4RTZA 2M9UA 1M9SA 1OOTA 5KYYB 1V29B 3MCAB 3TQ7P 3CC4Q 2KT1A 3CD6Q 4K11A 2DL7A 3CC4A 2EQUA 4QKUA 1Q7YC 1KQ2A 3CD6A 5KYWA 3VS1A 2JT4A 2MAMA 4PJOA 2VUBA 4JS5A 1CKAA 3TCJA 2ZPBB 4FT4A 5LJ5h 2OTJA 4HCZA 5CKEA 2Y4XA 4Z02A 1BIBA 3ZL7C 1X27A 1B34B 5GMKi 3JCMW 5A0LA 3CMEQ 2LQ8A 1BCMA 2LTOA 2DXBA 1WYXA 3CMEA 3REAB 3QWYA 1IHVA 2O9VA 2FHDA 2W0ZA 3CC2Q 3A98A 2L3SA 2E70A 3PGGA 3CC2A 1UHFA 4MZPA 1T3LA 4X1VA 4X34A 3JSCA 4M78E 4M7AF 1VQ4T 2PVDB 2ZPEB 1KC8U 3OBWA 4F7UB 1M1FA 1M1KU 2HAXA 2HKQB 2C06A 4LXCA 2YWWA 1MV3A 3SDZA 1VQ5Q 2C0TA 1QP2A 1QWFA 3JCMP 2V26A 1WHMA 1VQMA 1N8RC 2FO0A 2RQUA 3SFMA 3HP9A 3T9NA 1X6BA 1UHCA 3UF4A 2G6FX 4RMOA 4OB3B 2MPXC 4BI3A 4O5VA 1UB4A 2NUTA 1GL5A 2QQBA 4DOWA 4IKFA 2P0QA 5GAMj 3JCMX 1ACMB 3CCRQ 2V8JA 5CQXA 1YJ9Q 1BKBA 3OS0A 2X4JA 3JCMe 2JW4A 3HRTA 1Q81U 5CKFA 1RABB 1G83A 2YRVA 4M7DB 1S1NA 2EQMA 3L2WA 3PVLA 5CIUA 5GAMg 1TS9A 3NTKA 3RDVA 3SWNB 1D1AA 1PKTA 3VJPA 2KSSA 1BI1A 1ZBXA 1K9MR 3CPWA 2VKNA 2QQRA 3L2VA 2RK2A 1JXMA 3EGDB 3EG1A 3NHNA 1VQOT 4FT2A 2ROTA 4LDUA 4MZMA 5FU7B 4FYYB 4M77F 4F7UE 2X3WD 3PMTA 4KUIA 2J6FA 1WHJA 1WNLA 2LCSA 1JJ2P 5GAOm 2EGEA 1TU0B 5GAN7 3CCQT 1Y07A 3QUIA
chains in the Genus database with same CATH topology
3WVDB 1N9RA 3PFSA 3DLLA 2DTOA 2M16A 3V7CA 4J6WA 2CZ6B 3HSBA 3LYIA 4LDVA 3META 4A54A 2I2LA 3OQ5A 2DAQA 2VV5A 2E6ZA 5I2MA 4M75D 2V8KA 5FU6B 3PIOA 4A4FA 4EPCA 2XICA 3OSVA 4KULA 3RKWA 4JRKA 1BIAA 2WSFE 3CMET 1VQ6A 2PU9B 5GANj 4JLGA 5DLQE 1Q81C 2LX9A 1VQ6T 2DZCA 3C12A 1QVFA 2R5MA 3QBYA 4VUBA 5D6WA 4C0DC 1BI2A 4NL3A 1W2BA 2XDPA 2L5QA 4B9WA 3ZBDA 5CCAA 1XOVA 3LGFA 4C92A 4EMKA 2P0KA 5GAOr 3QSUA 4O6JA 3CC2T 2JUFA 3M53A 3J81E 4C8QA 1KD1U 2DO3A 5GANg 2DXTA 2JVVA 4HKEA 2DPPB 2KQWA 3GF5A 4RCBA 1UGSB 4II1A 4DA4A 2RI2A 3ME9A 2HBPA 3X20B 3CPFA 4RG8A 3CCUT 1NJIU 3FEOA 3SD4A 5GAN3 3GPLA 2EQKA 4M7DF 5CKBA 4M7DE 3JRZA 3BDLA 3OYDA 2E65A 4ME7A 3NTHA 4DQ2A 3JCMc 4EMHA 4PKCC 5FU7C 4ZTJA 3NTIA 4N4GA 1N27A 5C0MA 3OS1A 1Q82C 3F70A 2RJCA 3X25B 3CCSA 5CO7A 3JCMV 3HFOA 1I81A 2VXEA 4QQDA 4RG2A 4X9CA 3JCMf 3TREA 4C0ZA 2DXUA 4OP0A 4BE1A 4LDWA 2X4WA 3OB9A 2CGHA 4M77D 2KVQG 3L1AA 3MEVA 4XTXA 3GOXA 2H3JA 4C92G 4D6WA 3JB9I 3CMAT 4EMKB 3P8BB 5HK3A 3LLRA 2XK0A 4PNOA 4JRQA 1S72A 1VQNT 4C8QG 1WJSA 5GMKj 2YLCA 2ZCFB 4C8QB 4XQ3A 2RJFA 1YITT 1VQ9A 1G3WA 4JRIA 1WJRA 3A8LB 2P4TA 4BY6B 2A3LA 1VUBA 3QHSA 4JJNK 3FB9A 1IZ6A 3CCEA 2HQXA 3O8VA 1KHCA 1XTDA 2HD0A 2RH2A 4B9XA 3S3NA 3CCET 1O75A 1M8VA 1UEBA 2XG8D 4MZTA 2EFIA 1IREB 1JBMA 2F5KA 3LW5E 3OYYA 1K8AC 4A4GA 4M7AA 3KUFA 1I4K1 3GNGA 1LNXA 5KCOA 2CZ1B 3JCMJ 4IUQA 3X28B 3CPWS 1GXIE 3G6ET 4KUDK 1VQLA 2EWNA 5D6YA 3JCMd 2QQ9A 2K3XA 2VXFA 4IUUA 2PQWA 3CCRA 1OZ2A 3H6ZA 3QYGB 2M0OA 2L3RA 5LJ3d 3BW1A 4OB1B 4CRIA 5GANf 1M90C 2LQKA 1BI3A 4QQ6A 4C0DB 2L8DA 1YJ9A 2DZ9A 1JJ2A 3PTAA 4JRPA 2FB7A 3VYHB 2CS7A 4EMGA 5DM7R 3G7ZA 3E19A 5AYFA 4X9DA 1YJ9T 1K9MC 4OMFB 1U1TA 2KY9A 1KC8C 4LD6A 4PJOF 2X4XA 4BB7A 4PJOE 1BI0A 3MP6A 2D6FA 2RJDA 1KQSA 3CCLA 2CZ0B 2K5IA 2VGMA 1WGSA 1UGRB 4M78G 3RERA 2Y90A 2RA2A 4M7AG 4L59A 3INZA 1H3ZA 3OA6A 3LWIA 4YTLA 3V7RA 3M4GA 4M7DD 4V2SA 2QTXA 2DEQA 4FU6A 5GMKm 3HRSA 2RHXA 2E5QA 3A8MB 2KK4A 3CC7T 2MWOA 3UT1A 2CYZB 3LWHA 5A0DA 2ZPFB 5LJ5d 3OY9A 1ZQ1A 2DXCA 2JNGA 2L89A 3OBYA 4IUPA 4F7UF 5GAMe 1N9SA 4C92C 4BI4A 2QEXA 2IVWA 2RM4A 3OYFA 5GANe 4M75A 3CBPA 2BKDN 2K2VA 4FM4B 4TVRA 3M56A 4DOVA 4ZN1A 3S6WA 5J39A 5DLOA 4LDYA 1QVFS 4BY6C 4BDZA 4MMLA 4C0GA 4C5HA 3OYKA 2E1HA 3OYIA 3J80E 1EIFA 4ELZC 2X35A 2GF7A 3LH0A 2EIFA 3VKIA 3OYMA 3NFCA 3WVEB 2WSEE 4NL2A 3QG1A 3M9QA 3M58A 3CXCA 1WQWA 2VGNA 3HFNA 3JB9F 2K4YA 2QI2A 1HK9A 3VU3C 4OGCA 1U1SA 2V8IA 2QDYB 4Y91A 4UC4A 3M54A 4C8QE 5HY6A 4XTWA 3TU4K 2P0PA 3BFMA 3QZ9B 3G4SA 2RB6A 1YIJA 3CEYA 2KDSA 4JDSA 4R55A 4IUVA 1N8RU 1I5LA 3L2QA 3MEUA 4M75G 2FL7A 5GAMf 4M75B 4BACA 4N0AA 4KBMB 4ATOA 1H641 3OW2A 2RJEA 4OF1A 4QVZA 5CKHA 1KD1C 2XHCA 2JTFA 5C6SA 5A0GA 3DB3A 4JS4A 5CVIA 4J83A 2JTMA 1QP3A 3L2WA 1M4ZA 4PJOD 2LT1A 4M77A 2YLBA 2XKOC 1RL2A 4J7IA 4E7HA 1Q86C 5CKDA 5GMKe 2JOYA 5FRMA 3S3MA 2FVUA 1XQHA 4M78C 4A53A 3MO8A 5CK9A 4M7AC 5GAOq 1YHQA 3QJ6A 4XU3A 3BDUA 4MMKA 5D6XA 1I8FA 2LCCA 5GMKh 2GFUA 3L2ZA 4OB0B 4C0FA 2EAYA 4J8OA 1JB0E 3P8DA 4KT0E 3OYJA 5A2QE 1VQ5A 2LNVA 2R57A 2E41A 4OVAA 2BIVA 4ZGDB 2NLUA 2PUOB 5GAMd 3UPUA 1K73C 3CCST 4E47A 1VQ4A 4HT8A 3BY7A 4C5IA 3FIFA 1YBYA 3DB4A 3HHTB 2D0QB 4C5EA 4C92B 5KE2A 1VQ5T 1G5VA 5CQYA 1VQKA 2LT4A 1R8OB 4M77G 3JB9H 3A8HB 3QDRB 1M1GA 4NS5A 4R56A 1S72T 1BYMA 1ZHIA 2G3RA 3KXTA 2DK3A 4XU0A 2ZZDA 1QW1A 4BDYA 1VQ9T 1JJ2S 5KCHA 3M55A 4IURA 3G71A 1YJNA 1WJQA 4XTZA 3JCMb 3GIBA 1HXDA 2CZ7B 2IG0A 2RHUA 4XK8E 3QO3A 3EFRA 3QIIA 1N6AA 4XU1A 1Q7YU 4E7LA 1G3SA 