3ZBUA

Ferredoxin-nadp reductase mutant with ser 80 replaced by ala (s80a)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYAIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNEKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
molecule tags Oxidoreductase
source organism Nostoc sp. pcc7119
publication title A Hydrogen Bond Network in the Active Site of Anabaena Ferredoxin-Nadp(+) Reductase Modulates its Catalytic Efficiency.
pubmed doi rcsb
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3zbuA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3zbuA02
1JNYA 1KRHA 3I1FA 1U2RA 4RJLA 4P6VF 2VNKA 4AF7A 1QH0A 2FX3A 1KC8D 2EIXA 4RCZA 2BF4A 2VYQA 1B2RA 3WY9A 4ACBA 4NCNA 3CC4B 1K9MD 1DDIA 3AVWA 4M2LA 1JJ2B 2BM1A 3W2EA 1S72B 4N3GA 3WYAA 2E1RA 4K1XA 3W2HA 5H59A 3QFSA 1CQXA 1KK2A 1M90D 3VO1A 1R5BA 4ZCIA 1FNBA 3AVVA 4YAOA 4LBWA 5AN9A 2QEXB 1XB2A 2DCUA 3V76A 3QFRA 2XNJA 2ZITA 3CCVB 5TY0A 1BQEA 4ZCMA 2DEUA 3PENA 1EFUA 4PC3A 3CCJB 3WNDA 1QUEA 1D1NA 2BMWA 1QFJA 4PC2A 3WNCA 3MCAA 3OZUA 1YJ9B 3ZBUA 4RD0A 3CD6B 1GAQA 3CCQB 1BJKA 1H42A 4QFMA 4AC9A 3U2QA 4B4DA 3P26A 1ZM9A 1QUFA 4G1VA 1YJWB 4P3YA 1QVFB 3J81k 4DQLA 2VZLA 4TMTA 2PMDA 4C0SA 3B8HA 3B78A 4M53A 4TMVA 4MYUA 1G7TA 1D8TA 4ZGNB 1KK3A 3FJOA 1NJID 1ELOA 2C78A 1QFYA 5THXA 1TVCA 1W34A 3WXMA 3CCLB 3MHPA 4PC7A 2OTLB 1H85A 1YI2B 1BX0A 1VQ5B 1GAWA 1VQLB 1IB0A 1Q82D 1F60A 2PIAA 3OJXA 3FPKA 3OZWA 4WQMA 1JA1A 1R5NA 1EFCA 1K8AD 1VQMB 4LBYA 4ZCLA 4LC0A 5GV8A 3E1YE 3CXCB 2VNIA 2QMUA 3CPWB 4B43A 1VQ9B 2BGJA 2BM0A 1TLLA 3OW2B 3JQPA 1EP2B 3LYUA 1CNEA 1QFZA 1KQSB 1KK1A 2B7CA 2BVNA 3JQRA 1QG0A 3CC2B 4ACAA 3CMAB 5FA6A 2CRVA 4F7DA 1KTVA 1YIJB 4B47A 2DY1A 5HXBA 2GQFA 1ZM3A 2HCJB 2R6HA 2YWFA 5TV2A 1OGJA 4H9GA 3W5UA 3U6KA 4YAUA 2BN4A 4U9UA 1EWYA 4FWTA 2XNCA 3QFTA 4B48A 3WNBA 3OJWA 4PGOA 4TMXA 1I7PA 4B44A 4C43A 2YWEA 5H5JA 1F20A 3G71B 3AGPA 1W87A 3SJZA 3AVUA 4Y9UA 4YAWA 3VNVA 1Q7YD 3W5HA 4DQKA 5TR9A 1DDGA 3CRZA 2QA4B 1VQNB 3QSYA 1FNMA 1WDTA 3ZZTA 4UAJA 4EH1A 1FDRA 3CCSB 2YWHA 3W2FA 1AIPA 2BPOA 2OK7A 4LBZA 3QE2A 1SM4A 3LVBA 1G7CA 1D2EA 1HA3A 1VQ6B 3A1FA 4ZV4A 3ZZUA 1FRNA 4TMWA 1TUIA 1EP3B 2BV3A 1KK0A 4ZGQB 1B23P 3E20A 1QX4A 1KJZA 4R71A 1VQ4B 1UMKA 1G7SA 1QGZA 4QHYA 2OTJB 1KD1D 1QVGB 4IW3B 5JBQA 3VMFA 1AMOA 4YALA 1GJRA 1QGAA 3G4SB 5KSWB 4HE5A 2B7BA 1IJEA 2BGIA 2QN6A 1GR1A 4M4SA 3CCEB 2B5OA 1M1KD 4TMZA 2GPJA 1IJFA 1FNCA 3ZBTA 3CCUB 2D74A 4LBVA 4B3XA 1GO2A 4Y9RA 3ZZ0A 1VQPB 4TN1A 1QGYA 3CCMB 4RD3A 4AF6A 3VO2A 1K73D 5EMNA 3AVTA 1NDHA 2NPFA 3ES9A 4PC6A 4N3NA 4HE6A 1G7RA 1N8RD 1VQ7B 2QTLA 1Q86D 3CCRB 3P27A 4RD2A 3CMEB 1J9ZA 1SKQA 1YJNB 1OB2A 1A8PA 4G1BA 3AVYA 1R5OA 2HDNB 1TTTA 1ZUNB 3W2IA 2EFGA 4BPRA 3ZC3A 4FK8A 4G5GA 2BSAA 1E63A 3MMPA 2CNDA 1YITB 1VQKB 1VQ8B 2J7KA 3WBKA 1FNDA 5GV7A 1E64A 2X3UA 1Q81D 2YWGA 1W2BB 2OK8A 1N0VC 3LRXA 3I55B 2XEXA 1EXMA 1JA0A 3G6EB 2RC5A 3QFCA 1N0UA 4Y7CA 1FRQA 1ZM4A 4RD4A 1OB5A 1CNFA 4MYTA 2VNJA 1YHQB 3CW2A 1EP1B 4YHBA 1EFTA 2DERA 4FN5A 4NBSA 1OGIA 4RD6A 1S0UA 2AHOA 3U6BA 3CB4A 3OZVA 1XE1A 4YAFA 1VQOB 3VNUA 4M1KA 1BX1A 1GVHA 3AGQA 1ZM2A 2HMAA 3JQQA 3WBJA 1DG1G 1E62A 4RD1A 3W2GA 4Q7JB 3B82A 4RCYA 2QTZA 3AVXA 2VNHA 2PLFA 5DSZA 4J0QA 2DETA 3I56B 4PC1A 4M0LA 2C77A 3W5VA 3CC7B 1JB9A 3LO8A 1W35A 1DARA 2RC6A 2QDXA
chains in the Genus database with same CATH superfamily
2JEYA 1JNYA 2WWYA 1UM9A 4DUGA 1KFEB 2NN3C 5ULLA 1HNWB 4FYVA 1I1OA 3DVLA 5CCEA 1NVUQ 5E9QA 3V46A 3L4EA 4EZIA 2WIDA 3DLBA 3JTEA 3OT5A 5KYXA 2G9ZA 4P5PA 4UOQA 1QIHA 2A9QA 2IYQA 4IGFA 3IVGA 1EEXB 2A9JA 2HK7A 2OE2A 2WEKA 2ZIZA 3O7MA 2VHWA 1NBMD 4ACBA 5AUQA 4OJQA 3ZPNA 1VPLA 1PGPA 3LDHA 1PJCA 2ZJ5A 1VE6A 3JWHA 5CA1B 1EWTA 1P5JA 1UJ2A 4DBLC 2DT8A 3ZKWA 3GELA 1LVUA 4LRQA 2APJA 1GPKA 4JL8A 3W7VA 3EPHA 5TS2A 4QJBA 3GLIA 4UHHA 4MYDA 4GQAA 3R9XB 3F71A 4FSHA 1OYVA 1WSDA 2PKEA 4YS6A 3U4IA 3H87A 5JEEA 2UVPA 3FOZA 7REQB 1MAVA 4EHKA 3STUA 3UPTA 4OHYA 1Y1RA 1SHLA 5KX5B 4B17A 3KZNA 5JY1A 1N5MA 4E5SA 1GRNA 5I5GA 1KYVA 3U26A 1TCCA 2QQFA 4CWAA 3TBKA 4C2UA 1PWZA 1TJPB 3UK7A 4CTMA 3QFSA 3GSIA 1PFYA 2VQFB 2IYSA 4B3FX 2PEYA 4HLNA 5DH9A 1HNXB 2Q1TA 2QX7A 1Z16A 5ALKA 2YN2A 1YZGA 4X61A 4F1JA 821PA 1KEEB 2OORA 3OX1A 1QJCA 3HU5A 2FPRA 1TFUA 4F6LA 3IUNA 4PCAA 1C2TA 5IVKA 2QTGA 3RE1A 3SF8B 4F9TA 5LZ9A 2XWBF 2P6RA 4NAUA 2CJWA 1XMVA 1JMYA 4IIBA 1MC5A 3TNFA 3TEMA 3OLWA 1F0PA 4QTXA 4O0MA 2GJKA 1J0BA 2ILVA 1JHDA 4P3XA 2XMZA 1RMYA 1FVOA 2XLCA 3ZDXB 4CEIA 1F4LA 2PGDA 1JLKA 2VTKA 3BTOA 3ZHQA 1CRPA 4XEUA 1N2XA 4JEUA 3D6NB 5CFOA 1B4DA 1G20E 1UKYA 2J85A 3PUVA 2J59A 5HE8A 4B32A 5LD2C 2XNJA 1H0HA 2DTEA 1QFSA 4Z9XA 1PFGA 2EG5A 1QPZA 1E32A 2X1VA 3MTQA 4QOFA 1R6TA 3TSYA 1OT5A 1O2DA 3EUAA 4B3BA 5CIYA 2R7KA 2BBWA 2DH5A 3CVOA 2DEUA 3WGZA 3QVVA 3ZD8A 4EX7A 4NR0A 3WNDA 1KFCB 2VKQA 1B3RA 2OBBA 1JXOA 1LNZA 1Z4QA 2VS1A 3ESRA 3FCOA 4FW8A 1QDLB 3BIXA 4UDNA 5CEEA 1YMUA 3RBZA 1PGQA 1UBJS 1N2IA 1V8ZA 2Q3EA 2Q5QA 2Z8XA 4ZRDA 3KPUA 5BSMA 2GK3A 3INGA 4R5HA 3Q7PA 4Z0NA 4X65B 4UM5A 2CLLB 4LJ4A 1F0NA 2VDKB 2JA1A 4INJA 2NUTA 3OZCA 2HUPA 5C9ZA 3JSAA 2IA5A 1EDEA 4AUNA 3PF8A 2NYUA 1WZ2A 1EB9A 