3ZC0A

Structure of afc3po - duplex rna complex
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
190
structure length
190
Chain Sequence
b'MRLEECRKRLEELEAAREELLKVLREMRIHSTKSIALIHAGKVEEAEQELKKAIELLEKVKAYREYPEIYFYLCNDAMQELVEAIAFKNAISGEFTFEIDLEVTPAAFLNGFAAAVGELRRYALTKLIEGDFKSAERMLEVMEKIYERLMEFTTFPDKLVSGLRKKLDVARGGIERTKSDYIAAKVARLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFTRAX
publication title Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/rna
total genus 77
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zc0A00
3ZC0A 5JR9B 5JR9C 5JREA 5JRCB 3ZC1A 5JRCA 5JR9A
chains in the Genus database with same CATH superfamily
2DNXA 1N33T 1B7TA 2BG9A 2HPLA 1XZYA 3AE7A 4ZXLA 2YK0A 3RKOA 2XAGB 3EABA 4C91A 4CN4A 3ZYLA 3VKHA 3HA4A 1YXRA 3ZMZB 2BVLA 5JDNA 1SHZC 4TV8E 3RRCA 2OA5A 5AQJB 2DI4A 4AQFC 3N9LA 1ZKEA 2HN1A 2WCAA 3J9X1 2EHOB 4IDZA 2WB5A 3ETUA 4U74A 4DUYT 3GWHA 3VR8A 2XSAA 4YSXA 2WM9A 4XBFB 4OHFA 2LHRA 3CK6A 4QXBB 2C5KT 3OYZA 3A8YC 5JR9C 3FZHB 2KZ7B 4V1Av 5L3BB 3UFGA 2KWHA 1LVKA 1HCIA 2NTXA 1OEDC 3LBXA 4NXMT 2WZIA 1G73A 2E9XA 4FJOA 5ABHA 3K1SA 2CPTA 2IUBA 4HFHA 4X62T 3OYXA 5LMNT 3RPUA 2Q9QD 2VKJA 2LKGA 2VKHA 3NKZA 4GK5E 2HN2A 3Q5WA 2M6BA 3LK42 2FJAA 3I0OA 3TLSA 3JC6C 4DV7T 3CX8B 2IMLA 3C51A 4U31A 5HAXA 4DV1T 2WS3A 2QRXA 3FXEB 4XAXB 2YU2A 5CA0E 4CQIA 4U7IA 2H88A 2CEAA 2NWBA 2SPCA 4DR5T 1VOMA 2L9QA 5EK2A 4ZI2C 2XQ3A 2WQYA 3RQWA 4EIWA 4NUVA 3RH3A 1HF8A 4NPPA 4KHPT 2LM9A 3ONXA 3ZN1B 3AA7B 2XQ9A 2CM0A 2DLRA 5KXJA 4HTEA 3ZKRA 3HI2A 4LF5T 2DHRA 2NR4A 4UVCB 3UQ4A 2BKPA 4BAYB 4YTMA 1SA0E 4LF7T 3RIUA 4DR6T 4DV0T 5GONE 1T98A 2JMKA 2X0YA 2XQ6A 1LKXA 2YKSA 4TZ4C 2BG9C 2LM2A 3QNUA 1HNXT 2BKOA 3TLVA 2WMNA 2WDQA 5CFBA 2NW7A 3PUZF 3KV9A 3CX7B 2XQ7A 2KXPB 2X0LB 1UCUA 4HFCA 4X1KE 2Q9QA 5HYAA 4YXDA 2BBHA 2X51A 4ZS2A 4HKAA 2XM1A 3SS1A 4UR9A 2C5IT 4CXXA 3CMLA 3L39A 4ILBA 3G06A 2KWIB 4EZ4A 2CWYA 5HCMA 4QKNA 2XJ7A 2BDEA 3ZEFB 2W67A 5FMNA 5LOVE 4IT4A 4H9OC 2VQET 2K24A 5AQPB 5HWYA 5LHHB 2CXDA 2CMRA 3ZSSA 1UUSA 5AQUB 3J7Yq 3AA0B 1MNDA 1QSDA 4B6XA 5J2UE 3OVUA 1BR4A 1XWMA 4DR4T 4JV5T 5JRCA 3ZCIA 3ANWA 1IBLT 1BR1A 3N9PA 4QH1A 5IWAT 3ESLA 2HHHT 3AEEA 1HR0T 1US7B 4GOUA 3BQIA 3KV5A 3UU6A 4LMJA 5LP6E 3UU8A 2D0UA 3VRBA 2CRBA 2A9UA 3HKCE 4IDPA 4YHHT 2ODUA 2JIWA 2E5LT 2LSJA 1YD8G 4NIQA 1LVFA 4KX6A 3RI5A 1T7SA 3O1JA 3ONJA 3LBXB 4H9SE 2J62A 4O2BE 4BA9A 2E9XB 3PTRB 2N2NA 1UGOA 5JTGA 4AIUA 2J4GA 2OV9A 4DR7T 4JI2T 5BMVE 3ONLC 2XAJB 4HFBA 5LGUB 2LJLA 1WFDA 3VRAA 5LXTE 4YFSA 3PUSA 1D0XA 2KLQA 2V8SV 4AKRB 2MOZA 3V5UA 5JDHA 3PUXF 3QB5K 3NWIA 3VHLA 2JQKA 2NOXA 3AEFA 3KFWX 4MFRA 4OFZA 4QXCB 2K9AA 4QX8B 2IC9A 2LHNA 5LMUT 2BS2A 3KBTA 4HWCA 3T1YT 5FXWA 4UV9B 4WNKA 1AJ3A 1HX8A 3TKLB 2XAHB 3FZMB 3LJCA 2UXCT 3VU7H 1NENA 2CLYC 4QH5A 2WBLA 5AQOB 2PG8A 3PUAA 4OYKA 5TAOA 3PJAA 4JEHB 5C3JA 2E5VA 2D2SA 2UU9T 3PUVF 4O4HE 3QOFA 3AAIA 3QK6A 2UXDT 3FZKB 2L8KA 5AQVB 2LOSA 4ILCA 2QA7A 2V1DB 2X66A 5JDGA 3I1AA 4Z90A 3Q5XA 3HR0A 4KBMB 1WYCA 5EZYE 3ZPOA 2FJDA 3EVYA 3ZJ1A 3N2KE 3OTOT 4EEDA 1KK7A 4PK5A 1S94A 3MXZA 3WAJA 3EHZA 3H37A 1XNRT 4PJNA 2Q9QB 3AAAB 3B5MA 1N34T 4YY3T 3KVAA 3AVSA 3KINB 4IIJE 2V5CA 2ZM0A 3ZSTA 3UUBA 1UK5A 4NUUA 1MIWA 5AQMB 4O8SA 1IAPA 1XMOT 