3ZBUA

Ferredoxin-nadp reductase mutant with ser 80 replaced by ala (s80a)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYAIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNEKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Hydrogen Bond Network in the Active Site of Anabaena Ferredoxin-Nadp(+) Reductase Modulates its Catalytic Efficiency.
pubmed doi rcsb
source organism Nostoc sp. pcc7119
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
total genus 89
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2012-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3zbuA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3zbuA02
1VQ7B 3CCLB 1QVGB 3CW2A 4B3XA 4ZCIA 1IJFA 1ELOA 4TMZA 4PC6A 1JJ2B 3G71B 1YIJB 2R6HA 2NPFA 3QFTA 1Q7YD 3CC4B 1R5NA 2QDXA 4QHYA 1EP2B 3ZBUA 1KTVA 5H59A 1BX0A 3QSYA 1QGAA 2AHOA 1GO2A 3OJWA 1VQ8B 3WNBA 1VQ9B 5TR9A 2XEXA 1TTTA 1TVCA 1GJRA 2QTLA 3B8HA 4B4DA 1FNMA 1YITB 2QN6A 4PC2A 3CCEB 4PC3A 3OZUA 1DDIA 1BJKA 1R5BA 1S0UA 4YALA 2QTZA 1E63A 4ZGQB 3MMPA 2C77A 1ZM9A 3CMEB 2BM1A 1H42A 1KD1D 4B48A 3LO8A 4YHBA 1EP3B 2C78A 1EFTA 2RC5A 1KK1A 1Q82D 1B2RA 3JQPA 1JA1A 4LBZA 3W5UA 3QFCA 5TV2A 1VQ5B 3ES9A 3CCRB 1YHQB 1CQXA 1FNBA 3VMFA 4DQLA 4N3NA 1K8AD 3PENA 3W2GA 4K1XA 1I7PA 1F20A 4U9UA 3AVVA 3J81k 4P6VF 3MHPA 2BMWA 1TUIA 1EP1B 1KQSB 1ZM4A 1F60A 1OB2A 3U6KA 3CC2B 3MCAA 1KK0A 3LRXA 3ZZ0A 3I1FA 2BGJA 1QGZA 4M0LA 2BGIA 3W2HA 4C43A 1W34A 3FPKA 4ZCMA 1G7TA 4TMWA 2D74A 1K73D 1FNCA 3AGQA 2OK7A 3CXCB 3AVTA 1OB5A 4RD1A 3CD6B 2BN4A 4M4SA 3WNDA 5JBQA 2XNCA 1A8PA 3I55B 3W2FA 1E62A 1KK2A 1VQPB 1NJID 1CNFA 4H9GA 3CC7B 4M1KA 4PC7A 1HA3A 4RD6A 3VO2A 4G5GA 3ZZUA 4RD0A 1ZM3A 3CB4A 1H85A 3VNVA 2EIXA 1ZM2A 4B47A 1VQKB 1G7CA 4ZCLA 4F7DA 1FNDA 4WQMA 3CMAB 2VNHA 4R71A 1CNEA 1QUEA 4Y7CA 1EXMA 4IW3B 2BV3A 3CCSB 1ZUNB 3JQQA 3U6BA 1DDGA 1JB9A 4FWTA 4HE6A 2GPJA 4HE5A 1KC8D 1QFJA 1U2RA 4ZGNB 2HCJB 1YJWB 2J7KA 1TLLA 1M90D 2BPOA 3V76A 2VNJA 5GV7A 3AVUA 1YI2B 1W2BB 2YWGA 4RD2A 2B5OA 3OZVA 2PMDA 3VNUA 1FDRA 2HMAA 1KJZA 4NCNA 1Q81D 3OJXA 1S72B 4PC1A 1IB0A 4AC9A 1GR1A 2PIAA 1OGIA 2XNJA 4B43A 1JNYA 2DERA 3W5VA 3FJOA 3QE2A 3WY9A 4YAWA 5KSWB 1W87A 2OTLB 2HDNB 1N0VC 2BSAA 1GAWA 2CRVA 2YWFA 4Y9UA 1NDHA 5DSZA 4MYUA 2QMUA 3W2EA 4M2LA 4B44A 1QVFB 1DARA 4RD3A 2DEUA 5TY0A 1EWYA 2PLFA 3CPWB 3E20A 4NBSA 3QFSA 3WNCA 1VQMB 4Y9RA 4UAJA 3CCVB 4QFMA 2VZLA 4LBYA 4TMVA 2ZITA 1KRHA 3P26A 1XB2A 3W2IA 1G7RA 3WBJA 3LYUA 1D2EA 3B82A 4G1BA 3SJZA 1FRQA 1WDTA 3WBKA 1VQLB 4TMXA 4TN1A 2BF4A 1R5OA 4C0SA 2QA4B 1W35A 5EMNA 2VYQA 4J0QA 2QEXB 5HXBA 4PGOA 1IJEA 4Q7JB 1D1NA 4M53A 1FRNA 5FA6A 1N0UA 4YAFA 1AMOA 4DQKA 3CCMB 1EFCA 4RJLA 2X3UA 2BM0A 1N8RD 2YWHA 1QH0A 3WXMA 2B7BA 4ZV4A 1BX1A 5AN9A 2EFGA 4P3YA 4LBWA 3U2QA 1AIPA 3JQRA 3A1FA 1BQEA 2FX3A 3AVWA 4BPRA 1B23P 1GAQA 2OK8A 3OW2B 4AF7A 2YWEA 1QG0A 1QUFA 1SM4A 1OGJA 2DY1A 1G7SA 3G4SB 2VNKA 4RD4A 2RC6A 4ACBA 3CCJB 4LBVA 1UMKA 1YJ9B 5THXA 1DG1G 2GQFA 2VNIA 2B7CA 3AVYA 3CCUB 3LVBA 4YAOA 3CCQB 2BVNA 2CNDA 3WYAA 3E1YE 4FK8A 4ACAA 1M1KD 1QFZA 4EH1A 2DETA 5H5JA 1XE1A 3ZC3A 4AF6A 4FN5A 3ZZTA 3VO1A 4TMTA 3W5HA 2OTJB 1D8TA 1JA0A 2E1RA 1K9MD 1VQNB 4RCZA 1KK3A 1QX4A 1VQ6B 3AGPA 3CRZA 3QFRA 3ZBTA 4G1VA 1QFYA 1Q86D 1J9ZA 4LC0A 1YJNB 4MYTA 2DCUA 5GV8A 1VQ4B 3B78A 3I56B 4RCYA 4N3GA 3OZWA 1E64A 3AVXA 3P27A 1QGYA 3G6EB 4YAUA 1GVHA 1SKQA 1VQOB 1EFUA
chains in the Genus database with same CATH superfamily
2X0JA 3GUHA 4FFLA 4MJXA 1E7WA 1WF6A 2OBMA 1X1AA 5U4XA 4AZTA 5KQPA 3F6YA 1DCMA 2DY0A 3HA2A 3H18A 5DNCA 2JHFA 1O6FA 3MYRA 4EW2A 3WWDA 4FOTA 1X9HA 3RKUA 1U4NA 3UCFA 4DDHA 1B76A 2AXQA 4FS3A 5HKAA 1PV4A 3GQBB 1RPZA 3A11A 2OV8A 2RHBA 2J9ZB 1Z62A 4NCJA 3TR5A 3UGKA 2KSQA 2X14A 2QX9A 1R00A 3E5RA 3HR4A 5IEBA 3SYTA 3GLGE 4NATA 4LNAA 4OHPA 2GJ8A 4IKOA 1T6ZA 3I0MA 3SYMA 2R4QA 4WBNA 1FL9A 4QPCA 3GPDG 3WL5A 5KNCD 2ZS9A 4Q9JA 3CLUD 4PBRA 1DJMA 5FCDA 1L1FA 2VWQA 3MGBA 1GO2A 3DQPA 1P7CA 1TT5B 4HAZA 4YFVA 5DM0A 2GVZC 2ZVDA 1FXSA 2RK3A 3A1SA 3P2EA 2I2WA 4UBNA 5CXQA 1J0AA 2XRFA 3BBLA 1HFKA 1G0NA 3ZV6A 4AMVA 1SVSA 2OQRA 2BE9A 2C7QA 4M8NE 5HPYB 1OBHA 1QO9A 3S3TA 1IBKB 1D1TA 4IXTA 1OA1A 4S3MA 1YR9A 4MEJA 1E1YA 2MSDB 2ZW9A 5TQ2B 4C7VA 2J41A 4QUAA 5KYGA 4L8LA 1Y3BE 2Y66A 3NHLA 1V9LA 1H2YA 1ISGA 5J2TA 2WU1A 2XRZA 4OJMX 4NFLA 1PK7A 2M6SA 2KHZA 5DN6D 1T4DA 4LV8B 3W6OA 4CEJB 3MRSA 5E6SB 3QEAZ 1I9GA 2OCPA 1E3WA 3BORA 3Q6MA 4BQPA 1R5BA 2HMVA 4BLPA 3JW8A 3LLSA 3OJCA 1IFXA 3CSDA 3PHHA 2CJFA 4M0KA 4UCFA 1C7IA 1GFZA 3FLMA 2Q7OE 3TMKA 4E12A 2PX8A 1U6IA 1OAOC 2VEDA 2XYHA 1YR3A 3NHWA 1KI7A 1HDZA 4QEDA 2ZSJA 3L0SA 3L02A 2CB0A 3DBOB 4YMTA 2E5FA 4IV5A 1I2BA 5FULA 5JSKA 3PI6A 1J9EA 4R2XA 3FZNA 2FHSA 2PGIA 4TSKA 2PNJA 4MRRA 1PNQA 2I6SA 1NVDA 2OC9A 2G63A 1Q1GA 4NBRA 4UD2A 4BVEA 1JA1A 1J8DA 2ZSFA 3JYPA 3TLYA 2O0JA 3EY4A 4AO7A 2RHJA 3AP2A 4XB6B 4RZSA 4Z4HA 5DOZA 2JRLA 3OQNA 4LPSA 2EQBA 4YIKA 4FSXA 2LCIA 5JXJA 1FC0A 1RHRA 1RWVA 3RVQA 1XTVA 5LU8A 4KDRA 3TZKA 3U4CA 1ZK4A 2JLSA 2HSZA 4IQGA 3A6KA 5ITZA 2B6NA 4ROTA 2UXDB 1AMNA 3PENA 3CZMA 1V11A 1I7QB 2ESRA 1B26A 3A35A 2VJJA 4QEKA 3U7IA 4KAXA 2Z6BD 1PO7A 1Z26A 