3KC2A 3KP1A 4MSUA 3ONEA 4RVHA 4AJ9A 2G7MC 3ASSA 2FEAA 3TTYA 4OKSA 3IDOA 4KXMA 2R5WA 2A57A 3CUTA 2OZEA 4TTAA 3HCBA 3IJPA 4EJMA 1X77A 2BGRA 1CY8A 4JBHA 4RE6A 1DG3A 1XCJA 2FRDC 3EZYA 4W4TA 3CVXA 3P26A 2XYHA 2WF8A 2D62A 2C7VA 5I9SA 4J4TA 5KOYA 1OX4A 1SHKA 3EC7A 2B83A 2BGLA 4KSCA 3H13A 5C8YA 1OCEA 4JI3B 1W6UA 4CLRA 4MVJP 2FQ1A 4RMNA 3U80A 2ICAA 2ZTMA 2PLAA 2X6TA 2ZRAA 1XT6A 3IE0A 1HF3A 1M2NA 2IK8A 3ABRB 3UJ9A 1SRQA 2GDJA 4BNZA 5IZCC 4RHUA 3GVKA 1S1CA 3ZU5A 2WOOA 3ENKA 2VCHA 5DM60 3MGBA 4IXNA 3T54A 2AFRA 4E2FA 1QFYA 3DZFA 1ZR2A 1NB9A 4EMSA 5F9FA 5D84A 4JQZA 1W34A 5ECYA 1AGXA 1YFZA 1CS0A 2W9XA 2H2IA 3FFXA 4ZP1A 3WADA 2P4SA 2V4UA 4HN4B 2AJTA 2QN2A 2PWPA 3LPCA 1MQ9A 1RQGA 2PSHA 5EI5A 1AM4D 1PK9A 4TWIA 4Z4RA 1ZK2A 4ENTA 4XLEA 1NAIA 3A37A 3N7AA 1L4KA 1GGKA 7REQA 1EFDN 2ZVPX 4DSOA 1DC6A 1A97A 1VSQA 2V1XA 1YU9A 4QM7A 4NFHA 3WGTA 1TU3A 2EKPA 5C8YF 1L7AA 1XC7A 2IYNA 4QPNA 2YMLA 1CYDA 3OCZA 2PH7A 1RAIA 1RKXA 1U4OA 3IP5A 4MR8A 4EYEA 2PO7A 1WOSA 2FFBA 2G4LA 4AJIA 2I1QA 4DLRA 4EUKA 4ND3A 1A04A 3E1YE 1VMEA 2VSYA 1I30A 2VNIA 3CZPA 1HZZA 2JAOA 5ALHA 5K1ZA 2XRYA 1OFGA 4C7MA 5BPFA 2QA5A 2G82A 2XUJA 1AB5A 4Q48A 5E3JA 5JNSA 4Q9IA 1EHCA 3PEEA 2BM0A 4E21A 2I8LA 5F51A 4X1KB 3GJRA 4JLPA 1M0SA 1AZSC 4KNWA 2B9VA 1QFZA 1TF2A 3V3KA 4A1FA 1GUFA 1P7ZA 5C37A 3H2IA 1WU8A 3P4YA 4YCAA 2P8SA 3IEKA 5FA6A 3IR5A 1XOIA 3C6QA 4M9QA 4Y2UA 1SCQA 2R8ZA 3DSRA 4DMFA 3C3CA 4GI1A 4CCAA 1RQXA 4EI8A 2DY1A 3BJZA 4OJTA 4PR0A 3Q7EA 3UYKA 4IFIA 4CMAA 2CNOA 5DWDA 4RTMA 3QE4A 4Z8XA 1IMOA 3H7AA 3VTAA 1W1IA 2ZR7A 4WLUA 3WYBA 1ZMRA 1Q57A 2Q3MA 2XWSA 3REQA 5FUWA 4B1FA 2BDUA 3BN3A 5A6VA 3ADOA 3AFOA 3TVDA 4LJRA 1MPTA 1YBAA 2ZETA 2F3UA 2GK6A 1AKWA 3AB3A 3BREA 3DOOA 2JFQA 2HTEA 5F5NA 4J0FA 4F56A 4UUMA 4QUZA 1XA3A 2I62A 1ZEJA 3F9CA 2IT1A 1O8CA 2XOEA 4ZHQF 2JIMA 4EOGA 1NY6A 1AT1A 4J16A 1AN0A 2ZT7A 3DONA 2GO1A 2GRJA 2AKAB 3VSDA 1WBBA 2Q1WA 4LGCA 2Y1KA 1J8DA 4JEIA 1M8PA 3U1VA 3C3JA 4PCLA 4Y6QA 1CS4C 4EL5A 1K2VN 3SC4A 4N5NA 2JCYA 2O6LA 1BPLA 4TMYA 4INPA 3STVA 2QM3A 3AVUA 4YAWA 1L4LA 1J07A 3PC4A 3I9V6 4N3BA 3BPSA 1JFSA 3CWZA 3BJEA 3QM1A 4UU7A 1VKNA 4XM1A 1H9AA 3PC6A 4HYQA 4DLVA 2C4VA 1HE5A 3JAKA 5AXBA 2A9RA 1A5AB 2B0CA 1G20A 3C5EA 3CA8A 3F74A 4IUBS 1E9EA 1JQAA 1K4YA 3NAGA 4R0VA 1BXZA 1E3WA 2J9FB 4JI6B 1TEZA 1AZLA 5BV0A 4MUKA 2H0QA 4G0QA 4YONB 2O3RA 1M34B 3RVSA 3THYB 4CMCA 2D3WA 4UAVA 2V96A 3TW0A 4E2ZA 1LUAA 1AB6A 2IHNA 4L07A 3FRJA 4AIIA 3IMKA 2PRIA 4M87A 4LBZA 2XHEA 2NU6A 3R3SA 3CUEF 4OU4A 1VQ6B 2JAPA 4LHSA 1I6KA 2D4AA 3BXFA 5ETJA 4BV3A 1E5QA 1CUXA 1AGRA 3F67A 3PEFA 5A6SA 2P27A 4MVJI 3PQEA 3LNTA 2R1VB 1AHHA 3OY7A 4XQEA 4RHYA 4EEKA 3SQWA 2Q6VA 4GP9A 1EVYA 3NIWA 1QO0A 1XYVA 1M2VA 3MWJA 4JUCA 3CE6A 3E6AA 2ZROA 3AF3A 3PI7A 4PE5B 3W7AA 3R7WA 4A92A 3FDJA 4JBNA 4Q1AA 3V5NA 2IBSA 3GU3A 1KEEA 1RQRA 4ZXPA 5TVKA 3RIHA 1RXVA 3DP9A 4J1QA 7AT1A 4YMGA 5K8LA 1SEVA 2BSXA 1MB4A 4JWTA 5IWCA 1DKLA 1JFRA 2YHUA 4P32A 3K1AB 4GMXA 3KQNA 4IJQA 3H2GA 4Y2SA 1LBQA 4QO8A 3L8CA 4PYLA 1FMLA 1ZVJA 2PCLA 4K9DA 2O8DB 2E21A 2P6UA 1W93A 2WFAA 1WDKA 4NZMA 1VSTA 4DCMA 1SG0A 3S8EA 1R0YA 2X8KA 5ICCA 4HJRA 3EVZA 3ZQKA 1RYDA 2H4YA 2ZUBA 5CAEB 3PNMA 2CLOB 4G5HA 3EIOA 1A7AA 3NH6A 2XZPA 1DE0A 4NAHA 1P9WA 4IW3B 3N2KB 1OMOA 1NI4B 1RPNA 4DK1A 1QK3A 5AQEA 3TGWA 5HKBA 4G1FA 1L7DA 2ZBRA 4LCEA 2H1LA 4O3FA 2PZGA 5KYUA 4NYIQ 3X1JA 2PT6A 1XWFA 2XUQA 3EVDA 2IV2X 2NMVA 4JMLA 3BD6A 4Y98A 4YLGA 3CESA 1UJ4A 1N2SA 1PL7A 3JZAA 4JI5B 3TR0A 2I7XA 4MKHA 1RC0A 3LT2A 1NBWB 2PX2A 2IDMA 1EGHA 1YL5A 1UMCA 1ZAKA 2WICA 2JIDA 2OXFA 3LTEA 2GVNA 1HOTA 2XOKD 4K03A 2GHRA 2O0MA 3AJRA 3HUFA 5SYMA 2AR9A 3ZI4A 1X86B 2JLWA 2O19A 1S9HA 3AEYA 2PS3A 3KV3O 4CGZA 4I1IA 5FBLB 3ZZ0A 1Z6PA 5BW4A 3HKEA 1P4JA 4EWLA 1TYBE 3O74A 3IOYA 1LTQA 2I3BA 1E6WA 3IBSA 3O1LA 5LXTB 1KXJA 2A30A 4PIMA 2XDAA 5F1YA 5CFNA 1H1DA 1QGYA 1FQOA 1T0IA 4U63A 4ZWNA 4GHWA 2X0IA 1G3MA 2HWKA 2JHPA 3A6DA 3PFHA 4C2TA 4C0KA 4J3NA 3OZRA 1MXHA 4MUFA 3WDLA 4TYMA 3MT7A 1H6AA 4NOMA 4PYNA 3T9BA 1H3EA 2C9OA 1UWVA 5DSXA 1U94A 3K09C 1V7ZA 4MW4A 3KELA 3LHIA 2PM8A 1EJ6A 1SXJC 1A4IA 3EVBA 4IUCS 2JH3A 3G2NA 2C82A 3NAQA 3TIFA 1ESMA 3VI3B 4CDRA 4JD5A 4R3NA 4MDFA 1U2GC 3KKQA 1RIFA 3PJEA 1UZAA 3KFLA 5CLQA 3LOUA 3OHPA 3I4FA 3MQ4A 2ZDHA 2C8KA 3MZ0A 1R6XA 3OD1A 3A1CA 1V7QA 4ZOAA 3V4VB 1WCXA 5EINA 3KJFA 4G4GA 3RYCA 2DFVA 1TTTA 2ZSKA 3KOXA 4IHKA 1ZZGA 4CM9D 1Q21A 5F35A 5KYYB 1PL8A 4LXQA 4A73A 4E11A 4EEZA 3NEPX 6REQB 1S3GA 5F3DA 2FG5A 4WZEA 3W5SA 4XDYA 2ZP1A 3GVXA 4FGSA 4KFUA 2OPBA 5AI9A 2BJWA 1TCBA 1XD2A 2YNMA 3IAUA 4KV7A 2HNAA 3IAS6 4IIXA 3L6UA 3ZDAA 3UKJA 3MMPA 2WJIA 1C4WA 3BAFA 5CT6A 3AHHA 3JYLA 4YJHA 3T5MA 5DNYB 1CPYA 1R6VA 3KM0A 2AFIE 1U9ZA 2M1XA 2J7KA 3WBKA 3BXZA 3MIZA 4MLDA 4OO3A 4QG7A 2YV5A 1FNDA 3H1BA 3MTBA 4HEQA 4LCJA 4LYDA 1SURA 4OUDA 4DRXB 5GVSA 3M83A 1I32A 1AURA 3JQ8A 4Z4EA 1A50B 5G0VA 2IOFA 1NURA 2HWYA 3HU3A 4KE9A 4U00A 2GBLC 2X3UA 1Q81D 1ZU4A 1KOLA 4BO5A 1W2BB 4WZKA 1CY6A 3VI4B 5ALIA 2XDQB 3NB0A 5JWRA 3WGIA 1UZNA 4LXHA 5ESDA 1HYBA 2GF9A 3EIQA 1FOEB 1DIAA 3LIIA 4XPIA 5EZ6B 5IJAA 3SS7X 4CV2A 4JENA 3HN6A 3OBBA 3DTVD 2F1JA 2QHXA 1UOEA 