3PE0A 3DTOA 4BJNA 3ZT5A 3JADA 1Z0PA 5IYZE 5AQRB 2V7JA 1KNRA 2X0HA 1HNWT 4DMVA 3AE1A 2LSYA 2KINB 5LYJE 5ABFA 1D0ZA 2BS4A 3MKDA 4E7SA 5CA1E 2UUBT 3TLUA 5LHGB 4JI3T 5LGNB 2EHOC 3EI0A 3HKDE 3NZQA 4H9QC 5JDMA 2WU2A 5F3JA 3MZKB 1CHUA 5JRCB 4XZCA 3AB3B 4ZHQE 3ANWB 4ILUA 4O4IE 2LRLA 4PJLA 1N36T 2LSGA 2XQ5A 2CWOA 3FZLB 2M6IA 1X9BA 4I0UA 4DV5T 3HKBE 5DABA 5FYMA 3UULA 3H3AA 2H7OA 5L4HA 1KNPA 4EXTA 1U5PA 3Q5EA 3ZJ2A 2IIUA 1OEDE 2V6YA 4Z91A 4U72A 3RYIE 2PJQA 4UXNB 3OJAA 3V5SA 4YSYA 3CX6B 3R6NA 1YKHB 5C8YE 2LLYA 2VL0A 2V7LA 3UFEA 4DV4T 5IUXA 3PDYA 4IGUA 3CIRA 2B76A 2V7IA 2JMHA 2XASB 3P7IA 4MALA 3CVRA 4CXYA 4HWHA 5LCYA 2KSRA 4H63V 5FNVE 5LG3A 5FY0A 2W61A 1FIOA 1UX5A 5F5WA 1BR2A 4KMCA 1IBMT 4Z8XA 3Q5DA 5JVDE 4EYUA 4U7YA 3RF1A 3RGLA 4JI5T 2KMFA 3AECA 1DU2A 5JDLA 4JUYA 2UUAT 2NW9A 3I0QA 5JDFA 3FZFB 3F31A 5DJQC 4IE4A 1ZOYA 1XDOA 4UV8B 4GYRA 5J1GA 2XZEA 2VKDA 4X1IE 4WBNE 3AE9A 4LMLA 3HKEE 4DMWA 5LGTB 4YJ2E 4X5TA 1KF6A 1E7PA 3RC8A 5J0ZA 4KI0F 2LSIA 3LSVA 4OYJA 3NRYA 4ZOLE 2IHR1 4WYVA 2ES0A 3CQGB 4ISTA 3DP7A 1OXZA 3NRXA 1W0BA 2VL8A 5L3DB 2CBJA 2V7MA 4LF8T 3IEEA 1L0VA 5AFUL 2UXXB 3SOLA 2X67A 3OPCA 3N2GE 4YT0A 2WMOA 2YOEA 3QC9A 4UF0A 4I55E 4ZI3C 4EOZB 4CI2B 2BKNA 3VKGA 1J1JA 4EGWA 3KVBA 2V6XA 2I6HA 2X9HA 2LE8A 5J2TE 2FJBA 5ABFB 4GKKT 3M65A 3ZCJA 1J5ET 4X65T 3NZPA 4JI7T 2IC6A 2Y8DA 3WAKA 4L5GA 5KDMC 3ZC0A 1VRBA 1WR6A 2OLTA 3AAEB 4U3CA 2XTLA 2JPFA 1D1AA 2ZM8A 3D0TA 4ILAA 1KFYA 4MLKA 1HS7A 4IE0A 3PUWF 4IREA 2MYSA 3IBPA 2E9XC 2YDRA 3UT5E 4AISA 3SFEA 5HXRA 5M4YA 3GA8A 2XQYA 1D0YA 1E2AA 4OX9T 5KMGP 4UIGA 2QYWA 2V6YB 1KNZA 2CCQA 1WRDA 3UUNA 4TWDA 4G2AA 4M1PA 4COFA 2WP9A 1MMGA 5HEHA 4KHZF 4F8HA 2ZMAA 3T8OA 4ERRA 4DO0A 4X1YE 2MBGA 4L0RA 2P9BA 2WZHA 2XY8B 1MMAA 1BR0A 3C4XA 4O2AE 5FXZA 4L9IA 1T8BA 1W0AA 4DR3T 4DV2T 5KX5E 4YJ3E 5L3EB 3IA3A 5CGMA 2XQAA 4K0KT 4DUZT 2CE7A 3PUGA 2LSKA 2LOPA 3W15B 3A7MA 5AQKB 2ACZA 4HEAA 4GYSA 3UU4A 3GN5A 3MJXA 3TLTA 2CXLA 1J5WA 3UQ7A 4Q25A 3ZLIA 4DIDB 1G8XA 2CHNA 4U2YA 3ZYMA 4IL4A 3I9WA 2NP9A 4EV6A 5L4EA 2RPAA 3B13A 4HWIB 3ZC1A 3JC6D 4AI6A 5HEOA 2PBIA 3C64A 3RIUC 1M62A 2K3WA 5CB4E 1JNZA 4HWFA 5LJMA 1I6ZA 4H9NC 3IF8B 2I59A 3EDVA 2XUEA 4P09A 2J1DG 2VB6A 4U2ZA 4EB6E 2WY2A 1WR0A 3ZT6A 2ODVA 1NAFA 2LT3A 5JH7E 4AQFA 5LA6E 5LBQB 3X1DA 4ADZA 5F8PA 2XM2A 1WCRA 4ZI2D 2Q9QC 3PUQA 3C98B 3AEGA 3HL6A 5HCJA 2YEVC 4YSZA 2V7KA 4LF9T 3ZMTB 5H6QB 5HXHA 4U33A 3K8PC 2I0MA 2RP4A 4I43B 1NWMX 3C4ZA 2X9XA 1D1BA 3AE5A 2H89A 4PJJA 3Q9DA 5H6RB 4B3RT 1W9RA 2KNDA 5HWXA 1OEDA 4HGAA 5AQGB 4P0AA 3PU3A 4TUYE 2X9YA 4TNVA 1FEWA 1ZEEA 3VR9A 3ZMSB 3KDSE 4IL9A 1IZNB 1MNEA 4PW8A 4UF0B 5LNKA 2JQQA 2C5JA 2W00A 2C0SA 3E0ZA 4JI1T 4P1NA 1QUUA 3QB5A 4DBQA 3P4PA 3U3IA 3P4QA 3K3NA 2YN6A 3EDUA 4EZHA 3P50A 4PNIA 2WDRA 3O9XA 4CXWA 2LEHA 1O3XA 1X79A 1MIVA 5FXVA 3ABVA 4PFPA 4BJMA 2PFVA 4MBQA 3AA1B 4ZZBA 3N9OA 2XSBA 3E08A 1LRZA 3RYCE 2QGSA 2N1GA 2XAFB 3L8RA 3N9NA 2BZBA 4G63A 4YLHA 3UU5A 5DQWA 1OWAA 3FB2A 4P0BA 4IE6A 3CWZB 4I50E 3AE3A 2DCFA 3C4WA 3AE8A 4HFEA 2WSSV 5FKYA 3RRWA 4OK0A 4FI5A 4JI8T 1ZV4X 1Y64B 2YINA 4TN7B 3MACA 1FMWA 2BS3A 3K3OA 4O4LE 4HE8A 4LF4T 5AQSB 1E1HB 4PJMA 3EUHA 2A2FX 5LHIB 1HG2A 4KP3C 1I94T 3AVRA 3A5XA 4KUMB 2VKOA 3TLWA 4LFAT 5ETWA 4N78D 5IHYA 