3ZBUA

Ferredoxin-nadp reductase mutant with ser 80 replaced by ala (s80a)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYAIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNEKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title A Hydrogen Bond Network in the Active Site of Anabaena Ferredoxin-Nadp(+) Reductase Modulates its Catalytic Efficiency.
pubmed doi rcsb
source organism Nostoc sp. pcc7119
molecule tags Oxidoreductase
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3zbuA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3zbuA02
1BX1A 1KK2A 4YAWA 3W2GA 1CNFA 4F7DA 1D1NA 1M1KD 1QH0A 3WNBA 4YALA 5FA6A 1QGYA 4LBZA 1YI2B 1B2RA 1K73D 1FNBA 3U6BA 2PMDA 3CCRB 4FK8A 2HMAA 1QUFA 3WXMA 3QE2A 2VZLA 1GJRA 4P3YA 4C0SA 3OZVA 1JA1A 4N3GA 1I7PA 1E64A 1KQSB 4M4SA 2BGJA 3CXCB 1B23P 3B82A 1E62A 3J81k 2QMUA 1XB2A 4MYUA 1YIJB 4TMXA 2C78A 1QFJA 2OK7A 2RC5A 3W5VA 3CMAB 1GAQA 5GV8A 1YITB 1FDRA 1FNDA 3W2FA 3VO2A 5H59A 4ZCMA 4Y9RA 1VQ5B 3FPKA 1OB2A 3G6EB 2BVNA 1EWYA 3V76A 1FRQA 1QVGB 1OB5A 1VQ7B 1G7CA 3OZWA 3I1FA 1W87A 1YHQB 1VQ6B 1S72B 3CPWB 3WNDA 3CCMB 2HDNB 2EFGA 1IB0A 3CCEB 3QFRA 1D2EA 2YWHA 3ZZ0A 2DETA 4DQLA 4PC6A 1YJ9B 4M2LA 1K9MD 5H5JA 1GAWA 1VQPB 4B3XA 3LYUA 2BMWA 3CB4A 4Y9UA 2PLFA 4FWTA 1ZM9A 3CCLB 3W2IA 5DSZA 2XNJA 4RJLA 4PC2A 3AVXA 3CC4B 1W35A 3A1FA 1QGZA 3QSYA 1A8PA 4ZGQB 3CCQB 2FX3A 2VNIA 2B7BA 4UAJA 1VQ8B 1VQ9B 1QUEA 1KRHA 4N3NA 5TV2A 4YAUA 2AHOA 4YAOA 1KK0A 4C43A 1QFZA 4ZV4A 3W2EA 2BM1A 3OW2B 3B8HA 3ZBUA 2HCJB 1EP3B 5EMNA 3B78A 4HE6A 3PENA 1U2RA 4M0LA 4FN5A 1D8TA 1W34A 1JA0A 2NPFA 3SJZA 2QN6A 3LVBA 4LBWA 1VQKB 3ZZUA 1NJID 1F60A 3AVWA 2BGIA 1TTTA 3E1YE 3G71B 1GVHA 1R5BA 1TUIA 1IJFA 3VNUA 3VO1A 1YJWB 4QFMA 2BV3A 4RD3A 4LC0A 1QGAA 4M1KA 1F20A 3LO8A 3CD6B 1KC8D 2VNJA 3WBKA 1DARA 1VQNB 1QX4A 1EP2B 1HA3A 3E20A 3CC7B 4J0QA 1AIPA 4LBYA 1QG0A 2J7KA 4IW3B 2ZITA 4RD0A 1OGIA 4P6VF 4NBSA 1G7TA 4M53A 3CRZA 2YWGA 2GQFA 1BX0A 3P26A 4LBVA 3AVYA 5THXA 3U2QA 1TLLA 4PC7A 4PC3A 1CNEA 2YWEA 2DCUA 3CCVB 3AVVA 4B43A 4BPRA 1R5OA 1Q7YD 2XEXA 2PIAA 1GO2A 3QFCA 4TMZA 3P27A 1NDHA 1EFTA 1TVCA 3CC2B 1EFUA 1BQEA 5JBQA 2R6HA 1ZM2A 3W5HA 3AGPA 2C77A 4AF6A 4TN1A 1SM4A 1KTVA 4MYTA 4G1BA 1R5NA 4H9GA 3CMEB 2BF4A 1VQMB 1FNCA 1ELOA 1M90D 3AVTA 4G1VA 4WQMA 4TMWA 1K8AD 4EH1A 1JB9A 4PGOA 3QFSA 4TMTA 2QTLA 3AGQA 5AN9A 1DDIA 1KD1D 1J9ZA 1N0UA 1G7RA 1VQ4B 4U9UA 3W2HA 1VQOB 3WY9A 2DY1A 1Q86D 4B44A 4DQKA 4Q7JB 1BJKA 3JQRA 1JNYA 4RCZA 1Q82D 1AMOA 4YAFA 3LRXA 4ACBA 1G7SA 2E1RA 5GV7A 4AF7A 1ZM3A 1ZUNB 4HE5A 4ZGNB 2D74A 3MCAA 1SKQA 1H85A 2BSAA 2OTLB 3JQPA 2YWFA 1QVFB 2VYQA 4R71A 1Q81D 2OK8A 1N0VC 3CCUB 3OJXA 1UMKA 3QFTA 2GPJA 3VNVA 3AVUA 2DEUA 1IJEA 1WDTA 3MMPA 3U6KA 1VQLB 1N8RD 1CQXA 4RD1A 2RC6A 2VNHA 4ZCLA 2OTJB 5TY0A 3VMFA 1S0UA 2BPOA 3ZC3A 3JQQA 1KK3A 4ZCIA 2QDXA 1KK1A 4ACAA 3I55B 4QHYA 4Y7CA 1QFYA 3WBJA 5TR9A 4AC9A 1EP1B 3MHPA 5HXBA 2XNCA 4B47A 4TMVA 3FJOA 1DG1G 3ZZTA 4RD6A 1E63A 4B4DA 1ZM4A 5KSWB 1DDGA 1YJNB 4G5GA 3CCJB 3OJWA 3W5UA 2VNKA 2X3UA 1OGJA 3ZBTA 4PC1A 1EXMA 2B7CA 4B48A 2QEXB 3ES9A 4YHBA 3G4SB 2BM0A 4RCYA 1XE1A 3CCSB 1H42A 2BN4A 3WYAA 1EFCA 2QTZA 1KJZA 4RD2A 3OZUA 1JJ2B 3CW2A 3WNCA 2DERA 2QA4B 4K1XA 1FRNA 3I56B 2CNDA 2CRVA 4RD4A 1FNMA 2B5OA 1W2BB 2EIXA 4NCNA 1GR1A
chains in the Genus database with same CATH superfamily
2VUIB 3VO8A 2NV4A 4ALJA 3RJ5A 1CNMA 221PA 1Q1EA 3O6VA 5CH5A 1DWQA 3ZIAA 4RESA 4ZV7A 3BIFA 2ES4A 1N5MA 2NUAA 2CB0A 3I61A 4RK5A 4PHCA 1YQDA 5LYYA 2P6MA 5HVNA 1YE3A 5KTRA 2BCEA 4Z9BA 1CEQA 3BA1A 3OCCA 1UMCB 3GJ7A 1Q3TA 2GHQA 2FPPB 1RTKA 1UQTA 1I5EA 2WIJA 1R3UA 2H06A 1YDFA 2A1TS 3GRFA 3KVVA 1BD3A 1E60A 3TWOA 3NDBB 4B6GA 1YIAA 4Y2VA 1MJGM 1U04A 3KYIB 3CP2A 4M1MA 5EE5B 1B0ZA 4XX0A 4L5BA 4FK8A 4MICA 1JHZA 3LGSA 1P4GA 2HMVA 3UHJA 4MITA 1QUFA 2X9QA 1NF9A 4KN6A 5I7RA 4KXFB 4OEHA 1T9HA 5I9BA 3ZIUA 2GS9A 4UBLA 3T5PA 1I24A 2QU7A 2Q1XA 2WAAA 1DJNA 1DPFA 3LT1A 2XT9A 3VSAA 3K1JA 3WA6A 3C74A 4N3GA 3FMIA 3DNMA 3V7NA 2P7IA 3ZYCA 1FY2A 2HIAA 4MI1A 1G60A 2BBWA 2MOKA 5L8VA 3AF4A 3N2GA 3QLTA 4UHBA 5CVDA 1R2QA 5AKEA 3S2EA 2VYCA 1OX6A 1X0VA 3SOPA 3I4LA 2WWTA 1PT8A 3CYFA 1UJ2A 4KG7A 3BCRA 4FMPA 1SULA 1Y5RA 1H3EA 2FPOA 5CM2Z 1YU6A 2VP6A 4J03A 2CNLA 1NY6A 3AR9A 3V1MA 3U7QA 5KX5F 2PEZA 1CK4A 4QREA 1ZGBA 1SKYB 4N6NA 1JIIA 2R7LA 4HD8A 4R7GA 4ZQFA 2A0FA 3ZHUA 1VA4A 2J3MA 2QLJA 3IGFA 4BMXA 2JDIA 1G3QA 2IGTA 4DCPA 4GPBA 1QH8A 2YYSA 3TKAA 3P4UA 821PA 5BW6B 3TGWA 5ALVA 2IA5A 2DAPA 1PL0A 3E27A 4ZQBA 3PFNA 2G80A 4BNHA 2K2QB 3CF0A 4AJJA 5JS2A 3BXEA 3LLVA 4GM4A 1J97A 4JB8A 4D8VA 1DOHA 2CYCA 4MVJG 4X91A 5JY6A 5F9MA 1D7AA 1W44A 1Y5MA 1KOFA 1SCNE 3QYJA 4UHCA 4FNMA 4CDMA 1UZMA 4E4YA 3T1YB 1SXJD 1YQWA 2GJPA 1KEUA 1JT2A 3VSBA 1GZ5A 2YJ6A 2Z58A 4E12A 5A0TA 1Z75A 3FTCA 3THSA 2X19A 1G1MA 4RULA 4JJKA 4J8PA 2FRDA 3CRMA 1IZ8A 3QY0A 3RTBA 1G21A 1TM2A 1GSHA 1ZH4A 4NU6A 4E09A 5DIZA 3OEEA 3CCMB 2IIVA 4PO9A 1RAGA 5FLYA 2XQJA 3O84A 2WF6A 1UZNA 3D8NA 4U5QA 3TCNA 1P2BA 3PR2B 1HTTA 4IXTA 2HDNB 2QV0A 4MWTA 3T5MA 3D1JA 3K9LA 2WWRA 5EKTA 1VLJA 2PA0A 4GXTA 3RC3A 4IDPA 1AXRA 3MPUA 4GI1A 4GS5A 4IIJB 