5EP2A 4E4TA 3EZ6A 2WT8A 3HS3A 5C2JB 4JI6B 3IVXA 1RIIA 4QLAA 5COBA 4CQMD 2FPKA 3CBQA 1V8ZA 1XU4A 1ZD9A 4BMYA 4CMCA 4YCNA 4D02A 2V7TA 4OLHA 3EVEA 3R2JA 2GZRA 2A78A 3IJRA 1EAMA 2GFHA 3RTCA 1YA8A 2BFFB 1RKVA 1YDGA 2PWPA 2O2CA 1NNUA 4RESA 1M6YA 4OXNA 4PAMA 1FMFA 1WORA 1BXKA 2C03A 3ZZNA 5K8UA 3DM5A 5F1YA 2OBNA 1M83A 1YU6A 1S96A 2FVYA 4P4NA 4EKIA 5J4KA 5HKKA 3SJCA 1JPNA 2FN9A 3BY1A 2VTEA 5KOYA 4GRDA 2C96A 3GFBA 3LF2A 1DJLA 2XKJE 4M9RA 2ZUTA 3SX0A 5C81A 5LFAA 1FNCA 1JE0A 2QUJA 4UHCA 1UXOA 5CFQA 5EWMA 3KL2A 1WD7A 3AKYA 5BN1A 1K08A 2O8NA 2XB6A 1SIBE 3CW9A 4L57A 5C51B 4D46A 5I48A 1QB8A 4P2BA 4OHZA 5KSOA 1YDWA 2EV9A 2AQKA 3H8JA 1G2IA 1G9SA 5TPWB 5AJVB 2OHFA 1Y5LA 3UGTA 5IF9A 1C0EA 2IF2A 2AFIA 4YO7A 4JJ6A 2BUCA 4UNIA 2AK2A 2GS9A 1HF3A 1UOOA 2PANA 1S2GA 5I9MA 4K3VA 3WNDA 1JIJA 5H68A 2G9ZA 4KO4S 2IS2A 2ZUEA 3TLCA 1IHDA 3HE3A 4N18A 2ZE8A 3KQNA 2R85A 1SA0A 5B3AA 3TW6A 1YR2A 5K3EA 4GE0A 1YMVA 4KYVA 4A92A 1I6LA 3EDQA 5M29A 3AESB 3A2LA 4OPSA 2I1LA 3ENKA 4L72A 3D7KA 5FA5A 1QHIA 3F5DA 5FFMA 1AKVA 4ZI2A 5C8YF 3CRRA 1LRLA 3I9LA 4J8PA 1NW8A 4MGYR 3KUUA 4PGMA 4R7TA 4YP9A 4DC9A 2JLWA 5HRAA 3JWEA 3DB1A 5JO0A 2PS0A 1EFLA 3UY4A 2I29A 1UD4A 1J0DA 2AKAB 2J3IA 4TM7A 1N33B 4AMUA 3E82A 3COJA 3MBOA 1MHTA 4G3XA 2M2IA 5I45A 3RG8A 3RT7A 1C7FA 1A8HA 2UVPA 3LP6A 3TPFA 1RHQA 2XUQA 5CM2Z 3HKCA 3WYGA 4I5IA 4QU5A 4ZZIA 6Q21A 5AW7A 4AZWA 2D1RA 2WMDA 3LE8A 4LPKA 2ADMA 3CLUC 3H16A 3FY4A 4LKRA 4BNDB 3D6HA 4RD0A 5TJHA 1GG5A 4O8CA 3QUTA 4XOIA 5C80A 4XYEA 3U3KA 4Q1EA 2MJLA 4X65B 1VPEA 1JT9A 2C2BA 2H2HA 1VGQA 2FZWA 5LPNA 1OA0A 1FXWA 1OLSB 3VPAA 1RXCA 2DFVA 4DSAA 4YAGA 2BC9A 1T3LA 2O8BB 5WRFA 3AJRA 2NSDA 2VP3A 3DVRX 2B8EA 3O4FA 5E1DA 3KK0A 3T3HA 1VMKA 2B9EA 3KHTA 1ECBA 1DLJA 4CR7A 3N0RA 4D4JA 1UD2A 2ZKLA 1B73A 2ZI4A 3FPJA 3PRHA 5LC1A 3D7RA 3OU7A 3VR6D 4G41A 4BUJA 1E9CA 1O4WA 2G80A 1C9JA 4Q9HA 1NQAO 1UEXC 2P9GA 4G2NA 2FWMX 2JFNA 3T35A 4ZN6A 1DKQA 1OBFO 4P5DA 1SIOA 1OHHD 5HRUA 4U7HA 4WZTA 2Q28A 1UPCA 3ZDQA 4HPJB 1A4UA 4EO7A 1ZHOA 1FTWA 1MXHA 3NWJA 4HQRA 3RYIB 1N34B 2FW6A 3NR2A 1B14A 1Z16A 3SE0A 1V45E 3NB0A 4WKNA 4YA6A 4ZTUB 2W4MA 1AKMA 2YNMA 3A04A 1L7BA 4QFDA 1H9BA 3GVIA 1V25A 4KL8S 3TLZA 1HO3A 2IVZA 3ZEIA 2YY6A 1GRCA 4JJAA 3HJFA 1XPRA 3VDXA 4DQXA 3KU4A 1QANA 3H2KA 1DOHA 3TEFA 3QMPA 4QLOA 4YAIA 9MHTA 2RGNA 1X39A 2BFOA 3F71A 4YASA 1N6NA 1OZAA 4F3YA 3DWGA 4R9VA 4FT4A 3I04M 4A4DA 1CZRA 2OZLB 3I01A 4QYWA 4UCXA 4ODIA 2A5LA 3B2NA 2CKMA 3ABOB 3TJZA 4RHYA 3UOGA 4CF6A 4RGYA 1IK4A 1MB0A 5ALGA 4ZT2A 2R9VA 1CC1S 3MJFA 2ASEA 4XUDA 3RVRA 2FWJA 3U4QB 5IZ4A 4QULA 4OY3A 2LTAA 4QFCA 5GY7A 3ZGZA 1HZZC 1S2OA 4R54A 3KQOA 2J0SA 4NBLA 1NF8A 4FFVA 4II7A 2V0NA 3THYA 3H1GA 3JU3A 4P83A 5GV7A 3SHOA 4YGXB 1NT4A 1J42A 1NSYA 1UOPA 5LYYA 1W19A 2F3QA 3BAFA 2ZJ5A 3FSGD 1N5MA 1HOXA 1Q16A 3AU8A 3CVOA 3AHFA 4WN9A 5BWMA 3BQJA 4LTNA 1YNSA 4WGGA 4W1RA 2XBUA 1SFRA 2JEZA 3KE8A 2X1VA 4R68A 5DCUA 3U0BA 3VO9A 2ZJ1A 3TIGA 5ELXA 2IZOA 5L7YA 1MV5A 1WZNA 1M33A 3A3OA 4DLTA 3Q12A 1BRMA 2INGX 4DMMA 1T3SA 4MZXA 3FNBA 3R0VA 5KYUB 3B8EA 2ERXA 1RDFA 4R05A 1X77A 1KO7A 4CCSA 1WVGA 4IILA 3VBCA 2BZSA 5K0ZA 4NICA 1W0KD 2EF0A 5DISB 3PL1A 4F11A 2YYYA 1X14A 3AVOA 4UTXA 3K9FC 1SBHA 1YQQA 1L5GB 2BF7A 2QOEA 4GMKA 3OJEA 4JMPA 1HE3A 2IUSA 4DLZA 1HQCA 1TA9A 3GT7A 1WF3A 4RHEA 4LYFA 2CV0A 2UUPA 4ZHQF 3BD7A 4BJ1A 3Q40A 4BO9A 4QA9A 4ZOBA 5AVQA 2L0XA 4FD3A 5AXAA 1I1HA 2JGRA 1C0PA 3P7MA 1BO6A 3TLKA 4IEIA 4BMNA 4B6JA 2FPWA 2QMUA 3VR5A 2VHZA 3DTVA 3EOBI 3IUQA 3B5JA 2HK9A 2O06A 2UYOA 2Z2ZA 1C1XB 4CT4B 4HLUA 5IF3A 1QVFB 4RHXA 1Z0SA 5BYKA 4RYLA 1UFKA 5F21A 5TY0A 3FNIA 2GAJA 4O5AA 4RNCA 5CYFA 1E4OA 1OX4A 1N07A 1X2BA 2V59A 3AH8A 5AK3A 2JDIA 4REOA 4B6PA 4YPVA 1DPFA 3IE2A 1QK4A 4OJNA 4K8RB 2DBZA 3L5OA 2NUTB 1BN6A 3EMDA 1AK2A 5JXHA 5KWEA 1KSHA 1TTQB 1KQNA 4EQZA 4IDNA 4P2GA 1WEKA 1PV2A 2FOLA 2I7CA 2IPMA 4IIXA 4ZQCB 2A88A 3PJRA 4D9CA 3SJ7A 3A3YA 4GQIA 4MGZR 2CLEB 4PYLA 4MWZA 2RAPA 5BQPA 4W5RA 2ZM6B 4AKSA 3KAPA 3QVLA 1KRWA 2X6TA 3B6EA 1SHTX 1VBNA 2AI2A 3VTFA 5EXEA 1PZFA 5KNDH 5AIBA 2PD3A 4HGNA 1BJRE 1N6LA 1ZU5A 2NO9A 4QUKA 5LB2A 3VR6A 1C7EA 1YCDA 5F9HA 5B7PA 2AE1A 2X41A 3PQ4A 1CJVC 3FCSB 4V0QA 5ALXA 4X60A 2WVAA 1VQLB 4MO2A 4X5OA 3RSQA 4UEOA 3C1UA 2HQRA 2QA4B 1QV9A 3LX6A 4KQIA 1E0KA 2B2CA 3TGPA 3WSWA 3B89A 4YXWD 1QIEA 2DBRA 5HXBA 5E4JA 4BNDA 4X7FA 1VLQA 2WA2A 4MUEA 1T36B 2QYOA 3DE0X 3AM4A 2Z9CA 3S27A 3KYIB 4XSHA 2P9YA 3EVBA 1M2JA 3PT9A 1RHUA 4MRNA 4I8DA 1R6BX 2WJZB 1M1NB 4YJGA 4GI1A 1TQHA 1OMOA 2Q4RA 5IXJA 1U4OA 1FQOA 1N75A 1PS0A 1HRDA 2XBLA 4EFKA 2DBQA 4UOZA 1QIIA 1SKAA 1XA3A 2XA2A 2I33A 4TL6A 1EFCA 5CIWA 4BFTA 1FW8A 4WY5A 4PHCA 6ABPA 4PCUA 3SR0A 2K87A 2YXDA 2VZEA 2Y99A 3BDVA 1NC1A 4FWBA 4REQB 3JQAB 4OP7A 3RK0A 4DADA 3A6LA 4Z3KA 1ND5A 3SFZA 3KJFA 2V55B 4OJKA 3EC7A 2GZHA 3OPQA 2AR9A 4F8JA 1GGKA 1MO5A 2J0VA 2M1XA 2H51A 2R6DA 4R0MA 1VL5A 4LZJA 4RDJA 1ZEJA 3BMCB 4I8IA 3K4PA 3AUFA 4IRUB 3C24A 4NCHA 4MYCA 1LLQA 2QQEA 3WSTA 5CBKA 2ID4A 2FPGB 4IHAA 2V4MA 1Y3IA 2J46A 3L6CA 4LWPA 4EVRA 3CR8A 3QVKA 2YNMD 2I3AA 2W2OA 4HFMA 2HCFA 1XRSB 4F4FA 1IXYA 2ZJ0A 2FSVC 2F90A 4GWLA 3NDBB 2LIVA 3F6BX 