5HXCA 3ZT7A 5EK4A 5HEGA 2W4XA 3BK9A 4TWFA 2NTYA 4EAHA 3F2EA 4CN6A 5FXXA 3U78A 4I4TE 1R8IA 4E7ZA 4X66T 2DL1A 2QVAA 2X9WA 3RKGA 3AE2A 5ABEA 1HTJF 2A3DA 3RC3A 2VASA 2VVSA 2MAWA 3WI3A 4AKIA 3N9QA 5FVLA 3L3PA 4QH4A 3BQLA 2LRKA 2FBWA 2BBJA 4AQGA 3GN5B 5L3FB 2A72A 2L3LA 4YHJA 3RLFF 1IBKT 4PK6A 3RIFA 3P4WA 1UX4A 4AKGA 4ZEYA 2IAKA 4WW0A 4C90A 3CQXC 3GMIA 4GIWA 2LKHA 5AQFB 3NBXX 2VQFT 2JQHA 3PUYF 3RQUA 2CBIA 5LB7B 5L3GB 3AE4A 4UEMA 2E2AA 3BQKA 2ZM2A 4JI6T 2UXNB 1W09A 4ZZCA 2W66A 4B3ST 2JQ9A 5L2LA 3ETVA 4MHCA 3N5LA 2W63A 1VCSA 4LMKA 2FUPA 2UUCT 1T72A 3MK7C 2ZLYA 5FL0A 2W2UA 4A56A 5AQLB 2DWGA 4LFBT 2WDVA 5JR9B 3E22E 2BG9E 2CA5A 1ZP0A 3H3MA 3T1HT 1OEDB 1HNZT 1SUMB 5JREA 3PV0F 5JDQA 2W0GA 4WZXA 2YDSA 2WAUA 3S4UA 4QHOA 5DQVA 3KBUA 5FP3A 4ASKA 4GK0E 4DR1T 3LDQB 4J2CA 4PK4A 1VCTA 3KV6A 3FXDB 3R84B 3OBVE 3FBZA 2Y6XA 3RYHE 4AQYT 1WYBA 2M67A 2XAQB 3SWHA 3P4SA 2Y48B 3N9MA 1U4QA 5HEUA 2D9DA 4DV3T 4WBOA 4JYAT 3IHRA 2PTFA 4LFCT 4AKLA 4H63H 2D5UA 4QX7B 5L3CB 1MMNA 2EHOD 2H3RA 5EK3A 4TNWA 4HN9A 2D0TA 3CPZA 4AKHA 4PFOA 4DBRA 2CHOA 2W62A 2JRKA 2K48A 2RA1A 2BVMA 2WWVA 3F57A 5AQNB 3C50A 2HPJA 1FJGT 2VURA 3Q2MA 4EYYR 4K0UA 2IW5B 2BG9B 1YQ3A 5CJ5A 3FBLA 3AXJA 4JI0T 3AA6B 4DVDA 3FHNA 2N9DA 2VK9A 3LFMA 3K3QC 4UVBB 3DJBA 3ZMVB 3O1IA 4B3MT 1NEKA 2ZM6T 2IDOB 4X20E 1QLBA 4PAGA 3JCFA 4IHJE 2XQ8A 4UELA 4JLEA 3AE6A 2J47A 3PURA 1Y01A 5E0OA 4HFVA 3P4RA 1YKEB 3OKQA 4X64T 1CUNA 1KEYA 2XQ4A 3RYFE 2WWUA 1N32T 2H7VC 4TWHA 1H7CA 2Z6EA 2EHOA 3M3ZB 3MA9A 2NW8A 3QUJA 2JJ9A 5ABGA 1IJ5A 2K5BB 3O4XE 3O1HA 5HEJA 1XMQT 4A98A 4ANJA 1XNQT 3B57A 2MTQA 5FY7A 2DWKA 4ISSA 5AQIB 4AXPA 3UUMA 2CXFA 1M7KA 2ACXA 3L09A 4IDNA 2YU1A 5C2TA 3P8CD 1YW0A 4JBWF 4IE5A 4EEBA 4A5XA 2X68A 4YTNA 2XPKA 3AEAA 3SFDA 3ZYKA 2F4VT 4F6RC 2V26A 5AQHB 3ZN0B 3LK3B 5HXSA 1MIYA 3AEBA 5AQQB 2MPKA 3JAFA 4YTPA 4DV6T 2FJEA 3RIAA 4LF6T 2AE9A 5HXEA 5LBMA 4IDOA 3CKDA 5JQGE 4HFIA 3LG7A 4QXHB 4HWDA 2UXBT 3UUXB 4A97A 5LG4A 5FY1A 5JR9A 5BR8T 3UTKA 1XDPA 1UURA 4HFDA 2KT9A 3RHWA 1SE7A 3EAMA 2WU5A 2G0UA 2VVNA 4O4JE 1D1CA 4ZI3D 1ZHCA 1YQ4A 1HG5A 1Z8UA 4H9PC 4CI3B 4GKJT 5FVKA 3SRZA 2B1EA 5A1LA 3KV4A 2AXDS 3JAEA 5AQTB 2HH7A 4CN1A 4ZS3A 4NXNT 4TX5A 2GK9A 1GQEA 2V5DA 2VWAA 3I9YA 5ADXL 5LJNA 1EZ3A 2CLYB 1IJ6A 4DNDA 3PU8A 3RX6A 3ZMUB 3PJAJ 4IDQA 4ZI7E 1FMVA 4TV9E 2YDQA 4CI1B 1MMDA 3UU3A 4H9RC 1HFAA 1V9DA 2XHEB 4CZZB 4JEUB 4B3TT 5FL1A 1JNRA 4QWNB 1HX1B 2E8IA 3CQCB 3LK2B 3AEDA 4DR2T 1S35A 3N2OA 3NVOA 4UVAB 2E9XD 5L47A 1WLXA 2R6GF 4JI4T 3AXJB 4IE7A
chains in the Genus database with same CATH topology
1HX8A 3TKLB 2DNXA 2XAHB 3LJCA 3MK7C 3VU7H 2ZLYA 4IE0A 2CLYC 2WBLA 1B7TA 4A56A 2PG8A 2HPLA 3PUAA 2MYSA 3IBPA 2DWGA 2E9XC 4OYKA 3UT5E 5TAOA 4JEHB 5HXRA 5JR9B 3E22E 5M4YA 2CA5A 3GA8A 2D2SA 2XQYA 1D0YA 4O4HE 3AAIA 3QK6A 2YK0A 5KMGP 3RKOA 5JREA 2XAGB 4UIGA 2L8KA 5JDQA 2W0GA 1KNZA 2WAUA 4C91A 2LOSA 3ZYLA 3VKHA 2CCQA 3HA4A 2QA7A 2V1DB 1WRDA 3UUNA 2X66A 3S4UA 3ZMZB 5JDGA 4QHOA 4G2AA 3I1AA 2BVLA 5JDNA 4M1PA 1SHZC 3Q5XA 4TV8E 3RRCA 2OA5A 1MMGA 3HR0A 4KBMB 1WYCA 2DI4A 5DQVA 4AQFC 2ZMAA 3N9LA 5EZYE 3T8OA 3ZPOA 4ERRA 4DO0A 3KBUA 3EVYA 4X1YE 3ZJ1A 5FP3A 4ASKA 1ZKEA 4L0RA 4GK0E 2MBGA 2P9BA 4J2CA 4PK4A 3N2KE 3J9X1 1MMAA 1BR0A 3C4XA 1KK7A 