3VVCA 3L8HA 1SU4A 1PNQA 2IZ5A 4B81A 2IH5A 3EGDA 2W2LD 3RLIA 4A8JC 3TCKA 3CNEA 4NYJR 5DNDA 1LW6E 1VGRA 3WLEA 4BJ1A 3ZDEA 2PJRA 4X91A 2AD5A 2QLLA 3MRTA 4KK4A 3FD8A 3II6X 3DAOA 5FWXB 2NU6B 3HPRA 3DOJA 3W3ZB 4B6SA 5E4FA 2LW7A 3GGDA 4NBSA 1MX1A 3CWQA 4ZYTA 1LJUA 3G8CA 5JAHA 3K1TA 3VHQA 2WUGA 2FSUA 3UV6A 5C34B 4N54A 1XPOA 2H4FA 3ZJTA 3I61A 2PKWA 4FQ8A 4JLNA 3USES 4CR6A 1LV7A 3OKPA 4RVFA 2D5LA 4DG5A 4DQDA 2ZIGA 4MIKA 1SUIA 2NXCA 4MKIA 1CU1A 4PFJA 4QDZA 3WWEA 3IE1A 3GCZA 1CY7A 3LT0A 1V8DA 3NGMA 3N2IA 5HS4A 1VE3A 4K8RB 4IJ5A 3IKVA 3PXAA 4PZCA 2PNFA 3GVPA 3RWOA 4PQGA 4ZQHA 1SB9A 4YNBA 1D5WA 1ZQ1A 5EVJA 4TROA 2JN9A 3QXHA 1XQXA 4QELA 2F1OA 5L3SB 2FVXA 5FBWB 1TJ5A 2XB6A 2ZYRA 3A28A 1TT5B 1F5NA 2BFDB 4PHCA 1SVKA 5T3UA 2NU9A 2Q2WA 4KE6A 4JLDA 1YVRA 3LI2A 4OUKX 3OURA 4PLFA 1EAMA 3NW9A 1NSYA 5EC8A 3UUGA 3ROPA 3DFIA 3EEQA 3TFQA 1A4RA 1LPBB 5CNIA 4BJ3A 4A23A 2OHOA 2XNDD 1VQ1A 3QP9A 3ETEA 3L7AA 4QIHA 2R4TA 3BCUA 4BFTA 4UTRA 3KJNA 1EH5A 1RBMA 4Q4HA 4F4FA 3O8RA 3P9IA 4L8LA 1PCXA 3M9WA 1E0AA 1EK2A 1ZW1A 4P4LA 1NLUA 3MTGA 4QUBA 5CLIA 4D25A 1TMOA 1ZN2A 3DGFC 3RKRA 1SCBA 5CVDA 3URMA 2O8BB 4O4HB 5IRCD 3BMQA 3K4HA 2CCJA 2C4TA 3B60A 1ORRA 3CLTD 3BTVA 3HYCA 1Z9BA 1VSBA 3N8HA 4O1MA 4BWYA 2NP7A 1EK5A 2V03A 2WM2A 3LLVA 1ZK0A 4YP7A 3WJ7A 3DKPA 2YVQA 5DYGA 1V5FA 2VSNA 2XUHA 1GRQA 3DV0A 1KJWA 2UZ4A 3TRKA 1SQFA 4D9HA 1OW3B 2CLFB 3D3EA 3H2BA 1T2FA 4WZ6A 3OA0A 5HQ3A 4WZBE 4OGFA 3V7AA 4R2MA 3B9BA 3VFDA 3FLBA 4AS1A 1RU3A 1LS1A 3FVQA 4X44A 1N9GA 3U0BA 4MUAA 3IBGA 4GQIA 2C20A 1UD6A 2IRWA 3ANNA 2YJ4A 3UW3A 1WBJB 5MN5A 3T7TA 3S3TA 3T9AA 2CV2A 2J32A 1FQJA 1JJ2B 1YQWA 4I99A 3D64A 4Q4JA 1N1EA 2DKOA 4OU5A 8ABPA 5JADA 5E9JA 4QVKA 5CJPA 3U9LA 3PA8A 1C8VB 2B9EA 1E3XA 5I4BA 4QQFA 5CM8B 3PT5A 1EVKA 1TYDE 2J67A 2ZRHA 1KIFA 1SVIA 3DDZX 3THOA 4EI2A 1N1MA 5I9IA 2VBIA 3RW9A 2IXGA 1E61A 1EA5A 2XB8A 3Q9LA 3ZBPA 3O1JC 4PG8A 5A5VA 2ATCA 2G5PA 1QH9A 3HFJA 3C14C 1FDTA 3WMWA 2NZJA 3UKDA 1KQGA 1W4ZA 1GPAA 2A35A 3AF2A 5EE0A 1K8RA 2BCGY 3JQ6A 1WXQA 2WZPP 1KQOA 2AEEA 3B9PA 1FDWA 3ZDCA 3T3IA 4EGJA 3AVVA 1OF1A 3OEWA 3OJEA 1GPYA 4RC9A 4YAOA 1ETUA 2J6CA 4NMHA 1XCBA 4RA9A 3P9YA 3E9CA 1PL6A 4U7GA 3PRJA 3F1KA 2BBOA 4ZOBA 2ZSEA 5E3HA 4AURA 3ORQA 4K28A 4YRJA 3KL4A 3LVRE 4K9RA 4R51A 1T5HX 1U0HC 5IKOA 4BMVA 3QMWA 3HFRA 3RU7A 4J0IA 3ZHRA 2W6QA 1JFFB 3EAGA 4EYSA 4Q01A 3TLMA 2OCDA 1IXRC 3BA1A 3CRVA 4WOJA 3T4UA 5SYAA 4ALIA 1PAUA 3UANA 3WC4A 1YNOA 5B7NA 2V7EA 3C87A 1HY3A 3A4LA 3DM5A 4OJYA 5JQGF 3NVKI 4L9SA 1AS0A 2XCSB 3JCZA 5FLKA 1FSPA 3VTZA 4P34A 5REQB 4YR9A 5EMLA 4QBKA 4UUNA 5KQMA 4Q05A 2QRVA 3MCAA 2NVUB 1A9QA 4EG4A 2GM4A 2DR3A 3BB1A 4D4KA 2G8LA 1YJ9B 3U13A 4CJXA 1IPHA 2J6IA 2OHHA 5BSTA 2W2XA 5GWXA 1GZDA 4DUYB 2Z9BA 3MAJA 3Q41A 3T61A 3CD6B 3AKYA 3KZXA 1QCZA 1JIJA 3BXEA 3DBOB 1XEWY 4HDNA 4C0AC 4D99A 1GTRA 3KWFA 3QX3A 2VL7A 4K0KB 3TKAA 4RXMA 2IU6A 3NKFA 2Q7DA 2AG8A 3RJMA 3PL1A 1CW2B 2R9VA 5JYBA 3X1YA 2JBAB 5GZ1A 1QCDA 1QJ4A 3WKEA 5KNDA 1YBFA 2IIQA 1UC4B 4TYNA 1V0FA 5IYZA 3FYUC 3ZLJA 3DEFA 4RQUA 2V9ZA 4U7FA 4WEOA 1Z6XA 2Q4RA 1ZM9A 3PNQA 4PO9A 4F3KA 2DB3A 3FCAA 3L6CA 2CF4A 1W5TA 2ZYHA 4Z4UA 5KSZA 1Y3FE 3WK6A 1T5SA 4CG3A 4UEJA 4R05A 4MVWA 3PWTA 3ABIA 4NATA 3O1HB 3KUCA 4Q9AA 1ZK1A 3AIMA 4JBYA 4FB5A 1U0SY 3LBAA 3NHAA 5HIAA 2JVJA 3KQSA 4ZIRB 4HNQA 1XD8A 2JVIA 4EPTA 4DJTA 2NYAA 5FYDA 4CMEA 1ODJA 4D80A 2C78A 4Q1VA 4CL8A 5C8ZA 3NFRA 1D5CA 2P7IA 3HCOA 3U31A 2X7XA 1ZL0A 4MCAA 4NE2A 1FSGA 4DM4A 3ORSA 1T10A 3GN2A 2YV4A 4WXHA 4JWKA 3GFRA 3B5IA 4UJ3A 1PJAA 3O92A 5LQAA 2BH9A 2QM8A 2W0MA 3HI6A 3JWEA 3QUBA 4N5LA 4UC0A 3ZWWA 2F8TA 3V32A 1O8BA 1SAYA 4R68A 4WY5A 2JFVA 3HO8A 2Y1CA 1ZD5A 4NXNB 4BLQA 1DCKA 5BUCA 2I54A 3LVFO 1LDBA 1YF3A 3DVRX 2V65A 3GJ6A 2XNDA 4LC9A 3V1KA 3RABA 4F12A 1JLLB 3AEUA 2X8LA 4IIGA 4CZ2A 1X80B 5C51B 4HZIA 3NOVA 4E30A 3ZU6A 1WEHA 3SJPA 3EMBA 1T24A 2WTUA 1VB3A 1O03A 1GKKA 3DBHA 3K9LA 4IX1A 4FPXA 4M0KA 4GXTA 4YP0A 3VRHA 3DBHB 3WWZA 1WXIA 5FA8A 4A36A 3T1NA 1DXHA 1ECFA 1T26A 1ZOPA 2YZKA 4ONEA 4R9VA 2RDMA 2ZOSA 4NDZA 1E6LA 1ZC4A 1NXQA 4FUQA 5FNVB 4H1TA 4UOZA 2BGJA 1MAAA 4MR8B 2H2GA 2BFPA 4G9BA 4IH1A 4LYJA 2WIAA 4WZAB 1EP2B 1HE8B 4FX2A 4I2VA 1V8FA 2XCRB 4FBGA 3P32A 4U9IS 3RAGA 5DTQA 2JIQA 3F6RA 2ECFA 3G5TA 3W9UA 4DM3A 5LQSA 2Z98A 3GLHA 2JW5A 2FCAA 1H2ZA 5D5QA 4X6UA 1ULZA 2VTDA 4AJOA 1UXGA 3KLOA 5IBPA 3TQRA 4IHJB 5D87A 1X70A 3AHDA 4B47A 1V8OA 3EBOA 4IHJA 4ZEXA 1JHXA 1X1BA 2Z3WA 1BS9A 3DUWA 3N39C 4W5HA 5LZ8A 1IEVA 3TB4A 2BGKA 1UMDB 4GICA 1TAGA 4MCIA 4P08A 5CYOA 3RROA 3U40A 3H9GA 3HYLA 4ZAVA 2HJWA 4A16A 4AKSA 4P98A 3ER9A 2G04A 3U6KA 1U63A 1OZAA 2ILTA 2AOWA 1EWYA 1F2VA 1WQ1R 2VRCD 3G89A 3OG9A 5BP7A 4CMHA 3HXOA 2VAVA 4QQRA 3RSHA 1TCVA 2FW1A 3H7IA 3C3KA 1BVYF 1O1YA 4GWGA 1A77A 3HSSA 4GLBA 4AX4A 5AW2A 3G9TA 3HLYA 1VBFA 4AMVA 4Q3EA 2P2ZA 4XFDA 2QE6A 3HKDB 2RGUA 2FQYA 1P39A 3OEED 2Q28A 1O7JA 4TGLA 4F45A 1QLJA 1XV5A 2YZ2A 4HXFB 3K1ZA 4ZYVA 5A4FS 4XLTA 5JAPA 3IVMA 1CP2A 5CK5A 3USZA 3BMNA 4TV8F 2II6A 4KO2S 1OREA 4WCDA 1V1MA 2UDPA 2GD2A 2Z2JA 4GECA 1Q7YD 3T9DA 4LQLA 3CZAA 3U3KA 1DC5A 1V47A 1R18A 4ND1A 1ZNZA 1BU5A 3Q87B 1HEYA 2OBYA 