5FLXE 3JB9D 1KQSS 4M78A 2PVOB 3LGLA 1WPYA 2F69A 1OI1A 2RD1A 2RI3A 1PSFA 3CBMA 4J5YA 3ZFJA 2KMTA 5GAOl 1D3BA 2RO0A 4RKUE 4M75C 1FX7A 3H8ZA 1JRIA 2LCLA 4HT9A 1VQLT 5CR2A 3JAME 1G3TA 3CCRT 2XDBA 3I56T 3X26B 3I55A 1MHNA 1YCYA 2EJ9A 1PSEA 2CKKA 3GNFB 3HRUA 1Y96A 1OYXA 2QA4A 2PUKB 1U8RA 3FJPA 3MP1A 3JB9J 2DKGA 4NOYA 3OS5A 2RHIA 1XNIA 1NJIC 3CCLT 1Y71A 1X6OA 4PLIA 4M78B 2DTHA 2ZGWA 3V8LA 3RMSA 3L42A 3RIRA 4M7AB 2LVMA 3OSSC 2WSCE 4QVCA 1D3BB 1UGPB 3V8JA 2ZPGB 5GAOn 4N0AC 4M7DG 4PLLA 1VIFA 1VQ7A 2DD5A 1QVPA 1NPPA 2K5FA 2XI9A 5J3BA 3RESA 3CXCS 1VQ7T 3PMIA 3VUBA 2BUDA 5FROA 5LJ3h 4QVDA 2M9UA 1M9SA 3RKYA 2EKOA 4QW2A 1V29B 4FL6A 4A4EA 5GANd 3MCAB 1Y96B 2QEXT 5FRNA 4M77C 4E7KA 2R5AA 2A7YA 4E7IA 4BI8B 5GAN5 1VQPA 3RMQA 1B34A 1VQOA 3M57A 3OW2S 1VQ8A 2KAFA 4L5GA 4A4KA 1W2BS 1X01A 3A8GB 3CC4A 1FWZA 2EQUA 2PVGB 2WACA 4PL6A 1YJWA 4J6XA 1QVGA 3CCJA 1Q7YC 1KQ2A 3J7AF 5LJ3j 2MMPA 2X4YA 2DVEA 4C92F 4C92E 3CD6A 2MAMA 1RI0A 4MDXA 4PJOA 2XU8A 2VUBA 4C8QF 4JLIA 4JS5A 3TCJA 2DJZA 2ZPBB 2ZPHB 4FT4A 3OYBA 5LL6S 1LJOA 5LJ5h 3G4ST 3QPHA 2OTJA 4HCZA 5CKEA 5EG2A 1YIJT 3CCQA 3JCMg 4BD3A 4PJOB 3FLGA 3EAEA 3OYEA 2Y4XA 4Z02A 2OTLA 2OTJT 1BIBA 4CI0C 5KH6A 5LJ3g 2VC8A 3OYGA 2OTLT 4J7FA 4EDUA 3QZ5B 1B34B 2HQEA 5GMKi 3JCMW 2E10A 5A0LA 1YI2A 5L8RE 2R58A 5GAN8 2QQAA 3OMGA 3OMCA 1YI2T 3JCMQ 2LQ8A 1NPRA 2LTOA 3M5AA 4QQGA 3AHUA 2DXBA 4XTVA 4F7UA 4HCBA 5LJ5j 3CMEA 1K8AU 4PJOG 5GAOp 2FHDA 4XAXB 2GCXA 3A8OB 3CBOA 4ELYC 1YHQT 3RKXA 3CCVA 5CAIA 5IT9E 3FC3A 3Q1JA 3CCVT 2HNIA 4M7DC 3C95A 2E70A 4ZGJB 2DTIA 2JZ2A 2XDDA 1M90U 2Y4YA 3MEWA 3PGGA 3CC2A 4MZPA 5LJ5g 4X34A 3SWNC 3FDRA 3QJYA 2GQVA 4M78F 3X24B 3JSCA 4M78E 5GAN6 1K9MU 2DD4A 4M7AF 4FIBA 2PVDB 2ZPEB 4L6V5 4OGEA 2M1HA 3GLXA 3OYCA 1W4SA 2LDMA 1KC8U 4M7AE 3CCUA 3OBWA 4Y28E 1M5Q1 1FXXA 4M77B 4F7UB 4F7UG 1M1FA 3DLMA 4WF2A 4ZTFA 1M1KU 1VQKT 1VIEA 2C06A 5GMKl 2HAXA 2XD0A 2RHZA 5I2SA 4FSXA 2K5LA 4BUGA 2MF2A 3HL8A 4LDXA 4IUTA 3SDZA 4Q5WA 4ZN3A 3G71T 3QXEB 1YJNT 1QP2A 2AHJB 4C92D 3JCMP 1TH7A 1DJ7B 3SB2A 3L2UA 3CMAA 2F5TX 1O9SA 3MEAA 5LJ3f 2VYTA 4C8QD 3OYNA 1VQMA 2E64A 4ZGEB 1N8RC 1VQNA 1VQMT 4MDWA 3SFMA 5GAMh 3JB9G 3HP9A 3WXMB 2JN0A 3T9NA 1YITA 3DKMA 3HKSA 3M59A 5J26A 4RMOA 4OB3B 4M7DA 4OB2B 3C4SA 2EJFA 2QXFA 4BI3A 5M9OA 2DIGA 4N4HA 3E9GA 4O5VA 3SWNA 3OYAA 3I55T 5DY9A 1UB4A 3KBGA 2QQBA 4C5GA 1X75C 5IAYA 4DOWA 4IKFA 2P0QA 2QA4T 4J6YA 2D9TA 4M75F 2LC4A 5FU6C 4M75E 3JCMX 5GAMj 3PIPA 3MHXA 4PJOC 2V8JA 3C94A 2E6NA 3VUZA 2EYQA 3G6EA 1NZ9A 4LD9K 1KHIA 1AHJB 3R6OA 3PT9A 5CQXA 1MGQA 3S3OA 2E12A 1BKBA 2O4XA 2RHYA 4GLKA 1WQ7A 2X4JA 5I21A 2EQJA 5LJ5f 3HRTA 3JCMe 3OS0A 3E1SA 2YHTA 1Q81U 5LJ3e 5CKFA 1QVGS 2YRVA 4M7DB 3UWNA 2EQMA 3EFSA 3PNWC 2RK1A 3ER0A 3JCMh 3ZEHA 3P8HA 5CIUA 3ASKA 5GAMg 3CCMA 3NTKA 3CCMT 4E7JA 3QKJA 2MI6A 4M78D 3VV0A 1UGQB 1SSFA 2QQSA 3SWNB 2MWPA 4M7AD 4XU2A 1VQ4T 4A4HA 5GAN4 3FRNA 1M1KC 4JUVA 3VJPA 5HK0A 2KSSA 1Q86U 2EJGA 1BI1A 1ZBXA 2FYKA 3UDCA 3VYGA 3CPWA 1KG1A 3QYHB 3LX7A 2QQRA 4HA8A 2RK2A 3L2VA 1VQPT 1OZ3A 2ZPIB 3URGA 3CC7A 2B8AA 2XIDA 4N4IA 1VQOT 3E9FA 4FT2A 3OYHA 1VQ8T 4P5NA 2O4XB 2LRQA 4LDUA 4MZMA 4XTUA 3V8KA 3CC4T 4XTYA 2GFAA 5FU7B 1YJWT 2DIQA 3CCJT 3M4YA 2RI5A 1P92A 1LOJA 5LJ5e 3OYLA 4BE0A 1Q82U 3OS2A 4M77F 3CD6T 5GAN2 4M77E 1G3YA 2O01E 2OAUA 3MP8A 4EMKC 4F7UE 3I56A 1K73U 3TEEA 2K57A 3PMTA 3RUXA 5IN1A 4KUIA 3A5ZB 3GP8A 1Y7XA 4C8QC 3V7SA 1WNLA 4RCCA 3L2RA 1NE8A 3HPWA 2K3YA 5KE3A 5GAOm 4GY5A 4BE2A 5GANh 5GAN7 3CCQT 4HCCA 1Y07A 3QUIA 3N5BB 5HKCA 1KQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZBD A; 
#chains in the Genus database with same CATH topology
 1U3O A;  3PFS A;  1TG0 A;  3NPF A;  2DTO A;  2M16 A;  3V7C A;  1NEG A;  3VS2 A;  4LDV A;  2J7I A;  3OQ5 A;  4J9F A;  2E6Z A;  5FWB A;  4A4F A;  4KGV B;  1VQ6 A;  4JRK A;  2WSF E;  4PJO B;  1RAC B;  2A37 A;  2CT3 A;  2KRM A;  2P84 A;  4VUB A;  1D09 B;  2YXY A;  2L5Q A;  2PNI A;  1UGV A;  5IXB A;  4C92 A;  2P0K A;  1KJW A;  2E5K A;  3M53 A;  2DXT A;  4PJM A;  5GJW B;  2HL5 C;  1KD1 R;  3TSZ A;  2ENM A;  4II1 A;  3I5R A;  5IHN A;  2HBP A;  1OEB A;  3CPF A;  3FEO A;  3SD4 A;  1AWO A;  4M7D E;  4PJN A;  4DEY A;  2KXC A;  3BDL A;  4GLM A;  2E65 A;  1Q86 R;  3NTH A;  5FU7 C;  4N4G A;  1Q82 C;  1X2K A;  1ZSZ B;  1I81 A;  4QQD A;  1S72 Q;  3L1A A;  3CMA T;  2H3J A;  4D6W A;  4EMK B;  1T0J A;  5HK3 A;  4GBQ A;  4JRQ A;  1S72 A;  1VQN T;  1K9A A;  4C8Q G;  4EIK A;  2YLC A;  1X69 A;  4JRI A;  2E3H A;  2P4T A;  4J9D A;  3FB9 A;  1NM7 A;  3S3N A;  2HD0 A;  4B9X A;  3CCE T;  2FZK B;  4MZT A;  2F5K A;  3KUF A;  5KCO A;  2COY A;  3X28 B;  1GXI E;  3CPW S;  2PZ1 A;  2EWN A;  3JCM d;  2PQW A;  3QYG B;  