2EHOB 3KV6A 4O2AE 4PK5A 5FXZA 1S94A 3MXZA 4IDZA 3FXDB 4L9IA 3R84B 3WAJA 3ETUA 3OBVE 4U74A 3H37A 3FBZA 3GWHA 2Y6XA 5KX5E 3RYHE 4PJNA 4YJ3E 2Q9QB 5L3EB 3AAAB 1WYBA 2WM9A 2M67A 4XBFB 2XAQB 3KVAA 4OHFA 3SWHA 2LHRA 2CE7A 3PUGA 2LSKA 2LOPA 4QXBB 2C5KT 3AVSA 3W15B 3KINB 2Y48B 4IIJE 3OYZA 4HEAA 4GYSA 2ZM0A 3N9MA 5JR9C 3GN5A 5L3BB 1U4QA 2KZ7B 4V1Av 3MJXA 2KWHA 1LVKA 2CXLA 1HCIA 4NUUA 1MIWA 2NTXA 4WBOA 3IHRA 1IAPA 3LBXA 4O8SA 3PE0A 3ZLIA 3DTOA 4AKLA 4H63H 4BJNA 1G73A 2D5UA 2E9XA 1G8XA 4FJOA 3ZYMA 4QX7B 3I9WA 1Z0PA 5IYZE 2NP9A 5L3CB 2V7JA 3B13A 1MMNA 3ZC1A 3JC6D 2EHOD 2H3RA 4AI6A 5EK3A 2PBIA 3OYXA 4DMVA 3C64A 2LSYA 2KINB 5LYJE 4HN9A 3RPUA 1D0ZA 3MKDA 5CB4E 4E7SA 5LJMA 2D0TA 2Q9QD 2VKJA 3IF8B 4H9NC 2I59A 3CPZA 5CA1E 4AKHA 4PFOA 2VKHA 4DBRA 3EDVA 4GK5E 2XUEA 4P09A 2W62A 2J1DG 2VB6A 2JRKA 4EB6E 2K48A 3Q5WA 2RA1A 2BVMA 3LK42 3I0OA 5LHGB 5LGNB 3JC6C 2EHOC 2ODVA 3CX8B 3F57A 1NAFA 3C51A 2LT3A 3HKDE 3NZQA 5HAXA 5LA6E 5LBQB 4ADZA 3C50A 4H9QC 4AQFA 5JDMA 5F8PA 2HPJA 4ZI2D 3Q2MA 2Q9QC 3FXEB 4EYYR 3PUQA 3C98B 4K0UA 2YU2A 3HL6A 3MZKB 4XAXB 2IW5B 5CA0E 2YEVC 5F3JA 5JRCB 2V7KA 4CQIA 4XZCA 3AB3B 5H6QB 3ANWB 3ZMTB 4ZHQE 5HXHA 2CEAA 4ILUA 4O4IE 3K8PC 3FBLA 4PJLA 3AA6B 2LSGA 4DVDA 2NWBA 2RP4A 2SPCA 4I43B 3FHNA 1NWMX 2N9DA 2CWOA 2VK9A 3LFMA 1VOMA 2L9QA 3K3QC 5EK2A 4ZI2C 4UVBB 3C4ZA 3DJBA 4EIWA 3ZMVB 4NUVA 3RH3A 1HF8A 2X9XA 1D1BA 3HKBE 3O1IA 2LM9A 5DABA 3ONXA 5FYMA 3ZN1B 3AA7B 4PJJA 3Q9DA 5JH7E 5H6RB 2CM0A 2KNDA 3UULA 3H3AA 2H7OA 2DLRA 4HGAA 4EXTA 5HWXA 4HTEA 4X20E 1U5PA 4PAGA 3HI2A 4P0AA 3ZJ2A 3PU3A 4IHJE 2DHRA 4TUYE 2X9YA 4JLEA 4UELA 4UVCB 1FEWA 1ZEEA 3PURA 4U72A 3RYIE 2PJQA 4HFVA 5E0OA 3ZMSB 4BAYB 4UXNB 1SA0E 3OJAA 3V5SA 3KDSE 1YKEB 3CX6B 3R6NA 1IZNB 1MNEA 3OKQA 1YKHB 4PW8A 4UF0B 5GONE 1T98A 2JMKA 5C8YE 2JQQA 5LNKA 1CUNA 2C5JA 2V7LA 3RYFE 2WWUA 2W00A 2C0SA 3UFEA 1LKXA 4TZ4C 3E0ZA 3PDYA 2H7VC 4IGUA 1H7CA 2Z6EA 2WMNA 2NW7A 2EHOA 2V7IA 1QUUA 3KV9A 3MA9A 2NW8A 3CX7B 2JMHA 4DBQA 2KXPB 3QUJA 2XASB 3U3IA 2JJ9A 2X0LB 1UCUA 3K3NA 1IJ5A 2K5BB 3O4XE 3P7IA 4MALA 3O1HA 4X1KE 3CVRA 3EDUA 4EZHA 4CXYA 2Q9QA 4PNIA 5HYAA 3O9XA 4CXWA 5LCYA 4ANJA 2X51A 4ZS2A 2LEHA 3B57A 4HKAA 2MTQA 1O3XA 5FY7A 2DWKA 1X79A 4ISSA 4H63V 4AXPA 1MIVA 3SS1A 5FNVE 5FXVA 2C5IT 3UUMA 2CXFA 4PFPA 4BJMA 2PFVA 4CXXA 3CMLA 2W61A 4MBQA 5FY0A 3AA1B 2ACXA 1FIOA 3N9OA 2KWIB 4EZ4A 1UX5A 3L09A 3E08A 2CWYA 1LRZA 2YU1A 4QKNA 1BR2A 2QGSA 2N1GA 2XAFB 3N9NA 4KMCA 3RYCE 2BZBA 4G63A 4YLHA 3P8CD 4Z8XA 1YW0A 5DQWA 1OWAA 3FB2A 4IE5A 2BDEA 5JVDE 3ZEFB 2X68A 4P0BA 4IE6A 3CWZB 4I50E 4EYUA 3ZYKA 4F6RC 5FMNA 2DCFA 5LOVE 3C4WA 2KMFA 2V26A 3ZN0B 5HXSA 3LK3B 4H9OC 1MIYA 2WSSV 3RRWA 4OK0A 2K24A 5JDLA 4JUYA 4FI5A 2NW9A 5HWYA 3I0QA 5JDFA 5LHHB 1ZV4X 1Y64B 3F31A 5DJQC 2YINA 2CXDA 4IE4A 4TN7B 5HXEA 3MACA 1FMWA 2CMRA 3K3OA 4O4LE 5LBMA 4HE8A 4UV8B 3J7Yq 3CKDA 4GYRA 1E1HB 3AA0B 5J1GA 1MNDA 4PJMA 1QSDA 2VKDA 2A2FX 3EUHA 4X1IE 1HG2A 4KP3C 4B6XA 5JQGE 5LHIB 3AVRA 4WBNE 3LG7A 3A5XA 5J2UE 4QXHB 4KUMB 2VKOA 3HKEE 1BR4A 4DMWA 5LGTB 5ETWA 4N78D 5IHYA 4YJ2E 3UUXB 5JRCA 5HXCA 3ZCIA 3RC8A 3ANWA 5LG4A 5EK4A 2LSIA 4OYJA 3NRYA 5FY1A 1BR1A 4ZOLE 5JR9A 3BK9A 3N9PA 3UTKA 2ES0A 2KT9A 2NTYA 4EAHA 3ESLA 3F2EA 3CQGB 4ISTA 3DP7A 5FXXA 