4IPTA 4MROA 5IAOA 4WBXC 1J2JA 5DX1A 3NOVA 3UH0A 4DIFA 5AKYA 4FFRA 1CFZA 4B75A 1HDXA 1WUYA 4PC6A 1TVKA 4BX3A 4DLZA 1U5CA 4WK6A 4ZICA 2E4AA 3HS3A 3ACCA 1KI6A 5B6IA 1JP7A 1XU4A 4JMLA 1JVNA 3HY6A 2QUKA 3IT2A 1UKEA 5DLDA 5GONB 5FWXA 3TAUA 1J49A 4G1CA 2HFKA 4TXHA 3TL3A 4A8JA 3LQQA 5DBGA 4X94A 5TRTA 4M8LA 2IU0A 4X24A 2P1ZA 2WVHA 3LT0A 3T1OA 4DLVA 5K09A 4CFZA 4QRIA 1H6CA 4PYRA 3SJUA 5KEIA 5GAJA 5KYNA 1K5PA 5DHFA 4H1VA 5IDVA 4OH7A 2MU1A 1V0FA 1F06A 1MEOA 1XVUA 1GLNA 2FX5A 3BZWA 4QRDA 5AI8A 5BT9A 2VBUA 2IYPA 2ODNA 3HNPA 4DLSA 1XCBA 3SPXA 4KK4A 3KVNA 2OFXA 1H2BA 2EWWA 3OM1A 3NBMA 2Y0DA 3QZUA 1AE1A 4H7DA 4N0QA 5TDHA 5LQCA 1N34B 4MZDA 1HFEL 2ZRFA 3G49A 4R9RA 4GDMA 4J94A 3UMFA 3QSYA 1DPGA 1DAHA 1EBUA 4L8WB 4O2AA 4YB8A 5D01A 1EEHA 2QGZA 3GIWA 4I4LA 4M36A 1CHNA 3WKBA 4OP1A 5CW1A 3GLRA 4Q16A 3ZV6A 6PFKA 3V55A 3C6MA 2R1UA 3UF0A 1G291 3OF2A 1BDBA 1JG3A 3IQFA 4CFSA 4KPYA 3BEDA 3KELA 4FJ1A 4GBJA 4PGFA 4BJ5A 2UXCB 2PX3A 3LA8A 2O7VA 1Y7PA 1RQNA 1LNSA 5F7JA 4DWWA 2Q62A 4PYMA 2UXBB 4AULA 4NBVA 3KHKA 3HEAA 3IAM6 2QD2A 5LYJF 1HRDA 1P91A 2TRSB 1T29A 3FYHA 4JELA 5JH7A 4P7KA 5LCXA 4LZLA 1EFPB 4FILA 2G9UA 3SNKA 1QFZA 3BWMA 5F77A 1Z26A 4EEZA 3GPCA 2WQZA 1OC2A 3T1VA 1L7DA 2C2KA 1R6DA 3ZBUA 3Q72A 4NF2A 1N2XA 1E2IA 2HCJB 2VHXA 3BE6A 4MHTA 1QDUA 1VE5A 4TTAA 5A5VA 4RYDA 2JCBA 4K8RB 2IYWA 3GFGA 5FAKA 2HA3A 1TMKA 1O4VA 3NJ4A 3CY6A 3RQSA 4A82A 2P5TB 3LBIA 3AFNA 3ZY5A 3ZZUA 3Q85A 5K6TA 4XKWA 1JG7A 3GQBB 3KSBC 3B1XA 1KF0A 1IXSB 3BRWD 1OREA 2DPGA 1JPVA 3MT8A 3P2YA 4TZKA 4F2WA 4AS1A 2WIAA 3CUYA 4YP6A 3D3KA 2V7VA 4G0QA 2EBWA 2PRYA 3H11A 1H8EA 5JANA 1PIWA 2MINA 3TCKA 4DV4B 4J3NA 4CUJA 3MYYA 3S55A 1O96A 2J7PA 4HAWA 1UWLA 1KQ3A 3CC8A 4MYHA 4BX0A 3IBFA 2CV0A 3ZE6A 1Y3FE 4CHTA 2YN4A 1OR8A 2YHSA 4M0DA 1EMDA 1NBWB 1I4OA 3TSCA 4DSNA 4DUPA 4IVPA 2YRWA 1NGSA 1RLMA 4PG5A 5LSAA 1H2FA 3ONUA 1W93A 1RRKA 1RPNA 2NTYC 2R8OA 3AEZA 5HK8A 5FFFA 1KVUA 2ZI3A 4FEGA 1HUQA 3WMFA 5CDTA 4TKLA 1C3LA 3JTMA 4D0NA 3E4CA 2CE7A 1RXEA 5LBIA 3LF2A 1SUAA 2ALJA 3CM0A 3F2VA 2C84A 2ID8A 3VKFA 4CF5A 1MEEA 2ZJ6A 3FNGA 2J7KA 1QQAA 1JFFA 1WEKA 2H48A 4Q93A 1YMVA 3MZ0A 5AJVB 1RC8A 3B3GA 1WXQA 5CRIA 4IXDA 2Q27A 4HNGA 4PPFA 5E2IA 2DIEA 1V37A 1TUGA 3EZGA 3Q3EA 2J67A 1M8KA 1VXOA 1BX0A 3CTAA 2C07A 4M1YA 1IIRA 1TQHA 1R4AA 5C4MA 5ALIA 3AVYA 3LNCA 4JJ8A 4PC3A 1CNEA 5GQSA 1NNLA 1CVIA 2J5XA 2VYVD 2CWWA 2W48A 1LPPA 3ESDA 5E6SA 3PC7A 5T3YA 3UO8B 1KEKA 3ICPA 5ICMA 2YNMD 3KQNA 3EEFA 1G0NA 2O52A 2UUBB 2YN2A 3AP3A 1F8FA 2BGNA 2RDMA 4S1PA 1B2LA 3ZY3A 2JFWA 3C24A 2CUTA 4J0IA 1NL3A 2P0YA 3DUFA 3OUTA 4G07A 4ZGBA 3JQGB 1A2QA 2VN8A 4Z3DA 2HDOA 7ABPA 1DGQA 1V11B 3PQEA 4PN3A 5JSHA 2XCRB 2OCKA 4WAUA 1R3DA 4E1VA 1K7XB 4DT1A 1Q1BA 1U28A 1KQOA 1WTAA 2EP7A 3F4BA 3GLHB 5K2MA 1AU9A 4EA8A 4RHFA 3Q3HA 4LJ9A 4YV1A 1R4NA 4D9GA 1Q95A 1AGPA 3ODGA 4O5AA 5IW8A 4BJHB 4U02A 3VC1A 1FS4A 2Q5OA 6YASA 3LXUX 1JJFA 2AR7A 4XIGS 3O26A 3SFVA 4YX9A 2PBLA 5IM4F 1GTZA 1RR6A 1X1QA 1Q22A 1E20A 1VTKA 3H1GA 3CMEB 2FPXA 1XTZA 3ACDA 1KEPA 3DAGA 3AEUA 5KNDA 5B1IA 3D4BA 2Z6UA 3EWAA 2W6OA 3ZHQA 1P18A 3BSWA 3E5NA 3Q7IA 4XR9A 4Z4YA 1HQDA 5HM6A 4BO1A 4ERNA 2ECOA 5JAPA 2ZK7A 1ACMA 2MMCA 3DXXA 1CCWA 1V6AA 3G6WA 4BP1A 3I5YA 3KS9A 1O8BA 2A5GA 4ZCQA 4ML3A 3SS9X 1ECPA 3IO3A 3R3UA 1MAWA 5LP6C 3GFQA 3EG9A 3HXOA 1Y4DE 2PT9A 1SUEA 2XMDA 5DK4A 5MF6A 3AC0A 4F2DA 3A0UA 1ZQ9A 4EBFA 4KQKA 1MDBA 1T5TA 1OYOA 3N8IA 4FQ8A 4M9UA 1G7RA 3OKAA 2XITA 4OF4A 2DPHA 1OF1A 1YOVB 1YV9A 1Q0ZA 4U8GA 1W59A 3PA8A 5JMOA 4BCBA 2ZIXB 3PUMA 2IBMA 2ZBFA 1VIAA 3WFJA 2OBLA 5AVSA 1M8JA 3MMXA 4AJNA 4WACA 1N7JA 3KJNA 5DWDA 3IIMA 5IWAB 3H6KA 1C7ZA 1WORA 2R00C 2X2PA 2QTHA 4TKUB 5LUBA 4LSZA 3W90A 3GJRA 2Q07A 2PL9A 2SICE 5A7GA 1AV7A 2GRAA 3EZFA 2VLIA 3QVVA 5TPZD 4DABA 3NTRA 4QUZA 3EC2A 4OQPA 4Y2TA 3BE8A 4ZYZA 4LPSA 1KKMA 1ZAKA 4CQLA 4BY9E 4NZ9A 3SQMA 4ZD6A 2DLDA 1GU1A 3FF4A 3R5HA 4UPDA 1BVHA 1M6VA 2H3HA 5ECGC 2J3DA 2P79A 3RWOA 2OLKA 5L3SA 1PTKA 3QP9A 1EUQA 2MSKA 1EFVA 1UD3A 2Q4TA 4P8RA 5C9ZA 5D5HA 3GDWA 2O4CA 3MS2A 3GLFB 2DFKB 1KAQA 4Z9YA 1UBKS 4Q4CA 2DKOA 4QGSA 2WSSD 2OCGA 4MMZB 2BCGY 3KXIA 4L4SA 5K3AA 3UT6A 1JQJC 5BWLA 4H6VA 4R2JA 5DHAA 3D4IA 2GN4A 1EZZA 4ITRC 2BHLA 3Q9NA 2Q0XA 3VKGA 2ONYA 1JFTA 3INTA 4P4TA 3EDMA 1JYSA 3FR7A 4N0MA 4XGQA 1XAIA 2SCUB 3M5CA 3C43A 5C46F 3PJRA 2AUTA 3OZXA 4QU8A 5LPNA 1TJNA 1ZI8A 1L8XA 2G40A 3E9EA 4AURA 2QTFA 1VMAA 3IQXA 4YGXB 3BBLA 4DCCA 4UOQA 1X2BA 1Z2AA 3MMPA 4U2KA 4X8OA 5DNVA 3U4AA 1VQLB 3E84A 4G3XA 3BQNB 2HBYA 3HPRA 3UIEA 3WX0A 5IT9A 4ZI5A 1HO3A 4MO2A 4ZANA 4QELA 3UAGA 2JIQA 3KFXA 3JQQA 1KK3A 4ZCIA 3AZQA 1KK1A 2F1HA 4K9DA 1K3TA 1D07A 1LJ8A 1JJ7A 1NIJA 4EW1A 3ZV7A 2ZIFA 2NSJA 4TGLA 1SG0A 3PI6A 5LQKA 3KVOA 4XWOA 4ASUA 2EJUA 1Y4ZA 2RIRA 2V0CA 3OFSA 5K0LA 1DV1A 4DYVA 2IITA 2R8PA 4G5YA 4JBIA 3UFXB 2DKFA 2HCRA 2QRGA 3GMIA 3KVYA 1TT5B 1XQ1A 3V6MA 4G24A 4WVLA 2XY4A 3RU3A 3LGAA 4M3NA 3IELA 4TKMA 2XNCA 2CXTA 5JXJA 2WHPB 1Z4JA 4LJYA 3QPCA 1LK5A 5E9WA 1U7UA 2I2CA 4PLZA 5L7WA 2CV1A 3K09A 4UVEA 4B3BA 4US1R 3DC7A 1E63A 1A8HA 3OCUA 4L27A 3C5CA 2JBHA 3D3EA 3TLBA 1O6ZA 2G67A 4BDSA 2ZXUA 2J6HA 3B6IA 3FPLA 