1ADJA 1U8UA 5AM5A 2NU8A 2RC6A 2ZBUA 5CT8A 5SZIA 2A1UA 3ACDA 3EVFA 1UWLA 1TOAA 1DFGA 3D43A 3KEGA 5K0GA 4XGIA 3PG5A 4N39A 1RTKA 3MD0A 1ARZA 4A0RA 1JWLA 2HMSA 3HGQA 1N7JA 2OO3A 1IJBA 1ZFNA 3W3AA 3WI7A 2PJRA 3OOWA 1KETA 1IDOA 1RKBA 1XQYA 1F7UA 4C4YA 2C3MA 3LS2A 1BFKA 2CNDA 4I5GA 4D0RA 4C6TB 3LL4A 5FPQA 3BFKA 2FPOA 3PKZA 4YB8A 4QELA 3OWXA 2QN1A 2Z3WA 3CXUA 3DAPA 1NZDA 1V96A 1VBFA 4QT0A 3K6KA 3U9SA 4UKDA 2HLDD 4QIHA 3DD1A 4R3WA 5B36A 4IZHA 2QX4A 4ON9A 2GPYA 4PLCA 2FMKA 5CLQA 2PO5A 2C7BA 1ZSNA 4M21A 5IAEA 3V4VB 4C0AC 4CV1A 3BK2A 4EARA 4EUSA 1BWPA 5AI4A 1TQ2A 2DETA 1KYIA 3IHTA 5BN3A 1XJWA 4DEXA 3H05A 1XE1A 4EM6A 4UAUA 3JAWB 2WVHA 2CXRA 3D0QA 4W7HA 3TFWA 2IA5A 4WADA 4OX9Y 1KJNA 4F8EA 2FZEA 1JFTA 2ZZNA 4F9TA 3ZZTA 5GIPE 4JFAA 3N58A 4K9OA 1AO0A 3PTZA 2HV9A 3QNMA 2W42A 4LYDA 2UZ0A 2VDWA 1JA0A 1P5HA 2QK4A 3B1VA 3ONVA 3OVMA 4JYPA 2FQ1A 3DFZA 4Y6GB 4US2R 3CEAA 5LOVF 4RCZA 4NNPA 2D3NA 4RQAA 4MV0A 3RTEA 1MJHA 5EVCA 2EDAA 3ZCUA 5JAUA 2ZS7A 4DLLA 2XWJI 2FF7A 2P5YA 5SYNA 1T0PA 2FEWB 1VJCA 2PDAA 1V1MA 2YWJA 4IUBS 5H83A 3EWNA 3NBYC 2BFEB 4D74A 3OKAA 2K2WA 3FOBA 1JDUA 3UK1A 3T3NA 3CMMA 3QXSA 3BGSA 2ATEA 1QP8A 4H0FA 2QS9A 4P26A 4MKZA 3GLFE 3G6EB 3QLVC 4YAUA 2I6XA 4AJLA 1EHIA 5FWYA 3SVTA 5GJBA 4H6PA 3NHBA 1SKQA 4WK0B 4BIIA 1QF6A 2ACVA 5CPFA 4BNUA 1NM5A 3HH8A 3PUZA 2X0RA 1T4MA 3A4TA 3MXOA 2V6BA 1U2DA 1VPTA 4LWZA 1WRBA 1H2FA 3LO5A 4LXYA 5AT1A 3ZPXA 3RK4A 3BICA 1L4YA 5KQMA 2VOEA 4ZO4A 1YE8A 4PSVA 4L8VA 1ELOA 3HWX1 4XTCS 2MOKA 3UMFA 5HQ3A 4NH0A 1UKBA 3AUUA 4GE3A 5FPHA 4EGQA 2ODPA 4V02A 3G71B 1OPRA 2CCGA 2WIDA 1SMKA 1AD2A 4N8DA 4TXMA 4YRBA 4G0UA 3MS7A 1W0JD 3SY8A 4WXPA 4B6SA 4RTSA 3ET5A 2GAAA 3I92A 1K5PA 3R75A 1JFFA 3BXZA 3QSYA 3I64A 4HGRA 2RMKA 4PTLA 3RFXA 2WHYA 3BCHA 4DM7A 3ADCA 1CFJA 3TSZA 1ONPA 5TQJA 5BMOA 2XA1A 1QOQB 2JLRA 2O8FA 5HOQA 2QN9A 1Q0QA 1FUEA 2UV8A 3MOIA 4PZUA 2E4YA 4KN5A 1JIQA 1ZGGA 1RJ9A 3CLSC 1JA9A 1TJ3A 4BZQA 1J4AA 5KAPA 4LF7B 5FNVB 1G8GA 2A30A 2JJYA 2Y0PA 3ZWXA 4M0UA 1NG9A 1LPMA 4NYMQ 1V1RA 2JA2A 3JV7A 4XMYA 1WQ1R 2D54A 4M9ZA 3RF7A 4PN3A 1C7JA 1XRJA 2R8BA 3D0KA 1R6DA 4B4WA 3UENA 4QXAA 5FUMA 1BKSB 4JSRA 1ZJ5A 4E6PA 2J09A 3BTUA 3ASTA 3LC1O 2IU0A 4PPNA 1PGQA 2PUVA 4R9SA 1OVGA 3N1UA 4DRZA 1E2FA 1F3OA 5KVSA 1I5OA 2Z1DA 4E94A 4O3FA 2FG6C 1ODKA 3O1JC 2XLCA 4QQRA 4XWYA 4XYMA 2IEZA 2R5WA 5PGMA 3UT5A 2A5DA 1QRTA 3A27A 4YRRA 1ORDA 2KS6A 1Y8ZA 3PF9A 5ALIA 3S2SA 3FD8A 2Y1FA 4N8SA 2J7PD 3DDCA 1QHXA 4XASA 5IC5A 4J0EA 3LLMA 2WFLB 3I8XA 3F7NA 1KZ7B 2I6GA 1H4SA 1H6DA 4Z86A 5EUQB 1CUWA 1RBZA 2H9IA 1DQNA 4I55F 4F6RB 3V1YA 1Z15A 5LJLA 5M34A 4L0CA 3TL2A 4RJTA 1YD7A 1MABA 4K0RA 2VPZA 1EFHA 3ZWCA 4KR0A 3AOEA 2H1WA 3P52A 3ND6A 4AZ3B 3JSXA 4DA4A 4CI9A 3PFCA 4QGAA 3GXOA 4F71A 3WOHA 2JH3A 1HY3A 2LE0A 1GG2A 3KKPA 1GUBA 3PQ8A 1MQSA 1XVTA 2XVAA 5FBKA 3ZR4B 5E1BA 4UZUA 5CJ2A 3SBXA 4CNBA 2NZ2A 1ONSA 4HPXB 4I08A 3AVVA 1HSOA 4RHFA 4MRPA 2P8JA 4YMVA 3TOSA 4TTVA 4B8YA 1PG0A 1KQSB 2R1TB 1WLSA 1XV5A 2VH1A 4PSAA 3VC3A 3BVPA 1RI3A 3FZQA 2ZIUB 2Y1OA 1HTTA 2NO6A 3CC2B 1B74A 1ZWLA 2Y76A 2ZTUA 3I9KA 3JVIA 4D4MA 3GROA 5D1NA 1KK0A 1EBFA 5HS4A 2OBTA 3MD9A 4LXXA 4R0NA 4UMDA 1CZHA 4GH5A 4RMGA 2XDQB 2AN9A 2RHTA 3QXJA 4M0LA 4MRMB 2W7TA 1OPXA 1SUIA 3FPKA 2JGDA 3I3OA 3NKLA 3SEZA 5CD1A 3HJUA 2HC9A 1E66A 5BYJA 5JWOA 2VP2A 2Q6VA 3GI1A 1QIFA 1NJGA 1G7TA 3FGZA 4FJ1A 1TEXA 5EHNA 4ESEA 1BVHA 4JJ8A 2ONYA 5DTMA 4L9AA 2SECE 4WLVA 3LRTA 3QEBZ 1WP4A 3OJOA 4J1TC 2H5IA 2I87A 4PE5B 3G85A 1DAIA 4HX2A 3IMFA 3OOJA 3LC0A 4XARA 7ADHA 3ESDA 2PMEA 4RQUA 3L0CA 5K7SA 1FRVA 4PLFA 3HCRA 4I6EA 2NV4A 2ONZA 3AJ9A 1DKOA 3GJ4A 4MPPA 5TPZD 1MC4A 2QUAA 4G1UC 1UFRA 2ONKA 4UTZA 3Q5GA 3HYCA 1VE5A 2BKUA 3IPXA 3EQZA 4E70A 2D1FA 2AYYA 2IPLA 3DC7A 3I01M 1PZHA 3C8DA 4P9NA 2G0NA 3CURA 3VKHA 2F67A 4HDSB 1JDTA 2HK7A 2IKSA 4DLKA 5ALNA 5D3MA 5LLTA 3GAFA 1WHSA 1JVNA 1E7QA 4G07A 4X7MA 3IQDB 4CQJA 5JO9A 2ARKA 1XN4A 1FFBA 1OF1A 1CJUC 3GUUA 1CG6A 4XGKA 4MICA 3VO2A 3STYA 5T67A 4LJ7A 1ZI8A 3IOYA 2V0CA 4YCSA 2HYDA 5JISA 2FK7A 1BFDA 2F55A 3IBFA 2Q5LA 5DCYA 3V8MA 1HDYA 2WLSA 3ZDRA 5AW2A 2VJPA 1XNQB 1AQJA 1I2ZA 3C4QA 3CSUA 1ZI9A 3GD7A 1JHVA 1UBTS 2IHTA 2VJCA 1EHCA 3DDZX 1L4NA 2PJZA 3WGQA 5I7HA 4V1CA 3PS9A 4G4IA 5E7IA 2WJVA 1E20A 3AUYA 1EFKA 4M9UA 2BONA 4WASA 3F8TA 1TGYA 2WYVA 4TV9F 1KI9A 3KPWA 3HZRA 4LZWA 4AO8A 2P90A 3GRCA 5AKXA 1W85B 3Q2OA 1U0EA 1WL8A 2YC2C 1J97A 3FMVA 2OG2A 2D7JA 2O7NA 2EJCA 1FNDA 2J6BA 3EIXA 4J16A 4PFJA 3G02A 2G8LA 1A9YA 2P3SA 2FPIA 4OI0A 1QTNA 3KFVA 1VXOA 3CMAB 3RVDA 5KVVA 1JXOA 3ZOZA 5ALZA 1ZIDA 2Q3BA 1FB5A 4ZCTA 5BRJA 3HM9A 1G8AA 2W93A 2Z8ZA 4RO0A 1Z47A 5BYAA 5J63A 2XYRA 2GCOA 5H80A 2IEGA 3CM0A 4IOJA 2Q1YA 1K4YA 1EXMA 1RVV1 2P91A 4TV8A 1IHPA 3OU6A 4AD8A 5KQLA 2DHCA 5D85A 4KR3A 3FBTA 1QH8A 1D3AA 3F1KA 2YOFA 3HDQA 4JUCA 4QUJA 5DHRA 5KYYA 1Y8RB 2G5TA 4RPDA 4I55A 2AQHA 5CR9A 1A5AB 3RRBA 3VVCA 4K1LA 3DVAA 3E3NA 5K3CA 3V33A 5HQJA 2PFSA 4EFLA 1PR1A 4LX8A 1JB9A 4KVAA 1P39A 2E6UX 3CZ5A 3WE7A 4QNMA 3ZE8A 2AG8A 1CLUA 5ALRA 1A27A 1W5TA 2NOAA 1VG8A 4C4ZA 1QNFA 2Y1XA 3N2EA 5IUKC 4E03A 5B30A 1CHNA 5ALFA 1ZCFA 2HCJB 3O6VA 3B70A 4IF4A 5LBTA 4F4UA 2WTBA 