3U78A 1OXZA 1US7B 4I4TE 2G0UA 3NRXA 4GOUA 3BQIA 3KV5A 4O4JE 1D1CA 2VL8A 5L3DB 4E7ZA 4ZI3D 2V7MA 5LP6E 2X9WA 3IEEA 1ZHCA 1HTJF 2D0UA 2A3DA 3RC3A 2VASA 1HG5A 3WI3A 4AKIA 5AFUL 2UXXB 3SOLA 4H9PC 4CI3B 3N9QA 2X67A 3L3PA 3N2GE 3HKCE 2WMOA 3BQLA 3SRZA 2B1EA 3QC9A 4UF0A 4I55E 2ODUA 4ZI3C 4AQGA 2LSJA 1YD8G 4CI2B 4EOZB 5A1LA 1LVFA 3GN5B 3KV4A 5L3FB 2A72A 2HH7A 4ZS3A 4TX5A 2GK9A 3VKGA 3O1JA 2VWAA 3I9YA 5ADXL 5LJNA 1EZ3A 2CLYB 1IJ6A 2L3LA 4YHJA 3LBXB 4H9SE 4DNDA 3PU8A 4O2BE 4PK6A 3RX6A 2E9XB 3ZMUB 1UX4A 2N2NA 3PTRB 4BA9A 4AKGA 2IAKA 4WW0A 4ZI7E 1FMVA 4TV9E 4C90A 3CQXC 3KVBA 2X9HA 2LE8A 3GMIA 4CI1B 4GIWA 5J2TE 3NBXX 1MMDA 4H9RC 5BMVE 1HFAA 3M65A 1V9DA 2XAJB 3ZCJA 2XHEB 4CZZB 5LGUB 2LJLA 4JEUB 5L3GB 3NZPA 5LXTE 4UEMA 4YFSA 3BQKA 2ZM2A 3PUSA 4QWNB 1D0XA 2KLQA 2UXNB 4AKRB 2MOZA 2E8IA 3CQCB 3V5UA 5JDHA 2IC6A 3LK2B 3VHLA 2Y8DA 3WAKA 4L5GA 5KDMC 3ZC0A 1VRBA 2NOXA 1WR6A 1S35A 3N2OA 3KFWX 3AAEB 4MFRA 4OFZA 4UVAB 4QXCB 2K9AA 4QX8B 2E9XD 2IC9A 2XTLA 2JPFA 1WLXA 5L2LA 3ETVA 2LHNA 1D1AA 4MHCA 2ZM8A 3KBTA 3N5LA 3D0TA 5FXWA 2W63A 4UV9B 4WNKA 1AJ3A 4MLKA 1HS7A 4IE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZC0 A;  5JR9 B;  5JR9 C;  5JRE A;  5JRC B;  3ZC1 A;  5JRC A;  5JR9 A; 
#chains in the Genus database with same CATH topology
 2DNX A;  1N33 T;  1B7T A;  2BG9 A;  2HPL A;  1XZY A;  3AE7 A;  4ZXL A;  2YK0 A;  3RKO A;  2XAG B;  3EAB A;  4C91 A;  4CN4 A;  3ZYL A;  3VKH A;  3HA4 A;  1YXR A;  3ZMZ B;  2BVL A;  5JDN A;  1SHZ C;  4TV8 E;  3RRC A;  2OA5 A;  5AQJ B;  2DI4 A;  4AQF C;  3N9L A;  1ZKE A;  2HN1 A;  2WCA A;  3J9X 1;  2EHO B;  4IDZ A;  2WB5 A;  3ETU A;  4U74 A;  4DUY T;  3GWH A;  3VR8 A;  2XSA A;  4YSX A;  2WM9 A;  4XBF B;  4OHF A;  2LHR A;  3CK6 A;  4QXB B;  2C5K T;  3OYZ A;  3A8Y C;  5JR9 C;  3FZH B;  2KZ7 B;  4V1A v;  5L3B B;  3UFG A;  2KWH A;  1LVK A;  1HCI A;  2NTX A;  1OED C;  3LBX A;  4NXM T;  2WZI A;  1G73 A;  2E9X A;  4FJO A;  5ABH A;  3K1S A;  2CPT A;  2IUB A;  4HFH A;  4X62 T;  3OYX A;  5LMN T;  3RPU A;  2Q9Q D;  2VKJ A;  2LKG A;  2VKH A;  3NKZ A;  4GK5 E;  2HN2 A;  3Q5W A;  2M6B A;  3LK4 2;  2FJA A;  3I0O A;  3TLS A;  3JC6 C;  4DV7 T;  3CX8 B;  2IML A;  3C51 A;  4U31 A;  5HAX A;  4DV1 T;  2WS3 A;  2QRX A;  3FXE B;  4XAX B;  2YU2 A;  5CA0 E;  4CQI A;  4U7I A;  2H88 A;  2CEA A;  2NWB A;  2SPC A;  4DR5 T;  1VOM A;  2L9Q A;  5EK2 A;  4ZI2 C;  2XQ3 A;  2WQY A;  3RQW A;  4EIW A;  4NUV A;  3RH3 A;  1HF8 A;  4NPP A;  4KHP T;  2LM9 A;  3ONX A;  3ZN1 B;  3AA7 B;  2XQ9 A;  2CM0 A;  2DLR A;  5KXJ A;  4HTE A;  3ZKR A;  3HI2 A;  4LF5 T;  2DHR A;  2NR4 A;  4UVC B;  3UQ4 A;  2BKP A;  4BAY B;  4YTM A;  1SA0 E;  4LF7 T;  3RIU A;  4DR6 T;  4DV0 T;  5GON E;  1T98 A;  2JMK A;  2X0Y A;  2XQ6 A;  1LKX A;  2YKS A;  4TZ4 C;  2BG9 C;  2LM2 A;  3QNU A;  1HNX T;  2BKO A;  3TLV A;  2WMN A;  2WDQ A;  5CFB A;  2NW7 A;  3PUZ F;  3KV9 A;  3CX7 B;  2XQ7 A;  2KXP B;  2X0L B;  1UCU A;  4HFC A;  4X1K E;  2Q9Q A;  5HYA A;  4YXD A;  2BBH A;  2X51 A;  4ZS2 A;  4HKA A;  2XM1 A;  3SS1 A;  4UR9 A;  2C5I T;  4CXX A;  3CML A;  3L39 A;  4ILB A;  3G06 A;  2KWI B;  4EZ4 A;  2CWY A;  5HCM A;  4QKN A;  2XJ7 A;  2BDE A;  3ZEF B;  2W67 A;  5FMN A;  5LOV