1BBZ A;  3BW1 A;  4QQ6 A;  4C0D B;  4JRP A;  1K9M C;  3G7Z A;  4X9D A;  4OMF B;  1U1T A;  1RAI B;  1TWB A;  4PJO E;  2D6F A;  2K5I A;  1WGS A;  4M78 G;  3RER A;  3LH5 A;  2Y90 A;  2C0I A;  4OMP A;  2F1L A;  3EHQ A;  4V2S A;  1NBE B;  4FU6 A;  3HRS A;  3EG2 A;  1ZSZ C;  2CYZ B;  2DXC A;  3FJ5 A;  2JNG A;  1BK2 A;  1N9S A;  2DER A;  4M75 A;  4HXJ A;  3CBP A;  2K2V A;  5DLO A;  4C5H A;  3OYI A;  3J80 E;  2EVR A;  3NFC A;  2JTE A;  4FW2 A;  3M9Q A;  1WQW A;  1BB9 A;  2QDY B;  4UC4 A;  3TU4 K;  3QZ9 B;  3HTR A;  4JDS A;  2KDS A;  2FL7 A;  3VS3 A;  2D8H A;  2E3I A;  4AFU C;  4KBM B;  4ATO A;  4QVZ A;  1KD1 C;  5A0G A;  4J83 A;  4E7S A;  1RAG B;  2CSQ A;  1QP3 A;  2QG9 B;  2RN8 A;  1Q86 C;  5CKD A;  2FVU A;  2K7A A;  3MO8 A;  2D1X A;  1WI7 A;  2BTT A;  3CXC P;  3OYJ A;  5A2Q E;  1VQ4 Q;  2R57 A;  2DL5 A;  1B7T A;  1NYG A;  4HT8 A;  4E47 A;  1VQ4 A;  4C92 B;  1VQ5 T;  1G5V A;  1OPK A;  3H0F A;  5CQY A;  3OW2 P;  3JB9 H;  1IHW A;  3QDR B;  2G3R A;  2ZZD A;  1QW1 A;  2SRC A;  4JJB A;  5KCH A;  4XTZ A;  3JCM b;  1LPL A;  1ZUK A;  2CZ7 B;  4J9C A;  3EFR A;  3QII A;  1N6A A;  4E7L A;  4M78 A;  2DBK A;  3I9Q A;  3CCR T;  1J3T A;  5KYY A;  2GGR A;  3PVQ A;  3GNF B;  3EHR A;  4RUG A;  2L3P A;  2YSQ A;  2RHI A;  1WHK A;  1WHL A;  1OUL A;  3M0R A;  1K76 A;  1Y71 A;  3VS5 A;  2M0Y A;  1PC0 A;  2ZGW A;  1CKB A;  4R0K A;  3OSS C;  1D3B B;  1UGP B;  2ZPG B;  4M7D G;  1VIF A;  4J9E A;  2K5F A;  1VQ7 T;  4Z88 A;  3PMI A;  3VUB A;  4QVD A;  3RKY A;  4FL6 A;  1VQO Q;  2QEX T;  3CC7 Q;  1VA7 A;  2R5A A;  2A7Y A;  5GAN 5;  2CDT A;  1B34 A;  1VQO A;  3M57 A;  2KAF A;  1JU5 C;  4A4K A;  1W2B S;  3A8G B;  4KH0 B;  1FWZ A;  1RAH B;  4PL6 A;  3J7A F;  4J6X A;  2DVE A;  4C92 E;  1D0Y A;  1RI0 A;  4MDX A;  4C8Q F;  2A08 A;  3CCQ Q;  2ZPH B;  1OX8 A;  5LL6 S;  1LJO A;  2DF6 A;  1Q7Y R;  1RAD B;  3CCQ A;  4BD3 A;  3OYE A;  5KH6 A;  3OYG A;  2OTL T;  1QQJ A;  4J7F A;  2HQE A;  4CC3 A;  2E10 A;  1YI2 A;  5L8R E;  2R58 A;  1WFW A;  1NPR A;  2ESW A;  3AHU A;  1WHH A;  4F7U A;  3CPW P;  4HCB A;  1UG1 A;  5LJ5 j;  2YDL A;  4PJO G;  4XAX B;  2GCX A;  1JXO A;  3A8O B;  3CBO A;  4ELY C;  3RKX A;  3CCV A;  2RQT A;  5IT9 E;  3R6N A;  2HNI A;  2DTI A;  2XDD A;  1M90 U;  1C6V X;  2OI3 A;  1WA7 A;  1JQQ A;  5LJ5 g;  3FDR A;  5KYN A;  2GQV A;  4M78 F;  4OMO A;  5GAN 6;  1FMK A;  4F16 A;  2DD4 A;  4OGE A;  2M1H A;  1W4S A;  2X51 A;  4Y28 E;  2HMA A;  4ZTF A;  1QKW A;  3DLM A;  2XD0 A;  2DBM A;  2FPD A;  4FSX A;  1K1Z A;  2NYS A;  2MF2 A;  5KYX B;  3CMA Q;  4LDX A;  4J9G A;  2L2P A;  3D7S B;  2YUN A;  4Q5W A;  4ZN3 A;  1VQN Q;  1TH7 A;  1YCS B;  3CMA A;  2DM1 A;  2CH4 A;  3OYN A;  2VYT A;  2E64 A;  1VQN A;  1V76 A;  4MDW A;  3WXM B;  2J6O A;  3CCE Q;  1AT1 B;  5J26 A;  2EQI A;  4M7D A;  2CP0 A;  2MK5 A;  2EJF A;  3C4S A;  2QXF A;  4JJC A;  4KRT A;  4N4H A;  3SWN A;  5DY9 A;  5IAY A;  1VQL Q;  5FU6 C;  4M75 E;  3EGD A;  6AT1 B;  3EG0 A;  2KRN A;  3SEM A;  4GLK A;  5LJ5 f;  2EQJ A;  2YHT A;  5LJ3 e;  1K8A R;  2EBP A;  2NUZ A;  1H92 A;  3UWN A;  5AT1 B;  3CCL Q;  4FYX B;  3EFS A;  3ZEH A;  3ER0 A;  3P8H A;  2DFU A;  3CCM T;  3QKJ A;  2MI6 A;  1SSF A;  2CP5 A;  1KFZ A;  4M7A D;  4XU2 A;  3FRN A;  1M1K C;  5KYU B;  1ZLM A;  2O88 A;  3QYH B;  3LX7 A;  4HA8 A;  2YRC A;  1C0M A;  3EGX B;  2O4X B;  1MNE A;  3VS0 A;  2GFA A;  2DIQ A;  3OYL A;  3OS2 A;  2H3E B;  1G3Y A;  2O01 E;  1W1F A;  3MP8 A;  2BZ8 A;  1K73 U;  3RUX A;  3GP8 A;  3A5Z B;  4C8Q C;  1T0H A;  1SHG A;  3L2R A;  5KE3 A;  4BE2 A;  2QTV A;  3REB B;  4J6W A;  2LZ6 B;  5HKC A;  3WVD B;  1N9R A;  2EPD A;  4J9H A;  4HVW A;  3HSB A;  2NUP B;  4RTX A;  2I2L A;  2D0N A;  1HD3 A;  2HBW A;  2A36 A;  5I2M A;  2O2O A;  1OX9 A;  2DRM A;  1GCQ A;  2XIC A;  3RKW A;  1BIA A;  1Q81 C;  3C12 A;  2NWM A;  1ZSZ A;  1MMA A;  1BI2 A;  1SRM A;  2J06 A;  2XDP A;  1XOV A;  3LGF A;  4EMK A;  2F2X A;  3QSU A;  4A63 B;  4O6J A;  4RTY A;  2JVV A;  1RAA B;  2DPP B;  4RCB A;  4DA4 A;  1LVK A;  1NG2 A;  4D8K A;  3CCU T;  1NJI U;  4M7D F;  1IB8 A;  1TUG B;  2DVJ A;  4DQ2 A;  3JCM c;  1ZUU A;  4PKC C;  5EC7 A;  5C0M A;  1N27 A;  3F70 A;  2RJC A;  3X25 B;  5CO7 A;  4RG2 A;  4X9C A;  2DYI A;  4LDW A;  3OB9 A;  4M77 D;  1VQ5 A;  2KVQ G;  4XTX A;  2MIO A;  4C92 G;  4FYW B;  3JB9 I;  1QVF P;  4JZ3 A;  3THK A;  2XK0 A;  2FEI A;  1W2B P;  1Q82 R;  1WJS A;  2QYZ A;  2MCN A;  1QCF A;  2DL3 A;  3KFV A;  4IIM A;  2EKH A;  1VUB A;  4JJN K;  1IZ6 A;  2EGC A;  1EX4 A;  1KHC A;  1XTD A;  2QAZ A;  1O75 A;  1UEB A;  1K4U S;  2KT8 A;  4E7Z A;  1K8A C;  1UDL A;  4CC4 B;  3JCM J;  3G6E T;  4KUD