4Y2XA 3L06A 4BEJA 2OV1A 4KUGA 1R15A 3UYKA 1DOZA 1U65A 3QG1A 4X00A 3SXUA 1HT3A 2CFOA 3UC9A 1P1FA 2XYQA 4HDNB 2ES4A 5LL6P 4BO3A 1A8UA 1TJ5A 4TYPA 3GPCA 2XGSA 4LHVA 5JNVA 3ETEA 3S6JA 4Z4YA 3HNRA 1SXPA 3HO1A 3PQ2A 3P71T 4RY0A 4UPEA 2YWGA 1SEPA 1RZVA 4KDCA 3ADDA 3NWEA 4RHCA 3Q3JB 3T41A 3DDHA 3WB0A 1NQUA 1Z4LA 4RA9B 4QWWA 2BJHA 2PMDA 1QLHA 4LHWA 621PA 2WNIA 4DPMA 1IULA 2C3UA 2VRNA 5F4BA 1KJZA 3D02A 3SIWA 3CH5A 4UFPA 1HNNA 4DV6B 2CT8A 3FYHA 4H0NA 4ND8A 1SQ6A 1L4GA 4LGCA 3AT1A 4U8HA 2AQIA 1EDEA 1XDGA 4UJ3A 4QGBA 5B1DA 3WS7A 5K2OA 5TIIA 4D9EA 2EXXA 1P0IA 3Q10A 4G1CA 1IBRA 2H1OA 4EL0A 2QTGA 4HYEA 3EUEA 2C4HA 1OFHA 1EK1A 3FIJA 1NKVA 5DF1A 4FKZA 2A2ZA 3X2SA 4AAYA 1NHGA 3O83A 1JNXX 1BQ3A 1QNLA 3NEAA 4NJEB 5JD5A 4ZT3A 2ZM5A 3GLHE 2BGGA 3WY9A 3G0IA 4D56A 1NQWA 1OROA 4KXFB 2HF7A 2PA3A 1Y5NA 1LH0A 3LLCA 1LK5A 1W44A 4QC2A 2OTLB 5DT9A 5I3CA 2BMJA 3B1KA 3QELB 1CJMA 4IEEA 4XGNA 4MW6A 1RSZA 1Y1TA 2IOFK 3L07A 3PHJA 3NUGA 4UE2A 4UBJA 3SWWA 1L5RA 3L46A 4MX8A 1MG5A 4HK4A 4OHUA 3A6FA 1U2ZA 2WD8A 2G1UA 1B42A 2GCOB 5JDIC 2MCFA 1P18A 2Q4OA 2YZKA 1J33A 2IXDA 2J0QA 2JJMA 4X6LA 5JCXA 1IC6A 1TJNA 3DPUA 2AOTA 4PRKA 3TXYA 1J22A 5LWHA 2C3YA 4PZAA 4CKEA 5CMLA 4CLDA 1QBGA 2C20A 3BSYA 5CCBA 2JIPA 2VEOA 1TT5A 1EFRD 1M0TA 1QWOA 4CLRA 1M0SA 2F7SA 2BSQA 2O3RA 4Z2AA 2BCEA 2XE4A 1DRKA 2VDUE 4YMWA 5MDHA 4J43A 2CJXA 4FYVA 4BQSA 2WMYA 3CCVB 4Y2JA 4IJWA 1PQYA 3SSOA 4WBNB 2VZLA 2JIBA 1X86B 1Z0JA 1KI1A 3GG9A 3D5TA 3K1AB 4L16A 3QX9A 3W2IA 4C21A 4LFAB 1SHKA 4OU5A 1WMSA 2UZ3A 3FYCA 4Q4AB 4CQLA 3UK6A 2R6FA 2AD1A 2G1PA 2IBSA 2NSYA 3WFJA 4PO3X 3T9DA 1WUTA 2F3RA 3WADA 2C84A 3C16C 4CLRB 1GPJA 3SJZA 5FD8A 1EX1A 3A9SA 1R9JA 3CUEF 1I01A 3NAGA 4FMBB 4X1KB 1T5SA 1K6IA 3HKEA 4WLFA 1KE1A 4ZMRA 4C0SA 1E2EA 2WHEA 4Z4FA 3PPVA 3C7CB 4J0QA 3EXG2 2LZ0A 1QIDA 3DBVO 5AKJA 2YIDA 1I36A 5BSTA 3WYFA 4M53A 1J06A 3BD8A 2FMXA 4FC6A 5FA6A 2QTTA 4QO8A 1F9AA 5ER9A 5FL7D 4WUTA 2RGUA 4FQ5A 5E1MA 1GSHA 3KCQA 1SB9A 2R6GA 4FFDA 1H2EA 3MSCA 1OI7A 1F8YA 1T1SA 1LQUA 2WDPA 3MEQA 4M9SA 5SYMA 3TSAA 4BO8A 4EF6A 2Q1SA 1DE0A 3T3GA 1QYIA 3N5KA 3RW9A 2XB2A 1DAFA 1OFGA 2FYTA 1CKEA 3C4VA 3QUCA 5EWJA 2A0WA 4PNPA 2YWHA 3P9QA 3A1UA 2G1KA 5GONF 2AZTA 4EA7A 5TDHA 3S40A 4BOYA 5AUNB 3AETB 3W06A 3QLVA 2OXTA 3EXEA 5EIEA 5GVRA 5DBFA 1LS6A 3IERA 2WYIA 1M73E 1C3LA 1ZRNA 2NZYA 5BOSA 4A6XA 1MJ5A 4U4AA 4UASA 1DG9A 3GD5A 3JATB 4JJIA 5TGZA 1SQSA 3S2FA 4ZVOA 4Z2YA 3RWOA 3PCRB 3GNSA 3R7LA 2Z9BA 1CIPA 4A1FA 4H35A 3OZGA 4KWIA 1RMTA 4UM7A 3P97A 2QL5A 1ZZEA 3N2IA 4RY2A 1QVZA 5BUSA 4EMBA 1NBAA 1ULBA 5AXCA 1FBNA 4K2AA 5FFNA 4KMOA 4W1QA 4CKCB 1DRWA 5ICEA 3T3EA 2RCYA 2R5NA 3NO4A 1Z9BA 2JCYA 5AM2A 2V98A 3RIEA 4N5MA 1ZD2P 3ZHVA 3K6JA 1PJQA 3VSCA 2CNKA 3X1KA 3O90A 4LBVA 1UMKA 1KAEA 4HN4B 2ZRDA 4IIYA 3GJSA 4XAQA 3DDUA 3UMBA 1VE1A 1MJGA 4R2KA 7GPBA 5A7GA 4KV7A 2QI9C 3NOVA 2WQZA 4UUOA 3ASRA 3TR0A 2RE8A 3O4RA 2EEPA 5FJJA 1QIKA 1RYZA 2GO7A 3P4UA 6AT1A 1B93A 2FQQA 2GPSA 5B58T 3G9TA 4L2IB 3WMEA 5K0TA 3B48A 4PIVA 2CD9A 3WYAA 4LHZA 3VRHA 2JF0A 3FDZB 2C9MA 1L7DA 4IMIB 4L5CA 1FFEA 4LWQA 3ETHA 3Q8KA 1NVMB 4AVYA 4E1BA 4BZPA 4RK6A 2NLOA 5AW1A 4GXQA 4KWTA 4ZO6A 5L45A 3G49A 2LBPA 4JB0A 3D8UA 4GR5A 2WZDA 3Q6NA 2QPOA 4HZUB 4WOCA 5JI2E 1BXGA 3PB3A 5BN5A 5IUNC 3D4LA 2ZJFA 4MNTA 2YMMA 5LXTB 4YNBA 1DKUA 4BKOA 1FS4A 3KJHA 1OGYA 4C29A 2Z5LA 1BYIA 2DUMA 4NFYA 4D8YA 4F2HA 1BE1A 1RI4A 1V2HE 3PC8A 3HXOA 2MSCB 2H3EA 3LQ1A 3VQTA 3VO1A 1ZXBA 2JIQA 1JI3A 2FF5A 2Q21A 4IUCS 4W8HA 4LSMA 3RS2A 3ZNNA 4F4CA 5JS1A 1SUCA 1R5JA 3NQ41 4GMHA 2JGFA 4U3JA 4DYDA 3AGPA 3RC9A 2TYSB 3QWFA 1MVNA 1RWOA 3UMJA 1DJPA 5I6DA 1TPZA 3ONDA 2YWXA 3OFSA 5F2EA 4GL2A 2OHGA 1ZC3A 1NNSA 3GLHB 1YI1A 1D8AA 3IQEA 2WINI 3BMNB 2OHHA 3L84A 1W88B 3OETA 1PGNA 3EJWA 1W48A 4EGJA 1FFYA 1VQ4B 2R751 4Q4DA 4YT4A 2H00A 3OTWA 1N9GA 2OYSA 3BE4A 3CX4A 5EVJA 2I67A 1E64A 1Y80A 2NZXA 4RAOA 5FBWB 2AUMA 4MW5A 2NACA 2KE5A 1ZJWA 1UC4B 4D3DA 3LUGA 3W8NA 2Q6LA 1AZTA 3K94A 3TDMA 5E6SA 3KKKA 3R3UA 4Q15A 2NTVA 1EFUA 4RJ2A 3IV7A 4GIBA 1B16A 3TDNA 4P8RA 5DNUA 2GQ0A 5AI5A 2W98A 2C9DA 3NP9A 4KJXA 1L5OA 2JIDA 4RSHA 1IXZA 3DULA 1IPHA 4OKIA 3WISA 5J43A 1LW7A 4BMCA 3A8IA 1ZCBA 3CIOA 2A86A 3NHPA 5F9FA 1AM4D 1C9DB 2EKBA 4F3CA 1LX6A 3UG6A 2ZJOA 1WOPA 2P4SA 5LUBA 3WMFA 1XXHB 3QA3E 3E9MA 3F8SA 1U9ZA 4MUHA 4O59O 2V03A 5HKBA 4LTMA 3QPWA 5DHFA 3ZTTA 4LC1A 2CLDX 3FFWA 1U1CA 3ZK7A 2MWMA 3FM9A 1GRNA 1YZNA 1LBEA 2XGGA 1ISHA 3SKYA 5HX7A 4C6HA 3OIFA 2VI5A 3M81A 2YVAA 4K6KA 1MIHA 1VXRA 4DR2B 3WYDA 5IYZF 1KO8A 1EM8B 3NEPX 5SYAA 3G5TA 4WN3A 5CT9A 3USCS 3H19A 4DSOA 3O91A 2A9RA 4KGXA 3W2TA 5C31A 3T3IA 1F51E 2C7RA 2FEPA 1BCSB 4NOMA 4RACA 4XCXA 5KWVA 4UOEA 2B37A 4W9RA 1OAOA 2FCRA 1XLTA 1A0OA 4IWXA 1U63A 3V2HA 4EJMA 1UJ4A 1AURA 1GA4A 2GJAA 3BREA 1NSTA 2CHVA 4B82A 1W36B 4D97A 3GT0A 1QH9A 1AV6A 3V48A 2YIJA 2QTZA 1C7QA 5T8KC 2VQSA 1U1FA 2NM0A 3O5AA 5CGQB 5BSXA 1MT3A 4IH4A 4EKYA 4CW7A 3N3AC 5ELLA 3ROGA 4F7WA 2VF4X 3GXBA 3C45A 1IL0A 3WX0A 4TM8A 1DB3A 2J6CA 2Z4RA 3IQXA 4YEDA 1XDDA 6ADHA 3FPCA 2MSLA 1GQ2A 4FTWA 4MS3A 4DLYA 2BEWA 4RVFA 1K97A 3I4CA 1QVVA 2ETXA 2QMZA 4FFSA 3VV2A 1NJ2A 1O54A 1EWTA 3N6RA 