E;  4IT4 A;  4H9O C;  2VQE T;  2K24 A;  5AQP B;  5HWY A;  5LHH B;  2CXD A;  2CMR A;  3ZSS A;  1UUS A;  5AQU B;  3J7Y q;  3AA0 B;  1MND A;  1QSD A;  4B6X A;  5J2U E;  3OVU A;  1BR4 A;  1XWM A;  4DR4 T;  4JV5 T;  5JRC A;  3ZCI A;  3ANW A;  1IBL T;  1BR1 A;  3N9P A;  4QH1 A;  5IWA T;  3ESL A;  2HHH T;  3AEE A;  1HR0 T;  1US7 B;  4GOU A;  3BQI A;  3KV5 A;  3UU6 A;  4LMJ A;  5LP6 E;  3UU8 A;  2D0U A;  3VRB A;  2CRB A;  2A9U A;  3HKC E;  4IDP A;  4YHH T;  2ODU A;  2JIW A;  2E5L T;  2LSJ A;  1YD8 G;  4NIQ A;  1LVF A;  4KX6 A;  3RI5 A;  1T7S A;  3O1J A;  3ONJ A;  3LBX B;  4H9S E;  2J62 A;  4O2B E;  4BA9 A;  2E9X B;  3PTR B;  2N2N A;  1UGO A;  5JTG A;  4AIU A;  2J4G A;  2OV9 A;  4DR7 T;  4JI2 T;  5BMV E;  3ONL C;  2XAJ B;  4HFB A;  5LGU B;  2LJL A;  1WFD A;  3VRA A;  5LXT E;  4YFS A;  3PUS A;  1D0X A;  2KLQ A;  2V8S V;  4AKR B;  2MOZ A;  3V5U A;  5JDH A;  3PUX F;  3QB5 K;  3NWI A;  3VHL A;  2JQK A;  2NOX A;  3AEF A;  3KFW X;  4MFR A;  4OFZ A;  4QXC B;  2K9A A;  4QX8 B;  2IC9 A;  2LHN A;  5LMU T;  2BS2 A;  3KBT A;  4HWC A;  3T1Y T;  5FXW A;  4UV9 B;  4WNK A;  1AJ3 A;  1HX8 A;  3TKL B;  2XAH B;  3FZM B;  3LJC A;  2UXC T;  3VU7 H;  1NEN A;  2CLY C;  4QH5 A;  2WBL A;  5AQO B;  2PG8 A;  3PUA A;  4OYK A;  5TAO A;  3PJA A;  4JEH B;  5C3J A;  2E5V A;  2D2S A;  2UU9 T;  3PUV F;  4O4H E;  3QOF A;  3AAI A;  3QK6 A;  2UXD T;  3FZK B;  2L8K A;  5AQV B;  2LOS A;  4ILC A;  2QA7 A;  2V1D B;  2X66 A;  5JDG A;  3I1A A;  4Z90 A;  3Q5X A;  3HR0 A;  4KBM B;  1WYC A;  5EZY E;  3ZPO A;  2FJD A;  3EVY A;  3ZJ1 A;  3N2K E;  3OTO T;  4EED A;  1KK7 A;  4PK5 A;  1S94 A;  3MXZ A;  3WAJ A;  3EHZ A;  3H37 A;  1XNR T;  4PJN A;  2Q9Q B;  3AAA B;  3B5M A;  1N34 T;  4YY3 T;  3KVA A;  3AVS A;  3KIN B;  4IIJ E;  2V5C A;  2ZM0 A;  3ZST A;  3UUB A;  1UK5 A;  4NUU A;  1MIW A;  5AQM B;  4O8S A;  1IAP A;  1XMO T;  3PE0 A;  3DTO A;  4BJN A;  3ZT5 A;  3JAD A;  1Z0P A;  5IYZ E;  5AQR B;  2V7J A;  1KNR A;  2X0H A;  1HNW T;  4DMV A;  3AE1 A;  2LSY A;  2KIN B;  5LYJ E;  5ABF A;  1D0Z A;  2BS4 A;  3MKD A;  4E7S A;  5CA1 E;  2UUB T;  3TLU A;  5LHG B;  4JI3 T;  5LGN B;  2EHO C;  3EI0 A;  3HKD E;  3NZQ A;  4H9Q C;  5JDM A;  2WU2 A;  5F3J A;  3MZK B;  1CHU A;  5JRC B;  4XZC A;  3AB3 B;  4ZHQ E;  3ANW B;  4ILU A;  4O4I E;  2LRL A;  4PJL A;  1N36 T;  2LSG A;  2XQ5 A;  2CWO A;  3FZL B;  2M6I A;  1X9B A;  4I0U A;  4DV5 T;  3HKB E;  5DAB A;  5FYM A;  3UUL A;  3H3A A;  2H7O A;  5L4H A;  1KNP A;  4EXT A;  1U5P A;  3Q5E A;  3ZJ2 A;  2IIU A;  1OED E;  2V6Y A;  4Z91 A;  4U72 A;  3RYI E;  2PJQ A;  4UXN B;  3OJA A;  3V5S A;  4YSY A;  3CX6 B;  3R6N A;  1YKH B;  5C8Y E;  2LLY A;  2VL0 A;  2V7L A;  3UFE A;  4DV4 T;  5IUX A;  3PDY A;  4IGU A;  3CIR A;  2B76 A;  2V7I A;  2JMH A;  2XAS B;  3P7I A;  4MAL A;  3CVR A;  4CXY A;  4HWH A;  5LCY A;  2KSR A;  4H63 V;  5FNV E;  5LG3 A;  5FY0 A;  2W61 A;  1FIO A;  1UX5 A;  5F5W A;  1BR2 A;  4KMC A;  1IBM T;  4Z8X A;  3Q5D A;  5JVD E;  4EYU A;  4U7Y A;  3RF1 A;  3RGL A;  4JI5 T;  2KMF A;  3AEC A;  1DU2 A;  5JDL A;  4JUY A;  2UUA T;  2NW9 A;  3I0Q A;  5JDF A;  3FZF B;  3F31 A;  5DJQ C;  4IE4 A;  1ZOY A;  1XDO A;  4UV8 B;  4GYR A;  5J1G A;  2XZE