K;  2VXF A;  4IUU A;  3CCR A;  2M0O A;  5LJ3 d;  4OB1 B;  2K79 A;  1YJ9 A;  2L8D A;  4RTV A;  3E19 A;  5AYF A;  5D7U A;  2KY9 A;  2JS0 A;  4LD6 A;  4PJO F;  4BB7 A;  1ZA2 B;  1UGR B;  3MPU B;  2EYZ A;  2RA2 A;  1T3S A;  1VQ7 Q;  3INZ A;  3OA6 A;  4YTL A;  3V7R A;  4FYV B;  2DEQ A;  2KK4 A;  3CC7 T;  4F14 A;  2BZY A;  2QEX Q;  1IO6 A;  1GFD A;  3M0P A;  2ZPF B;  3OY9 A;  1ZQ1 A;  3OBY A;  3VS6 A;  1UFF A;  1KIK A;  4PJJ A;  2QEX A;  2IVW A;  3OYF A;  5GAN e;  3MJX A;  1SPK A;  2BKD N;  4DOV A;  1YJW Q;  3S6W A;  3CCJ Q;  4BDZ A;  1NLO C;  4MML A;  3OYK A;  4ELZ C;  1KQS P;  5FWC A;  4NL2 A;  2MYS A;  2VGN A;  2JMA A;  2K4Y A;  1HK9 A;  3VU3 C;  2RF0 A;  4OGC A;  1WIE A;  2GTO A;  2V8I A;  2OTL Q;  2P0P A;  2RB6 A;  1ZUY A;  3QWX X;  4IUV A;  1N8R U;  4JPB W;  4M75 G;  5GAM f;  4BAC A;  2VAS A;  2RQV A;  4OF1 A;  1AZG B;  2A0F B;  2XHC A;  2JTF A;  2JTM A;  3VS7 A;  3AT1 B;  3EH1 A;  2XKO C;  4E7H A;  5FRM A;  5GMK e;  1XQH A;  4QT7 A;  3RBB B;  4M7A C;  2EYY A;  5GAO q;  3BDU A;  5D6X A;  2EW3 A;  2LCC A;  2GFU A;  4OB0 B;  1UTI A;  4J8O A;  1JB0 E;  3EFO B;  4ANJ A;  1OQK A;  2COW A;  1OV3 A;  3FIF A;  1AWX A;  1U06 A;  3H0I A;  2LQN A;  4C5E A;  1R8O B;  1Y57 A;  4R56 A;  1M1G A;  2YT6 A;  3I5S A;  1RI9 A;  2RQW A;  2DK3 A;  1PHT A;  4BDY A;  1VQ9 T;  1IRX A;  4IUR A;  3GIB A;  1WJQ A;  4ESR A;  2CP7 A;  1YIT Q;  1WPY A;  2RI3 A;  2HKN A;  1PSF A;  3CBM A;  1D3B A;  1FX7 A;  3SHW A;  1D1B A;  1VQL T;  1G3T A;  3I56 T;  1YCY A;  5FW9 A;  1PSE A;  1OYX A;  2FRY A;  2KXD A;  2PUK B;  4AT1 B;  1ZSG A;  3EG9 B;  3JB9 J;  4NOY A;  3CCL T;  1YWO A;  4PLI A;  3RMS A;  2WSC E;  1NEB A;  3TVT A;  3CCM Q;  4QVC A;  4PK4 A;  4N0A C;  1M2V B;  1QWE A;  2DD5 A;  5J3B A;  4DBH A;  2HSE B;  5FRO A;  5LJ3 h;  4IIO A;  2EKO A;  2O9S A;  4QW2 A;  1G8X A;  4A4E A;  5GAN d;  4M77 C;  3RR6 A;  4E7K A;  2KRS A;  4PJL A;  3RMQ A;  1D1C A;  4L5G A;  2AKK A;  2PVG B;  1QVG A;  2MMP A;  4C92 F;  1N5Z A;  4FSS A;  2GTJ A;  2XU8 A;  4JLI A;  2YUO A;  1M27 C;  2DJZ A;  3G4S T;  3QPH A;  1QKX A;  5EG2 A;  4AMC A;  1YIJ T;  3JCM g;  3FLG A;  2OTJ T;  2DE0 X;  4CI0 C;  3OMG A;  3JCM Q;  1HYO A;  3M5A A;  5GAO p;  2K3B A;  3VS4 A;  5KYX A;  4LN2 A;  5CAI A;  4OMQ A;  1VOM A;  3Q1J A;  3FC3 A;  2IIM A;  4ZGJ B;  2V1R A;  2Y4Y A;  3CCU Q;  3MKD A;  1K9M U;  4FIB A;  4L6V 5;  3GLX A;  2LDM A;  1WX6 A;  3EG3 A;  3CCU A;  4F7U G;  4JZ4 A;  2AZV A;  1GBR A;  3I35 A;  1VIE A;  2RHZ A;  4AFS C;  2K5L A;  1YWP A;  4BUG A;  3HL8 A;  4IUT A;  2ED0 A;  1YJN T;  3QXE B;  2JXB A;  1UEC A;  4KGZ B;  3VRZ A;  1DJ7 B;  3SB2 A;  3L2U A;  1O9S A;  1E7O A;  3MEA A;  2VVK A;  3O5Z A;  4C8Q D;  1VQM T;  3JB9 G;  2SEM A;  3HKS A;  3M59 A;  2XMF A;  4E2F B;  4OB2 B;  4LUD A;  3E9G A;  8ATC B;  4ORZ A;  2AIR B;  3I55 T;  2KYM A;  3UAT A;  4C5G A;  3G6E Q;  5KYU A;  1FMW A;  2QA4 T;  4J6Y A;  2D9T A;  4M75 F;  2LC4 A;  1VYV A;  3PIP A;  3MHX A;  3C94 A;  2E6N A;  3EH2 A;  3VUZ A;  3G6E A;  3PT9 A;  2DNU A;  1MGQ A;  3EGX A;  2VB6 A;  2O4X A;  2RHY A;  5I21 A;  1WQ7 A;  2DET A;  3E1S A;  1QVG S;  2B86 A;  2MOX A;  3JCM h;  3QDF A;  3M0T A;  2RK1 A;  1KD1 U;  1ARK A;  1SRL A;  3ASK A;  4LUE A;  4M78 D;  3VV0 A;  2MWP A;  4JUV A;  1F1B B;  1Q86 U;  2EJG A;  2D8J A;  2FYK A;  4JJD A;  3VYG A;  5I11 A;  7AT1 B;  1VQP T;  1KC8 R;  1OZ3 A;  2ZPI B;  1GRI A;  2LJ0 A;  2ABL A;  4N4I A;  2B8A A;  4M4Z A;  2BE9 B;  2GBQ A;  3URG A;  3CC7 A;  1VQ8 T;  2NUP A;  4P5N A;  2LRQ A;  4XTU A;  3V8K A;  1M1K R;  2L0A A;  4XTY A;  1SEM A;  1YJW T;  2HSP A;  4AG1 C;  3CCJ T;  3M4Y A;  4DEX A;  2K57 A;  1ABO A;  4RCC A;  3HPW A;  5GAN h;  1UGQ B;  3N5B B;  1KQ1 A;  2OAW A;  1KK7 A;  3DLL A;  2CZ6 B;  2V8K A;  5FU6 B;  3PIO A;  2ED1 A;  3OSV A;  4KUL A;  2M02 A;  4JLG A;  2EYW A;  2LX9 A;  2DZC A;  3JV3 A;  1VQ6 T;  2R5M A;  3QBY A;  5D6W A;  1JEG A;  4NL3 A;  1UJ0 A;  2W10 A;  1ZX6 A;  1Q81 R;  2GQI A;  2PTK A;  1UGS B;  2KE9 A;  2EQK A;  5CKB A;  2EYX A;  3JRZ A;  4RTW A;  3OYD A;  3U23 A;  2O31 A;  4EMH A;  3H0H A;  4ZTJ A;  5I22 A;  3M0U A;  3EGU A;  5GAM e;  4C0Z A;  3TRE A;  2AK5 A;  4CC7 A;  2DXU A;  4OP0 A;  2X4W A;  2CGH A;  3GOX A;  2J6K A;  3MEV A;  1VQ9 Q;  2VWF A;  3P8B B;  2DX1 A;  3LLR A;  4PNO A;  4C8Q B;  1HJD A;  4XQ3 A;  2DJQ A;  1YIT T;  1PM3 A;  1VQ9 A;  1BCO A;  3A8L B;  2A3L A;  3QHS A;  3CCE A;  3UA7 A;  4E6R A;  1Y0M A;  1SKU B;  2DL4 A;  3GBQ A;  4J9B A;  1IRE B;  3OYY A;  3LW5 E;  4M7A A;  1NLP C;  3I56 Q;  2FZC B;  2CZ1 B;  2RPN A;  4IUQ A;  1VQL A;  2AT1 B;  5D6Y A;  1AOJ A;  1QMC A;  3I56 A;  