4WN9B 2II6A 4M1ZA 4MDFA 1SURA 1SVNA 1AN9A 3CS3A 1PJ4A 4L75A 3RJ9A 2AFHB 2F2TA 3UHAA 5B3JC 1KL7A 3HMKA 5CA1A 2I0FA 2BBSA 1H8HD 3GDOA 5TV2A 5CPBA 2DVMA 3SICE 1S3GA 5KYNA 2B7LA 5ADVA 1YHQB 1NRWA 4FGWA 4ZGGA 2WM3A 3UJDA 2J3LA 3OIVA 1A97A 2PVCA 4DLUA 3NNDA 5DYWA 2H2WA 2NO7A 1LDMA 1TZKA 3JU4A 1WTHD 4AVZA 2CNWD 5EHZA 3Q72A 2EBHX 3IIEA 5IAJA 2G4CA 2R8OA 1OV4A 3ND9A 1RLIA 1TU3A 3MHPA 2XITA 3FNRA 4KBFA 4MR8B 4CGZA 4M1SA 2EZUA 5IKMA 4O2RA 1ZH4A 1WB5A 1C3OB 3LW8A 3GJQA 2CMDA 4L07A 4R7GA 4BLOA 4ZOCA 5C7IO 3KD2A 3LQFA 2WT4A 1TO1E 4F38A 3WZLA 3RS5A 2IEYA 1JG1A 2QTAA 1RI2A 2A1UB 4M0MA 1VG9B 2X8LA 4BX3A 3UMYA 3TQTA 2ZSKA 3Q6IA 5AQEA 1CLEA 3TAHA 4E09A 4JYMA 5A6VA 3TW8A 1QTIA 1KS2A 4NECA 2MSKA 4BQFA 4BPBA 3B7PA 4O4LB 1GPYA 4XQ0A 1JU9A 1GYRA 1NR1A 3EGEA 5JPIA 2C5GA 3VDNB 2V4DA 2QMHA 1YQWA 2D74A 1K73D 3ZK9A 4EHKA 1T36A 3NTLA 2PH7A 3SLDA 3CNOA 4PS1A 4BFZA 3ZDDA 4B7UA 3FOCA 4U39A 1RHKA 2ICAA 2AN5A 2FN7A 2WZQA 1ZAKA 1Q15A 2ZSBA 1Y34E 3RU7A 4OFXA 3ADPA 1ENZA 2ZRFA 4J3JA 4TS3A 3W05A 3WJAA 5MN4A 1FDUA 3H5RA 4KQGA 1CEQA 1Y1RA 2ZSAA 3R8XA 4RABA 4K6HA 4GVPA 4LTDA 4II3A 2BHRA 4G5RA 4OM7A 4PGGA 3VJRA 2P2LA 4NZ9A 1PQUA 1IJKA 2YCBA 3FTQA 5CT5A 3EQ9A 1R9MA 1JKIA 3BTSA 1A96A 2HOQA 4XM2A 2YWDA 1AKQA 2GKGA 2XNCA 2W2QA 4HYYA 3P2MA 4JA2A 3Q9SA 4KE6A 1JUDA 4LYAA 3UTDA 2HA7A 4BQRA 5IBCA 1TIPA 4FSDA 4M7OA 1PR6A 2MU1A 4DDVA 2DTDA 3WDLA 1YASA 1GKKA 2GEVA 2QP9X 3HMQA 4F5EA 2WZNA 3JPYA 1CVIA 3JQ8A 4I1VA 3RI3A 1KK2A 3IDOA 3EZ9A 3H4MA 4JT8A 4QUEA 5IARA 2EYQA 5JJCA 2I80A 3KPYA 4O3MA 4Q9IA 1HG0A 5L9AA 2P4UA 1G9XA 2YXLA 1KEKA 3HYRA 1XAJA 4YQYA 1QOZA 4MPDA 3CLSD 2VYVD 2QNBA 1G6HA 2KBEA 2QM7A 3PA8A 4OK6A 2YQZA 1R3DA 5JW6A 2A94A 4J7XA 3EMBA 1ZA2A 1PWEA 5FEMA 4WOKA 4QYIA 1H1TA 3ZWYA 4EK9A 3VDQA 2I66A 3M1IA 5JSQA 5K6TA 1XRPA 1EK0A 2CDNA 4R51A 5BRAA 4XQGA 3IALA 3TH5A 4B35A 2QN2A 2D1QA 1R7RA 2VJOA 2YCLA 3WLMA 4D3YA 2J4DA 1L8QA 1U28C 2FZGA 2XUHA 4R9NA 4XA8A 4Y6OA 3ZHCA 1YF3A 5A62A 2VAVA 4X7BA 2G17A 5I5GA 2WG2A 4RVNA 4YCDA 2YXNA 1RIFA 5A7FA 1ESCA 2PLNA 2OAGA 3E1KA 2PZ8A 2TMYA 4OQPA 1RJ9B 2QGFA 3JR7A 3PPXA 1Y89A 2XE7A 4P08A 2P0AA 5AK0A 2Z56A 1YR1A 1HQYE 2ZI9A 2LR0A 2ODAA 3PUWA 2CSXA 4OHVA 1JYSA 3JR3A 4Q3OA 5ES4B 4UMFA 4P6YA 4HT3B 3EE6A 1V26A 3G82C 2PNFA 3KJQA 3AHHA 4IGFA 5CM8B 1TAHA 2QIPA 5TX7A 4LDAA 3TINA 2B4KA 4FFMA 4D6XA 4RTPA 2BGKA 1SC9A 2LDBA 2GRUA 3CTMA 4ER3A 3EUWA 5U9CA 3T3OA 3OE7A 2C29D 3DE3X 2E87A 3KB8A 3ZY2A 2E4VA 5BQ5A 4QU8A 821PA 1KNQA 3TLEA 1L0BA 1NP3A 1DVRA 3AERA 4QTXA 5JRZA 4P0TA 4NBUA 3K9WA 4E14A 1H93A 2QG4A 3T38A 3U6BA 2QRUA 3AUTA 4P4UA 1JU3A 1Y7HA 3BWVA 1UFOA 3IRVA 1S3SA 1YXMA 2WOOA 3A37A 3JASB 1J0CA 3EXHA 3N2LA 3E9DA 5DBEX 6CHYA 5AW4A 4OB7A 5IKXA 3DHEA 5BVGA 4MUNA 2O3JA 3T7JA 3SIRA 2AEMA 1QFMA 3HU1A 4A8JC 4O4JA 3GIWA 3AV0B 3CZ9A 5K3OA 2HK6A 4JLWA 2VFAA 3GWGA 5EUBA 4UHJA 3DG9A 2H9YA 1N06A 5AW9A 3IAUA 4DJFC 1XTRA 4N7RA 4L50A 3E7WA 3BTOA 3SS9X 1T9KA 3A3NA 3PVCA 4XN0A 3DKKA 5T6MA 2HJ9A 5J3JA 2L18A 2IGBA 3GFOA 4CKWB 3SZRA 4H7HA 4MKFA 4QVAA 3AVUA 4OUKX 4CEIA 3EQ2A 1C30A 4NEHB 3D31A 3FSRA 3PQEA 4L6IA 4Y2PA 4UCWA 5G4KB 3D6AA 3TLAA 4GEGA 5JNRA 3OM0A 4RZQA 5K9ZA 1SGWA 1NVVQ 3FDIA 2DH5A 5JSFA 2FEKA 2LD4A 2H7CA 5LDHA 1DJNA 5EJ7A 2VG8A 5F3DA 3ONEA 3F4LA 2QMEA 2ZYWX 1Z5PA 3BXOA 1SKBA 4OP2A 1STOA 2CGEA 4YRTA 3LUFA 5CA0B 3MM4A 2UZ1B 4J4HA 4C0LA 2VHVA 3QE4A 4G8DA 4TL8A 4CT0A 7MHTA 3H7IA 1ZD5A 1PGJA 1NLYA 4XFKA 1F1BA 1H3NA 1K68A 4FR0A 4KSBA 5CP8A 5EESA 5FUBA 2ERYA 2H2IA 4C2AA 4HNGA 1D6NA 4DLSA 1UAAA 5B4UA 1TM3E 2FMTA 4QUIA 1J56A 5AVRA 1W87A 2IEAA 3C1AA 4RADA 4POOA 2CL6X 3ISTA 3C3BA 1HOTA 3CG4A 4YUXA 4I8XA 2CJWA 5C37A 3CWCA 3ZWVA 4AJ1A 3P94A 4V0SA 3V8NA 1Q2XA 1UXHA 3WXBA 4JBWA 1RJDA 1RXEA 2Q2QA 4PRZA 3DLCA 5ED0A 4BWFB 1YJBA 2FSSA 5D6NA 3V9AA 4IHQA 4B0OA 3P0HA 4WUVA 2PYZA 3H9CA 3G5AA 3JARA 2CXPA 4M76B 5DGDA 5DP1A 2ZWAA 2PX4A 1ACJA 1GGFA 2DPXA 5BPHA 4P0PB 1HKUA 4D25A 1EUCA 2HHHB 1U1GA 2R97A 3A4YA 3EFHA 4Y2VA 3THSA 4N9WA 2GKSA 3F3KA 2V74B 4BU1A 3VYSB 2B30A 1IMOA 2PT6A 4GBJA 1MQAA 3I9JA 1AKUA 3TI9A 3HTXA 5IZCA 1C1DB 5T4HA 4BGIA 4UAJA 1TECE 2P77A 4MAAA 4QJ4A 2GNOA 2KM1A 1JALA 3E3MA 1OIXA 3PC2A 4IICA 2YXEA 3IUJA 4G0XA 4KRXA 3M9LA 3QKUA 5BMVB 3M5PA 4NE9A 4KYTA 3W8EA 2JKYA 2EKDA 1E77A 3OO0A 1VC2A 5JWHA 1ZD1A 3DAHA 4BMSA 4EHLA 1A9TA 1NF3A 3UVEA 4ENSA 2VQEB 1NBMA 2WHPB 5DT2A 4GC5A 4XI9A 2FWRA 1RQPA 1EQAA 4YLEA 2P2DA 5FADA 4F93B 1DC5A 1OYWA 3IOBA 3UFXA 3RAFC 2AW3A 1FRNA 4I50F 4ZD6A 1G1AA 1RJWA 2EWMA 4MCIA 1DXQA 1U7XA 4AN4A 2IOHA 3ZNOA 2P5TB 3H42B 3EVTA 3I0NA 3BL8A 3OOCA 3OPYB 5AKYA 1UOEA 1KJQA 3RRMA 3DMDA 1N2OA 1P2SA 5D8DA 1U0SY 3GAMA 4GX0A 2RAVA 2E49A 3VU1A 1S89A 5AW3A 1JJAA 1O5IA 1UKVY 1RE0A 3GOHA 3E15A 2GCEA 2WKPA 3VC1A 4Z1MD 3JD4A 1LFAA 1DHRA 1BLIA 4EX7A 4OM8A 5FPSA 1IN6A 1L7PA 4RV9A 3R7BA 4GEKA 1WLYA 2P62A 4I36A 3E18A 4UU1A 1QPBA 3L7IA 3ND8A 3H2YA 2FZVA 4QXPA 1NXSA 4WOJA 3PJGA 3JVUA 4UU8A 1TMGE 3OHPA 3S81A 4MV7A 1R4MA 2Q8PA 1BD4A 2VJMA 5HGJA 1QHSA 4CDMA 3WKAA 2TRSB 1I7DA 1VYVA 1BQEA 4OH1A 1ZN2A 1I6WA 4DVGA 4CETA 2PL3A 2I6FA 2Q4DA 2CHFA 3I5MA 3D7MA 3A4NA 4HGZA 5TE9A 3PUVA 4UBKA 4GO1A 1ZISA 3IEVA 2PR2A 4NMXB 