4PAQA 1ECJA 1QNFA 4D79A 1UODA 1XZAA 2C07A 1Y8RA 1FNMA 4Q18A 1N6OA 3AOGA 1Q5PA 3UWDA 2FETA 1IPEA 5FT9A 2QUIA 1TO2E 3IOCA 4R8SA 4A6XA 4DDMA 1E92A 2BFWA 3VQTA 1VJ5A 1L5GB 1KDTA 1DI0A 1VYVA 5JXJA 2DE0X 3CZRA 4QYTA 1MGPA 1ZA1A 3I23A 1XROA 3KR9A 4H3SA 2W5UA 4LE2A 3WWYA 4NE9A 2NPOA 3FOEC 1IHMA 1WY7A 1QYDA 2ID7A 3P9XA 1WULS 2VDQB 2OY0A 1ONNA 4QDXA 4KAJA 1GADO 3EHDA 4GR5A 4QUDA 4PN3A 3BCDA 3E58A 1WVIA 1E5VA 3CT4A 3TX6A 4GOJA 2IHVA 3ZNQA 4C7BA 2JFYA 1VLVA 3I9V1 3CVJA 5AOCA 2GN9A 1RVV1 2P0YA 1UT8A 1O5TA 1YAHA 2WFLB 2DHCA 3T7KA 3WLNA 3DQPA 3F9IA 4URWR 3OOHA 6ADHA 4H27A 3F3KA 3LKBA 2GM3A 2JLVA 4QGAA 3RTDA 4XJXA 1O08A 3SEAA 2IPXA 3HC7A 3RS0A 1MW8X 4DANA 4OJNA 4XWOA 4RKEA 3WSWA 1B1AA 2O5CA 3NWOA 3GHHA 3UTCA 2O0LA 3PFWO 3QVWA 5IBQA 4O1IA 1K0FA 1O95D 4REMA 3ZVMA 4C5AA 4ZJPA 2Z04A 1P61B 3FYCA 3MTAA 2VAMA 5ALOA 1QVGB 3IUPA 3QPCA 5TMEA 3GFTA 4BU1A 2EDCA 3AR6A 3KV1A 2PGOA 2H5LA 5EN4A 2EKZA 1H2RS 1WUTA 2DQ4A 2P5TB 1KYWA 2YZGA 2ZI6A 1JE0A 4IHJF 4R69A 4MPDA 5FUVA 2O7VA 1R4ZA 2ZAOA 4ARAA 2CJYA 2R7NA 1FSFA 13PKA 1FU8A 4ZZ1A 3TOSA 4IJWA 4TTJA 3FVWA 2AH5A 4PG4A 4ZZIA 5CYFA 1UT6A 4ZOLF 2ZJ2A 3BHMA 4BP8A 3T7EA 4CT5A 3RYIB 2P9EA 4GYWA 1K6EA 2G28A 2XGGA 4QSMA 1UDXA 1UD8A 1DL5A 1X39A 3JQ7B 1JLLA 1SXJE 5F1PA 4BL5A 3QG1A 4H6XA 1Z15A 3CCUB 4G65A 1EB8A 2HEIA 4NENA 3K20A 3DZCA 4B3XA 4FJ0A 4H6WA 5F64A 5FUQA 5IBCA 3GP8A 4OI0A 4G5FA 4GEGA 1LS6A 1GUZA 2GZMA 3TJMA 2EYQA 4R81A 1HT2E 4P7FA 4EA8A 4NMXB 3IBFA 4IIJA 3MWGA 3EY9A 1XN4A 2W83A 5ENDA 1HDOA 2XIJA 1YJQA 1UPCA 4HWOA 1D7AA 1SZCA 2J3HA 2X9NA 4HP8A 1YLOA 3JZMA 5TQ0A 3RSFA 1NP3A 4FU0A 4PLTA 4OQMA 3F6EX 4ZC1A 2GZDA 1DAEA 2B21A 3CLVA 3RTEA 2XJ4A 1S2IA 3B36A 3EC1A 1JEOA 1KEZA 3W6PA 2GD1O 4RPBA 5B6JA 5ICGA 4AJHA 4GSYA 3Q8MA 4MWOA 3R8FA 4MWCA 5ALXA 4Z4CA 3AIKA 2XSZA 5AJHA 1JPNA 4IJKA 2ZZGA 5TLSA 3N0TA 4TV9B 4B7XA 1C9KA 3HXTA 2V9CA 4IWNA 1CB0A 2Q5OA 4FONA 4AJLA 4BBPA 1N5RA 1WR8A 3WIOA 3OTIA 2XYPA 2GBCA 2IJGX 3A2NA 3CSDA 2C7GA 5SZJA 5EWJA 3TLXA 1HQCA 3VHXB 3ZEAA 1ZUNB 3KTAB 3DOHA 2FSHA 1BFDA 2P3SA 3B1FA 3B6MA 4HAZA 3PC8A 4IDQA 4W8HA 5CA0F 4I1VA 2Y1DA 1OFHA 2ZQZA 4R7ZA 4YROA 4FTWA 4OIFA 1Y34E 1MOPA 3X2FA 5K0TA 4I3HA 1UIRA 2LBPA 3AERB 1JAIA 2FXVA 3HDTA 1UDAA 1RWMA 3DOUA 1I3OA 3O4RA 4RSHA 5AXDA 7MHTA 2WV9A 1M1NB 2LCFA 4ZT2A 5K20A 1UKBA 3E9RA 1J24A 3PEYA 2V0NA 3MJFA 1AGPA 2PZMA 1W2HA 1ZGCA 1P5ZB 5KKNB 2VJOA 1P1JA 1HE4A 1OVMA 4YEJA 3D1LA 4LRYA 2YIVX 1K5PA 1QH8A 1G3RA 2PU7A 4NABA 3IV9A 2YVLA 4TM7A 3VZSA 5AVYA 5DVZA 3R7BA 1L5HB 1J5EB 3G5AA 4J8PA 3DS8A 3Q40A 4QPZA 4MQFB 5D86A 3JQAD 5G0TA 4CLOB 4OK6A 2XAAA 4OXIA 2WJ3A 2F62A 2QM0A 4EFLA 3QVOA 2GEBA 5LCXA 1ADGA 4FFBB 1KDZA 4DCUA 1GL6A 1Z39A 4Y0NA 5JQGB 3NYQA 2VJNA 1LB1B 4IDCA 1ZY2A 4KCGA 5JEDA 4YAEA 2QE7D 2CLIB 2CLCX 4JR0A 3ONUA 4XM3A 5AVXA 5JQGA 3ZWXA 3SSAA 5JDIA 4AYWA 3GDGA 2YYAA 2X8WA 2PGIA 3AXSA 2IEIA 1OLSA 1R0BA 4BKMA 4YHBA 1BN7A 2RGXA 2CE2X 5FWAA 4FDMA 3JQ9A 1L6RA 3DEKA 2G76A 2AQIA 1QF6A 2GCOB 1RHUA 4BO3A 2RHOA 1X74A 2FVYA 2GASA 4OKNA 2Q4OA 1IY8A 3NORA 3NVMB 1V1RA 5K6AC 1Q1AA 3H9UA 3CFYA 4M0EA 5EWLA 1I5EA 4OKIA 4YAFA 1VQOB 4B8ZA 1IYZA 1VP3A 1IBSA 2P9CA 1X38A 1X7XB 3LUGA 4Z9AA 4HFRA 4H7IA 4E33A 3O4IA 1W0CA 1CIPA 3A1PA 1S2GA 1BRMA 1PKEA 4KJZA 1K97A 4JQCA 3I6QA 2NXWA 3ICPA 4DLUA 4NCAA 4RNDB 3PEUA 4RK0A 3IUQA 1Z62A 2EKLA 3FBGA 4MRPA 1ZSNA 5COAA 3QXCA 5BVHB 2YJ6A 5ELXA 1CR1A 1D0IA 1Y1SA 2XB9A 2L69A 2WYRA 3SQDA 1Q1ZA 2EHJA 3HB7A 3E9NA 4N4AA 5EJ2A 1KQNA 3UXHA 4UQPA 3SR0A 4Z7QB 5JHHB 3OOCA 1V2GA 5L4SA 4U3JB 3AVXA 1XUOA 1W5EA 5JS8A 4EG0A 4DV0B 4LHVA 4NBTA 4CEHA 2AI1A 2H54A 3HL4A 5DSZA 4W1SA 1YDEA 2I2FA 1IU9A 4KNYA 5BN4A 4OFXA 1A8SA 1L4GA 3V4LA 4K9OA 4BUCA 2MTBA 2PX4A 2X0FA 1C1XB 3H5IA 3ZCVA 3FBTA 1P6UA 2QRNA 2YR0A 2E1BA 3B1JA 1FJXA 2BFAA 2O2SA 3HA7A 1XRSB 3HV2A 3S44A 4BEVA 2UUCB 4BPBA 3ADDA 2BDEA 3ENQA 4B6GA 4DLAA 2DYIA 1CRLA 2DGDA 3CNLA 1IM5A 3BCRA 4W1RA 4CL0A 4F4JA 4HNGA 5FBVB 5KYXB 2PR7A 3QY0A 5CYGA 1ZESA 5F3RA 4ESVA 2YV3A 1WW8A 3W5DA 1ONBA 5EIXA 1KSFX 1WCV1 1VMDA 2XE8A 3GFQA 4RY0A 1A0OA 1CEQA 1REQA 2X13A 2C5HA 3W8EA 4CKCB 1WM1A 3R09A 4Q1DA 1SXJA 2CXXA 4PLYA 1RNLA 3HFSA 3LWBA 1KC8D 4PS0A 3F0TA 5J59A 4GXNA 1J0XO 1Z0FA 4ITRC 1BROA 3E7PA 1ECLA 1B2RA 5HMLA 1TM7E 2AA3A 1X94A 3DO8A 1ZG3A 1ISJA 4OX9Y 4CE6A 3IHWA 1JF8A 5CXSA 3U60B 1XCLA 1S4QA 1OILA 2QAGC 2OQRA 5FH9A 4EY8A 4BCBA 3GMTA 3AVWA 4YAIA 3IILA 5L3ZA 1JDPA 4KIWA 1FTYA 3UC9A 3GH3A 1C0LA 1DX9A 3FTEA 2FR8A 3BBPA 3ETDA 1ISMA 1DKOA 5G4KB 3WYAA 1NQOA 4RQTA 2D0DA 3IHLA 4R1OA 5KUTA 1U2EA 3KSRA 2IXTA 1PS8A 1TIKA 3DKRA 1BWPA 4E4RA 5CCBA 3GAMA 3K8YA 2J5RA 4YN3A 2ZG6A 3AF6A 3MW8A 3T3GA 1A5TA 1HNNA 2V7GA 3AO0B 1MBZA 1YDHA 3QTBA 1LTHR 2SNIE 4YR7A 3VHXA 3ZK7A 5BMOA 1JQBA 1CP3A 1E1DA 1V3UA 1F2TB 2C58A 1AQYA 1XWWA 2YWCA 4HWRA 4I8DA 4M89A 2WYIA 3WZ2A 1XZQA 1EGAA 3THRA 3KR2A 2W0SA 4RXTA 2NV6A 3TVYA 4JLVA 4YCCA 3I01M 4EF4A 1NDUA 4BVLA 3O3OB 4P31A 3IKMB 4IMJB 2PZKA 5AK0A 4KYUA 2P3MA 4MV5A 1HBJA 5KVQA 2HQSA 1XA0A 1ZGGA 1IOLA 3JSXA 1EEHA 1WOPA 5H0IA 1JKXA 1H9CA 1NV8A 5JSKA 2P2SA 3D6MA 3QBTA 2OAEA 1BE6A 3NOXA 3NBZC 4OMCA 3QYJA 1Y0BA 5ESRA 1SU8A 4Z53A 2HLDA 1VI5A 