1M2O A;  2FRW A;  2QGF B;  2FB7 A;  3VYH B;  5ECA A;  2K6D A;  2QK0 A;  1KC8 C;  2X4X A;  1B07 A;  3MP6 A;  2KNB B;  2RJD A;  1UUE A;  2KI7 A;  3CCL A;  2VGM A;  2IPO B;  4L59 A;  1HSQ A;  1AZE A;  1H3Z A;  4M7D D;  3M4G A;  2QTX A;  2E5Q A;  2LX7 A;  2MWO A;  3LWH A;  5A0D A;  2L89 A;  1UJY A;  4F7U F;  2BE7 D;  2KBT A;  2OJ2 A;  4ZN1 A;  1EIF A;  5HCK A;  3VKI A;  2QAS A;  3OYM A;  4KH1 B;  2WSE E;  3G4S Q;  3CXC A;  1YIJ Q;  3JB9 F;  2OTJ Q;  4C8Q E;  2AZS A;  3M54 A;  5HY6 A;  4XTW A;  3BFM A;  1NYF A;  3G4S A;  3A1P A;  2ATC B;  2DRK A;  3CEY A;  1YIJ A;  2ECZ A;  3EFO A;  1PD0 A;  4N0A A;  1PG5 B;  1H64 1;  2V1Q A;  3OW2 A;  2HQH A;  2RJE A;  5CVI A;  4OMN A;  3RNJ A;  1M4Z A;  4PJO D;  2LT1 A;  4M77 A;  2YLB A;  2COZ A;  1RL2 A;  4M78 C;  5GJV B;  1TUD A;  1SSH A;  1QVG P;  1I8F A;  1AEY A;  1IXD A;  2EAY A;  2CSI A;  4KT0 E;  5IH2 A;  1PD1 A;  2CUB A;  4ZGD B;  2CP2 A;  5GAM d;  1X43 A;  3CCS T;  4C5I A;  1MV0 B;  3C0C A;  3DB4 A;  3HHT B;  1H8K A;  5KE2 A;  3A8H B;  1YJN Q;  1YFN A;  1YNZ A;  1BYM A;  1ZHI A;  4D8D A;  3VRY A;  4XU0 A;  4DBR A;  3M55 A;  1TUC A;  3EG9 A;  1YJN A;  2DL8 A;  1VQM Q;  4XK8 E;  3QO3 A;  1X6G A;  1Q7Y U;  1G3S A;  3IQL A;  2F69 A;  1OI1 A;  4F04 B;  2RD1 A;  2RNA A;  4Y92 A;  4J5Y A;  1M3A A;  2KMT A;  4RKU E;  1FYN A;  2I0N A;  3I55 Q;  1M2V A;  1RUW A;  5IHI A;  4HT9 A;  2QA4 Q;  1BU1 A;  2XDB A;  3X26 B;  3I55 A;  1SHF A;  4WCI A;  1MHN A;  1M3B A;  1UE9 A;  3HRU A;  2CKK A;  4AFZ C;  2QA4 A;  1U8R A;  4FCY A;  2P4R A;  2DKG A;  1QLY A;  1XNI A;  2BZX A;  1GCP A;  1X6O A;  3V8L A;  1D0Z A;  4M7A B;  2LVM A;  1H3H A;  1E6H A;  5GAO n;  1ZBJ A;  1VQ7 A;  2XI9 A;  3RES A;  1I1J A;  1MMN A;  1VYU A;  3CXC S;  2BUD A;  2KR3 A;  1VQP Q;  2C0O A;  1Y96 B;  2H8H A;  3UA6 A;  1VQ8 Q;  5FRN A;  1M30 A;  4E7I A;  4BI8 B;  2X3X D;  1VQP A;  2KRO A;  3OW2 S;  1VQ8 A;  1X01 A;  1EFN A;  2WAC A;  1YJW A;  3CCJ A;  5LJ3 j;  2X4Y A;  2AKL A;  3H9N A;  3NGP A;  4J9I A;  3OYB A;  2HDA A;  1Q95 G;  2OTL A;  3EAE A;  2FPE A;  2KEA A;  5LJ3 g;  2VC8 A;  4EDU A;  1WZO A;  3QZ5 B;  5GAN 8;  2QQA A;  1K0X A;  3OMC A;  1YI2 T;  3M0S A;  1VQ6 Q;  3CQT A;  4QQG A;  2YRD A;  4XTV A;  5KYW B;  1K8A U;  3NMZ C;  2FPF A;  1YHQ T;  2F2W A;  2YUQ A;  2DA9 A;  2F2V A;  4PFO A;  3CCV T;  4M7D C;  2E4H A;  3C95 A;  2JZ2 A;  1C1A A;  3MEW A;  3SWN C;  3QJY A;  3X24 B;  3OYC A;  4M7A E;  1M5Q 1;  1FXX A;  1IGU A;  4M77 B;  3H41 A;  4WF2 A;  4PFP A;  1VQK T;  5GMK l;  5I2S A;  2CH4 W;  1V1C A;  1GFC A;  3G71 T;  2AHJ B;  4C92 D;  1TSF A;  2F5T X;  1QCO A;  5LJ3 f;  1WDX A;  4ZGE B;  1I5O B;  1W70 A;  5GAM h;  2JN0 A;  1YIT A;  3DKM A;  4KGX B;  1AVZ C;  2CT4 A;  1I07 A;  1W6X A;  5M9O A;  2DIG A;  2X9H A;  2JM8 A;  3OYA A;  3KBG A;  3M0Q A;  1X75 C;  2KGT A;  4WTO B;  4DBQ A;  5L23 A;  4PJO C;  1FMV A;  2EYQ A;  1NZ9 A;  4LD9 K;  1KHI A;  1AHJ B;  3R6O A;  3S3O A;  2E12 A;  1XJW B;  3PNW C;  3CCM A;  1QCN A;  1D0X A;  4OML A;  1ZA1 B;  2A28 A;  4E7J A;  4RTT A;  2QQS A;  2YUP A;  1M3C A;  2NUT B;  4A4H A;  5GAN 4;  1M90 R;  2K2M A;  1OU9 A;  5HK0 A;  3UDC A;  1RLP C;  1KG1 A;  1GCQ C;  2XID A;  3E9F A;  3OYH A;  1RAE B;  2Z0W A;  1TTH B;  4HCK A;  3CC4 T;  1PCX A;  5IXF A;  2RI5 A;  1P92 A;  1LOJ A;  5LJ5 e;  4BE0 A;  1Q82 U;  3CD6 T;  5GAN 2;  4M77 E;  2OAU A;  4EMK C;  3TEE A;  1SG5 A;  5IN1 A;  1Y7X A;  2LQW A;  3V7S A;  1NE8 A;  2K3Y A;  4GY5 A;  1TXQ A;  1YP5 A;  4HCC A;  2CUD A;  3TSW A;  2HCK A;  3LYI A;  3MET A;  4A54 A;  2DAQ A;  2VV5 A;  2ROL A;  1SF9 A;  4M75 D;  4LE9 A;  1WHG A;  4EPC A;  3CME T;  2PU9 B;  5GAN j;  5DLQ E;  1QVF A;  4C0D C;  4HVU A;  1W2B A;  4B9W A;  3ZBD A;  1PWT A;  5CCA A;  5GAO r;  2CP3 A;  1YN8 A;  4AG2 C;  3CC2 T;  2JUF A;  1PRM C;  3J81 E;  2CP6 A;  4C8Q A;  1VYT A;  2DO3 A;  2FG0 A;  5GAN g;  4HKE A;  2KQW A;  1R0C B;  3GF5 A;  2RI2 A;  3ME9 A;  3X20 B;  4RG8 A;  5GAN 3;  3GPL A;  1OU8 A;  2LJ3 A;  1MND A;  2CRE A;  3CCS Q;  4ME7 A;  2KYB A;  3NTI A;  3OS1 A;  3CCS A;  3JCM V;  3HFO A;  2VXE A;  3JCM f;  4BE1 A;  1RAF B;  2L3Q A;  5GMK j;  1U5S A;  2ZCF B;  2RJF A;  1K73 R;  1G3W A;  1WJR A;  1ABQ A;  3G1J A;  4B6M A;  1WXU A;  4BY6 B;  2HQX A;  3O8V A;  2RH2 A;  1G2B A;  1M8V A;  2XG8 D;  2EFI A;  2JJ9 A;  4F17 A;  1JBM A;  1WXB A;  4A4G A;  1I4K 1;  3GNG A;  1LNX A;  1Z9Z A;  1AD5 A;  1MMG A;  2DMO A;  2QQ9 A;  2K3X A;  1MUZ A;  1OZ2 A;  3H6Z A;  3ULR B;  4CRI A;  2L3R A;  5GAN f;  1M90 C;  2LQK A;  1BI3 A;  1JJ2 A;  2DZ9 A;  2HL3 A;  3PTA A;  4CC2 A;  5DM7 R;  1YJ9 T;  2CS7 A;  4EMG A;  4FW1 A;  2OX7 