1RLMA 3WLLA 2PEZA 4G6IA 1DCTA 1N08A 1JQBA 3K30A 5KQRA 2G72A 2GLTA 3IVRA 3OTIA 4FZRA 4CR8A 5CDTA 2O5CA 1YC5A 2NO1A 1WULS 5KBYA 3H9NA 1CR1A 1QHHA 5COAA 3PX3A 521PA 1DMSA 1LI5A 4FMCF 1XPOA 2C2YA 4MINA 4R6WA 1AKTA 2LCFA 1RRMA 4CMIB 3R7WA 4IGKA 1I1NA 4L4SA 3DEYX 3BRWD 1H4TA 2XOKD 3KSMA 4JKOA 4NQZA 3E1YE 3GEBA 3M2PA 4J2HA 4RKYA 1FA9A 2PU5A 3ZGVA 3OPYA 1F2UA 1T8WA 5DWDA 2CVZA 4MQEA 2F59A 3NW9A 3ZCPA 1F7VA 1A71A 1F6DA 1N6PA 1XPUA 2NU7A 5I9TA 1XTTA 2IYXA 3PYXA 4HDAA 1DRUA 2ZB3A 1ZSYA 3SR4A 1UMBB 3H2IA 4QVKA 4EQ6B 3BC9A 1D2HA 2PWZA 1MCZA 4KWHA 3NC0C 4BLQA 2RBGA 3KZOA 3U9LA 1E2BA 4YEJA 3LIIA 2W9XA 3BJMA 5JFOA 3VHLB 3C70A 5CDFA 1HXHA 2I2XB 1FIUA 5LKAA 4WXMA 5ENZA 2XVXA 4XR4A 4DLRA 2ENWA 3IDSA 5I4CA 1XDBA 1FMCA 3PFGA 3PNLA 4O2BF 4ZMBA 1U7TA 3TXXA 1Q19A 1WCWA 4X0EA 3T9EA 4FILA 3DJYA 3VR5H 4UM9D 3PBKA 3S2YA 1D7AA 4IUDS 2B4QA 5SY4A 3VX3A 4OFBA 3GEMA 1Q86D 4OQZA 4LC0A 3MJ4A 4RE5A 1AGXA 1MAAA 3OQIA 3QXCA 3R74A 4YRGA 1VLMA 2GNPA 3PNPA 4M8LA 2CNLA 1E6UA 1Z0AA 1WQ4A 3C7TA 3OEYA 4LY9A 4DRYA 3VVBA 3WJ7A 2BJWA 4JOQA 2NNWB 2P7IA 1ULSA 1XTZA 3EXHC 2FFQA 4LSZA 1NYLA 2ZCVA 3OPOA 2X9QA 4QDOA 3HDJA 2QY6A 2ZRMA 1KO4A 3VZCA 3INNA 3LX4A 1KDRA 2VPQA 3MQFA 4DJTA 2O7QA 4HQOA 2ERCA 2MTBA 4YMGA 2NVOA 1T2CA 1QVGB 4C0KA 2AZDA 1JU4A 4B3XA 2ACWA 3L8DA 1V48A 1TTHA 2P2NA 3QU2A 2O0MA 2JAOA 2WTXA 1UPFA 1DP4A 4PC6A 1G4HA 1TJYA 3C3AA 4JXKA 4X1KA 1HMYA 4PPFA 4Q9KA 4ZDJA 3T94A 5JMWA 1IZZA 2A14A 2BFCB 3FAZA 2R6HA 2VRWA 3EASA 3HCBA 2PSEA 4HXEB 2PGLA 5LOVA 1TYCA 3K0AA 2PT9A 4TRJA 3UPDA 1WPXA 3JD2A 3KKEA 1P1IA 2QVCA 4JLOA 1WOYA 3W5IA 1D9XA 3I45A 3R6JA 2AOVA 4KLRA 1KWKA 4BN5A 2D3TA 2B8TA 1P1JA 3GJTA 4B45A 3OA0A 2GK3A 4Y9TA 3B3JA 5FP0A 5A4FS 3KR9A 3GQBA 3OPVA 3TG2A 4OQXA 1SUFA 3GU3A 5K3DA 1ETHA 6LDHA 5A4DA 5LSAA 3LTEA 4BV2A 3BXEA 3KJEA 2HRCA 3ZD9A 5GTDA 4H16A 1A72A 1K92A 1T15A 2IXGA 3DYIA 4X1IA 4F9FA 2E2WA 3MCWA 2GZ1A 2OMEA 3DFMA 2R8RA 5AFSA 1FNMA 1DC4A 1Q91A 1U7OA 3KUDA 4XFJA 3T4PA 3WO1A 4EZIA 2FPPA 3U09A 4BFXA 2P35A 1TYAE 4PYNA 1JLKA 3T5GA 5LYJB 3P2KA 4RLZA 1JS1X 1FFCA 3V4PB 2G9RA 4NWIA 2CF5A 3EIUA 3VR3A 2OCLA 1BKDR 4NZOA 4B6EA 2AG6A 3GLIA 2ZZMA 3BQNB 3GHYA 3WK8A 4B76A 4AKHA 1Z5ZA 2G3YA 3G2IA 4MQFB 1G21E 5I7VA 3UYLA 2NAFA 5BORA 1EP9A 3KNZA 5EMMA 4LGVA 4K26A 5GPBA 1A2KC 1EQ2A 3DPSA 4BTEA 3RTBA 1E1RD 1UC5B 4MW9A 3PGMA 3WQBA 1GG8A 3BH7A 4NJEA 1GZ6A 1Y7PA 4MLPA 4BQIA 1L1QA 2HF2A 1KP9A 4PS0A 1XDWA 2ENUA 3BRCA 5HCNA 3TF5A 2FMFA 1EXWA 3RTGA 4BNJA 4EFDA 4TKZA 2P68A 3C14C 4CQMB 5CTJA 4N48A 4RLHA 3IUSA 4D4IA 2ZYIA 4OSOA 5JDCA 5L4NA 3ONUA 2A1TS 4MV3A 1Z7BA 4BN0A 2WD7B 2ZRQA 1B2RA 4YCAA 1ZW6A 2V7VA 1IWOA 5KC9A 4IDCA 3NBXX 4PN7A 2GPAA 1MC5A 1VQ5B 3KVYA 4QXMA 2R00C 4DV5B 2QRPA 2ZIVB 2DJ5A 1DXHA 5HNKA 1TMKA 1HDCA 1PU2A 3E0QA 3G0HA 4N3NA 3DZJA 5DGCA 1Z8FA 5KQGA 2QRNA 1RP1A 2BFBA 4YIHA 1LB1B 1L5YA 1S7GA 1ZICA 1C8VB 2ZI5A 3FF4A 3QF4A 4LRUA 1U9IC 4X1YA 1OH8A 4B85A 3NBZC 1E2HA 3QU7A 4ZI7F 4BKMA 3TG8A 1E8DA 1BCRB 1QFSA 2PXHA 1E32A 3OQPA 2IGTA 2Q5EA 2Q9CA 4OI4A 3GW8A 5LQKA 1U2TA 4RU1A 4S0ZA 5A9SB 2XJ9A 1FDTA 1ECJA 1P29A 3ILYA 4KWEA 3AY3A 4PLGA 4WLUA 2Z43A 3LUDA 1HMPA 5AUQA 4XRRA 5F52A 1YB6A 4A0QA 3EHDA 2ILTA 1SBIA 2EJVA 2FPPB 2PS9A 1V16B 3EG9A 4LXGA 2UUAB 3O4IA 4JOBA 2EGGA 2UUOA 3CJQA 4PPYA 2NYUA 1P2TA 1XRNA 3LCCA 4ZEXA 2WJ4A 1YJ5A 1OHHA 4O1IA 4U8GA 4ZCMA 1BA3A 1RVDA 1QDUA 2O2JA 4OGFA 3ROMA 4DIFA 2BEVA 4UUAA 2PCLA 1ZWKA 2J67A 4AZSA 4LNUB 5EXTA 3RS8A 4YUAA 4N76A 1T5OA 4M60A 4OMCA 3PKJA 5EUCA 4LFCB 2OK7A 1Q22A 1DKPA 2RSLA 1YQDA 3MCZA 4JKIA 4LRWA 4MLDA 1QP0A 4OYRA 4TTIA 4IO0A 2EC5A 1NUSA 3QOYA 4ARAA 2O0HA 2X23A 4DNXA 1JF8A 2Y9PB 4UMEA 3G2KA 3NDRA 4GRAA 4JT4A 5CNKA 3CD6B 1E4VA 2IP4A 3GMTA 4M4SA 1B8UA 2B36A 2ZIFA 3M82A 3KELA 2D5IA 1M34E 1N2CE 2EGUA 1J2UA 2VT3A 3HYTA 4NPHA 4O29A 2IODA 3R9IA 3IEMA 2AR7A 3V7WA 5JSYA 2FW8A 3GFPA 3NHJA 2KVOA 1RS0A 1Z2PX 3WLEA 1L5ZA 3VNBA 1NP7A 2RH8A 2ZLBA 4OTZA 3DZFA 1RCFA 1N3IA 1BGXT 2OFOA 2GB4A 3VMMA 1N2XA 2YHIB 1BE0A 2MYNA 2IHZA 1NTRA 3HWSA 5J1SB 2JKZA 3AX6A 1R0YA 5CVDA 4JYAB 2VHTA 1FYDA 3DHWC 3SIPA 2HJHA 1V3UA 3FHLA 1NPTO 4OXYA 2QQ5A 4RM2A 4EKGA 3GVCA 3K5PA 3L01A 1EVZA 3L8EA 3ORQA 4MB0A 3WL3A 4B3CA 3RD5A 4B7AA 5E9QA 3ZZUA 2Q50A 4GD3Q 1NAIA 3S28A 4DMUB 3ECAA 4CMAA 4LHYA 5A03A 3ZY6A 1C0IA 4OP3A 3LP5A 1RAAA 2IYLD 3GFTA 3ITKA 2G36A 3OCXA 4WINA 2F9FA 4DSNA 4PONA 1PFVA 4YPFA 1C0KA 4L27A 4D3FA 5BP7A 2ZT8A 1SOUA 4EY4A 5IHXA 3MMXA 1NLMA 4H27A 1MO2A 2HDHA 2V7UA 4MVJG 2DPGA 1ZM3A 3R1IA 2JIZD 1KI6A 1IH8A 4BRZA 1F0KA 5EJ5A 1WPCA 4IXWA 1HTBA 3DO6A 3C98A 4GLLA 4FCCA 2XGJA 5IDVA 3PVZA 1ZM2A 1JEEA 1LKZA 3Q7EA 4J9UE 3OBBA 1AC5A 4U2BA 4JC4A 4WRRA 2XAUA 5AK4A 5AKLA 3PVDA 1G7CA 1SBCA 2D2FA 3RJ5A 3OCYA 2IXEA 4F7DA 3SDZA 1DX6A 5DM70 4PGHA 2Q5OA 1GNPA 3QBTA 4JR1A 4YJ3B 5EWMB 2HA2A 3BS4A 4KGVA 3KAJA 4AZ0A 2X2OA 3ANSA 3I1IA 2C5FA 2QB5A 5JJ5A 4C08A 3ZUPA 3K0SA 2J9GA 4E3WA 3ZY3A 1F14A 3FPSA 4DUPA 1YUNA 1Y42X 2AC2A 3L43A 4QUDA 2GN1A 5JSZB 1BMTA 1KBQA 3OQHA 4RDCA 3H2GA 4EYEA 3HJTA 5B3JA 4ZO9A 3DH0A 2FZCA 2ZBEA 5DO9A 5CFNA 5IJ0A 2GBFA 3VFDA 4NG4A 3RIGA 1RAHA 3K0EA 5IJWA 1T29A 7REQA 3WKDA 4G25A 4FDUA 5SZJA 2BV3A 1WVIA 