4R40A 4C4TA 3MUNA 3N53A 2GD0A 1R8YA 3RS8A 1MAWA 1ZWLA 3VGPA 3VTFA 3S7ZA 2VHTA 1S3SA 2VYND 3ROTA 1JEDA 1IK6A 2ZYWX 3DCNA 5I4KA 4LCBA 2WJGA 1FSSA 3EEIA 1Z0AA 1PG5A 3WWOA 1C0PA 2IP4A 4L22A 1NE7A 1IY2A 2HV8A 2OXCA 1EFPB 5BQOA 5AW8A 3CEPB 3AETB 4LVOA 1DB3A 4OHMA 3TYXA 1GN9A 2ZB3A 4PX5A 3LFTA 3V8NA 2DYKA 4NOJA 1KYZA 2Q4TA 2BFBB 4QSHA 1NW6A 1PFKA 3I9NA 3LUHA 1ISGA 4TTIA 5L3QB 5LZ4A 4JR1A 4QXAA 2XTNA 1MU0A 1ZNWA 2BIFA 3M2TA 3OCXA 4YIKA 2W71A 1XTJA 1VPEA 3EMVA 3PQ4A 5F5LA 3TW8B 3ZWKA 5GM2A 5JROA 5CVUA 4NARA 1Y6QA 4EYGA 4ZYYA 1Y4UA 3A4VA 4P0QB 4I66A 1WPCA 2VP3A 5CB4B 4O4LB 4D82A 3BG5A 3L7LA 3A6PC 4W9MC 1I5RA 5K3AA 4KTTE 1YR7A 3AUTA 4UDYX 3QELA 2W93A 3RAPR 3W5BA 1U2DA 2GOYA 3E9QA 4I46A 4XM2A 5JC8A 1ZD8A 3OTWA 3TTSA 4PTZA 2FQXA 3QEJA 1KY3A 1E7MA 4H7PA 3CUWA 1TIPA 3TSAA 3CTAA 5HSGA 1K0UA 1C4KA 2WF7A 4MGHA 4OBXA 1XN1A 3RTAA 5KYTA 5DNUA 1YRAA 2YDYA 3FOBA 3QZUA 1YR1A 1HX7A 2O6HA 3HN7A 1KL7A 4CFSA 2FH5B 4RACA 4IIUA 1RZVA 3NTQA 5IDWA 4IO0A 3B2QA 1V0EA 1TOAA 1O4WA 3JYNA 4ZT3A 4NBRA 1FVHA 1EZ4A 3ETNA 1E69A 1ZCAA 3B51X 4HDQB 3Q2OA 4PCUA 2ZEJA 4JJKA 1VTKA 4ZFNA 1GPWB 1XD9A 3KJQA 2G1UA 1QU3A 5BWMA 1K8AD 1UC9A 2C00A 2ZRMA 4DCGA 3C1TA 1QV6A 1VHLA 5HXAA 3PT9A 2IUSA 4W1QA 2XBUA 4J07A 2AR0A 2CY0A 1RXEA 2GEUA 3NHWA 5KTOA 2J6BA 2JL1A 1RM0A 3NWJA 2QMUA 2XDYA 2VQEB 1VFPA 1XCOA 2BHLA 2H7VA 1J2TA 2C4NA 4I4TA 2V4MA 1NSFA 4F0JA 1SUDA 3WRXC 2GM5A 2KMLA 1GRRA 5HJ5A 5KOIA 3NM5A 2VF5X 3TQOA 2Q6IA 1CNEA 3MRVA 1Q20A 2JASA 2PAAA 4ZO4A 2O52A 2A7XA 4Q9JA 1KK1A 3SYRA 1EUDB 4KOAA 1MVNA 3KPYA 3ANMA 5IVDA 1GL3A 1KFBB 2N42A 4PNPA 3GLGA 3DBIA 1NX6A 2O14A 1F8YA 3GLGB 3GOHA 4YP5A 5FWNA 1Q77A 1XZKA 3Q3JB 3PLRA 2Q46A 3GP5A 1XMOB 4ZYXA 5JZMA 4YJ3B 1HL3A 1L7PA 3CRW1 5FL3A 2BR5A 3PFFA 3R5SA 2AR7A 4MPRA 2RK6A 5JSZB 1OWNA 1WS6A 2YXDA 3L02A 1D9ZA 3CGWA 2WC1A 5IJXA 4RK6A 4XYLA 1QGOA 3QFTA 3QJGA 4TKOB 3DF9A 4D46A 3K8OE 1XGKA 4CHTA 1A8IA 1E1RD 1UPUA 3ACCA 3IKTA 3WNBA 5EIWA 2JLZA 2H2DA 3K9BA 4AZ0B 4JVNA 3KB6A 4IIDA 4RX1A 5MN4A 4ZVLA 3B12A 3KHTA 1JEYA 1CDOA 4GVLA 1TUBA 2IYYA 5E0OA 2BFEA 3WRVA 4X1YA 5K8CA 1E9SA 3VPGA 3MTJA 3CUSA 1PWXA 4AWBA 3HBNA 1AK9A 1X87A 3MN1A 1P0PA 4W82A 3HPQA 5K05A 1IBKB 3PA6A 3O1IC 3SWWA 4YGYA 1Q91A 3QWBA 4O4LA 2OC9A 2JIOA 5AT1A 2FSVA 2MU1A 3SVLA 1M0WA 4KREA 3OCVA 1CUIA 3GLVA 4PHHA 1WA5A 1DDGA 4PW0A 5DLPA 3S29A 1JT9A 2CVPA 3AFIA 3LBYA 4MLCA 1JKJA 2OC4A 2PH1A 3JU3A 1JMKC 1U6KA 1UOOA 5BR4A 4BYMA 1GXSA 1JAYA 3BZUA 4P54A 4PIPA 1KMIY 3VR3A 4EKGA 2PT9A 4EH1A 1U02A 2UUPA 2ZRCA 3KO8A 1M7BA 3IULA 2ZWPA 4KWCA 1BS1A 1BSVA 2XQGA 3K0KA 3OOWA 1QE5A 1I6WA 3UMFA 3W2FA 4WN9B 1QIJA 1AOXA 4XQFA 3V9AA 2BPOA 2ZWVA 2IL1A 3ZW9A 3LBFA 4R1MA 4FYXA 1RLIA 3JD1A 1PNVA 5C7IO 2EWWA 2IV7A 2GS9A 4KQ9A 1NVDA 1MF7A 3WAKA 1PQWA 4HEA6 4LHYA 4A6DA 4F8JA 1CZOA 3CBQA 3RTCA 1NRKA 1THGA 3LF1A 1V8BA 3L8YA 3BEOA 3NIFB 5D5PA 1EFHA 1E9RA 2YMMA 2M2IA 1UBKS 3ZZUA 4G9EA 4L6AA 4UFPA 5BWOA 1I4OA 4E2XA 4KO8A 3ZCQA 1EWRA 2DXIA 1TUIA 4FWBA 1RKQA 4GM1A 3BZWA 4OFWA 1RKBA 1WTHD 3JPYA 4HB0A 1BHJA 4KO1S 1G2OA 1XK6A 4FYMA 1F5SA 3DVAB 5KOHB 1AUQA 3NCTA 4J6EA 5IUKC 3BL6A 3S2FA 1R9GA 5EZYA 1QX4A 2MR5A 4M0DA 4HQKA 5B64A 1QKJA 4ZC8A 3ZQ6A 4G6IA 2P0AA 4EUFA 4L4ZA 3F96A 3WLIA 1SWVA 2HK6A 5ALDA 4CTNA 5BT8A 1T8RA 3NBQA 3BWMA 1T1GA 1TGVA 2ODNA 8OHMA 1MH1A 1RC8A 3A1WA 3B48A 4U7WA 4EG3A 2F1LA 4EELA 3ASRA 5ILOA 4BVAA 2CHFA 1VLHA 1RYNA 1MFPA 5DLEA 2YWRA 3N76A 2QLBA 5BWCA 1YA8A 4J0GA 1U3UA 5EP2A 3QVUA 5EKDA 2JLRA 2H1RA 2Y0BA 4D4LA 1CQJA 4ZKDA 2FJ0A 3IDAA 4D7AA 1ZWKA 5DIZA 2QJFA 4PCVA 3HR7A 1HWYA 5FTJA 4F4IA 5T8KC 1NBAA 4Y1FA 1QQ7A 2AB0A 2BGIA 4CDNA 5DTMA 3L4KA 4PQFA 3KVRA 4WHMA 4X9XA 3PHGA 3DPUA 1PYDA 3RGGA 1WHSB 2X0NA 1N2CA 4L16A 1Y8RB 4AIRA 4BO6A 5JSFA 2ECKA 2EX4A 1SRRA 3U7QB 4D81A 4EGSA 5KREA 1B0PA 1VA5A 1E20A 2FYTA 2H7CA 2JAUA 1XHEA 3DZ8A 1WXXA 3EWNA 4ITUA 4C3OB 3U3XA 5LUAA 2BR4A 2WZBA 4LYHA 1DZIA 3VXKA 2P9BA 1C7RA 3M82A 2HRDA 1JPJA 4HUQB 3QIVA 4HZUB 4AJ1A 2F59A 3KL2A 4MMXB 3FMGA 4YRGA 3KETA 3IAHA 3WE7A 5IUNC 4I50B 4AF6A 4GPEA 3WLHA 3SX4A 5TT0A 1YDGA 4ZVOA 1H93A 4DIKA 3OTHA 3L4BC 1CUAA 2Q4DA 3WHIA 2ID8A 3ES9A 2XVYA 4O02B 5AOBA 4BAGA 4QJ3A 2ZBPA 3K9GA 1XTVA 2UVPB 4GT1A 1CZRA 4H60A 4TPKA 3P0RA 1YB2A 2WSSD 4DA6A 3DLPX 3N9IA 5EXSA 3A1NA 1Z33A 4R1PA 1JT2A 3PQ8A 3QF7A 4JA2A 4KXLA 1L3BA 1GRCA 2OECA 1X2EA 2XNHA 3VPFA 1U5BB 1L7OA 2A9PA 4HQFA 1U7WA 4MRRA 4OOFA 4XB1A 2RK3A 3EPRA 1YJNB 2ID9A 4HWKA 5HNKA 4EY5A 3ISXA 3A8KA 1OTXA 3ROMA 5DYWA 4UHDA 3RLFA 5A4AA 1TZBA 1BDJA 1PZGA 2IOHA 3R7LA 3N87A 2OCXA 3QVMA 5K0LA 2BH2A 3N0RA 1NLFA 4EX6A 5CIQA 4AZ3B 1XAIA 5FOTA 4IQ0A 2EFGA 4FP9A 5A6SB 2QNIA 3G8DA 5JR3A 4MARA 1OAAA 3GRUA 2GFIA 3RFVA 4FK8A 4G5GA 1FY2A 2OV1A 2ZQYA 4HVLA 5KB3A 2XMRA 2X0JA 1CUDA 1NL3A 3GROA 2XI4A 2ZAIA 3UWSA 4C87A 2O2EA 2VT6A 2CUNA 3IQWA 2QL5A 3AEXA 2YHIB 2C4UA 4KXWA 4N3CA 1A1SA 2J3KA 2RHTA 3TIGA 3IMGA 4DYHA 1PZNA 2PE5A 2X2FA 3MPOA 2WVGA 5C4MA 3HDJA 2ZIVB 5ADHA 2WYWA 4RGQA 1HFEL 2XKJE 3WYGA 3WIEA 2ZJZA 4TS4A 2RK4A 1NBEA 1D03A 2OFXA 4FOLA 4Y2JA 5H68A 2O5VA 2UVQA 5GMOA 1NONA 4DMCA 3OQBA 1FX0B 1PO7A 4YK7A 1Q0TA 4EW3A 4MVJE 3U3JA 4ZU1X 1MG0A 1OBFO 