A;  4AFQ C;  1BI0 A;  2LP5 A;  1KQS A;  4PFZ A;  2CZ0 B;  2DEU A;  2DLP A;  4M7A G;  3LWI A;  5GMK m;  2RHX A;  3A8M B;  4Z8A A;  1NJI R;  3UT1 A;  1RLQ C;  4DBF A;  5LJ5 d;  4IUP A;  4C92 C;  4BI4 A;  2RM4 A;  2JS2 A;  1X2Q A;  2GNC A;  4FM4 B;  4TVR A;  3M56 A;  1QVF S;  5J39 A;  4LDY A;  4BY6 C;  2ZAE A;  4C0G A;  2E1H A;  2X35 A;  2GF7 A;  3LH0 A;  2EIF A;  2JM9 A;  2K9G A;  1WLP B;  3WVE B;  3QG1 A;  3M58 A;  3HFN A;  2QI2 A;  2QDL A;  1U1S A;  4LNP A;  4Y91 A;  9ATC B;  1M8M A;  4R55 A;  1PRL C;  1I5L A;  3L2Q A;  3MEU A;  4M75 B;  1YI2 Q;  1E6G A;  3BE3 A;  5CKH A;  3E2U A;  5C6S A;  3DB3 A;  4JS4 A;  1CSK A;  5IHK A;  1Z9Q A;  1KSW A;  8AT1 B;  2EGA A;  2FZG B;  4OMM A;  1YHQ Q;  4J7I A;  1PKS A;  2JOY A;  3S3M A;  3CCV Q;  1R77 A;  4A53 A;  1JO8 A;  5CK9 A;  1YHQ A;  3QJ6 A;  4XU3 A;  4MMK A;  2RMO A;  2J05 A;  5GMK h;  3L2Z A;  4C0F A;  1LCK A;  3P8D A;  1GBQ A;  2LNV A;  2E41 A;  2HZY A;  4OVA A;  1PNJ A;  2BIV A;  1IGQ A;  2NLU A;  2PUO B;  3UPU A;  1K73 C;  1VQK Q;  3BY7 A;  2DIL A;  1I0C A;  1YBY A;  2D0Q B;  1B3Q A;  1OPL A;  2LT4 A;  4M77 G;  1VQK A;  3G71 Q;  4NS5 A;  1S72 T;  2HEQ A;  3KXT A;  1AWW A;  1JJ2 S;  3G71 A;  1HXD A;  2RHU A;  2IG0 A;  1A0N B;  2LJ1 A;  4XU1 A;  5FLX E;  3JB9 D;  2RQR A;  1KQS S;  2PVO B;  3LGL A;  3ZFJ A;  2QGG A;  5GAO l;  1TOV A;  2RO0 A;  4M75 C;  2DYB A;  3H8Z A;  1JRI A;  2LCL A;  5CR2 A;  3JAM E;  4Z89 A;  1N8R R;  1EZZ B;  4HVV A;  2LNH B;  2EJ9 A;  1AWJ A;  1Y96 A;  3FJP A;  3PE0 A;  3MP1 A;  2M51 A;  3OS5 A;  2JMC A;  1NJI C;  1K0S A;  4M78 B;  2DTH A;  3L42 A;  3RIR A;  1WXT A;  1R0B G;  2LMJ A;  3V8J A;  4ZNX A;  4RTU A;  4PLL A;  1QVP A;  1NPP A;  1MMD A;  4RTZ A;  2M9U A;  1M9S A;  1OOT A;  5KYY B;  1V29 B;  3MCA B;  3TQ7 P;  3CC4 Q;  2KT1 A;  3CD6 Q;  4K11 A;  2DL7 A;  3CC4 A;  2EQU A;  4QKU A;  1Q7Y C;  1KQ2 A;  3CD6 A;  5KYW A;  3VS1 A;  2JT4 A;  2MAM A;  4PJO A;  2VUB A;  4JS5 A;  1CKA A;  3TCJ A;  2ZPB B;  4FT4 A;  5LJ5 h;  2OTJ A;  4HCZ A;  5CKE A;  2Y4X A;  4Z02 A;  1BIB A;  3ZL7 C;  1X27 A;  1B34 B;  5GMK i;  3JCM W;  5A0L A;  3CME Q;  2LQ8 A;  1BCM A;  2LTO A;  2DXB A;  1WYX A;  3CME A;  3REA B;  3QWY A;  1IHV A;  2O9V A;  2FHD A;  2W0Z A;  3CC2 Q;  3A98 A;  2L3S A;  2E70 A;  3PGG A;  3CC2 A;  1UHF A;  4MZP A;  1T3L A;  4X1V A;  4X34 A;  3JSC A;  4M78 E;  4M7A F;  1VQ4 T;  2PVD B;  2ZPE B;  1KC8 U;  3OBW A;  4F7U B;  1M1F A;  1M1K U;  2HAX A;  2HKQ B;  2C06 A;  4LXC A;  2YWW A;  1MV3 A;  3SDZ A;  1VQ5 Q;  2C0T A;  1QP2 A;  1QWF A;  3JCM P;  2V26 A;  1WHM A;  1VQM A;  1N8R C;  2FO0 A;  2RQU A;  3SFM A;  3HP9 A;  3T9N A;  1X6B A;  1UHC A;  3UF4 A;  2G6F X;  4RMO A;  4OB3 B;  2MPX C;  4BI3 A;  4O5V A;  1UB4 A;  2NUT A;  1GL5 A;  2QQB A;  4DOW A;  4IKF A;  2P0Q A;  5GAM j;  3JCM X;  1ACM B;  3CCR Q;  2V8J A;  5CQX A;  1YJ9 Q;  1BKB A;  3OS0 A;  2X4J A;  3JCM e;  2JW4 A;  3HRT A;  1Q81 U;  5CKF A;  1RAB B;  1G83 A;  2YRV A;  4M7D B;  1S1N A;  2EQM A;  3L2W A;  3PVL A;  5CIU A;  5GAM g;  1TS9 A;  3NTK A;  3RDV A;  3SWN B;  1D1A A;  1PKT A;  3VJP A;  2KSS A;  1BI1 A;  1ZBX A;  1K9M R;  3CPW A;  2VKN A;  2QQR A;  3L2V A;  2RK2 A;  1JXM A;  3EGD B;  3EG1 A;  3NHN A;  1VQO T;  4FT2 A;  2ROT A;  4LDU A;  4MZM A;  5FU7 B;  4FYY B;  4M77 F;  4F7U E;  2X3W D;  3PMT A;  4KUI A;  2J6F A;  1WHJ A;  1WNL A;  2LCS A;  1JJ2 P;  5GAO m;  2EGE A;  1TU0 B;  5GAN 7;  3CCQ T;  1Y07 A;  3QUI A; 
#chains in the Genus database with same CATH homology
 3WVD B;  1N9R A;  3PFS A;  3DLL A;  2DTO A;  2M16 A;  3V7C A;  4J6W A;  2CZ6 B;  3HSB A;  3LYI A;  4LDV A;  3MET A;  4A54 A;  2I2L A;  3OQ5 A;  2DAQ A;  2VV5 A;  2E6Z A;  5I2M A;  4M75 D;  2V8K A;  5FU6 B;  3PIO A;  4A4F A;  4EPC A;  2XIC A;  3OSV A;  4KUL A;  3RKW A;  4JRK A;  1BIA A;  2WSF E;  3CME T;  1VQ6 A;  2PU9 B;  5GAN j;  4JLG A;  5DLQ E;  1Q81 C;  2LX9 A;  1VQ6 T;  2DZC A;  3C12 A;  1QVF A;  2R5M A;  3QBY A;  4VUB A;  5D6W A;  4C0D C;  1BI2 A;  4NL3 A;  1W2B A;  2XDP A;  2L5Q A;  4B9W A;  3ZBD A;  5CCA A;  1XOV A;  3LGF A;  4C92 A;  4EMK A;  2P0K A;  5GAO r;  3QSU A;  4O6J A;  3CC2 T;  2JUF A;  3M53 A;  3J81 E;  4C8Q A;  1KD1 U;  2DO3 A;  5GAN g;  2DXT A;  2JVV A;  4HKE A;  2DPP B;  2KQW A;  3GF5 A;  4RCB A;  1UGS B;  4II1 A;  4DA4 A;  2RI2 A;  3ME9 A;  2HBP A;  3X20 B;  3CPF A;  4RG8 A;  3CCU T;  1NJI U;  3FEO A;  3SD4 A;  5GAN 3;  3GPL A;  2EQK A;  4M7D F;  5CKB A;  4M7D E;  3JRZ A;  3BDL A;  3OYD A;  2E65 A;  4ME7 A;  3NTH A;  4DQ2 A;  3JCM c;  4EMH A;  4PKC C;  5FU7 C;  4ZTJ A;  3NTI A;  4N4G A;  1N27 A;  5C0M A;  3OS1 A;  1Q82 C;  3F70 A;  