1RVV1 5CH3A 1NPYA 3GLUA 3M1IA 4R0VA 5KAPA 4D9NA 4QSMA 2V03A 2BF7A 1CUCA 1O5OA 1XJQA 5FEUA 1IEXA 4I1RA 1U0LA 2BBOA 3KV1A 3PD1A 3R5TA 4ZZIA 1UEJA 1SURA 4EJSA 1NAIA 2I2BA 2PWZA 2XGOA 1QYXA 2GF0A 3OX2A 3OJWA 4NG4A 4RXMA 5BN4B 1H3NA 2AR9A 3WOHA 3ZBTA 2P5YA 3M6VA 4MINA 3B3QA 4D1YA 4AY6A 2OOSA 3R5JA 2DU8A 3A1VA 3AP2A 4HQOA 1T6ZA 5J2UF 3A1PA 2YJNA 4I1OA 1XO1A 4RPHA 5DLQC 5DMXA 4DNTB 1ATIA 1B16A 2C4MA 4FZRA 4JY7A 5C34B 5B6PA 5BUQA 3HXPA 4W5OA 3AW9A 4YP1A 2P6RA 3X0DA 3KSRA 4NCJA 2HR1A 3UC9A 1E2QA 2CDAA 1XKLA 2C0PA 3ML1A 4ZJUA 1E4EB 5KDOA 3PXEA 1I4EB 4M1OA 4MKIA 3MK31 1IYZA 3NBFA 1UBOS 3HA2A 3MJCA 1NNEA 4BGDA 4P58A 1OFUA 3OFND 3PS9A 2NVWA 3ITEA 1B3BA 1TCCA 3ND9A 2AZTA 2YHIA 2B30A 3BCUA 4XYMA 1HXHA 1ZH8A 1E6LA 1AQUA 3GPIA 3MJEA 1H1LA 5LP6B 3QJYA 3K73O 4O0LA 1IONA 3OWXA 5ULLA 1GRVA 4LYGA 4BXOB 4B2YA 5C8DA 4PSDA 3W4JA 4DCGA 2XUJA 3I3OA 1NRWA 4ILKA 4K6HA 4BNVA 2X8JB 4JDUA 1FTGA 3CMMA 2PJUA 4N1AA 4NESA 5AO9A 3JQDA 4A6EA 3ZDCA 1ZR2A 3FTFA 2QT1A 1T13A 1U4SA 4Y6OA 1KPHA 1AKUA 1HR0B 3V8EA 4JV5B 1GKKA 4DV3B 1Q1QA 3A06A 1XPOA 5EJ2A 2X77A 2IYEA 2WE7A 3GRUA 5A5FA 2NO4A 2JAXA 5EFZA 3CLHA 2VF7A 4L0CA 5EJ9A 1E1CB 4KO4S 1AMNA 2F3QA 3MCUA 3H1EA 3SJPA 5I9TA 2AUMA 3EVBA 5ISMA 4GIBA 3P9PA 4J2HA 3KQLA 1CNFA 2RHLA 4EIWA 1Z0AA 4DDVA 3BERA 4UW9A 4B6FA 5LA6B 4D4JA 2XWPA 4ITUA 2F4VB 4Y0NA 1C3JA 3I8XA 1IY8A 3OSUA 4MMXB 4OOXA 1JLRA 4FYHA 2VT6A 2A59A 1XPUA 3L41A 1Q14A 1XNJA 4GKAA 2NTNA 4BMDA 2R86A 3C3MA 3TR5A 2PMDA 2HC9A 1L7AA 3UGQA 1S6YA 3ILVA 2BTQB 2VPQA 2FW6A 4PX9A 3U5TA 3IOEA 4LCBA 3HACA 3CZRA 4IS3A 5JV5A 4UJ5A 2EKDA 4PCAA 4JBYA 5FO1A 1H9AA 4P3YA 2V45A 4BIIA 2O07A 2HMWA 3EXEB 4DLYA 1XVIA 1X9IA 2FB9A 3KX2A 4IDEA 5DOVA 3TB4A 2B1QA 4BVEA 4TV8B 4CM5A 4EJMA 3UNXA 1OIVA 1Y8RB 3KPVA 2OMKA 3LGXA 1W9MA 3OP4A 2VH1A 3HO8A 3CXCB 4RY2A 2YFYA 2HIGA 3D5EA 1ESCA 4LRXA 3WQRA 4LX0A 3TZQA 4GAEA 2UZIR 3DTYA 4GSLA 4LHSA 1JGTA 4G1EB 1AO3A 3T9DA 4AF8A 2WICA 1USUA 5A9RA 4JOQA 3DL7A 3MAJA 1GSOA 4FFBB 2XHZA 1AY0A 5TQVA 3OZAA 1DAOA 3JD0A 2OL4A 1EM8A 3UMRA 5AT1A 4CMAA 4F56A 3LTNC 3F67A 5B7NA 1JF8A 5A3JA 2YQ5A 3MB5A 3TG8A 2YUTA 4QTTB 1LQ2A 5EMMA 5A3QA 1S2OA 5C4IA 4YRNA 2VTBA 2YZKA 4E5KA 2UAGA 4HATA 4AJ1A 4GLFA 3ZS9A 1CS0B 2VSOA 1S3GA 1QK4A 3PCTA 2XTMA 4GSYA 5F51A 2ONJA 4IDAA 4IHJB 1A4XA 1IY1A 3A11A 4DJJA 3P9SA 3TO5A 4CUKA 1CZNA 3L0PA 5FBKA 3CRNA 1EWYA 4X7DA 2WWVD 4AWBA 4PW0A 2H1IA 2UVPB 3B3FA 1BS9A 1XZGA 4PZ0A 5FKJA 3TOSA 3ZJYA 4TYYA 3QLJA 3IBCA 2OV3A 2IPXA 2JIZD 4DUYB 4TV9A 5I7VA 4QTXA 3L8CA 3ZDFA 3PFIA 4NI5A 3F6SA 3T7IA 2ZVQX 3AVOA 4Q21A 2VSQA 4LNAA 1NRJB 4I1VA 5IT0A 1XDZA 1DTEA 1PYGA 3CH7A 1YWGO 4OYRA 5C53B 2PKXA 2BW0A 3BD7A 3FPAA 2PKYX 4OY3A 4X44A 3VI4B 2RB5A 4ALLA 1RYBA 5HBRA 2AXEA 3RVMA 4WFJA 1W4LA 2HA5A 4FC6A 5JSKA 1Q21A 2WUWE 3LZDA 1X80B 3MA0A 3M9LA 3KYCB 2QR5A 3PE4A 3PFCA 2VXOA 4DNPA 4EUFA 1VJ0A 1V26A 1U7ZA 4OMCA 1P1CA 1L5HB 2V6JA 4RO0A 1KXZA 2LKCA 3BMQA 4KXMA 4TUYB 4XAQA 4WL0A 1YUNA 2PTGA 3NNDA 4OJNA 4JLNA 1VJ1A 2HSDA 4C6SA 3L1KA 2LNDA 2J85A 2JD1A 1ZCFA 5JC1A 1QFSA 3DLCA 2HRQA 3U7IA 1RIFA 1ZI6A 2O3UA 3ROQA 1Q7CA 4MCJA 1N4AA 5IU6A 3D7MA 4TZTA 4JYZA 1DJQA 2R6ZA 1K8XB 3EIUA 3WKEA 3PEVA 3JU4A 1Y63A 1TZKA 2Z4TA 3PKJA 1E94E 4B76A 2EHDA 4OMDA 1ICIA 4YMUA 3MTEA 3HVJA 1QE3A 2AOVA 4M86A 4LIPD 1R8JA 5I5GA 3K0KA 1ZUHA 3VMMA 5TVKA 1K7SN 4JROA 4F04A 1MABA 1R5JA 1CZRA 1U3GA 5CYPA 2DF8A 1PNTA 2A84A 1X7WB 4KKVA 4J2TA 5CNIA 3TW0A 4IIYA 1VL8A 2XF2A 4CG1A 4K9QA 2Z6BD 2ZJ4A 2P4EA 4NQZA 2WJ4A 4Q47A 3VC3A 3L49A 4JSRA 2FQQA 1VPLA 4ZOLB 5IJ0A 3T15A 4O5OA 2G82A 4O4IA 5D6NA 4DGQA 5JJ5A 1EK1A 1A9OA 1WF6A 2VF8A 3A37A 4MVJD 1RPJA 1MC8A 2J5QA 2RAFA 3F4KA 4Q3KA 4IJKA 3HYNA 4R2LA 2HQRA 1K92A 1XXHB 1BG6A 3CNNA 3NIWA 3ZOZA 4HC4A 3K2QA 3OQNA 5FOVA 1X0XA 2B8TA 3IB3A 4X93A 1P8JA 2QG9A 3KLPX 3TNLA 4N3NA 1HT0A 2H6EA 1T8YA 1X7YA 4JJAA 2XH8A 1HK7A 3ASZA 1CUVA 5ALPA 1NB9A 4CKEB 4KL8S 4FIZA 3DVRX 4ZT2A 2OGUA 4YYZA 1G5TA 4H77A 4KDFA 1D4ZA 1MQAA 2CJWB 2VI5A 5E9JA 3AHEA 2NSHA 4H6PA 5FHRA 1JVBA 3TQOA 3TTXA 4IDQA 1GR0A 4N7BA 2HA6A 1OLXB 3ZU6A 3AU9A 4M1WA 1R10A 4U9IS 3ROXA 5EMNA 1DQYA 4HQ0A 4ROSA 3DAYA 2ODQA 2D5IA 3LPLA 3B78A 4J4HA 4BEBA 1Y37A 1F17A 4XD2A 4WK4B 1RCUA 1OAOC 1OX4B 4QQRA 2Z8ZA 5ES4B 5KMGB 4FN5A 2XT6A 4A03A 2B2XA 4L1KA 3AQ4A 3S5UA 1ISGA 4BNYA 4PWYA 4BL5A 1VQKB 2B78A 2E21A 1K63A 5JNVA 4GPTA 1LTQA 3PWTA 3S1SA 1NG1A 2XVYA 1TZBA 3E8MA 3IT3A 3L04A 1KZLA 1XX6A 5HFJA 3T35A 2CXRA 2IDMA 1TTTA 3O8OA 3EIFA 2J8ZA 4DB4A 1KYYA 3CW8X 5LZ9A 4H4CA 3LKVA 3LPMA 4KZKA 1W0CA 1NR7A 4ZAXA 2VNSA 4LFAB 2HX1A 3ZDEA 4ZU1X 1OIXA 3ELYA 3HI4A 1ZIOA 3TTUA 1E4OA 2B6HA 4RHXA 1JV2B 3FGOA 4JJGA 2A9RA 4P32A 3WK5A 3B1YA 3DE1X 5DTIA 5J1SB 4WLNA 2DLCX 5D5PA 2H1RA 1A2BA 3WWZA 2CEKA 3UWKA 2B8JA 3JQFA 3MOSA 3SVLA 4MP8A 3UVEA 4HWPA 4LE2A 4KAXA 2WFAA 2D1QA 2WUFA 3CLRD 1UMDB 3OA2A 1JLLA 2Q8NA 4UM7A 4C14A 4ZOCA 4F3NA 1XC7A 2JEYA 3E5MA 3RC8A 2V7PA 1VMKA 1T5HX 2RMKA 3EZXA 1FFSA 3B1WA 1NDUA 3L92A 5EIBD 4B7XA 4TRJA 3BWBA 4FMCF 3VVLA 3S5JA 5CD9A 2QVBA 2BFBA 2VK8A 4Y2HA 4ZC8A 4HJRA 1VG8A 3A4MA 1SCDA 2J9FA 2J45A 3C7DB 4PICA 4ZRNA 1Y4UA 4FUQA 3VAAA 2H9AA 5FFMA 1E2NA 4A1OA 