A;  2VKD A;  4X1I E;  4WBN E;  3AE9 A;  4LML A;  3HKE E;  4DMW A;  5LGT B;  4YJ2 E;  4X5T A;  1KF6 A;  1E7P A;  3RC8 A;  5J0Z A;  4KI0 F;  2LSI A;  3LSV A;  4OYJ A;  3NRY A;  4ZOL E;  2IHR 1;  4WYV A;  2ES0 A;  3CQG B;  4IST A;  3DP7 A;  1OXZ A;  3NRX A;  1W0B A;  2VL8 A;  5L3D B;  2CBJ A;  2V7M A;  4LF8 T;  3IEE A;  1L0V A;  5AFU L;  2UXX B;  3SOL A;  2X67 A;  3OPC A;  3N2G E;  4YT0 A;  2WMO A;  2YOE A;  3QC9 A;  4UF0 A;  4I55 E;  4ZI3 C;  4EOZ B;  4CI2 B;  2BKN A;  3VKG A;  1J1J A;  4EGW A;  3KVB A;  2V6X A;  2I6H A;  2X9H A;  2LE8 A;  5J2T E;  2FJB A;  5ABF B;  4GKK T;  3M65 A;  3ZCJ A;  1J5E T;  4X65 T;  3NZP A;  4JI7 T;  2IC6 A;  2Y8D A;  3WAK A;  4L5G A;  5KDM C;  3ZC0 A;  1VRB A;  1WR6 A;  2OLT A;  3AAE B;  4U3C A;  2XTL A;  2JPF A;  1D1A A;  2ZM8 A;  3D0T A;  4ILA A;  1KFY A;  4MLK A;  1HS7 A;  4IE0 A;  3PUW F;  4IRE A;  2MYS A;  3IBP A;  2E9X C;  2YDR A;  3UT5 E;  4AIS A;  3SFE A;  5HXR A;  5M4Y A;  3GA8 A;  2XQY A;  1D0Y A;  1E2A A;  4OX9 T;  5KMG P;  4UIG A;  2QYW A;  2V6Y B;  1KNZ A;  2CCQ A;  1WRD A;  3UUN A;  4TWD A;  4G2A A;  4M1P A;  4COF A;  2WP9 A;  1MMG A;  5HEH A;  4KHZ F;  4F8H A;  2ZMA A;  3T8O A;  4ERR A;  4DO0 A;  4X1Y E;  2MBG A;  4L0R A;  2P9B A;  2WZH A;  2XY8 B;  1MMA A;  1BR0 A;  3C4X A;  4O2A E;  5FXZ A;  4L9I A;  1T8B A;  1W0A A;  4DR3 T;  4DV2 T;  5KX5 E;  4YJ3 E;  5L3E B;  3IA3 A;  5CGM A;  2XQA A;  4K0K T;  4DUZ T;  2CE7 A;  3PUG A;  2LSK A;  2LOP A;  3W15 B;  3A7M A;  5AQK B;  2ACZ A;  4HEA A;  4GYS A;  3UU4 A;  3GN5 A;  3MJX A;  3TLT A;  2CXL A;  1J5W A;  3UQ7 A;  4Q25 A;  3ZLI A;  4DID B;  1G8X A;  2CHN A;  4U2Y A;  3ZYM A;  4IL4 A;  3I9W A;  2NP9 A;  4EV6 A;  5L4E A;  2RPA A;  3B13 A;  4HWI B;  3ZC1 A;  3JC6 D;  4AI6 A;  5HEO A;  2PBI A;  3C64 A;  3RIU C;  1M62 A;  2K3W A;  5CB4 E;  1JNZ A;  4HWF A;  5LJM A;  1I6Z A;  4H9N C;  3IF8 B;  2I59 A;  3EDV A;  2XUE A;  4P09 A;  2J1D G;  2VB6 A;  4U2Z A;  4EB6 E;  2WY2 A;  1WR0 A;  3ZT6 A;  2ODV A;  1NAF A;  2LT3 A;  5JH7 E;  4AQF A;  5LA6 E;  5LBQ B;  3X1D A;  4ADZ A;  5F8P A;  2XM2 A;  1WCR A;  4ZI2 D;  2Q9Q C;  3PUQ A;  3C98 B;  3AEG A;  3HL6 A;  5HCJ A;  2YEV C;  4YSZ A;  2V7K A;  4LF9 T;  3ZMT B;  5H6Q B;  5HXH A;  4U33 A;  3K8P C;  2I0M A;  2RP4 A;  4I43 B;  1NWM X;  3C4Z A;  2X9X A;  1D1B A;  3AE5 A;  2H89 A;  4PJJ A;  3Q9D A;  5H6R B;  4B3R T;  1W9R A;  2KND A;  5HWX A;  1OED A;  4HGA A;  5AQG B;  4P0A A;  3PU3 A;  4TUY E;  2X9Y A;  4TNV A;  1FEW A;  1ZEE A;  3VR9 A;  3ZMS B;  3KDS E;  4IL9 A;  1IZN B;  1MNE A;  4PW8 A;  4UF0 B;  5LNK A;  2JQQ A;  2C5J A;  2W00 A;  2C0S A;  3E0Z A;  4JI1 T;  4P1N A;  1QUU A;  3QB5 A;  4DBQ A;  3P4P A;  3U3I A;  3P4Q A;  3K3N A;  2YN6 A;  3EDU A;  4EZH A;  3P50 A;  4PNI A;  2WDR A;  3O9X A;  4CXW A;  2LEH A;  1O3X A;  1X79 A;  1MIV A;  5FXV A;  3ABV A;  4PFP A;  4BJM A;  2PFV A;  4MBQ A;  3AA1 B;  4ZZB A;  3N9O A;  2XSB A;  3E08 A;  1LRZ A;  3RYC E;  2QGS A;  2N1G A;  2XAF B;  3L8R A;  3N9N A;  2BZB A;  4G63 A;  4YLH A;  3UU5 A;  5DQW A;  1OWA A;  3FB2 A;  4P0B A;  4IE6 A;  3CWZ B;  4I50 E;  3AE3 A;  2DCF A;  3C4W A;  3AE8 A;  4HFE A;  2WSS V;  5FKY A;  3RRW A;  4OK0 A;  4FI5 A;  4JI8 