3MD9A 4KOEC 2AI2A 3TW4A 5DCWA 4KZPA 1OJ7A 3MJ4A 1JDUA 2UAGA 4XWKA 1OZHA 4L15A 1CERA 1NOKA 4NLLA 1VMKA 2X42A 2IQIA 4TSRA 1NQXA 3G6EB 2DR0A 3EGOA 3PDIB 3TLJA 1HQKA 1WXFA 2B61A 4BVEA 1OAOC 2NX2A 1OKKA 1Y1PA 2HA7A 1XU9A 1CJSA 3FWNA 3I0MA 4K86A 4LWQA 6REQA 4WXRA 3WA7A 2GAJA 4DIBA 1XLTA 3F6BX 1B7GO 4TWJA 2O3JA 1E2PA 3O47A 3CB2A 1XAHA 4Y3UA 1THZA 4FOTA 4HF7A 2YTZA 3AM3A 3SEJA 5GONA 4AP5A 4HNAA 2X1LA 1QR2A 2AVNA 4S2UA 5DNCA 2GFHA 4KKVA 5I7VA 5JZSA 2VJPA 5AM4A 3AYZB 1AD2A 1LPOA 4QBGB 5KYWA 4INAA 3E2MA 4LVCA 3HNRA 1OAKA 4CCWA 1XZEA 3A26A 4JBGA 1V0JA 4WZAE 3BKXA 1NUHA 1T15A 2EQBA 1Q22A 2YXNA 5D8DA 4LHEA 4C4SA 3JQQA 4NV1A 1GNQA 3LHKA 1SEPA 2PGAA 4X93A 1K7CA 2PBRA 3DXZA 2WB2A 2O3UA 2WPNA 4I5EA 2R00A 4R1NA 2Q41A 1N07A 4NU5A 1YR3A 1FUKA 4MS4A 3B70A 1RAAA 1JHPA 2J4DA 4QDOA 3CRQA 3RRXA 1GUDA 1YQEA 4WBXC 3K0AA 3A7EA 5CYPA 4UQLA 1Z5NA 2AIRA 3C6KA 2PMWB 3H0CA 3CNHA 3RM3A 1IZ8A 1RPTA 2DUWA 1PJSA 1VHDA 3QWHA 4LQDA 2V0GA 1UFKA 1W0KD 1QHYA 3A7DA 3FETA 3FSEA 4U5QA 1O3YA 1PX0A 1OXVA 2W00A 1JJFA 2LR0A 2ZKLA 5C8XA 3M5WA 4YMLA 3D9QX 2JZOA 2FN9A 3DAPA 1U0LA 2KPOA 3VZDA 5B7GA 1D07A 1KI3A 3AEKA 5A9SA 2ZAGA 4DNXA 4KRXA 3CP8A 4YI3A 1E3QA 3R77A 1N5JA 2EBFX 2NT3A 2QVYX 3MVEA 1LA2A 4XCVA 2ONYA 3C1AA 3L1KA 4ND4A 1XTKA 2OLKA 4WVLA 3O8LA 4BLUA 2VH2A 3EMKA 4KQMA 3IEVA 1CQPA 1JXAA 1XDZA 2JFXA 2PZAA 5CA0B 2YASA 1QG2A 4RJLA 3JR7A 1GU0A 4P6VF 1YVDA 1GZSA 2YWDA 1MJGM 4M86A 4RPLA 4AZ3A 5JWOA 3KSBC 1YCHA 4QXRA 3T94A 2PXHA 1BCRA 5FOWA 2VP6A 2FMIA 3ND6A 4RLFA 3JVUA 4Q3AA 4XWTA 2FEPA 1ULTA 3T41A 4P81A 4PYIA 1AUVA 1J1ZA 4TL6A 2I2XB 4YP1A 3EOZA 5IDXA 1YS7A 3V4OA 4DA0A 3HZZA 1IUPA 1FFEA 2O2YA 1K8QA 1K9MD 4KPUB 3RG8A 2JBWA 2HPZA 1B0UA 1MAUA 4L74A 4NULA 2DTDA 4MRNA 5FWXA 3EFHA 4IS3A 5J1SB 2CJXA 3U7RA 1EVEA 1W4AA 4QOSA 3VO9A 1NG1A 5L46A 1N92A 3QUCA 5DYTA 3H3XA 4TV9F 3GGSA 4HMOA 3ZKAA 4D8XA 4NY1A 1YIOA 5IC4A 1O94C 1FW6A 1NFRA 4D74A 1WVGA 3RYHA 5F76A 4CU2A 2HM7A 2O8BA 1EKXA 1LI7A 4WCFC 5KNLA 2YBEA 2UV8A 4Y6RA 2R2AA 1NM5C 2J46A 2UYCA 2IHJA 1KEVA 1CQIA 3ABSB 3NZEA 2I4NA 3B7PA 5F4MA 4QJ5A 1QG6A 3VO1A 2W6ZA 4J29A 4YY3B 2I29A 5DXJA 3NAZA 1KVQA 4AG3A 3GGGA 5FNZA 4L76A 1QIMA 6NULA 1TLFA 1YB5A 2NU8B 2XT9A 4TYYA 1KI7A 3IP8A 1X15A 1KARA 5K0GA 3F2VA 4UTNA 2ESRA 3CNQS 3AH8A 1OA1A 2NU9B 1RQLA 3M6UA 2Q3LA 3NTUA 3TWOA 2QU8A 2PYZA 2WNSA 1VI6A 3H6HA 5H83A 1DHTA 3TG8A 5ALZA 5HFNA 2F1RA 4JJAA 3OW7A 2GEFA 1AGYA 3N75A 4BDTA 4BKOA 1NLZA 2AG6A 2RGEA 3E9YA 4I7EA 3PRHA 4Y6LA 4M9SA 4BO7A 1IXYA 3ZNPA 4B4WA 1DEKA 3LF2A 3ADPA 1DPGA 1BQEA 3DMGA 3DZKA 4KIFA 4K6FA 4L8FA 1DC3A 2FSVC 1EP9A 3VO8A 1XTZA 2OUKA 3DGEC 1FLDA 2QI9F 3HP7A 2VNAA 2YW9A 4XI9A 4WGGA 4ZRNA 1CBUA 3SJCA 4PAWA 2Q45A 1WQ3A 1MIOB 1GU1A 2WHXA 5LD2B 4X90A 2C54A 2K2QB 4J49A 2BZ0A 5TQJA 4E0BA 5JVDF 1F17A 2YFQA 1SA0A 4HAWA 3TG2A 1VF7A 2JDIA 4JGGA 1Y82A 2PRKA 4LF5B 1YK1A 4YP6A 1RWKA 3TGLA 5LL6P 3SF8A 3IPRA 4UVEA 1R4MB 4YRAA 2WJYA 1Z8DA 2CVQA 4ZQGA 3WHKA 1CXZA 4U2EA 4BO1A 3JQBC 3HM2A 4MJ7A 3K1YA 3WDSA 1JSLA 2H63A 3VR4D 3U2QA 3PUJA 4ZVRA 1AN9A 3V7WA 4IMPA 5GY7A 4DIMA 2PT5A 4LTDA 1MX3A 4H1VA 4KYTA 4R1LA 1QVFB 4WZBB 3TXYA 3MQFA 1K27A 4TT8A 3PWZA 5DYNA 1M66A 5KPJA 3VHRA 2Q3BA 4OA8A 1U8ZA 3BDVA 1Q1GA 4TM8A 2C84A 4XLFA 3WGUA 1HEUA 1M7HA 1RRVA 1S7CA 3A4TA 4GPZA 4QFCA 3AL0C 2WUEA 3DXFA 3K5HA 3T51B 3MTDA 2NM0A 1NWCA 5THXA 2WLTA 3EHEA 1GKUB 3AWIA 4UUQA 1IRIA 3SE7A 2NYVA 2OXEA 2B1IA 2AGVA 1UKVY 3DDUA 1K5HA 5CA1A 3JAWA 1EFRA 4PC7A 2OO5C 1Z7GA 2W2TA 1Z83A 5AJTA 4AVYA 2WJJA 3HBJA 3ZLBA 4MYHA 2Z56A 2PXCA 3KTFA 4JT4A 4Q9LA 1KAHA 3DMRA 2FMKA 4V0QA 5HKAA 2I22A 1VL2A 4ZCTA 5EWMA 5CVJA 1TYZA 1F60A 3X1XA 3ITDA 2Y0CA 5JH7F 5A4MS 2VRCA 4E7OA 3GJ4A 1D09A 1Y8AA 1DUVG 1DX4A 3IV7A 5KAPA 4DABA 1C9YA 2BRUA 2AWNA 2V98A 3QXJA 1RCFA 3M1AA 2JBHA 3CC8A 2OL4A 4QFDA 1QV9A 4CKYA 4QVGA 2VN8A 2HY7A 1IUNA 4BFUA 4F46A 4OSOA 2IUYA 3I32A 3PITA 3RBVA 3TXXA 5IS2A 3HB1A 3TLKA 3LLSA 1IPFA 2A1TR 2QL9A 4RZ2A 1ZXBA 1YVUA 2V97A 4IV8A 4ZVPA 3LK6A 3CN7A 3A31A 4AD8A 3AR8A 4TL8A 4UEWA 1ODLA 3UXYA 3DOIA 4EVQA 2NSHA 5FHQA 3ROZA 1IXSB 2IW1A 3Q3AA 4KR0A 4V3BA 3OZDA 1B6TA 2Z4SA 5T6MA 1YZYA 4EB3A 2IV3A 4MWZA 5AW4A 1IFXA 2IWHA 5EUBA 2ZE6A 4MW9A 1RD4A 5DXAA 3UWMA 1WD5A 2J5KA 3V48A 1UQUA 4QC2A 1NULA 4F6RB 1R8JA 1GTMA 2R6HA 2XGOA 1KDOA 4HNVA 4ZO6A 5CDSA 5I8PA 1KBZA 2XE4A 3A9RA 4PAMA 2WIGA 1LPSA 2H8KA 4R3WA 4CLEA 1KI1A 4EMBA 1SQSA 1TO1E 2I0FA 5IZCA 2LDBA 3OLCX 4EGFA 2LKCA 5D00A 5TQ2A 4EATA 3DL7A 2GXQA 1UBTS 2XNCA 1WMAA 2CWWA 2K7ZA 2OGSA 3F7TA 3CO5A 3KWLA 4FEGA 1W36B 1SXGA 1QH1B 1S8OA 5AK6A 1APBA 1B42A 4LHWA 4MZDA 3DW1X 2CFOA 3OIGA 2PJDA 2XB4A 3HDHA 1Z4JA 1NF8A 1OIVA 2DWQA 2EATA 3HWRA 2ZJBA 1GAEO 1ULUA 2WVJA 1IBLB 1CUVA 3ORRA 3FVTA 4G4SO 4UEOA 2NQ2C 4NCHA 5LN1A 1I7PA 4B44A 3BHNA 3D4NA 3MS2A 5U4QA 4XL9A 2WM8A 3HJHA 4ZICA 3R0XA 2AV6A 2EW1A 2Q1SA 1X3LA 5DM2A 2EF0A 1UK9A 2VTBA 3D2AA 3I5UA 3RVMA 1Y4ZA 3X1ZA 2AFIB 4TXNA 1KJ9A 3RFXA 2OILA 1YHNA 3I2GA 1A9SA 3IEUA 4F04A 1CUCA 3GA0A 4ZAWA 1WVMA 1XE3A 5G4LA 1TC2A 4XCXA 5AOAA 5KBYA 1UBFA 2JI4A 1RT9A 4UXHA 3O93A 3VV3A 2AJ8A 3OHSX 2B30A 2Z08A 3RS3A 4YUVA 2NOAA 3ZZTA 2QUZA 3ELDA 3QKRA 4FINA 