3Q9NA 3CCFA 3GL9A 1IG3A 1L4FA 3OLZA 3QFHA 2NVUB 5FOQA 4NU5A 1T6XA 4BO2A 4CMHA 5J58A 2N42A 3E8SA 2IEDA 2UYGA 2CZGA 2IPNA 3F5FA 3NHYA 1SXJE 4O8ZA 4RHUA 3EZGA 4RF4A 1TKAA 2DWOA 1CV2A 1UXKA 3GJRA 3OZTA 4MS3B 5E8JA 3P9ZA 1N2SA 4M9XA 1CY1A 5HBRA 3AM3A 5IKEA 2XMCA 2QG6A 3I30X 4B3HA 2IX3A 3LTNC 4JQCA 1SOAA 4M0CA 5FUVA 4BCBA 4FB5A 5IYQA 1K0UA 4OQ4A 1G5HA 3EX7C 5DEIA 3T9CA 2X7JA 5H9VA 2HZ7A 3T61A 5YASA 5CEEA 5L7WA 3V76A 3EGDB 4ZYZA 5CYPA 2VNJA 4PRLA 1AKWA 1MP0A 3PE6A 3WB9A 4ZICA 1O94C 3EQ7A 4F9GA 5KS2A 4HX5A 2DG2A 4QUHA 3SFVA 4G09A 2YIMA 1JAXA 3CO5A 3D0OA 2BCGY 1QK3A 2ZOSA 4I99A 3Q6QA 2XAAA 4OB8A 1YS2X 3WLKX 1ZVQA 5F2NA 1NUUA 1L8LA 3AQ4A 3G2PA 4IDQA 1FP4A 3JALA 4JJ4A 3KLNA 1K6JA 5I9NA 1XZKA 2E1PA 3A4IA 2E4WA 3OEED 3TFQA 1QBKC 1Z17A 3C74A 4NCNA 1C9EA 2JVJA 3CIFA 3HJRA 1VIDA 1Y7IA 3C7DB 3MUOA 4MW7A 3U7QB 1I4OA 1QG6A 4HWOA 3T34A 2QV7A 2ZJBA 2X8JB 3ESYA 3L04A 4YWHA 2BDEA 3WQQA 2NX2A 4I46A 2J6HA 3GARA 3N28A 1UBSB 1J1IA 1PL6A 4X92A 3UAYA 1S2LA 3L1KA 2O3UA 2K4MA 3W5VA 1OY1A 1WD5A 3IDZA 3NUZA 4I4IA 4L9RA 2DZDA 5F1KA 4WVFA 1XYYA 4KQ9A 1DIBA 3ILSA 4Y2QA 2A9PA 1XDUA 4PZCA 2HDNB 3RUCA 1CDOA 2L82A 4IGEA 4XH9B 1Z6ZA 3VTAA 3X1YA 5KVCA 1CJCA 4WXEA 4QX6A 3T0FA 3SLGA 1GHTA 2AXNA 2Q7DA 1NVUQ 4OATA 1TD1A 1P45A 1RWQA 1IBSA 2HBQA 3T5MA 1ACMA 3MLBA 1CQIB 1W0CA 5K03A 2EL9A 1R6AA 3DEFA 3L0DA 1HTWA 4RM3A 2HM7A 1T1JA 3BE6A 2P6PA 3RUPA 4RD3A 3HYLA 5AOCA 5K01A 4MP3A 4QYTA 3U7EB 5FLXA 3AC0A 1XZQA 2IYTA 2ZVQX 1CUJA 1JTEA 1E9DA 3HY6A 3NJRA 3GAAA 4GYKA 1S2IA 2OBLA 3BMNA 3HHPA 2W83A 4QPPA 2WYWA 4EUKA 3IQZA 2PPVA 5TJ9A 4BCCA 4BO5A 1NY5A 1M5TA 1ST2A 3Q5DA 3PJDA 5BNTA 4HCJA 4LBYA 4BZXA 4V0ME 1NM5C 2Q62A 4JL8A 5LM3A 1SK9A 3A10A 1UDWA 3O9ZA 4OAQA 3CGGA 1GU7A 3G8YA 3WBBA 4M1QA 2FJPA 3WBJA 1EK2A 1QQAA 3QBDA 1YMQA 3RBAA 4KNYA 3B82A 1E2GA 4B75A 4ALKA 2IDJA 1MTZA 4IMRA 3WL7A 1JR3E 2WC1A 2P7HA 2VPYA 4U7JA 2AMVA 4ZT7A 1R88A 4DW8A 1WSWA 1P0MA 3BJRA 4PO1A 4B87A 2WF7A 4G5XA 1NUQA 5JNLA 1NLZA 1YB1A 3DOFA 3W6ZA 1DUVG 4AICA 4QQFA 4DNFA 1Q6ZA 4R8MA 1XP8A 3UHFA 5HA5A 1F2UB 2PQ0A 2XBMA 4KLZA 3F2VA 3OZEA 1AKRA 2X3YA 4M83A 4NENB 3BC1A 1OJ7A 3RU3A 4N7BA 3SZ3A 4C4OA 4OXRA 2XUZA 2BTEA 3QPAA 5CEJA 1O03A 1W25A 1P4SA 1OXUA 4RXTA 4ZAYA 4MUJA 5G3ZA 3W1VA 1JPVA 4OLJA 3A3KA 5KYXA 4CEJA 3NBFA 2X77A 1RBMA 3QH4A 1AU9A 1V1MB 2FZ4A 3IOEA 4UEJA 4BLRA 1B7GO 2CUZA 2YKGA 4GPD1 4ND8B 3BEDA 4IJQA 3M4YA 4UFOA 2O8DB 5EKSA 3D59A 5TRDA 3CE6A 3I73A 2FUG1 2B7BA 5KVQA 2ZETA 4BO0A 1A82A 4IIJA 3DKIA 2LVBA 4N8EA 4B74A 3TOXA 1CF9A 1F3LA 1XU9A 3K9BA 4MXDA 1RADA 5FOTA 3BMXA 1Y4UA 4WCFC 1ZBDA 1VB3A 3OTOB 3P9IA 2VLBA 1YGYA 2A9JA 4Z9AA 5DLPA 1K3UB 2R60A 3L7YA 3HVIA 1B23P 5EP4A 5LQJA 2PT7A 3LBIA 4WK6A 4MVJE 2HQ1A 1GAQA 2PXAA 4MYSA 4CM3A 1ZXLA 4M1TA 1NR5A 1VIYA 1F0PA 5BSUA 2QD3A 3FH0A 2NTEA 4ER7A 4DL9A 2IHVA 1G7SA 4KX3A 2NSHA 1J00A 3WYBA 2EJWA 3GJYA 4PSDA 3R8CA 3HCEA 1NUPA 5D2CA 3SC6A 4F1JA 1VPWA 1P4RA 3P45A 1T4CA 4GVXA 1ZK0A 3PV0A 4WX2B 2FP3A 2GQFA 4XN3A 1VYTA 1SD2A 4OBEA 4ARZA 4XQFA 4FOPA 2F4NA 1THMA 1KZLA 3ZVLA 4S2EA 2HJRA 3U3RA 5A0TA 4N54A 1H2BA 3CZAA 4S2UA 2TMGA 1U8AA 4DREA 3TMYA 1T9GR 1XQ9A 1PGPA 2N9UA 1IXRC 2P1DA 4J91A 3BZBA 4LE0A 2UUCB 1SBNE 3A6PC 2JGEA 2ZJ7A 4AM8A 2G4LA 2GTIA 2O2DA 3ELWA 5E3IA 3WP0A 4DS3A 4DVJA 1YFLA 3G5UA 1D2RA 3BX1A 4BV9A 4Q21A 1G55A 3E2IA 4CLOB 2D6FA 4G4SO 3PQ7A 4XVHA 2Q1TA 4AKTA 5A5GA 4XB2A 3NHAA 5B6JA 1W0JA 4QBTA 4O2AA 4QRDA 1YIAA 1GAEO 3QHAA 4UU7A 4WA7A 5BRNA 2OO7A 4QO7A 1QJ4A 3ZH2A 3TWOA 1NXXA 3VKVA 5JH7A 3M9XA 4OL0A 4U2FA 4Y3UA 1MVOA 1N5OX 3L7DA 4YUVA 4ZHQB 1D8TA 1Q17A 3AEQA 3AL3A 3FUWA 3OD1A 1RYBA 2HXYA 2ZZQA 1YRHA 1VQ6B 4DDTA 3G0OA 5ALKA 4OA8A 3BZUA 3TDKA 2FW1A 4C1BA 1ZRSA 3QFRA 3EZXA 3UATA 4F2PA 5L4LA 2ZUWA 3DWIA 3KOMA 3F6EX 1BFUA 3UKDA 1ULUA 3L6RA 1A95A 1JR3D 4RGQA 3FTNA 2NU9B 2R4UA 3QE0A 2VHUA 4DARA 4IDDA 3W5BA 3P27A 1QH1A 1YA4A 5G53C 3ZWNA 5L4SA 3R9XB 4HN9A 2ODNA 2REOA 2XF2A 3Q7SA 4B3MB 4HMPA 2FUNB 3FVTA 4QOFA 1IVYA 1RAGA 1IHYA 3PQFA 4I9HA 3UHJA 4J0GA 1JR4A 4U9IS 1QQTA 1NL3A 1QIMA 1RM3A 4QTTB 3ER8A 3H8WA 4C05A 4CWAA 4DMLA 5JAOA 2XB8A 2I34A 3STXA 4B4VA 2UZIR 3G9XA 5EXSA 1JL3A 1WB4A 3KL4A 1XFDA 1VKZA 3KR0A 1CY0A 1Y8QB 3EXFB 4TRNA 4HDSA 4QU9A 3SQDA 3AUSA 4C0WA 4DABA 2DHEA 3I28A 4YUZA 3OOSA 1VDMA 1Q7YD 2BGNA 2DFDA 3FPGA 4X63A 4FDTA 5TC4A 3ZBUA 2YXPX 4FEEA 4ZIRA 3NVKI 1ZIOA 4Z4ZA 2E89A 2QSJA 5B1YA 2Y8EA 1P61B 3ROPA 2OBSA 4B4KA 1PYGA 2DQZA 4Y1GA 4TYWA 2CLKB 1W5BA 1WWKA 2ZRHA 2ZS8A 2D9RA 2SKEA 3V7FA 4N12A 1IOZA 4XPIA 3VU9B 3HJGA 4NHOA 1I4TD 5CAEB 3RSLA 2IZZA 2K7ZA 4Y7DA 1UC9A 3IIMA 2JCVA 1WZ2A 3RS3A 2RBEA 3QEJA 5U4QA 5F7ZA 3RF6A 1NV8A 2WU3A 5D5PA 2OP0A 4ISCA 1V5VA 4M8SA 4EVIA 2QN6A 2JGDB 2BJVA 4FZVA 4TL7A 1W93A 2J9FA 1RC1A 1L7VC 1LTQA 5CXSA 2VF5X 3BGIA 3C5EA 3TAUA 1VSQA 3LKVA 3WKCA 3PA1A 3WDSA 2WFAA 3E5HA 2ZIXB 4JFRA 3PEFA 4YALA 1N5JA 5FBZA 3WQHA 1K9VF 3EOZA 4CDNA 4Y2TA 2WZCA 4G8CA 3GFQA 4YJFB 4YCCA 5CXUA 5IDXA 2C77A 1MQ8B 2GVNA 5LA6B 1FEZA 5IBRA 3CLRC 1YKGA 2ZYGA 3KYCB 3PLRA 3DUFA 4OYLA 4P5PA 1I1OA 1QHNA 1AS0A 3QKSB 2GD2A 4ZPXA 1CY7A 3MWLA 1N6RA 3NJ4A 4IJVA 2N3ZA 4JENA 3H4VA 1ST3A 5T4BA 3BIWA 1J23A 1RM0A 2ZULA 