1NZFA 4NJMB 1FFEA 2RSLA 3HCRA 4AROA 5EXXA 3STVA 4DIEA 2AFHB 2FE4A 1CVLA 4KVGA 3CPHA 4AQDA 4FOLA 4KLRA 3VZQA 3FHCB 4HS4A 1FLDA 3GG2A 2XYGA 3MJRA 3VX3A 4C6HA 1IPEA 4Z1MD 1KEWA 1XI2A 3EPKA 3OZIA 4ES6A 3N2EA 5LKAA 4KGVA 3AM3A 1NLYA 3B9PA 1ZSNA 3U81A 3F3KA 5LD2C 5CA1B 2P2GA 3Q4GA 3UMGA 4P4SA 2VYNA 3H6HA 2P41A 3O4GA 4XPIB 3QVLA 2H4ZA 5TS2A 2PGNA 2ZBVA 3UMYA 2P2CA 4MKRA 4Y1EA 5JWHA 4XCVA 4OD0A 2CD9A 4TL7A 3D2CA 1N5JA 3A6ZA 1T0IA 1G8SA 2R6HA 2C58A 3NBZC 4TV9F 4X1KB 1AQIA 4X6UA 5EP1A 2EFYA 2W6ID 3WGYA 3VDQA 1C30A 1A9QA 2EFEB 3VR5A 4G97A 3MEQA 3UJDA 3U4MA 3EPJA 2GDJA 3C8ZA 2FOIA 2IPLA 4RV9A 1J8YF 4EEKA 3ESCA 2VIIA 4YHHB 4IFEA 2QMZA 3DNFA 1CERA 1V4VA 2R751 1ZW6A 3PFBA 4GVXA 4KW7A 3IPLA 4P4LA 4U3JA 2O7RA 3ONWA 1A7AA 3SE0A 2C31A 2QVYX 1GVNB 1KBOA 2FP4B 2R68A 3CS3A 4MPPA 5C7LO 2G1AA 1C7JA 2X8LA 2ZWMA 1BWQA 1QV6A 1OXUA 3Q39A 1IRIA 1NXOA 1Z73A 2BDUA 2CCKA 4C3VA 2H9IA 1ONOA 3C3PA 4TMWA 2P69A 2CLFB 2PFGA 4OHVA 4G0XA 4QOFA 2VUHB 2GBLA 2V7EA 4RY9A 1DBSA 2E5LB 4WKPA 2WSIA 1GDTA 3P2JA 5EQDA 1K0FA 4ONEA 4ZP1A 2JFOA 3A6JA 1S5PA 3T4UA 1FX0B 5F64A 3RFFA 5D3KA 3OW7A 2HEIA 2O5VA 1FUUA 3CNLA 1LPNA 3JQAA 3AETA 2VXCA 4MUHA 1PS8A 4TYWA 1XDGA 2FK8A 3O73A 1UBHS 3VZDA 3UHFA 1KD1D 3UEOA 4UUAA 2W22A 1J9ZA 3EBPA 4RIHA 1Z17A 1J2EA 3OTHA 4HZUB 2QRKA 4CMBA 4ARSA 1G59A 3LBFA 4U2BA 3CSDA 2FXVA 3HVIA 2OSBA 3E61A 3G9UA 3PLNA 4TWAA 5AMXA 5G4LA 4P2GA 5HF5A 4PZYA 4X7FA 2EGHA 4XLZA 3QEMA 2DY1A 4KSYA 4YACA 4ZOQI 4JYAB 2ZTNA 4FDVA 3HL0A 3WWYA 4QTUB 1WXDA 3C3DA 3WGJA 3FPHA 4Y6LA 1U65A 2REOA 2CFIA 5KYWA 3LX6A 2HTEA 4D02A 3NYQA 4PYJA 4HNAA 4RC9A 4E15A 1V7QA 1H8HD 3R76A 6LDHA 2REXB 3ZK9A 4CQMB 1P2VA 3NM5A 2BEWA 2X53S 1SO8A 3T8YA 4ACBA 1RS0A 2YKGA 2B2NA 4WOJA 5EJ7A 1PD0A 4IVNA 1AZTA 4EKEA 3CRQA 1PW5A 2PT7A 4OUKX 1IEQA 4OQLA 4O4IF 4RPLA 3QV2A 1M1ZA 3ER9A 1PJ7A 3CPSA 1E1KA 1O58A 1ZUNA 2A5DA 4YV0A 3ZVMA 2GJSA 2I7XA 1D09A 3D59A 3L8GA 1K6MA 2CL0X 5E4TA 3TTVA 2I4OA 3FRIA 2XMGA 1L8OA 4UDYX 2C4NA 1C9KA 3O38A 2WNSA 2VDKB 4OJTA 3HDHA 3GUZA 2ENWA 5CR9A 4G56A 2PVPA 1J2RA 4RS3A 3L0IB 2IX3A 1XDDA 1PG2A 1KO7A 2HU8A 4LHEA 1H69A 4V0QA 2G72A 1GTJ1 2JI6A 1DXHA 1URPA 3SOZA 3WMEA 4CIVA 1H5UA 2PH5A 3MJHA 2LDBA 4DDTA 1MDFA 3N86A 2H16A 4QECA 4JBGA 5F4JA 3AU8A 1TF2A 3VYUB 4Z2AA 4CKCA 1Y5NA 2QP4A 1X7ZB 2MSWA 4JLPA 2QM7A 4CR8A 1IJEA 1WDTA 1VE7A 4URUR 3TIVA 2ISQA 4G37A 5GZ1A 2VNHA 1DC3A 2ZRDA 3BF8A 1QHNA 1RHQA 4CR6A 5IF3A 2SECE 4ZVSA 2PJZA 4MA4A 4I55A 1Y6GA 1FB5A 1LV8A 3F5MA 4FFSA 3EHDA 1A72A 1XQ9A 2ORVA 2QQEA 4QHYA 5JCOA 2CNWD 5IYNA 2M5SA 3L0SA 2AN4A 1OZAA 2YVLA 3Q0TA 4GM1A 2BHSA 2XZLA 1C2YA 4DG5A 2JARA 1B8PA 3KQUA 2A78A 3MWYW 4EG0A 1I2MA 4B4VA 2C00A 2ZYTX 3PF8A 4GMKA 4DSTA 1XMPA 5JSZB 1KOLA 1XUOA 3MHPA 1XLUA 3SKXA 4K03A 4B4KA 1XNRB 1GQOA 2EP8A 1SHTX 3M1LA 3AI1A 3H5AA 4GICA 3WOVA 4LKRA 5TGZA 2ZR9A 5K0JA 4MV5A 1LPSA 4DMKA 5KVAA 1OZGA 2ZL5A 1HQKA 3GCZA 2IXGA 3WBBA 5LD2B 3NKVA 2D0OB 1QGDA 3NM6B 3DVAA 1BC5A 3HKBB 4BQOA 4LRYA 2G88A 2E0IA 3TVTA 5DNCA 2D3LA 4HT3B 3MJVA 2APJA 3OD5A 2OA0A 4FYKA 2QBYA 1HDCA 1EX9A 1IPHA 3Q9LA 1QNLA 1RYNA 4QU0A 3RSOA 5JDIC 3SKYA 2RBGA 4JC4A 2VNKA 1FOEB 5GTDA 1HG1A 2NWQA 1USKA 4PC1A 3IBGA 1SCIA 5HJEA 4M6WA 4XN3A 4HRVA 2B7CA 1WE2A 1LC3A 2IJGX 1NJ1A 2QY6A 4K9MA 5BYBA 4BYMA 2F8SA 4Q1DA 1KVRA 1L4GA 1N75A 3P5BA 1NW6A 4CMCA 3PNLA 4C3OB 4MR9B 2REQB 4XLFA 2Q99A 4YP9A 4NOJA 2V7XA 1L5FA 4MDHA 2XMPA 5G53C 1L7EA 3SCZA 2OWEA 3W9BA 1RKVA 4FE3A 4C4YA 5E38A 1GXSB 2AEMA 1Q2XA 3HC7A 3NTOA 4KO2S 3RJTA 4D9BA 1IXRC 4MGEA 4AAYA 5EWJA 4LHXA 3MS7A 1CZHA 1SC6A 3HA5A 3F9RA 3FPBA 2Q6LA 4TWZA 2XKBA 4AZ0A 2WHQA 4F4UA 4IZOA 1NULA 3K5PA 3OJEA 3D7RA 5F5NA 1JJ2B 3RODA 1IOZA 3NO4A 2GK7A 1D7OA 2IUFA 2ZB8A 3I1JA 1IN6A 3P2EA 3P8ZA 5ALLA 4B73A 4DA6A 1P1FA 1F6WA 3GH3A 1BJTA 4BKRA 1Y5LA 3EQ9A 4OHUA 4WKGA 4QGHA 5DVZA 1FFGA 1THTA 1JR3D 1WUJS 1LRLA 2BM8A 4CUZA 3GPLA 5F12A 5DXFA 1JBEA 1EGAA 5A05A 1YB4A 1KDOA 3RTDA 3RTEA 1SHLA 4WSOA 4CL0A 4YUYA 2EJCA 2OP1A 3WQQA 4FB5A 1NX6A 1WM1A 1X14A 5CXQA 5BNZA 1TRKA 1SQ0A 2OGZA 4TQAA 4B7ZA 1CB7A 3L6CA 4IJMA 4GPAA 2X9LA 1D1NA 3PXXA 5ITZA 4QDKA 1N2SA 2XT0A 4YALA 1SR8A 1ADJA 1XTVA 2QVZX 4P36A 1JLKA 4BVAA 2V31A 1NHWA 4MW4A 1MOQA 1ZK4A 1TZ2A 3BWCA 121PA 1RACA 1AGYA 5KOHB 5JR3A 4H2DA 5E6RA 2XUAA 1OAKA 4ND1A 4HQKA 3ZWVA 1ZVKA 2WYUA 3C8UA 1PNVA 2QL5A 5I51A 1IWPB 3G5UA 4N41A 1YLOA 4INOA 1VHQA 1MC1A 1WVGA 2Y2UA 4P86A 3RRJA 4Z4IA 2YN0A 1JPNA 4P82A 2A67A 2QLNA 5SYNA 2QGNA 4CF4A 1GG8A 1T8WA 3N9IA 1WW8A 4A6PA 3SF0A 1HQYE 1SZDA 5CM9C 1WQ1R 2C7GA 4V03A 1CE8B 4OAOA 4WN3A 4B87A 1IN4A 1P73A 1E64A 3WHLA 3NHBA 1Y8AA 3ZJTA 4M4SA 1E1RD 1HDZA 4QQKA 1OZHA 2MHCA 3GLSA 1UDCA 2YCBA 3L82B 3WK7A 5J23A 2YOHA 2PZKA 3P45A 4S35A 1KR5A 5C51B 1CZOA 3QF4B 1P75A 1R6TA 1G8KA 2A4KA 3U9TA 1SVMA 1HZJA 2FSVC 1F5SA 3DPUA 3DV0B 3ZJ5A 4ZIRB 4MV1A 1O08A 5AOCA 3RS2A 1QYIA 3V97A 3HNRA 5KOYA 4KJXA 2GM9A 1W0JD 4KFUA 4GRIA 1JFSA 2C9MA 5E8JA 2BLLA 3X1DA 1PJZA 4CIXA 1KR2A 1WZEA 2HPHA 1FDRA 3KXLA 2RI6A 1VQ5B 1XCGB 2Q28A 4JEHA 2Z5VA 2O2CA 4E4RA 5KVCA 3Q8WA 2C8VA 2XE6A 2WOOA 4MWEA 1EH5A 1OWNA 2JVJA 2H4XA 3AEQA 1NF3A 2WYIA 3DYBA 3E2MA 2CJPA 2R7AA 3O7WA 