4YJGB 4DAEA 4ZJUA 2ETXA 3CF4A 5A7HA 2HJHA 4ASUA 3BSSA 4GG1A 1BWRA 1AIPA 3QU9A 2AOTA 4ASUD 5JD5A 4BNXA 4EL0A 3KHSA 2YINC 2PZ8A 3TSWA 4DPLA 4FMPA 4D9EA 1KSJA 4P9SA 2JK1A 2UUOA 3IAM6 3KKOA 1ENZA 3JARA 1IBRA 3GFOA 1Z0JA 4AXBA 1EGMB 1VJRA 3EVNA 5JJ5A 1F4PA 4DKXA 2M6LA 3SQLA 4DTCA 1YA6A 3Q6QA 4HGYA 1JDNA 1EDZA 1Z4PX 3KG2A 2WSSA 3AFGA 2WF6A 1BFUA 1KZHA 1EXVA 1OE0A 1MX9A 1U9YA 1GUBA 2GN8A 2IPMA 5JNWA 4IJMA 1SHTX 3PXXA 5TNXA 5FHRA 2GNOA 4WN3A 1TX4B 3F9RA 1XFOA 1YONA 3RVBA 5JD4A 5IAEA 2LVBA 3R41A 1GPJA 3DHNA 3U1TA 5EFOA 3VDQA 3FCCA 2JGLA 1T5LA 1R74A 2ODBA 4AG6A 4MJ3A 5ALYA 1NKTA 3LPDA 1DAKA 2Z3VA 2FP4B 2HBZA 2ZBQA 1QE0A 4R71A 1ZS9A 4IFBA 4ZEMA 1IOVA 4HGNA 3OOJA 4ENWA 1CZNA 2YJ3A 1P80A 1PIWA 2ZTVA 1I5OA 2VWQA 2HF9A 5LOVF 1CDDA 3LBNA 2X6WA 3F7NA 4ARCA 2HPAA 3DWFA 1WZIA 1ZCZA 2XWJI 3ZGYA 4YO7A 1N2JA 4HQNA 1QRDA 3QX9A 3ZVKA 3QBEA 3ZZ1A 5AHRA 3MJCA 2H8GA 2NTNA 4DMGA 3N2YA 4I4TF 1JG2A 2XCIA 3GDFA 1P1HA 1E2BA 2ZTSA 5HKOA 1PJ7A 7YASA 1MO3A 2OAQ1 2FX2A 1IUOA 1YFKA 2B7LA 2VDVE 3NHRA 4WKBA 5IXSA 1MB3A 1NM5A 3A4YA 5F2EA 2YQ4A 3RK0A 1WB4A 3CCEB 2W2QA 4I5IA 3INNA 5FFMA 5TEVA 3NU1A 2VUUA 6GPBA 2MSDB 1IQUA 3HH8A 4MGEA 1IJFA 1ZFNA 2ZPUA 1NQAO 2D7JA 2VAXA 3ZUPA 4Q16A 3C16C 4OATA 5BSUA 4YHHB 2H51A 4B3SB 4M1ZA 4PPFA 1KE2A 3N0XA 2ECQA 4MR9A 4X8HA 1WXWA 4F85A 3GRAA 1D6NA 1K86A 1VCNA 2KSQA 3PZRA 1HUQA 5LB4A 1J0AA 1K89A 4CV3A 2R66A 2R1TA 1R00A 1RHKA 3LHFA 3PQCA 3UMBA 3QUAA 4RD3A 1I8DA 1OY1A 5EKXA 3EDYA 3TH5A 3T7RA 3TSOA 3WL3A 2RHHA 3FDXA 3ONFA 3QYPA 2WYVA 3FOFC 1J8YF 1M6VB 1NU8A 5KYWB 1XLTC 4UU1A 3F46A 3GAAA 4EGAA 3MXTA 1OXBB 4EB6B 2E85A 5JXIA 2PUCA 1IZZA 3GJYA 4TKMA 1SUEA 3LKVA 3QRWA 5KOHA 1CVRA 2G8NA 1NASA 1E6UA 4DDWA 3QI2A 4JP5A 5EESA 4G01B 5BSHA 3HB5X 3ZLVA 4TQUS 1YA4A 4QFBA 1OB2A 3DEAA 4TOIA 2C2GA 2EXXA 2RB4A 4YJGA 2JIZA 3LSTA 4TLEA 3T3MB 1Q19A 4DR6B 3E2IA 4OIMA 2XW6A 1SXJB 1WB5A 3OIYA 4EMUA 4KEAA 4YT4A 4TWAA 4JVOA 3VJKA 4XSHA 4LGYA 2FR0A 3TX2A 3RARA 3VKUA 4CF4A 1M1ZA 2HC9A 2PFGA 4JZKA 3WGYA 4FMDB 3I92A 3ECAA 3S8YA 5FOVA 4WKGA 3D43A 5B2FA 4R8LA 2E4YA 3JD2A 4JA0A 3SX0A 4C7VA 4RHTA 1YITB 1NRJB 5F78A 2A86A 1N0HA 4EHDA 4XJVA 4BIIA 4L9AA 5EE3A 1G3QA 4EG7A 3KQVA 2IY9A 3C1UA 5DGXA 1L5OA 3NBAA 3NTVA 4OQNA 3TAXA 3DQQA 2PSDA 1U31A 1XCMA 1Y1LA 2O23A 2ZJ8A 4O4HF 2X6XA 4HQRA 5G2OA 1ZGZA 2BELA 1UBNA 4CM9A 1TVKA 4KC0A 4I3GA 4BFWA 5DGIA 4HDKA 4B0PA 8ADHA 2ZI5A 1HRDA 2W2KB 1NN5A 2H17A 1W0JA 3OY2A 4L8GA 4GYJA 2D1YA 1JNXX 2REQA 3B9RA 3OCUA 3W8RA 4QUAA 4A9AA 1FZQA 3WGOA 5DTRA 4BB0A 1ZOLA 4EFNA 2H16A 4CM8A 3G0GA 3IVXA 3BZBA 3U3OA 1ZD9A 4DM7A 5FPYA 1ZUWA 2ZFUA 3MILA 3BQJA 2A0UA 3A4MA 4GDMA 1ZH6A 3KTOA 4ND2A 4ETIA 4KHPB 1PS0A 5FTKA 4RDJA 3CW2A 4PYKA 1F8GA 4MI6A 4TX1A 1KOGA 2P5SA 5JVDB 1LJ8A 1WW3A 4IILA 1LPAB 3SNKA 1JFVA 2C5EA 2K6GA 2IXBA 2PZLA 4K3VA 4QYSA 3RS9A 1ZR4A 3EOBI 4Z1OA 5BY2A 1SZJG 4RULA 2OKCA 2UZ3A 4P93A 2PHZA 5HIIA 1P9NA 2AK2A 3BB3A 4GL2A 4MUMA 2HI0A 1AQIA 3PRYA 4M1KA 1WU7A 2JRLA 3AR5A 3KVNA 3SYKA 3WL7A 2OAP1 1TVMA 1USVA 1T2NA 3DA8A 4LY9A 4CT0A 5FO0A 3FDIA 3H83A 4LDAA 4EHFA 1OQAA 3QPBA 4QRIA 1HO3A 4ZD6A 3SBDA 1CLUA 1ZINA 2WJ4A 4JB8A 4FN4A 3U7JA 5KNCA 1FFGA 1RPZA 3NLLA 2A5LA 2DQSA 1NKVA 4FYKA 1P2TA 1N1GA 1X19A 2DFPA 2LE0A 4D8UA 1JKMA 1I0IA 3A11A 4XD2A 3EGDB 1G98A 2RBGA 3UB4A 1IXKA 3GNTA 4HH0A 4WH0A 4N6OA 4AZWA 4F2DA 3B6KA 1H6BA 2ANCA 3GARA 1LFDB 3SS9X 4Z4ZA 3C0KA 1Q0UA 4YDRA 1YZVA 2BI8A 2Q5CA 1RLMA 4GE0A 4YAGA 5JC1A 4UPVA 2RAFA 3L0DA 4S2EA 1GG5A 4ZODA 3QE9Y 1C8LA 1JB1A 1NRXA 4D0NA 2JFWA 1QV7A 2WIKA 3CKYA 3OLQA 4EB6A 5LJLA 3QEBZ 2CWDA 5LQCA 2HXSA 4DWJA 1DPFA 3N2LA 4K9SA 2JGDA 4ZI7A 3LO8A 1QYVA 4DRXA 5KTYA 5JY6A 4YXWA 1F48A 4FOOA 3I01A 1R10A 1GGEA 1C7IA 3AJAA 1L7VC 2QDXA 2GRUA 1UAAA 3WFJA 2JK0A 3TK1A 4F3TA 3DBVO 1CZHA 3BMQB 3F6YA 4EJSC 3NOQA 3NM4A 4QUGA 1KEWA 2QZSA 4DLTA 3FIUA 1Y4DE 3LQYA 3R7NA 2K7FA 2BI4A 1OU0A 1HTTA 1DAGA 2WSLA 1T35A 1R6UA 4LAFA 5DRYA 5TSDA 3RIYA 2ZB2A 3W5IA 1T6ZA 1AZTA 2NSDA 3ZHVA 1R4MA 2ZJYA 1YFJA 1UBHS 1ZH0A 2PLWA 2ZJ7A 3HRHA 4NQZA 3SAJA 4DJFC 3Q1LA 2WIBA 2RIPA 2H00A 4KPGA 1GTJ1 4BBAA 2ERYA 4YQYA 4DMRA 4EUEA 5BSXA 3N5CA 4BVBA 5K0CA 2I6SA 3DP7A 1CUEA 5LP1A 3IALA 1RE0A 4D3YA 1TAUA 2PEZA 3WAJA 5AJVB 1D6SA 1GAJA 1AG9A 3GIWA 5J9FA 3CRNA 3RC7A 4NJOA 2XYRA 2NAPA 2O4UX 2R65A 3LY9A 5I7UA 1GCIA 1FK8A 3P45A 6Q21A 4OH7A 1UZUA 1JSXA 4DCOA 3NH9A 3JZDA 1CJUC 4ARBA 1R50A 1P7CA 4EKIA 4WBNA 1CQXA 5CRIA 1W36D 3M8KA 4L5JA 4D9NA 1CX9B 4DZRA 2AQ8A 1E1CA 1T2CA 1YXMA 2FFJA 3E9DA 5ITZB 3OPMA 4QICA 3IO5A 2A0WA 4N6NA 3NWEA 3WGVA 5HOEA 4BLWA 1QU2A 2WUVA 1KMHB 3ZKWB 1FU7A 5I3CA 3X1DA 3Q5GA 3P52A 3G9UA 3NKVA 2YQZA 4HWGA 3AMVA 2QLFA 3L7YA 1CFJA 2B8TA 3WSTA 2JCVA 3REGA 1PKXA 4XJTA 3ZIAA 5G3ZA 4S05A 4GWLA 3DE3X 3MJVA 2RGRA 1AMUA 4NC9A 1FS4A 3I53A 5F73A 3H94A 2O1WA 3QFRA 1YZNA 2R1VA 4KU4A 1ULHA 1BDBA 3HWWA 4OHCA 2FAXA 4IJVA 1DWOA 3KQOA 2YYSA 4V0NA 3O4HA 4L4UA 1I2MA 1LNQA 3KAKA 4FILA 4N01A 4MRMB 2IXEA 1U9IA 1HI9A 4J0HA 5KHLB 2ERCA 1CDEA 2GRAA 2HEGA 3AX6A 4L6CA 5BRJA 3RG2A 3DTVB 1RYEA 3HA2A 4MEAA 5FYQA 3IJEB 2XT6A 5LPNA 1QUEA 3HBLA 1ZMTA 4K9KA 4W6ZA 1O97C 4KE8A 3I04A 3QKRB 3EOAI 2X6YA 4XKWA 