2RJC A;  3X25 B;  3CCS A;  5CO7 A;  3JCM V;  3HFO A;  1I81 A;  2VXE A;  4QQD A;  4RG2 A;  4X9C A;  3JCM f;  3TRE A;  4C0Z A;  2DXU A;  4OP0 A;  4BE1 A;  4LDW A;  2X4W A;  3OB9 A;  2CGH A;  4M77 D;  2KVQ G;  3L1A A;  3MEV A;  4XTX A;  3GOX A;  2H3J A;  4C92 G;  4D6W A;  3JB9 I;  3CMA T;  4EMK B;  3P8B B;  5HK3 A;  3LLR A;  2XK0 A;  4PNO A;  4JRQ A;  1S72 A;  1VQN T;  4C8Q G;  1WJS A;  5GMK j;  2YLC A;  2ZCF B;  4C8Q B;  4XQ3 A;  2RJF A;  1YIT T;  1VQ9 A;  1G3W A;  4JRI A;  1WJR A;  3A8L B;  2P4T A;  4BY6 B;  2A3L A;  1VUB A;  3QHS A;  4JJN K;  3FB9 A;  1IZ6 A;  3CCE A;  2HQX A;  3O8V A;  1KHC A;  1XTD A;  2HD0 A;  2RH2 A;  4B9X A;  3S3N A;  3CCE T;  1O75 A;  1M8V A;  1UEB A;  2XG8 D;  4MZT A;  2EFI A;  1IRE B;  1JBM A;  2F5K A;  3LW5 E;  3OYY A;  1K8A C;  4A4G A;  4M7A A;  3KUF A;  1I4K 1;  3GNG A;  1LNX A;  5KCO A;  2CZ1 B;  3JCM J;  4IUQ A;  3X28 B;  3CPW S;  1GXI E;  3G6E T;  4KUD K;  1VQL A;  2EWN A;  5D6Y A;  3JCM d;  2QQ9 A;  2K3X A;  2VXF A;  4IUU A;  2PQW A;  3CCR A;  1OZ2 A;  3H6Z A;  3QYG B;  2M0O A;  2L3R A;  5LJ3 d;  3BW1 A;  4OB1 B;  4CRI A;  5GAN f;  1M90 C;  2LQK A;  1BI3 A;  4QQ6 A;  4C0D B;  2L8D A;  1YJ9 A;  2DZ9 A;  1JJ2 A;  3PTA A;  4JRP A;  2FB7 A;  3VYH B;  2CS7 A;  4EMG A;  5DM7 R;  3G7Z A;  3E19 A;  5AYF A;  4X9D A;  1YJ9 T;  1K9M C;  4OMF B;  1U1T A;  2KY9 A;  1KC8 C;  4LD6 A;  4PJO F;  2X4X A;  4BB7 A;  4PJO E;  1BI0 A;  3MP6 A;  2D6F A;  2RJD A;  1KQS A;  3CCL A;  2CZ0 B;  2K5I A;  2VGM A;  1WGS A;  1UGR B;  4M78 G;  3RER A;  2Y90 A;  2RA2 A;  4M7A G;  4L59 A;  3INZ A;  1H3Z A;  3OA6 A;  3LWI A;  4YTL A;  3V7R A;  3M4G A;  4M7D D;  4V2S A;  2QTX A;  2DEQ A;  4FU6 A;  5GMK m;  3HRS A;  2RHX A;  2E5Q A;  3A8M B;  2KK4 A;  3CC7 T;  2MWO A;  3UT1 A;  2CYZ B;  3LWH A;  5A0D A;  2ZPF B;  5LJ5 d;  3OY9 A;  1ZQ1 A;  2DXC A;  2JNG A;  2L89 A;  3OBY A;  4IUP A;  4F7U F;  5GAM e;  1N9S A;  4C92 C;  4BI4 A;  2QEX A;  2IVW A;  2RM4 A;  3OYF A;  5GAN e;  4M75 A;  3CBP A;  2BKD N;  2K2V A;  4FM4 B;  4TVR A;  3M56 A;  4DOV A;  4ZN1 A;  3S6W A;  5J39 A;  5DLO A;  4LDY A;  1QVF S;  4BY6 C;  4BDZ A;  4MML A;  4C0G A;  4C5H A;  3OYK A;  2E1H A;  3OYI A;  3J80 E;  1EIF A;  4ELZ C;  2X35 A;  2GF7 A;  3LH0 A;  2EIF A;  3VKI A;  3OYM A;  3NFC A;  3WVE B;  2WSE E;  4NL2 A;  3QG1 A;  3M9Q A;  3M58 A;  3CXC A;  1WQW A;  2VGN A;  3HFN A;  3JB9 F;  2K4Y A;  2QI2 A;  1HK9 A;  3VU3 C;  4OGC A;  1U1S A;  2V8I A;  2QDY B;  4Y91 A;  4UC4 A;  3M54 A;  4C8Q E;  5HY6 A;  4XTW A;  3TU4 K;  2P0P A;  3BFM A;  3QZ9 B;  3G4S A;  2RB6 A;  1YIJ A;  3CEY A;  2KDS A;  4JDS A;  4R55 A;  4IUV A;  1N8R U;  1I5L A;  3L2Q A;  3MEU A;  4M75 G;  2FL7 A;  5GAM f;  4M75 B;  4BAC A;  4N0A A;  4KBM B;  4ATO A;  1H64 1;  3OW2 A;  2RJE A;  4OF1 A;  4QVZ A;  5CKH A;  1KD1 C;  2XHC A;  2JTF A;  5C6S A;  5A0G A;  3DB3 A;  4JS4 A;  5CVI A;  4J83 A;  2JTM A;  1QP3 A;  3L2W A;  1M4Z A;  4PJO D;  2LT1 A;  4M77 A;  2YLB A;  2XKO C;  1RL2 A;  4J7I A;  4E7H A;  1Q86 C;  5CKD A;  5GMK e;  2JOY A;  5FRM A;  3S3M A;  2FVU A;  1XQH A;  4M78 C;  4A53 A;  3MO8 A;  5CK9 A;  4M7A C;  5GAO q;  1YHQ A;  3QJ6 A;  4XU3 A;  3BDU A;  4MMK A;  5D6X A;  1I8F A;  2LCC A;  5GMK h;  2GFU A;  3L2Z A;  4OB0 B;  4C0F A;  2EAY A;  4J8O A;  1JB0 E;  3P8D A;  4KT0 E;  3OYJ A;  5A2Q E;  1VQ5 A;  2LNV A;  2R57 A;  2E41 A;  4OVA A;  2BIV A;  4ZGD B;  2NLU A;  2PUO B;  5GAM d;  3UPU A;  1K73 C;  3CCS T;  4E47 A;  1VQ4 A;  4HT8 A;  3BY7 A;  4C5I A;  3FIF A;  1YBY A;  3DB4 A;  3HHT B;  2D0Q B;  4C5E A;  4C92 B;  5KE2 A;  1VQ5 T;  1G5V A;  5CQY A;  1VQK A;  2LT4 A;  1R8O B;  4M77 G;  3JB9 H;  3A8H B;  3QDR B;  1M1G A;  4NS5 A;  4R56 A;  1S72 T;  1BYM A;  1ZHI A;  2G3R A;  3KXT A;  2DK3 A;  4XU0 A;  2ZZD A;  1QW1 A;  4BDY A;  1VQ9 T;  1JJ2 S;  5KCH A;  3M55 A;  4IUR A;  3G71 A;  1YJN A;  1WJQ A;  4XTZ A;  3JCM b;  3GIB A;  1HXD A;  2CZ7 B;  2IG0 A;  2RHU A;  4XK8 E;  3QO3 A;  3EFR A;  3QII A;  1N6A A;  4XU1 A;  1Q7Y U;  4E7L A;  1G3S A;  5FLX E;  3JB9 D;  1KQS S;  4M78 A;  2PVO B;  3LGL A;  1WPY A;  2F69 A;  1OI1 A;  2RD1 A;  2RI3 A;  1PSF A;  3CBM A;  4J5Y A;  3ZFJ A;  2KMT A;  5GAO l;  1D3B A;  2RO0 A;  4RKU E;  4M75 C;  1FX7 A;  3H8Z A;  1JRI A;  2LCL A;  4HT9 A;  1VQL T;  5CR2 A;  3JAM E;  1G3T A;  3CCR T;  2XDB A;  3I56 T;  3X26 B;  3I55 A;  1MHN A;  1YCY A;  2EJ9 A;  1PSE A;  2CKK A;  3GNF B;  3HRU A;  1Y96 A;  1OYX A;  2QA4 A;  2PUK B;  1U8R A;  3FJP A;  3MP1 A;  3JB9 J;  2DKG A;  4NOY A;  3OS5 A;  2RHI A;  1XNI A;  1NJI C;  3CCL T;  1Y71 A;  1X6O A;  4PLI A;  4M78 B;  2DTH A;  2ZGW A;  3V8L A;  3RMS A;  3L42 A;  