1YVUA 1S1MA 4DXDA 4EPVA 2N42A 3A2NA 4C03A 1HT1E 2Z8XA 3BGVA 3MD0A 3OIWA 2WYRA 1XZFA 3EOAI 1SVSA 1QIEA 2OY0A 3H8WA 1I1OA 3MJFA 3FTNA 4Y6RA 4ZYUA 3MPOA 2ZYVX 1GNPA 4PZDA 1YHQB 1YFLA 4PZEA 4R2IA 1CJBA 1DAEA 1ULZA 2FRDC 1U0FA 1DAMA 2DP4E 4FOPA 5IS2A 4NYJR 1EU1A 1S72B 1NXTA 5CA0A 5ESRA 1ZCAA 3I9KA 3N75A 4G0PA 2W2QA 2ATEA 4PU0A 3ZNNA 3PNBA 3KJQA 1N9GB 3NC1C 4PAWA 4DUZB 2AF4C 5ALWA 1SKAA 4UNPA 2I6QA 1PSZA 3I37X 4I55F 4C7JA 1KYQA 1G63A 2CSUA 3Q41A 4KMSA 2GBGA 1IB0A 2W2NA 3G0GA 1VCOA 3N2ZB 5FV7A 3UH1A 2DCMA 4H3HB 4LFCB 4XKVA 3AKDA 2EW8A 3SIPA 3FNFA 3F98A 4O2BF 4BO2A 2GN2A 2ZSFA 4YRQA 1RXVA 1I0LA 1M6NA 3SDSA 2DM6A 1HEYA 5CDFA 2WU3A 3IVMA 2YYYA 4Q1EA 3L0CA 4RGQA 5SZKB 4U2DA 1RMYA 2QZPA 2W2LD 4O25A 5AKKA 2HHAA 2I9KA 4RH1A 3Q8LA 2B82A 1GZ6A 2ZSAA 4G63A 4DRXB 3NAQA 1PVDA 3G9TA 4AO7A 3IKMB 1Z39A 2XQVA 1GPYA 1JRLA 2ZQZA 3S2GA 1J9GA 1U8AA 3NS7A 4OHOA 1KYVA 4X84A 3ZKWB 2FR0A 2RGGA 3NMUF 2BE7A 4H3KB 1P6XA 2A2ZA 3GOQA 1A4RA 5ER6A 3NH9A 4ZAWA 3UKOA 4EHNA 1T6NA 2I6XA 1V5WA 2COEA 3CN7A 2JLWA 3M34A 2EWMA 3A3OA 2ZR7A 4L8JA 4BFLA 2B98A 3VA7A 2CLKB 5T7BA 3M6LA 2IYRA 3OY7A 5ALGA 3ZWNA 1RD4A 4P0QB 3CFYA 4A10A 2XNJA 3R5FA 4LWPA 3UAWA 2IYYA 3AM4A 3AVXA 2C4HA 3VKUA 2RGYA 4CM7A 3MT7A 4YECA 4D80A 5D84A 1U2DA 1WMSA 1W35A 1MKYA 3C3EA 4R7ZA 3U3ZA 5BR7A 2F1MA 4N0EA 4EECA 3RVNA 3GD5A 4TSFA 2P9FA 5BMVA 2ANCA 2QVLA 4DHWA 2OHFA 3DOEA 1KL7A 4QJIA 3SQXA 4DLUA 3MWJA 3CUVA 2R6R1 2VAVA 2EZ4A 2NUAB 2O5RA 1EFLA 1SVOA 2XWJI 4PVDA 4QX6A 4P84A 4CDGA 5L4SA 4U9HS 2YZGA 3DOHA 1LW7A 1PGOA 2DGDA 2ZUBA 3AIMA 3OFKA 4J1TA 2G09A 2PE3A 3QVJA 1SZJG 3GEPA 1HZZC 3LQKA 3L8YA 4KV7A 4WV3A 2Q46A 4XX0B 4N9WA 1XDBA 2O8VA 4WD3A 3GAMA 3WSTA 4UHDA 1TMGE 3CBQA 4AY2A 3RRFA 2JGMA 1T2UA 5C3UA 1FSSA 1J6UA 3BH7A 3QWFA 1NATA 4OMFG 5TC4A 5HJ5A 1G5IA 1YJBA 4ZDIA 3TOVA 4BMPB 1GCAA 4CTMA 5C7YA 1SC9A 4M0LA 2GEVA 4QAQA 3CZ9A 2YCLA 4EZBA 3N2GB 4GBMA 1PJ8A 4YRTA 2NPFA 1WWKA 4DJAA 1LSUA 3NANA 3SJZA 4W5RA 4WPGA 4HXGA 3ET5A 5AK0A 3W8EA 1SU8A 4DSOA 2D1SA 1CR2A 4HWGA 1VHLA 3WICA 1RQ2A 1Y6QA 4GLOA 4EB6B 5L51A 1J5XA 3AJEA 3H75A 4D74A 3W06A 3PGMA 1HT2E 2OHHA 3DBRA 4IZ6A 2CFSA 1AGXA 2BOVA 2H4FA 2QN1A 4K81B 5L3VA 1T5IA 2XXAB 2V7UA 1N6OA 3M33A 1QH8B 4Q7KA 5KZMB 5DTRA 1SXHA 2ZYGA 3LLMA 4LV5B 1ZVJA 1ETHA 2P6OA 4FU0A 4WFIA 1ULUA 1SOMA 1ZOLA 3NJRA 2L69A 5DTQA 3RRNA 3TFWA 1PGPA 2D2XA 3FYUC 5E3JA 1MJ5A 1XF1A 1OGYA 3Q7QA 1HV8A 1M0SA 3EA0A 3A58B 3TZBA 5BNFA 4TLDA 3C85A 3ZLTA 5EJAA 1OYVA 4XYLA 1GRRA 1ODJA 5G0UA 2WJIA 4HB3A 3H2KA 1XTRA 3HR7A 5JT1A 3HB5X 2LVBA 1XBTA 2BH9A 3IDZA 2BBSA 4TMYA 5GOZA 1WB5A 3UB4A 4XI9A 2J1LA 4U7TB 4IW3B 2DYKA 2ID7A 2WWWA 3BSSA 3QKUA 3V1YA 2ZITA 2O3TA 1OGIA 3EARA 3ETJA 4NBSA 1U2GA 3HJAA 3L6OO 4NH4A 5HBGA 1QCCA 2LE0A 2VDOB 1P0IA 3LPNA 2OZLB 2CWDA 2OBRA 2VJCA 1DEHA 1Z15A 2XCLA 3GVPA 1XEAA 4NEGA 2W2PA 3QFHA 3RNOA 2RE8A 4J1QA 3OPOA 1CUIA 4UVHA 5K6AA 1R88A 1KXJA 2NPIA 2IEDA 3LCMA 4ND4A 1EBBA 1B0PA 2V3WA 2HLDA 2VO1A 3BHJA 3CUWA 2HSGA 5I4CA 1E92A 4R6XA 5CFPA 5TE9A 5FNVF 2M9MA 3FNEA 4F5DA 4XFDA 5BSXA 4Z4HA 4ID3A 4QVAA 4R31A 4CCAA 4HX9A 4L6CA 4AZSA 2UYQA 4DAEA 2XTNA 3C5VA 3QLUC 4I1SA 4NBRA 5F35A 1TVCA 2H5EA 4XDZA 1E96A 1ZK0A 4X6YA 2AE1A 1U0OC 4M87A 1UKZA 2GEFA 4A8JB 4RJIA 5CNMA 4AP6A 2OECA 2XUIA 1SBYA 2ODBA 3A1NA 4IRXA 4UM5A 2C2OA 4HBGA 3FFBA 5L95A 3H17A 3WYGA 2AJTA 1TUEA 4CCYA 2C4TA 4WE3A 4UUQA 2K87A 2HO4A 4B5LA 3ASRA 1HF3A 2OB2A 4IIGA 2Q0HA 4LECA 5CA0F 2JLBA 1KP3A 1KEEB 5DRYA 2POCA 4UQPA 3N70A 3T7EA 1JH9A 5JJKA 2R85A 3I0ZA 3H5WA 2IEYA 4QFBA 3FMGA 5D2CA 1EZ1A 1TLTA 2EKPA 2VPXA 3QYFA 4LTDA 3F78A 3MBIA 4QU5A 3WJ7A 2V5AA 5FWAA 2IS2A 3PX3A 2HL6A 2AJBA 5F5XA 3W6NA 1FFXB 1DRJA 2GBFA 2QL7A 4QM7A 3GX1A 3CNEA 3SI7A 4BFYA 4O2AB 2O14A 3B9QA 3E70C 4JT4A 3ZHXA 1C14A 2QJWA 4YUZA 2ZREA 3OTOB 2B4RO 1GU7A 1SN7A 5FTWA 3SX2A 3A2MA 3FMFA 5J2TF 3T3NA 2LCIA 3N7TA 3MBOA 4S12A 1PWYE 4HYQA 2FDCA 3HYCA 1PVOA 3AUKA 2RGCA 5E7MA 4N7MA 2FPLA 3WWEA 4LF8B 4F9FA 2NVBA 1EXWA 3HUTA 5E6TA 4U9UA 1P80A 1EFRD 1YZTA 4FJ2A 5J5CA 5JWRA 2CZCA 5JH7B 4EY4A 2HUPA 3JQBA 2D13A 3CUEF 4B44A 4B8YA 2XE8A 1GNTA 1V8PA 4IYRA 1Z34A 4MR7A 1HRKA 1GGJA 2V4DA 1K89A 1WOSA 1TW3A 4LE1A 4F5WA 5HW0A 2VJYA 1LBHA 3RHZA 1DT3A 2V98A 2WD8A 5HX7A 4HAOA 4RZ3A 3BMNA 5J47A 5KJFA 2I6SA 3VH1A 4BMNA 3BTVA 5KYUB 2XVAA 3WLPA 3HBAA 1IULA 1Y8QB 3JZAA 5A6SB 5EA2A 1YL5A 5GV7A 3TJZA 1TIBA 2FMTA 4JZKA 3CG0A 1FU7A 521PA 3RAPR 1SOUA 2TMYA 2QT0A 3IPAA 5L53A 4JP8A 3WGMA 4NCIA 4JUFA 2HZ7A 3NHYA 1C3OA 1QZ3A 3H11B 3JX9A 1E2UA 3CF4G 2MINB 3DDNA 3IIIA 3KB2A 3L7MA 1Z5NA 4X00A 2VHYA 3S2UA 1EX6A 4ARCA 2PGXA 2ZWOA 1WZCA 3IRVA 4JOCA 1R00A 1YZHA 4DQDA 1LK0A 4S05A 4OYLA 4D8UA 3SHFA 4H60A 5J43A 1X7XB 2CLSA 1NM5C 1TJ4A 3V3TA 1Q9SA 1XQ6A 2NUBA 3TYXA 3FYUB 4HB0A 1GZSA 1FMFA 1DC7A 2HA0A 1T4CA 4J0GA 2PKWA 3S2FA 3UMSA 1RT9A 2FZGA 2H1WA 4JQCA 5D3MA 1P2GA 1CQXA 1J2UA 1SVNA 2YRXA 4TYPA 4D44A 4RTOA 2PT5A 2INGX 3LUBA 3R24A 4AM8A 3TUZC 1GTSA 3I0NA 3IAXA 2AE2A 3MRXA 5AW7A 3ZC3A 1UKVY 2VJJA 3R8XA 2GF2A 3E23A 4JI1B 3DP9A 4RVGA 3NTUA 3ONDA 1SELA 1N8TA 4CV1A 4E70A 4GZ6A 2QTNA 4F21A 3FSGA 2DLNA 3PEFA 3OZDA 4PQEA 3M6UA 3AWIA 1L5LA 4F3CA 