2EWMA 5KYGA 3WGNA 3FWYA 1LBEA 2CKDA 3C4QA 4LTNA 5F4OA 2G25A 5B2ZA 4B33A 1NNI1 1NVMB 1NPTO 1QYRA 5CT8A 5DFAA 3HACA 4JLJA 1U65A 3BXOA 3ZUGA 1T3SA 4X20B 3QGMA 1GAQA 5LNK1 4EI7A 5JW6A 1MUUA 4U2DA 5D3MA 3RUIA 4C04A 3JWGA 2J0UA 2NO5A 5C81A 3NDJA 3OPQA 3TSCA 1V48A 5B1IA 2QXUA 2HDHA 4BZXA 3A3GA 4HXGA 2HHLA 1XRRA 3V2HA 2OQ2A 3HGQA 4LF9B 2GXUA 1IWPB 1QUFA 3BS4A 3QU2A 3HCPA 1KEUA 1YZQA 4P3OA 4DQLA 2QRJA 5IYZF 1XTUA 3O4GA 1PF7E 5G1NA 5A7GA 5IYPA 3RQIA 3EULA 2J4FA 4XB6B 4WNAA 3TFOA 1PSZA 4XWYA 4JVSB 2Z5GA 3D7SA 5DV9A 1N9KA 1ECCA 3H8JA 1D04A 1W29A 1WZEA 2J3MA 3IUEA 2QYOA 5EGNA 5T4EA 4V0SA 5JYDA 3FJOA 5KOJA 1Q92A 1XZ8A 2ZRFA 4G86A 2AC4A 1JKIA 5BR1A 2GO7A 2ZIXA 1XZPA 2EZTA 2WDZA 4J4BA 2WT4A 4M7PA 3OMXA 4OBEA 5FPSA 3PGXA 1QTQA 1PJZA 3G13A 2I3ZA 2HCFA 2OOSA 2WSYB 3C5CA 1FUYB 1X7YB 1JIIA 1TL7C 4UD2A 3LCUA 1M5TA 1S2OA 3CIOA 5C80A 3E9MA 2XTJA 2YH2A 2Q21A 3G2MA 4RWZA 2YY6A 4URYR 3RF7A 5BMVA 5EWJB 5M34A 3EGXA 1A98A 2W6JD 3M5CA 5L53A 1Q7CA 1WEKA 5EUCA 1ZUIA 4BP1A 1GFWA 2F9MA 2O1SA 4RDCA 2E87A 5JDCC 2WHEA 3FWKA 3T7SA 1CY0A 1R0SA 3IERA 5EXEA 4YDQA 1NRWA 4IRMA 4NYMQ 5JSUA 1SOAA 1P77A 3C3XA 2WA1A 5BMVB 1GGNA 3OZAA 2GUGA 4RNCA 3DWGA 2P41A 3SZLA 1QO7A 2ZYUX 2QLTA 3OI7A 5IABA 5EIAA 1W4LA 5DZSA 1V9LA 3ZZMA 1GNVA 4G24A 1HTWA 4BFVA 4E5YA 4PAOA 1VJCA 3ZE0B 4TUYB 3STTA 2WPDD 1DEOA 1Z47A 2WHRA 3U4DA 2VOEA 3FAZA 3OJFA 3LV8A 3TW8A 1KYQA 1IVSA 2IYAA 2FDRA 3TDNA 3PDWA 5TMDA 4FMBB 4ALNA 3RC8A 2B34A 4L2IB 4ZOLB 1SOUA 4OQPA 3D3JA 4GZMA 3SBOA 3UG7A 5CLHA 4XDZA 1PN3A 3WWDA 4FFWA 1WOOA 3P9ZA 3V97A 1GT6A 3DDOA 5CUQA 3PTLA 2E4VA 2J8ZA 3W6NA 4O8ZA 1FBNA 3RUPA 1QS0A 2RGWA 4H6VA 4L1KA 1RBQA 3ABZA 2E5LB 4UFOA 4E51A 1HYEA 2H1OA 3MCVA 3JQAA 1JYFA 3DBLB 3DXYA 4BP9A 5A7FA 3FUCA 2V6FA 3RWBA 3ZIAD 3UUEA 1P60A 3P2KA 4R84A 4QX6A 1YSCA 2RHGB 3VPSA 5JNVA 5H5JA 3JQGB 5IEJA 4CXMA 1E2EA 2B4TO 1VHJA 3CZMA 3IELA 4Q4AA 3UV7A 3DT6A 1JDTA 3ZCSA 1GP2A 1VKOA 1NJFA 1TKCA 4D8WA 4ER5A 4G7XA 2Z2ZA 1NUTA 3KLNA 4QTZA 3VM6A 1MC8A 1XJWA 1RWBA 4GXQA 2FMTA 1R5JA 4DQKA 3BWDD 3LY8A 4D4MA 2IHKA 1GQOA 3LYHA 2ZIAA 4YVFA 3VR6H 1Z28A 3GVHA 1P72A 2I99A 3K70C 4KKTA 3AFNA 3QJYA 1PSDA 3Q12A 2FG7C 3M6FA 1S02A 5IXYA 2X6QA 1AS2A 2ENWA 4CKXA 3I2JA 1UPFA 3NQ41 4BMPB 4K9QA 2P7HA 3IP6A 1G0OA 4HXEB 2KLHA 2D9RA 4M9UA 2FE1A 4MHOA 4PYQA 3KUUA 4RKWA 5ESXA 2A4KA 4DEVA 3AUUA 5BUZA 3BWXA 1RYMA 3BGVA 3F49S 4NV0A 2P9JA 5A06A 4EJ2A 1SU7A 4BEWA 1U0NA 1QOPB 5IJZA 1VHEA 2QVLA 2V1UA 1SXHA 2DUNA 2Y8EA 2YYZA 2XX3A 2YZMA 3DCYA 3G8BA 4WRRA 3PJGA 1UBCA 3OWXA 3V9PA 1OH7A 1LX6A 6YASA 4E0FA 3HG7A 1P1FA 4IGKA 4IXMA 2IF2A 3GHYA 1X8JA 3GT4A 3V6MA 1FRNA 1VPVA 1H2YA 1UDBA 4JT8A 2F9LA 3D4LA 4FQ5A 1IMJA 1SOWA 3IYLW 4P4TA 4PAAA 3RY8A 1E1QD 3CUYA 3I34X 3QTTA 2OO3A 2FLVA 4DMUB 2QN9A 4K2AA 4RL6A 3UZUA 2WAXA 1NI5A 4ZI2A 3V2IA 1NNUA 1JLRA 3UBTA 2WZNA 1WY5A 4CKWB 2KB0A 3F5MA 3N05A 1DP4A 4MQMA 3IL2A 4PIVA 3H5VA 1LFAA 3T7AA 1HQDA 3F5QA 4L95C 2GPWA 5I7HA 1E59A 5GP1A 1ZN8A 5C7YA 4UVGA 1F2TA 1G8FA 2CEKA 4CQNA 3TQCA 4TLBA 2P2LA 2Q5EA 4J2TA 4FIDA 2CUTA 4YDHB 4Q6BA 5DLDA 1M83A 3C7AA 1EWKA 2VSQA 2ECOA 3MC1A 2R48A 1QXSA 2OV3A 4UHFA 1YR6A 4ZCRA 4TUYA 1BEEA 4DN6A 3WMEA 4LDJA 2HXYA 5WRFA 1HT0A 1QO9A 3WIVA 1Z0SA 3HU2A 3IBTA 2D2VA 1XHFA 4KGZA 4HAOA 4K6KA 4PPYA 3RRMA 3ADKA 3UAOA 4YLYA 1XZGA 4MP6A 4OOSA 5JMOA 4QGFA 1U5AA 2X9QA 1PHRA 2GHQA 1L4MA 4FS3A 3UATA 3QLUC 5JALA 4FSXA 3RVOA 3RVLA 1T4DA 3RYIA 4IHQA 2O8EA 1MR3F 3BWCA 4EPWA 1G2PA 1KY5A 1Z18A 1IHUA 2QK4A 3IRVA 3IVAA 5AH0A 1J0EA 5JO9A 4B31A 2C5AA 3MRSA 5J47A 5JD6A 1QYWA 3B3GA 1E3IA 1GQRA 3K5PA 3ONDA 4HBZA 4X94A 4FEAA 1U4SA 2IOQA 1YUBA 1O95A 3EZXA 4XAQA 2BW0A 4UZUA 3OZFA 4LYFA 2P78A 4UXJA 5LQRA 1ZDMA 2PYDA 1ZHOA 5I8WA 4EG5A 2ADFA 2DKNA 2SKDA 2JFNA 4XYEA 4YMSA 4RYDA 3DB1A 4J7AA 2YUIA 3HGTA 1DUSA 4AUEA 1XJCA 2Q29A 1B1CA 1FP4A 3FDZA 4BBJA 5BVGA 1KZ9A 1YT5A 3PNPA 2AMVA 2YRWA 3PE4A 4FD3A 3ZJ4A 1OT3A 3KFXA 2ZUEA 3JQFA 3K7EA 3VOAA 4N6GA 2KVOA 3ICCA 5INTA 1T43A 3WGMA 5M7EA 4RD2A 4ARVA 3L0PA 2FEWB 2I91A 2CMFA 4J0KA 1SKQA 4CR7A 4URFA 4GKKB 4A8HA 4RLSA 1XRMA 1IM2A 2COEA 1V4NA 2HDNB 3KE9A 3GFSA 3RCBA 4I3FA 3R6LA 2QJTA 4NNJA 3NTOA 4PRKA 5JPCA 1F3OA 4UUPA 2PN1A 4R83A 3RKUA 1S2MA 4WKPA 3WO1A 1YQGA 5K0EA 4OHZA 4X00A 1H1TA 3D3WA 3Q6NA 5I7RA 3UCFA 3AB7A 1JIKA 1ZIPA 4RMHA 1WMFA 4HRYA 4W7SA 2HGZA 3LQKA 1UINA 4IKEA 5I47A 1Q3KA 1TCAA 3FM9A 9GPBA 1N5LA 4HTFA 3BRSA 5C7OO 2LCIA 4L72A 3QPWA 1ZP6A 1FFBA 4IQ4A 4LJ7A 1NUSA 1H6CA 2PPVA 3W90A 4MICA 5GZ3A 3YASA 1PGNA 2UYYA 2I03A 4K9MA 4WMLA 4OXRA 2F43A 4JZYA 3UJPA 1EFPA 1GNPA 3L01A 4KN8A 3VKVA 1VYTA 2JLSA 3ED5A 4N5DA 4ZVVA 2VBSA 1NY5A 4Z2YA 3SJBA 4DV1B 4ZAGA 1T9CA 3IA7A 4GC5A 5TDHA 3W5AA 3PYXA 1Z06A 3DZHA 3UENA 1A9ZA 1D2AA 2AS0A 3BMOB 3MGCA 2LKDA 2D5AA 4Z7JA 2QUKA 1GTZA 1TRKA 5E7MA 1RJ9B 2REBA 3GLSA 4LPSA 2KQUA 5B58T 3OU2A 1WG8A 2EV9A 3PUZA 4BHTA 2RI1A 2YNMC 4OJMX 1V5EA 1KO1A 3B20A 1QPBA 2GERA 3W8FA 4Z5XA 5CEFA 4C4PA 1ADBA 1Z35A 4ZTUB 3GUVA 3HVKA 5JECA 2HR1A 3ZOKA 3Q10A 4G4JA 2VG8A 4EQ6A 1ZJ4A 1S0UA 1PFUA 4LRXA 4M1YA 4UBNA 5J4HA 1P74A 1TUEA 4TQAA 1PEKE 2HT6A 5CT9A 3PZBA 1PR3A 4NBNA 1ISSA 3M4ZA 3P96A 4C0BA 3NC4A