2GH1A 4NG5A 4LYGA 4AG3A 4OXXA 4WERA 1YDHA 1ZHFA 3PSAA 4JBIA 1GUZA 3H1FA 1MB4A 5B1IA 1K4KA 2ZGVA 1YCFA 2JJQA 1NW6A 2QXUA 4PLWA 5TQ0B 1FXUA 2PJDA 4NDAA 3CCRB 2VZ9A 5HFJA 2WB2A 4DT1B 3B3FA 1LSJA 1OFUX 2BHSA 2WWGA 3GGGA 1C4WA 4G24A 3EXIB 2R8XA 2DKNA 4X6XA 5ERXA 4BX0A 3LDFA 3G0CA 1EJ2A 3AEKA 5C4IA 4KQCA 1H2RS 1FQJA 4EYGA 2HSEA 3HP7A 3SQWA 5TARA 3KQHA 4ABYA 4X97A 3ASSA 3O8LA 2BH9A 5I01A 3P0IA 2AI3A 3GVHA 1TW3A 4Z8YA 2OHOA 3J81k 3HU2A 2NPIA 2XD4A 4MO9A 4NZNA 2QW0X 4BRWA 1X80B 3PHBE 1LSUA 3L93A 3GLIB 1RU3A 4M22A 2VBGA 4WZ6A 2EFDB 1W5AA 1T8PA 5ALEA 1P7YA 3ICCA 4RPKA 4UHEA 5HBGA 3WO0A 4QUBA 3AJAA 3CQ9A 4L7QA 1MH9A 1LVUA 1V5FA 4NARA 5KVAA 1CEYA 2V3WA 3KR2A 1WPRA 5DLEA 3QNWA 4KFRA 3AVPA 3SJUA 4OUDA 4DMRA 2WV9A 4JQOA 1QGZA 3M6UA 1QYVA 3QIVA 3I53A 3I72A 1BMFD 2Q3DA 4XVRA 4YV7A 3IR7A 5SZKB 2B99A 1HGXA 1KXZA 3QYAA 4KE7A 4RH3A 4S35A 3RUDA 1NQXA 1ZOSA 2PUTA 3F73A 1D0IA 2H48A 3A1WA 2Q5QA 1HZEA 4ZU3A 3X1DA 2BP7B 2W2MA 3KIPA 5DYTA 2XMBA 2J48A 4JB8A 5EIBD 4ZJPA 4MWEA 3AVTA 4ZC8A 5FPTA 2I7VA 2ZDHA 1NKTA 5IDQA 1L9KA 3JQ8B 4DCPA 1T43A 3R3ZA 2P6NA 4UULA 4PYOA 3REGA 1AK9A 2B69A 1UQRA 2XSZA 5K8LA 1W4RA 3TD9A 4D9JA 3F74A 2PGAA 5IBQA 1U9CA 4BX2A 3OZ7A 4KUHA 5DBGA 3SDSA 4IHJF 1H94A 2YVLA 5DS0A 1MIOA 3FROA 5EGNA 2VHWA 4X95A 1J8MF 1C1DA 1OQAA 1ZH2A 3QU5A 2C5EA 1CB7A 2QTWB 4D8WA 2ID9A 1K1EA 3HLKA 1IE3A 1E62A 3JYNA 1E3JA 3V2IA 4DGQA 2BZ1A 3SFTA 5CLIA 4MGKR 4OMFG 4H9GA 4ENTA 2PAAA 2PD6A 4M1KA 1CQJB 3SM9A 5CIYA 2JLXA 2IRWA 4H1TA 2Z08A 4FC7A 4K3UA 3K70D 4S1PA 1ATZA 1YHNA 1F2TA 3RROA 2VK2A 2PSFA 3N59A 2D2VA 2W71A 3TTTA 3PR1A 4V1CI 5DTJA 3LXRA 3V7NA 3MBIA 4D5GA 4B80A 4XNFA 5EXPA 3S99A 4Q9DA 1Z5VA 1E1LA 2Q41A 2IE0A 1ZGHA 2ZRPA 4G5QA 1OAKA 2R65A 1OLXA 4BQEA 5LZ9A 5TEWA 4BO4A 1ABEA 1J1UA 4QOSA 2DIEA 4F72A 4UEWA 1CWUA 3RIMA 1CIJA 1DPGA 3LC7O 4YP6A 2EG5A 3V8PA 3QVMA 2R1TA 2CHGA 5BUZA 1GTVA 1DQYA 3CUTA 2WVGA 2GERA 5AI0A 5D5QA 1DJQA 4PO8A 4Q3CA 4QOGA 5CH3A 4Z5XA 4PFQA 1PR9A 2QE6A 3A70A 3D3WA 1YJAA 4UE6A 5GZ3A 4Y9SA 2WZPP 3RIHA 2GZMA 4LAFA 3WHLA 2RGDA 2JFGA 1G5RA 3L0OA 1KOFA 2YDYA 3A6GA 3F98A 2LCQA 1T1RA 4X07A 3NBAA 2XE8A 4Q6WA 2IU6A 2R6R1 1XLUA 2F6RA 3IURA 3IAFA 1PT6A 3PWZA 4F9EA 1LPOA 3BXHA 3G05A 1M1YA 1NXQA 4O08A 5AM0A 1R6UA 3EUAA 4EJSA 1DDGA 4RH0A 1JWBB 3T0GA 3ONNA 5C1DA 1F06A 1J09A 5K3SA 4EPYA 2GPJA 3AXSA 3TEMA 2FSVA 1CRWG 3GPIA 3MWGA 4EVQA 4CM8A 2O2HA 1OYOA 1XTIA 2AA3A 3ENWA 4YP7A 2OD9A 5C34B 3VKUA 1YZQA 4N5DA 1R6VA 1NWCA 4RKEA 3VH4A 4EB6A 4OIFA 4DIUA 5KOJA 5EJ2A 3HLYA 4ONEA 1IY9A 1O94D 1MB9A 2J7KA 4MUIA 3BAZA 2ATCA 1ZN8A 3REFA 2PUWA 4XM3A 1GZUA 4CCYB 1WMAA 4R8SA 4F6LA 3OHMA 1POWA 2Q3MA 4ZI7B 3WLHA 2LV8A 4QPNA 1YDMA 3FF1A 4ROXA 3D1VA 3A1TA 3K8YA 3V1UA 4GPZA 3DF9A 1QVWA 3QVGB 4V24A 2ZAIA 2ZI3A 5FLEX 3S2EA 5CAEA 1L7MA 4X71A 2CCKA 2QN3A 4CE6A 3GHHA 1KJWA 5JARA 3P9SA 4DIOA 1US8B 1XEXB 2YJNA 4MGIR 3LGXA 3MC1A 4C89A 2VP0A 1IN7A 4LKOA 3H65A 2COKA 2FN4A 3IDFA 1G8PA 3QU9A 4PCVA 5CIQA 4BQOA 3O93A 5JEDA 1YO6A 3H11A 4Y0AA 3P19A 4YTEA 5D1HA 1OUMA 2OYNA 4IMPA 3RYHB 2Y0BA 4F56A 2KX7A 3NDJA 2QTRA 3HUFA 3ND5A 2FMIA 1ZGJA 3MRXA 1NJFA 2JAXA 3GFRA 3I2KA 1YFZA 3DEKA 2Z5GA 3UT5B 2PIAA 2C0QA 4EMSA 4XWWA 3ZHQA 3O8DA 4LJ4A 3SF8A 3L4BA 1UT5A 1FVFA 3MERA 3N8GA 3F5QA 2JPDA 5HMMA 1YZFA 4AYXA 3NGLA 4E5YA 1IZ7A 4KYIB 5AVWA 5JUWA 3GK3A 3PRKE 2YBEA 2FHPA 4Q4JB 4RMNA 3WKBA 4IJKA 3ICOA 2RHDA 5JBNA 2JI7A 3WZMA 4Z4VA 4JC8A 1OC2A 2C9YA 4X1IB 3I6IA 1N0VC 4IY1A 1X1SA 1ZUD1 3HFGA 2CRVA 1SC1A 4M0EA 2XWSA 4OXIA 3RV4A 4PF1A 1RNLA 4X45A 3X1MA 1NDHA 2R62A 4FZ5A 5FJIA 3OLYA 3UTCA 4I9GA 1E2NA 1XO1A 2V58A 1UANA 5DHTA 5EQJB 4FCTA 4OHFA 2C9CA 1HE4A 1FYVA 1U0TA 3CXRA 5KPDA 4PAQA 2HT1A 4B32A 2YW2A 3K2EA 5ESWA 2WTNA 3BSWA 3OP4A 3ZHBA 3I2JA 3WA6A 5A71A 4GF5A 1DWOA 3RODA 3OPNA 4P93A 4NBTA 3SEAA 5BV0A 1Z6XA 3GLQA 4UAGA 4B0PA 1HL3A 2J8ZA 1X7XB 3KKNA 5IPFA 4CBVA 3LUPA 4AQYB 2BFEA 3S2GA 1TD9A 3VZSA 4BWGA 1A3CA 3V8VA 4CDGA 4IVRA 4DV3B 1QO0A 2ZJ3A 2XYPA 2XW6A 4NOJA 3CN7A 3RU9A 3FNQA 3L77A 3OF5A 1KRHA 4D0GA 5L6MB 2DBVO 3WGNA 1NNI1 1U5BB 1Y1PA 3P20A 3T5TA 2AUTA 1K28D 4UNPA 3LYUA 4EYSA 5HZGA 1GQYA 3OEHD 1P3JA 4P7GA 4GOKA 1Y4AE 3IFSA 3TUZC 2IXBA 1G19A 1FJHA 4FINA 1AF4A 4KMMA 3RPEA 3RHZA 4FQ8A 2VP9A 1QPZA 2X2EA 1OIWA 4PPGA 2XQVA 1JAZA 3AK4A 2IHKA 5FHRA 5BN3B 2G04A 1X1BA 3MAJA 4Q05A 1A5ZA 4D8XA 4PGOA 1Y4ZA 2HCRA 4N3CA 4W6ZA 3ZS9A 4EX6A 2D06A 5JBIA 1J8VA 2IYQA 5EIAA 4GOJA 2H31A 1EX7A 1S8OA 3GT3A 1N0UA 3ED1A 4YAFA 2HQSA 2IYSA 2PQ6A 3Q4GA 3MT9A 3FYDA 4PYQA 2OA0A 4IFIA 1SOMA 4QEZA 3VOTA 2AF4C 3A6ZA 4MWDA 5EZYB 2R66A 4KWCA 2G71A 4P33A 3NWBA 2NVWA 1E58A 2ZUUA 2VK4A 1Z18A 2QR3A 1I8TA 5DNYB 3OCZA 1VI5A 4OHXA 3KXPA 3IKLA 2VDLB 1BQ4A 3UPTA 1XTSA 1CUCA 3FE2A 2IPOA 2D2IA 4BBPA 1IAQA 2HR1A 4MPJA 3GVLA 3PC3A 1NVVR 4M98A 4NK5A 2Z1MA 1M2VB 3BCDA 2WJPA 4ARSA 4QQNA 2F3TA 5J1TB 3R9WA 2VTKA 3L6UA 2X6YA 4WXHA 3QUSA 4UEQA 4J03A 2R7AA 1ZEMA 3A28A 1FDWA 3D4NA 4KVFA 2DFPA 4GSKA 3NT2A 2XT6A 3ZBPA 1XLWA 2EP7A 4PINA 5T8KA 3TZQA 5IC4A 2JLQA 2GYVA 1O1YA 5A3QA 1ILWA 1LDGA 2AKYA 3O38A 5AOBA 4LJRA 3CZ4A 4ZYYA 1JKJB 3PHIA 1KKMA 1ORTA 3KJZA 4TKMA 3PXEA 5C8YB 3E9NA 3DD5A 3Q1LA 4E32A