3VKWA 3ASYA 1DL5A 3C16C 4OL9A 2PUDA 4CM3A 2QRLA 4QLOA 1TYDE 5GMOA 2R48A 4MR8A 3PFHA 3UFBA 4NV0A 4DLRA 4BV9A 2VEOA 3AL2A 4M0MA 5DCLA 3V32A 3AHDA 3ZCTA 4FEEA 1T25A 3SS8A 4D4LA 4LSMA 3DBVO 5DN9A 2PCLA 1KO8A 5IZ4A 2Y99A 3GJ8A 4CI0B 1EE2A 2Q5EA 1JQBA 3E9YA 2VDWA 3NHFA 5IT5A 3DUFB 1G42A 3JS5A 5THKA 4IDOA 1VE9A 4QV2A 2G0AA 1GZDA 4FCTA 2W6PA 1PR4A 2XIJA 4ER3A 3OOCA 4XSVA 1CRPA 4RVFA 5GZ6A 1H4SA 1RZ3A 2GXQA 4RADA 3HXKA 2ZTHA 4WUTA 3PQCA 4TKVB 2G4CA 3OX4A 5BSMA 2EZ8A 1IY9A 4FZ5A 1JG1A 1K5GA 3FPPA 1H6AA 3OE4A 2VF5X 4H16A 5CB8A 2GD1O 1HVXA 4G8JA 3STXA 3BY1A 5FOTA 4MW6A 4A7PA 3VVCA 4L4XA 3UANA 1JDZA 4RVDA 2W83A 4NFSA 1QHGA 5JRJA 1OBVA 3UK0A 4HMOA 5H02A 1F3LA 3MELA 3V4OA 3TW8A 1NRKA 1XVLA 2BEUA 3QEJA 3L6UA 1DEKA 3HZZA 4Q4DA 3KCQA 1RRFA 4NZMA 1XTBA 3FI0A 4I3GA 1GNSA 3ADCA 1J0BA 3NX4A 1WZUA 5FCDA 3LHDA 3IPXA 3WMXA 4C7VA 3NWOA 5GADl 2FEWB 3JCZA 3ETCA 1WETA 3ZGVA 1CETA 1JR2A 3P0EA 1OHHD 4KUEA 2NT3A 1XP5A 1SQFA 1TKAA 3GAFA 4UXHA 2O6HA 4IUCS 4UEKA 3ZPXA 4NSNA 4QT0A 2ILVA 3EGIA 3EVAA 1G8GA 4XQ0A 4LOJA 4DARA 1QIFA 4R8KA 2JA1A 2C0QA 2B5OA 3R3VA 4H27A 4LDRA 2CFTA 1T1EA 3CE6A 2EIXA 1ABFA 2GZAA 4QRHA 1X1SA 4ICIA 1DCKA 4BC1A 3BYZA 4N6OA 4Z4WA 1ESEA 3HBJA 4Z51A 3M6XA 2ZZNA 2J3IA 2CNNA 3RJMA 5LZ2A 4QHSA 4IMPA 2QLTA 4CQLB 2P2YA 3HSYA 5ER9A 3ZQKA 4X62B 2Q3EA 2VWHA 2B8EA 1GN8A 1AM4D 2ODAA 3TRHA 2WJZB 4UM9B 5FR1A 4HFJA 3UGTA 4M0UA 4QUAA 2OHXA 3I53A 4DY6A 3QMPA 2ZW9A 1DO0A 2FQ1A 2UYYA 2B4YA 3CCRB 2WWIA 5HZGA 4URYR 5BNTA 3IL2A 3VI3B 4O3FA 3VR3D 1W25A 4X7PA 5JPIA 3ZHSA 4UTXA 1MEJA 4RAQA 1QU2A 4HGOA 2UZ1A 1IK4A 2QQ5A 1K06A 1R0YA 1X87A 1LK7A 4QUJA 3UMJA 3LUHA 3U5ZB 4C0SA 3FUWA 3RAGA 1JA1A 1KO4A 1B73A 5AOBA 2C99A 3BD8A 1OWPA 1P61B 3SLDA 1NTOA 1PLKA 3AY6A 3O2QB 4HGZA 1CRWG 3EXHC 5FYDA 3A1SA 4RPGA 3SR0A 1DKQA 1N8KA 4EFLA 1N8SA 4E1AA 3B52X 2RG1A 3HI6A 4WNCA 5AJWA 1NRIA 4MW1A 3RU2A 4J4TA 3B9BA 3VYVA 1BU5A 2QMHA 1BXZA 3I2HA 3J81k 1YBHA 2ZRMA 2AGVA 4BLWA 4G0VA 1XB2A 4PX5A 1VM6A 3QNWA 4Y8VA 1YIJB 3E1GA 3PPIA 1PJ2A 3SKBA 1WD7A 1OA1A 3AZOA 3D6JA 2J08A 1X92A 3KO8A 5JI3E 3ZW9A 1YGYA 4HDRA 2CBXA 1EJ2A 2XOEA 1JHPA 1PFYA 1ZIDA 2ACVA 2PHZA 2H7CA 2Q5QA 4W9RA 1VPTA 4A23A 1NJGA 5F9FA 2GN1A 1PEKE 1NQXA 1X8XA 4DA4A 2J9ZB 3ON5A 1KJIA 1S3IA 3SHQA 1YDHA 3BD9A 2ZVPX 3OZSA 5H7XA 1EAMA 4X7EA 3C0KA 4XCXA 5DM2A 1CQZA 3Q3CA 4H1TA 4YRFA 8ABPA 4HPWA 5A2GA 4QBIA 1V1RA 1GZHB 2QM8A 4AB1A 3QU9A 4PLPA 1HGXA 1RAHA 3W5DA 1S1CA 2XYRA 2X6YA 4P4GA 2VC2B 1CW2B 3I1FA 1FTQA 3A6FA 3X43A 4MUEA 1M6EX 3ZU2A 4DUGA 2LBPA 2XQIA 3Q11A 1NVFA 4TOIA 1XMIA 4DM4A 4KAJA 4F2GA 3CB2A 3OUUA 2MSEB 4FMDB 3JAWA 1WXEA 4B71A 2YW2A 3ESZA 2R6JA 1U7HA 4RDKA 4EJSB 4GGPA 1Q3KA 1SXIA 4XLEA 4M7RA 3E3OA 1L5ZA 4WCDA 3REQA 5BN3B 3Q7RA 3RRBA 3R5KA 3NUQA 2NU6A 2HCTA 5A9SB 5J4YA 1OH6A 4RTMA 4FW9A 2FW7A 3C8DA 2QAGA 2HU5A 1KZYC 1XZNA 4DQLA 4TYNA 1E9VA 2C5SA 3RU9A 4A91A 1L4YA 3VPSA 4MIKA 1LH0A 3OICA 3ZI4A 1DEAA 2W2TA 3IDQA 3UUGA 4OREX 5JSFA 2LR0A 2VWPA 1NW9B 1U2TA 1ZH2A 3E9CA 4IS2A 5B7QA 3DCNA 2ZXIA 5CEJA 3TBFA 1EQAA 1ZKDA 3MD9A 5M3BA 4N5DA 2WE8A 3C41J 5EIWA 3W34A 1EJ6A 4KU4A 4YRGA 3V4SA 1E0AA 1BS2A 2VJKA 1SUCA 4B32A 2SBTA 2B4KA 2VDRB 4MOWA 4W9NC 2WG1A 2WF9A 3OOHA 4C4XA 1BEZA 1A9PA 4WMLA 4DV2B 3CCLB 4J0FA 4L9SA 4C0BA 5A1JA 4IDFA 4LGYA 3BS4A 4WEQA 3KJHA 3LM8A 2CKMA 3ZWWA 1W88A 421PA 1CU1A 3K32A 1USVA 4WT7A 5FOWA 3WYDA 3USCS 3ZHYA 1NT2A 1Z6AA 2AXPA 2JCYA 1VHWA 4CQMD 5EY5B 3MG9A 3LU1A 1SB8A 3DZKA 3KT3A 2WILA 1EDBA 1Z0ZA 3GEDA 4GWLA 1LF5A 5B2ZA 2YYAA 1JPUA 3FGPA 4B80A 1A8PA 1S3FA 2FY8A 5AXCA 2Q6TA 5H1YA 5JBNA 1XRLA 2FG7C 4G5FA 3AYZB 3VPDA 3L46A 2MWMA 4H1WA 4DK0A 1W2GA 1F2DA 2O54A 2V3VA 4CMGA 4FPXA 1FUKA 1XCOA 1UXGA 2X8BA 4XXHA 1WHTB 1VB3A 4ZAVA 3ZE8A 3PDHA 5F23A 2Y1LA 2JFHA 4GE0A 4EHLA 5I7UA 2HW8A 5BPFA 1YHYA 2JLUA 3AJAA 1M75A 4JJ4A 2BL4A 2O1EA 3E22B 4GFDA 3D8RA 3PZBA 5B30A 1C81A 3PXUA 1I1NA 5JS8A 1WTHD 1YB7A 3RHFA 2I8LA 1IAQA 3KOYA 4JIGA 4D79A 3RSLA 1XVAA 2WC1A 3W7BA 2D7CA 3ISJA 2HJGA 3HUFA 4ARZA 1PNRA 2XDQA 1U31A 3LP6A 4NDZA 3R9XA 4C7OA 2JCVA 4QDJA 3CEPB 1YDMA 3FPJA 4H17A 3MQ4A 2GXAA 2POQX 2ZAOA 1RBZA 1JQLB 1U3UA 5K0EA 1RVDA 3VHXA 1A98A 2BR4A 2JLCA 3EXHB 1XYYA 4J7AA 1GL6A 4DR7B 1YMUA 2Q3MA 4JNKA 5CCBA 2VBGA 2LIPA 3KT0A 4LBWA 1HYHA 3N05A 2CXOA 2D8MA 4FI3F 2PUBA 1NFFA 3PUZA 1IHMA 1R9NA 4QT4A 5IYPA 4TL8A 5JFGA 3VBCA 4D6YA 2NO0A 1N7IA 4HEA6 1E8NA 4FHZA 4IILA 1IE3A 1EDDA 1GVHA 3E3NA 5DISB 4BMSA 5CCEA 1XU7A 2ZRIA 5G4KA 5DHPA 8GPBA 4GI2A 3EOZA 1FLNA 1YIDA 3RLFA 3VO1A 2R11A 4LI0A 1X7DA 1JILA 2RHDA 3QVWA 1IHOA 4F4HA 1VG9B 2Y1EA 1XA3A 3D0RA 3K92A 1VGVA 3PV0A 5ENDA 4AY4A 3BULA 2VTBB 3KEOA 1PG5A 1HDGO 4ZWNA 4B74A 1QDEA 2VDJA 4HAVA 3CPJB 3PQ6A 1YFJA 2AUNA 3L0YA 4JL8A 4R84A 1P3JA 4EUSA 1YBFA 3QE9Y 1DAFA 1Q83A 3UTDA 3EGXB 4L8GA 1M3SA 4ND2A 4UNQA 3NDIA 4FNAA 4EPRA 3FOZA 3IT0A 1HA3A 1HYQA 3SIWA 3EZ9A 3RYHB 2J09A 3UA3A 3LRTA 3FIUA 4B5KA 4MW5A 1JEEA 2DBRA 3OO0A 4HP8A 3W3AD 3O8LA 5LIRA 5BSRA 4QA9A 2L0XA 3ZHBA 1EFDN 2E5FA 2DWCA 2NZVG 2VT3A 2XKAA 3DSRA 3QK7A 2PUWA 3BB4A 4N5LA 5IJAA 5B64A 1G4AE 1GPWB 5J1TB 2B4TO 2HREA 4AN4A 4YV2A 2PSJA 1RKXA 4US2R 1QVVA 2IEBA 1JR6A 1QQBA 