3RIR A;  4M7A B;  2LVM A;  3OSS C;  2WSC E;  4QVC A;  1D3B B;  1UGP B;  3V8J A;  2ZPG B;  5GAO n;  4N0A C;  4M7D G;  4PLL A;  1VIF A;  1VQ7 A;  2DD5 A;  1QVP A;  1NPP A;  2K5F A;  2XI9 A;  5J3B A;  3RES A;  3CXC S;  1VQ7 T;  3PMI A;  3VUB A;  2BUD A;  5FRO A;  5LJ3 h;  4QVD A;  2M9U A;  1M9S A;  3RKY A;  2EKO A;  4QW2 A;  1V29 B;  4FL6 A;  4A4E A;  5GAN d;  3MCA B;  1Y96 B;  2QEX T;  5FRN A;  4M77 C;  4E7K A;  2R5A A;  2A7Y A;  4E7I A;  4BI8 B;  5GAN 5;  1VQP A;  3RMQ A;  1B34 A;  1VQO A;  3M57 A;  3OW2 S;  1VQ8 A;  2KAF A;  4L5G A;  4A4K A;  1W2B S;  1X01 A;  3A8G B;  3CC4 A;  1FWZ A;  2EQU A;  2PVG B;  2WAC A;  4PL6 A;  1YJW A;  4J6X A;  1QVG A;  3CCJ A;  1Q7Y C;  1KQ2 A;  3J7A F;  5LJ3 j;  2MMP A;  2X4Y A;  2DVE A;  4C92 F;  4C92 E;  3CD6 A;  2MAM A;  1RI0 A;  4MDX A;  4PJO A;  2XU8 A;  2VUB A;  4C8Q F;  4JLI A;  4JS5 A;  3TCJ A;  2DJZ A;  2ZPB B;  2ZPH B;  4FT4 A;  3OYB A;  5LL6 S;  1LJO A;  5LJ5 h;  3G4S T;  3QPH A;  2OTJ A;  4HCZ A;  5CKE A;  5EG2 A;  1YIJ T;  3CCQ A;  3JCM g;  4BD3 A;  4PJO B;  3FLG A;  3EAE A;  3OYE A;  2Y4X A;  4Z02 A;  2OTL A;  2OTJ T;  1BIB A;  4CI0 C;  5KH6 A;  5LJ3 g;  2VC8 A;  3OYG A;  2OTL T;  4J7F A;  4EDU A;  3QZ5 B;  1B34 B;  2HQE A;  5GMK i;  3JCM W;  2E10 A;  5A0L A;  1YI2 A;  5L8R E;  2R58 A;  5GAN 8;  2QQA A;  3OMG A;  3OMC A;  1YI2 T;  3JCM Q;  2LQ8 A;  1NPR A;  2LTO A;  3M5A A;  4QQG A;  3AHU A;  2DXB A;  4XTV A;  4F7U A;  4HCB A;  5LJ5 j;  3CME A;  1K8A U;  4PJO G;  5GAO p;  2FHD A;  4XAX B;  2GCX A;  3A8O B;  3CBO A;  4ELY C;  1YHQ T;  3RKX A;  3CCV A;  5CAI A;  5IT9 E;  3FC3 A;  3Q1J A;  3CCV T;  2HNI A;  4M7D C;  3C95 A;  2E70 A;  4ZGJ B;  2DTI A;  2JZ2 A;  2XDD A;  1M90 U;  2Y4Y A;  3MEW A;  3PGG A;  3CC2 A;  4MZP A;  5LJ5 g;  4X34 A;  3SWN C;  3FDR A;  3QJY A;  2GQV A;  4M78 F;  3X24 B;  3JSC A;  4M78 E;  5GAN 6;  1K9M U;  2DD4 A;  4M7A F;  4FIB A;  2PVD B;  2ZPE B;  4L6V 5;  4OGE A;  2M1H A;  3GLX A;  3OYC A;  1W4S A;  2LDM A;  1KC8 U;  4M7A E;  3CCU A;  3OBW A;  4Y28 E;  1M5Q 1;  1FXX A;  4M77 B;  4F7U B;  4F7U G;  1M1F A;  3DLM A;  4WF2 A;  4ZTF A;  1M1K U;  1VQK T;  1VIE A;  2C06 A;  5GMK l;  2HAX A;  2XD0 A;  2RHZ A;  5I2S A;  4FSX A;  2K5L A;  4BUG A;  2MF2 A;  3HL8 A;  4LDX A;  4IUT A;  3SDZ A;  4Q5W A;  4ZN3 A;  3G71 T;  3QXE B;  1YJN T;  1QP2 A;  2AHJ B;  4C92 D;  3JCM P;  1TH7 A;  1DJ7 B;  3SB2 A;  3L2U A;  3CMA A;  2F5T X;  1O9S A;  3MEA A;  5LJ3 f;  2VYT A;  4C8Q D;  3OYN A;  1VQM A;  2E64 A;  4ZGE B;  1N8R C;  1VQN A;  1VQM T;  4MDW A;  3SFM A;  5GAM h;  3JB9 G;  3HP9 A;  3WXM B;  2JN0 A;  3T9N A;  1YIT A;  3DKM A;  3HKS A;  3M59 A;  5J26 A;  4RMO A;  4OB3 B;  4M7D A;  4OB2 B;  3C4S A;  2EJF A;  2QXF A;  4BI3 A;  5M9O A;  2DIG A;  4N4H A;  3E9G A;  4O5V A;  3SWN A;  3OYA A;  3I55 T;  5DY9 A;  1UB4 A;  3KBG A;  2QQB A;  4C5G A;  1X75 C;  5IAY A;  4DOW A;  4IKF A;  2P0Q A;  2QA4 T;  4J6Y A;  2D9T A;  4M75 F;  2LC4 A;  5FU6 C;  4M75 E;  3JCM X;  5GAM j;  3PIP A;  3MHX A;  4PJO C;  2V8J A;  3C94 A;  2E6N A;  3VUZ A;  2EYQ A;  3G6E A;  1NZ9 A;  4LD9 K;  1KHI A;  1AHJ B;  3R6O A;  3PT9 A;  5CQX A;  1MGQ A;  3S3O A;  2E12 A;  1BKB A;  2O4X A;  2RHY A;  4GLK A;  1WQ7 A;  2X4J A;  5I21 A;  2EQJ A;  5LJ5 f;  3HRT A;  3JCM e;  3OS0 A;  3E1S A;  2YHT A;  1Q81 U;  5LJ3 e;  5CKF A;  1QVG S;  2YRV A;  4M7D B;  3UWN A;  2EQM A;  3EFS A;  3PNW C;  2RK1 A;  3ER0 A;  3JCM h;  3ZEH A;  3P8H A;  5CIU A;  3ASK A;  5GAM g;  3CCM A;  3NTK A;  3CCM T;  4E7J A;  3QKJ A;  2MI6 A;  4M78 D;  3VV0 A;  1UGQ B;  1SSF A;  2QQS A;  3SWN B;  2MWP A;  4M7A D;  4XU2 A;  1VQ4 T;  4A4H A;  5GAN 4;  3FRN A;  1M1K C;  4JUV A;  3VJP A;  5HK0 A;  2KSS A;  1Q86 U;  2EJG A;  1BI1 A;  1ZBX A;  2FYK A;  3UDC A;  3VYG A;  3CPW A;  1KG1 A;  3QYH B;  3LX7 A;  2QQR A;  4HA8 A;  2RK2 A;  3L2V A;  1VQP T;  1OZ3 A;  2ZPI B;  3URG A;  3CC7 A;  2B8A A;  2XID A;  4N4I A;  1VQO T;  3E9F A;  4FT2 A;  3OYH A;  1VQ8 T;  4P5N A;  2O4X B;  2LRQ A;  4LDU A;  4MZM A;  4XTU A;  3V8K A;  3CC4 T;  4XTY A;  2GFA A;  5FU7 B;  1YJW T;  2DIQ A;  3CCJ T;  3M4Y A;  2RI5 A;  1P92 A;  1LOJ A;  5LJ5 e;  3OYL A;  4BE0 A;  1Q82 U;  3OS2 A;  4M77 F;  3CD6 T;  5GAN 2;  4M77 E;  1G3Y A;  2O01 E;  2OAU A;  3MP8 A;  4EMK C;  4F7U E;  3I56 A;  1K73 U;  3TEE A;  2K57 A;  3PMT A;  3RUX A;  5IN1 A;  4KUI A;  3A5Z B;  3GP8 A;  1Y7X A;  4C8Q C;  3V7S A;  1WNL A;  4RCC A;  3L2R A;  1NE8 A;  3HPW A;  2K3Y A;  5KE3 A;  5GAO m;  4GY5 A;  4BE2 A;  5GAN h;  5GAN 7;  3CCQ T;  4HCC A;  1Y07 A;  3QUI A;  3N5B B;  5HKC A;  1KQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...