1XXLA 5IBPA 3OPMA 3QOWA 1FFWA 1KIAA 1YR3A 2DCUA 1MB4A 2Z6VA 4EJ0A 3TNJA 1YQUA 4UHHA 2YY6A 2BKEA 2JKVA 3OWHA 4MWDA 4NFLA 1JU3A 5JO0A 3ET4A 4TT3A 3LWDA 4TMZA 1NWCA 3RYIA 4YRJA 2IPAB 2X0FA 1EFTA 5EHQA 2AW3A 4JVMA 2Z43A 1INLA 2P75A 3UCXA 3SEFA 4Z4EA 2XE4A 4YP0A 4JVSB 4LX8A 3AG6A 3NM4A 1ULSA 1M76A 4G0ZA 4CV3A 1IHPA 3LQEA 2Q6VA 1KGSA 2YVAA 1QF9A 3OLCX 4QVGA 4QOSA 1L5NA 1MABB 4NMHA 2XA2A 2ZLBA 3WZMA 5EVJA 1LSJA 3B70A 1F4PA 1FUIA 3JALA 2CGEA 1SCQA 5BW5A 3U0BA 1MENA 3UAZA 3LX4A 3WSWA 3R6WA 1VQMB 4JEMA 4KQWA 3ZD8A 3GLIE 3ZD7A 1DWOA 2OO5C 2IP1A 3IVXA 4FDAA 2V7GA 3EQZA 5IJ0B 2EYUA 5MGNA 2RHGB 1H4QA 3HCBA 4X61A 1E3ZA 4KRYA 4GZ5A 3IUNA 1E6EA 2GCOB 3HXTA 1F8UA 1GHTA 1I7LA 3JTEA 1F0NA 3OJLA 5AJZA 3TEMA 3N58A 5BSHA 2RGXA 2XCQA 3CWZA 3HKDA 4IMJB 5INTA 3B5IA 1JU4A 5A4MS 3PSHA 1ZRMA 5HJ2A 2E7ZA 5AKJA 3HHEA 4DNQA 2EV9A 2OAGA 1PR3A 2BGKA 1TC2A 1W76A 2CD7A 4EYGA 4CN9A 2R8YA 5LC1A 1EVKA 1XMQB 5K4AA 1L6IA 3DKRA 4V0KA 2ZAYA 1SXJE 2VJBA 4IHAA 2ZRHA 3GBPA 2ZROA 2WIGA 3HMQA 2QKYA 4TTIA 1U2QA 5IAGA 5CX4A 2H2FA 1EVEA 3RASA 3WB9A 3PQDA 2VJAA 3QMWA 2XYPA 3L7JA 4FZ3A 4MRMA 5K8CA 2UUAB 3VPXA 1FRZA 5K8VA 2OESA 1JNYA 1MP0A 4RCZA 4UE2A 3BY2A 1CD5A 2OZEA 3DL4A 2Z2ZA 5EP3A 4RGBA 1JW9B 4JBWA 2RK6A 4A2PA 4S1OA 3WG9A 1XZCA 1IY0A 4B2PA 1W46A 1MAUA 5FTLA 1CS4C 1VKOA 2Q3DA 5DHUA 1RJGA 2EEZA 2OENG 3RHSA 2V58A 3WL3A 1J8DA 1NF8A 4R5MA 4XJVA 4ZVPA 4YAGA 4KFCA 3C6XA 1JDSA 1PD1A 2A0XA 1CQWA 4OFBA 4XEUA 5U1PA 3SHTA 4YR7A 3W5JA 1H94A 1KMHA 4EYKA 1AQLA 1R0BA 2V4UA 1NKVA 1WY5A 2FV8A 2V3CC 4LJRA 4TN5A 3WP0A 1JB1A 1GUYA 4X8IA 4UAUA 2JBAB 2GD2A 4O4JB 5FJIA 2UDPA 3LSTA 5K3BA 4HGYA 3E9QA 2ISSD 3UYLA 5T41A 5ICFA 1R12A 2DUJA 5JECA 4QDTA 1OV4A 3A4IA 3UKJA 2ZJZA 1XAGA 3PPXA 4UM8B 3CZ5A 3T95A 2GVZC 3AUFA 3S8EA 2GPJA 2F8TA 2GUGA 4CT5A 1JEQA 3OQ6A 1OI7A 4OM7A 3MXTA 4I99A 5E3IA 3R8CA 3ROFA 2DQKA 3WRXA 5E3HA 5BWBA 4IWYA 1FDOA 5TRDA 4QM6A 2FW0A 1GITA 2H1VA 2AYXA 4ETWA 5LKRA 3R77A 2DFNA 4BFXA 1YR1A 4A73A 1XMXA 3U7RA 1GGVA 5JS7A 1YRBA 2OTJB 1DB3A 2L82A 3NHMA 4YRLA 1XN1A 2AFIE 5EFOA 4PAQA 2C94A 4OPSA 3QE0A 3USES 2BFBB 3ESYA 1AZSC 3B60A 3W7VA 1N07A 4Z9FA 2A8YA 2G7MC 1VCNA 2FOXA 4TTRA 1BDIA 3LE8A 1CY7A 2FMXA 4EYQA 5TXGA 3VJKA 4KR9A 4PLWA 2WUEA 2M98A 4OI0A 2IUTA 2OBMA 2VZEA 4R05A 4WESB 1YJ8A 4IFTA 2HO5A 1C0PA 4J91A 4LRUA 4BQFA 1U63A 1XZDA 3W8FA 3H04A 4V0OA 3EA5A 4GPD1 4NZOA 4X3CA 3EWNA 3BRQA 1KDYA 2GBIA 1CZKA 5IXYA 4D96A 4Q1FA 3TLXA 2MSCB 5IC5A 1OVMA 4LJLA 1QP4A 1M34E 3O9VA 4NCKA 1QX3A 4HNQA 3NBUA 4G4SO 3CEHA 2ZL6A 1EVQA 5FBQB 3OPYB 1IQUA 4LZJA 4P83A 2RJ3A 3KZNA 1R16A 3HB1A 1DDGA 2C2ZA 1UXHA 3OWOA 1JJVA 4PGMA 2PJRA 4NZNA 1Q5PA 2I7VA 2Q9AA 5DYNA 1L5YA 3WL5A 1WP9A 3BIWA 3IDFA 1Z8HA 2JA2A 5CLHA 2B21A 5K3DA 3RABA 5DM60 3BIOA 4BN5A 2QTCA 2XBMA 2DT5A 3HUUA 2I29A 2Z8YA 4QPZA 4KVFA 2ONCA 5ETJA 1PNOA 4UZFA 4BNZA 4UTOA 5B57C 3X1YA 4DTCA 4DMFA 1ZJJA 4ZKDA 4U3JB 1GPKA 2ETVA 4YJ2B 4GGMX 1IMJA 2VTVA 1CBUA 3NYIA 4ZRDA 4EA9A 4OLAA 4OLHA 5D87A 4ZT4A 4E3WA 4M49A 4LGVA 1KORA 2DR3A 1PL6A 1YZUA 3L79A 2M1ZA 3K1TA 3V8NA 2D7DA 2VDPB 3FNHA 5E6SB 3TR6A 1NN1A 2ZATA 4G0YA 1PKEA 3DAPA 4I1UA 2BEVA 3QVSA 4L5AA 1VSVA 4LYDA 1IIBA 1KZ6A 2FEKA 2GPYA 3R0QA 4KNVA 3SNHA 3AETB 1G3UA 5E1MA 3GEHA 3H7IA 1L5WA 5HRAA 3C15C 2PUEA 3WK8A 1JIQA 2QYTA 5AVZA 3HCAA 2FMIA 4KBFA 3CR8A 5GY7A 3TUJC 3WJ1A 4KQIA 1KNXA 3AF5A 1U0TA 3GDOA 2ZE6A 4TM8A 3I9LA 4YUAA 3F3YA 4RZIA 4UNRA 5DM70 1XWFA 3L6BA 4PNEA 2G70A 1TMYA 1P7WA 1GT6A 3FTQA 4ND7A 5DGDA 4QUIA 1FSFA 4G9GA 2GVNA 3WRWA 4HNAB 4GD3Q 4A0FA 2FTKE 4ZMSA 1L6RA 4DBZA 5B53A 2V1UA 2ATXA 3O3OB 3KJIA 1KK2A 2JFGA 1FLAA 1HTWA 2BEWB 3GIDA 4O4LA 1PWXA 4I9GA 3KSZO 3K6KA 3CCFA 5FA6A 2BUCA 4LC9A 2V7QA 1AGNA 1TECE 5ENVA 5IBRA 5EZQA 1N0IA 1AKRA 2C1XA 1JWAB 1IZ9A 1E9AA 3F8SA 1JHVA 1OXTA 3JWHA 1U9CA 5JXIA 2UZ4A 3SHVA 2JDID 2C42A 3FPCA 4N3AA 2VSNA 2I1VB 2OEPA 2PWBA 3BJZA 3DA8A 1S9HA 4FONA 4NENB 5D5QA 3S2ZA 2AOWA 4E5YA 4DDUA 2HI0A 3DMTA 3OM9A 5CVTA 2NNLD 5TMDA 2FR8C 2ZUUA 1KU6A 2GHRA 4M55A 4QYIB 1ADGA 2H8KA 5EZYA 1W2WB 1DBPA 3GVJA 2JVKA 5CD1A 2XOXA 3HADA 3JYQA 2I6FA 1RBYA 2WKWA 3ERCA 1SVIA 1VJGA 5A71A 4CJXA 2NT4A 1OB0A 4Q3LA 3IHKA 3D4PA 1ZD8A 3LK7A 3TIIA 3X1XA 1V2HE 4ZGGA 5IBCA 5JEEA 4Y2JA 2QRVA 3L1VA 3AXSA 1KDTA 3DG9A 4P1ZA 2YMLA 4J6EA 5KKCA 4E88A 4J76A 2BR3A 3N0WA 4LF7B 4ME6A 4FOOA 4B09A 3D31A 1KFJB 2DC1A 1N2GA 2XJ4A 4DCMA 5ARBA 3FKQA 3JQEA 3OEED 1SH7A 3ZCPA 2I55A 4BBZA 4FFLA 4DN6A 1YC2A 4C3UA 3RYCA 5HKOA 3EUEA 4Z4TA 1NSYA 3GA5A 5FQOA 3UAYA 4CF3A 1WY7A 2VRWA 3GRZA 4XVCA 3KQOA 4ND8B 5DYTA 3W1WA 2JGIA 4YC7A 3MTBA 1H6BA 1LBEA 3CN9A 1ORRA 3IILA 2QTVA 4HDKA 1DBQA 4ZDWA 4EO7A 3PEYA 4RACA 3VO2A 3A3PA 4CKBA 4WJZA 1ZCZA 3QXGA 3G3EA 1OB2A 4FBLA 3Q1KA 4JD5A 4TLCA 3D64A 1E4YA 3U4DA 4B81A 1K08A 1MPTA 4P3NA 3WDLA 1UBLS 2VQDA 4ZC1A 4F3TA 1AHIA 3K9QO 3W6ZA 3D3WB 3TX6A 3BFJA 1QYWA 1DC5A 4CDRA 4F5EA 3G8CA 3AKEA 1O94C 4WADA 3DJFA 3FA2A 5CT5A 4P25A 1XMSA 3LWNA 4JS0A 2FMUA 4MKFA 2BZSA 2W9XA 3BAZA 4M9QA 4DDMA 4YT5A 5CFQA 1U8EA 3ICCA 4LOAA 3CPWB 1FX1A 1U3TA 3UJ3X 1GQFA 4MVJH 1E3TA 1I3OA 4C4TA 4EELA 1ILEA 5TX7A 5BV8A 1E7QA 3DL2A 2AFRA 3ZV5A 3FNBA 4G1FA 3SIRA 2BFNA 4GYKA 4X85A 1M2VA 1DINA 1FA9A 1V8DA 3AFOA 3VZCA 2F48A 4HSGA 2RHWA 4TVKA 4FYMA 1UADA 3RAJA 1C3EA 4F1WA 1A9YA 1D2EA 3Q3AA 3BQ9A 1ZMTA 3KKLA 1E7MA 3OF3A 4NMXB 1HE8B 1RQGA 4MRRA 4QYTA 1V16A 1JSLA 2VTEA 3I76A 2VBCA 1KH2A 1E7WA 2YHBA 4QFCA 4DSUA 5C5DA 5CFRA 5CX1A 2QXTA 1P3Y1 3O0TA 1WZIA 4HY3A 5AI4A 4YWJA 3U1VA 2J6BA 2IEZA 4X45A 4JWKA 1WB4A 4EYSA 5A3SA 5IYQA 5IJ9A 4MS1A 5EWJB 5HGXA 1PS0A 5HIJA 2W8BB 2PK3A 1AKWA 1U9IA 4KMMA 4OG2A 3WL8A 4X1OA 1SVKA 2OC9A 3H99A 3FMOB 3NCTA 2F3RA 4G84A 1ENPA 1JJIA 1K6IA 3X44A 3QH4A 5DGXA 3TZLA 3A6PC 2C0CA 1QP0A 4AUKA 4DREA 4F71A 2AD5A 1SB9A 3FWNA 2XWSA 4U1RA 1M7HA 1V6SA 2ERYA 4UFPA 2NU9A 1FMLA 1DKUA 1B8NA 1A7JA 4J90A 4TWBA 4G4JA 4JUCA 1LNZA 3RVKA 3TLGB 4F4IA 1II8A 4HDNA 4ZJYA 3DFMA 3A1FA 3H2JA 1XR3A 1RLTA 2AJLI 2I3AA 2I54A 2YZMA 1QOZA 2HLPA 3FUCA 5ALZA 5BYKA 2XCSB 1Z0KA 1XNHA 3CINA 2DTDA 4WLEA 4CL3A 2OORC 4JLOA 1QV9A 1ZRNA 5H83A 1N2ZA 1FTYA 3KQPA 2ODWA 1T8TA 3PSAA 1B93A 1N3LA 3KWLA 4HQNA 1F48A 2Y92A 4RHUA 5FUXA 1RJ9A 4ZODA 3SAJA 5F7XA 4H3VA 4HN2A 1FW6A 1TJ5A 3FUXA 5ITZB 1EVLA 3PKIA 1DAGA 2TSYB 1Z38A 1YGPA 1AQYA 2X7HA 3B85A 1QUEA 4QYSA 1YHZA 2PZBA 1H8ED 3KBOA 1FVXA 2IZ7A 3PNSA 5HTOA 1P17A 4JWTA 1YJAA 4P6YA 1NQUA 3D3NA 2J7PD 4J6FA 5AXDA 3L06A 3KLMX 3UOWA 4B4OA 2Q9CA 2AV6A 2XQFA 5A5EA 1XFOA 1CYDA 2HPVA 4KQCA 4WWVA 4ZV4A 3OOSA 2G9NA 1Z0UA 4F5YA 3K0AA 3VOSA 4N03A 3LA6A 3UG6A 3WGZA 1XA0A 4C5AA 3NRBA 2VZ9A 1E1DA 4RVHA 1QRSA 2XEDA 3NAMA 3OO1A 5F3RA 3RT1A 1T6YA 1FP7A 4RBNA 4X6LA 5G1OA 1ZD5A 1U2RA 2LD4A 1VKHA 1LZLA 2QVCA 1H2AS 2OYCA 3UPDA 4AP9A 1E1QD 4YCMA 1G17A 2HF7A 2GD6A 3HY3A 4IGIA 3IEKA 1JX6A 1XTPA 3WGIA 2ECKA 2E55A 5EE3A 3DLHA 2EL9A 4GP7A 3JD1A 4YLEA 5FNZA 1Z6XA 2J9YB 2O2SA 4DKJA 4Z4FA 4O4LF 5IRCD 4HCJA 3D8UA 5H9WA 3G71B 1VYUA 2P65A 1XG5A 4F6CA 1JVSA 3AVPA 1Z33A 1VI6A 2PH7A 1W4CA 1OWMA 2AN5A 2FWBA 2X0JA 3Q38A 1GGHA 1KSJA 3GUCA 3PHIA 4R6WA 1U4OA 2JFYA 1Y9JA 3G2JA 3M5DA 5DYWA 9LDTA 4ZCSA 2JGFA 3ZNOA 4MLCA 1JIKA 1F20A 1UL1X 1PG0A 4L9WA 2FW1A 3CD6B 2C5GA 1I6MA 1Q1NA 2ZTMA 1KC8D 4OM8A 2K7FA 3BCFA 1Y4SA 1PYDA 4OB6A 1GFSA 1Y7LA 5EZYF 1ND5A 4UFOA 4KR3A 2ZXEA 5LDDC 4NMWA 3D5TA 1CUSA 1BW9A 3TLJA 4EFMA 3KRTA 3E20A 4PXYA 2ZWVA 4NHEA 4RIIA 4JYMA 5BYAA 1AIPA 1S2DA 4FD3A 4EBBA 1WBBA 4ZK6A 5ICGA 2A88A 1DT5A 2R7NA 1T2AA 5IG2A 4PY2A 4KWIA 3LCRA 2GDZA 4KWHA 4DQVA 2ZSIA 2HQOA 4MPJA 2NO6A 3L4BA 3QVKA 4B7AA 1UC5B 2CZGA 2GJ8A 3ZE1B 3EFHA 1S4MA 2P2SA 2IQ5A 3GGOA 5IHPA 3VPAA 5BN5A 5DK6A 3TM5A 1JS1X 2QX9A 4WVFA 4PLVA 4X0CA 1VQ1A 1MNQA 3AB7A 5DTJA 5CB4A 5CYFA 1T4BA 1AXGA 5KNDD 2DPXA 4GT1A 1TGVA 3K0FA 2PRSA 3CNOA 3NHKA 2NUPB 5G41A 3TDKA 1M2GA 3V9PA 4B43A 1M2OA 1IWBB 2GAJA 2UZAA 4MHSA 1RRCA 3KAQA 2IUEA 3HKEA 1VCMA 1NMZA 1G9XA 1G5QA 2MIIA 3IQIX 1R8XA 2GPWA 3WDKA 1FXWA 1W4BA 2J32A 2W2OA 3A31A 3O4FA 4K3UA 5I9SA 1S7CA 2EQAA 2Q7DA 2D4AA 1FF9A 1RWQA 4B31A 2PD4A 4DIDA 4ZQCB 3LG2A 3DVSX 1AA9A 3WI7A 2C3MA 4C4ZA 5FTKA 3VKVA 1NBIA 1J06A 2VP5A 4TRNA 3ZDZB 4NJOA 3D0KA 2R6FA 2P4HX 4QPJC 4IGKA 1EX7A 1JZTA 2QQGA 1XRNA 2VWGA 3DZCA 3TIGA 2O48X 5A04A 4C22A 3D9QX 1NOIA 5FLXA 4MKXA 3P96A 1WCIB 4LXYA 4LXXA 4X1IB 1VSBA 1TJ3A 4HWKA 4YMVA 3IE0A 1N32B 1NMEA 4LK3A 4ZCPA 3OPYI 2YMQA 1RKBA 4P3OA 2WIKA 2BF4A 3PJEA 1XZQA 4HLNA 4D0SA 2EBHX 3CP8A 2BMAA 2CZQA 3GZJA 4FQ7A 4HL6A 4J0DA 3EBOA 3KETA 2C3UA 1M90D 1QR2A 4BU0A 3BXXA 3CCCA 5IYZF 1J33A 1I01A 3O1JC 4Z4RA 2CXSA 1TKCA 3OIYA 3EYWA 3KUUA 5BMVB 4B7UA 3PUJA 5AVUA 1TNDA 3FWHA 4UM9D 1N3IA 3C3BA 1XQXA 4B79A 1UAGA 2FWNA 4H0FA 4CL8A 1S2NA 2PKQP 5B58C 5L4NA 3QFSA 3M3PA 4XPZA 4RQTA 4YROA 1P2TA 1NU8A 1XZLA 4TQGA 2GEJA 2HM7A 4XLLA 3RYFB 3AIIA 1VYTA 1TPZA 1SKUA 2E6KA 3GCWA 2WNHA 5SZIA 4LDNA 4EENA 1RJFA 2IXTA 4CR7A 2Q2VA 1LI4A 1I2ZA 2FAXA 3PUHA 5FLKA 1AHNA 3OQJA 1E58A 2X8KA 1PAUA 3K35A 4KV9A 3VZRA 1KSHA 5FAXA 1XNQB 1CJCA 4E94A 3OQVA 4HDQB 1XRJA 3PL1A 1GCGA 3UHAA 5JCJA 2PUGA 1J09A 5JVDF 4DA8A 1P1HA 1D03A 4M22A 2JFFA 3C98A 2DFTA 2X1MA 4UE6A 1XMJA 2EXXA 3NYRA 2BEJA 5H4GA 4NOMA 2FK7A 1EJBA 4D97A 4LPKA 4A26A 1T1RA 4H1UA 4HGNA 2QP3A 3KJXA 5ADVA 5LZ4A 3TNYA 1DCMA 4YY3B 2VXBA 3QNUA 3HDTA 3HRKA 3QF7A 2ZZKA 4N7RA 4E5SA 1UFVA 1ZM3A 5I4BA 3ANSA 4ZGNB 3FPGA 2VQEB 1WULS 1QRDA 2H0RA 1G66A 1L0BA 2R8XA 1GA4A 4M54A 2CYBA 2H9YA 2MJLA 3WAJA 4Y0AA 3CT6A 2V7TA 3GHYA 3MCAA 1KAGA 3FMPB 4DLTA 2YHUA 4ASUD 1P4MA 2JGRA 2R1VA 2XSZA 3K05A 3KJEA 3DBRB 4OI4A 4RVNA 5F4BA 4DYHA 2IDKA 4JENA 3W7AA 1ADBA 4Z86A 3P9CA 4KZPA 1X2EA 4QJ4A 3VYRB 2O59A 1M7GA 4B4WA 4WCFC 4ZI7F 2RH5A 2NSLA 2EJWA 3LSYA 3ZCUA 3HCFA 4L73A 1UAAA 3COYA 4QDUA 4Z0HO 3O4HA 1M1NA 1TE2A 1U02A 3BK7A 3ELWA 2ZU0C 2NLOA 3EJ6A 2IFTA 4J16A 4MVJM 2G83A 5EYPB 4TWJA 1XJWA 3HBLA 1Q92A 3C2QA 2NADA 1XLTC 4P5PA 3WKAA 2V9ZA 1IZ7A 3EIEA 4BGVA 3BTUA 2A9OA 4WXRA 1A3CA 2I3ZA 1M2HA 2EX1A 4X5OA 2F9FA 3NEJA 4E32A 2B36A 1N33B 5IPFA 4MW0A 2FSUA 4KWCA 5C2JB 3TSAA 1JZQA 5KS2A 4U0KA 3OSZA 4W6QA 2VT7A 2JAQA 3WK4A 3THXB 4MVJE 3UAXA 2X58A 3GJ6A 3HXQA 3V4RA 1UC8A 1QGOA 4L50A 3HJNA 1PZXA 3F97A 4P38A 1PT5A 1Z22A 4MB6A 1IWOA 1RYMA 4QNMA 4YI5A 5E1BA 4Q01A 2Y1CA 5HXBA 1L4FA 3UXHA 4YDRA 3E9ZA 1C8KA 4TMVA 1H0SA 3FJOA 3NJ8A 2HA2A