T;  1ZV4 X;  1Y64 B;  2YIN A;  4TN7 B;  3MAC A;  1FMW A;  2BS3 A;  3K3O A;  4O4L E;  4HE8 A;  4LF4 T;  5AQS B;  1E1H B;  4PJM A;  3EUH A;  2A2F X;  5LHI B;  1HG2 A;  4KP3 C;  1I94 T;  3AVR A;  3A5X A;  4KUM B;  2VKO A;  3TLW A;  4LFA T;  5ETW A;  4N78 D;  5IHY A;  5HXC A;  3ZT7 A;  5EK4 A;  5HEG A;  2W4X A;  3BK9 A;  4TWF A;  2NTY A;  4EAH A;  3F2E A;  4CN6 A;  5FXX A;  3U78 A;  4I4T E;  1R8I A;  4E7Z A;  4X66 T;  2DL1 A;  2QVA A;  2X9W A;  3RKG A;  3AE2 A;  5ABE A;  1HTJ F;  2A3D A;  3RC3 A;  2VAS A;  2VVS A;  2MAW A;  3WI3 A;  4AKI A;  3N9Q A;  5FVL A;  3L3P A;  4QH4 A;  3BQL A;  2LRK A;  2FBW A;  2BBJ A;  4AQG A;  3GN5 B;  5L3F B;  2A72 A;  2L3L A;  4YHJ A;  3RLF F;  1IBK T;  4PK6 A;  3RIF A;  3P4W A;  1UX4 A;  4AKG A;  4ZEY A;  2IAK A;  4WW0 A;  4C90 A;  3CQX C;  3GMI A;  4GIW A;  2LKH A;  5AQF B;  3NBX X;  2VQF T;  2JQH A;  3PUY F;  3RQU A;  2CBI A;  5LB7 B;  5L3G B;  3AE4 A;  4UEM A;  2E2A A;  3BQK A;  2ZM2 A;  4JI6 T;  2UXN B;  1W09 A;  4ZZC A;  2W66 A;  4B3S T;  2JQ9 A;  5L2L A;  3ETV A;  4MHC A;  3N5L A;  2W63 A;  1VCS A;  4LMK A;  2FUP A;  2UUC T;  1T72 A;  3MK7 C;  2ZLY A;  5FL0 A;  2W2U A;  4A56 A;  5AQL B;  2DWG A;  4LFB T;  2WDV A;  5JR9 B;  3E22 E;  2BG9 E;  2CA5 A;  1ZP0 A;  3H3M A;  3T1H T;  1OED B;  1HNZ T;  1SUM B;  5JRE A;  3PV0 F;  5JDQ A;  2W0G A;  4WZX A;  2YDS A;  2WAU A;  3S4U A;  4QHO A;  5DQV A;  3KBU A;  5FP3 A;  4ASK A;  4GK0 E;  4DR1 T;  3LDQ B;  4J2C A;  4PK4 A;  1VCT A;  3KV6 A;  3FXD B;  3R84 B;  3OBV E;  3FBZ A;  2Y6X A;  3RYH E;  4AQY T;  1WYB A;  2M67 A;  2XAQ B;  3SWH A;  3P4S A;  2Y48 B;  3N9M A;  1U4Q A;  5HEU A;  2D9D A;  4DV3 T;  4WBO A;  4JYA T;  3IHR A;  2PTF A;  4LFC T;  4AKL A;  4H63 H;  2D5U A;  4QX7 B;  5L3C B;  1MMN A;  2EHO D;  2H3R A;  5EK3 A;  4TNW A;  4HN9 A;  2D0T A;  3CPZ A;  4AKH A;  4PFO A;  4DBR A;  2CHO A;  2W62 A;  2JRK A;  2K48 A;  2RA1 A;  2BVM A;  2WWV A;  3F57 A;  5AQN B;  3C50 A;  2HPJ A;  1FJG T;  2VUR A;  3Q2M A;  4EYY R;  4K0U A;  2IW5 B;  2BG9 B;  1YQ3 A;  5CJ5 A;  3FBL A;  3AXJ A;  4JI0 T;  3AA6 B;  4DVD A;  3FHN A;  2N9D A;  2VK9 A;  3LFM A;  3K3Q C;  4UVB B;  3DJB A;  3ZMV B;  3O1I A;  4B3M T;  1NEK A;  2ZM6 T;  2IDO B;  4X20 E;  1QLB A;  4PAG A;  3JCF A;  4IHJ E;  2XQ8 A;  4UEL A;  4JLE A;  3AE6 A;  2J47 A;  3PUR A;  1Y01 A;  5E0O A;  4HFV A;  3P4R A;  1YKE B;  3OKQ A;  4X64 T;  1CUN A;  1KEY A;  2XQ4 A;  3RYF E;  2WWU A;  1N32 T;  2H7V C;  4TWH A;  1H7C A;  2Z6E A;  2EHO A;  3M3Z B;  3MA9 A;  2NW8 A;  3QUJ A;  2JJ9 A;  5ABG A;  1IJ5 A;  2K5B B;  3O4X E;  3O1H A;  5HEJ A;  1XMQ T;  4A98 A;  4ANJ A;  1XNQ T;  3B57 A;  2MTQ A;  5FY7 A;  2DWK A;  4ISS A;  5AQI B;  4AXP A;  3UUM A;  2CXF A;  1M7K A;  2ACX A;  3L09 A;  4IDN A;  2YU1 A;  5C2T A;  3P8C D;  1YW0 A;  4JBW F;  4IE5 A;  4EEB A;  4A5X A;  2X68 A;  4YTN A;  2XPK A;  3AEA A;  3SFD A;  3ZYK A;  2F4V T;  4F6R C;  2V26 A;  5AQH B;  3ZN0 B;  3LK3 B;  5HXS A;  1MIY A;  3AEB A;  5AQQ B;  2MPK A;  3JAF A;  4YTP A;  4DV6 T;  2FJE A;  3RIA A;  4LF6 T;  2AE9 A;  5HXE A;  5LBM A;  4IDO A;  3CKD A;  5JQG E;  4HFI A;  3LG7 A;  4QXH B;  4HWD A;  2UXB T;  3UUX B;  4A97 A;  5LG4 A;  5FY1 A;  5JR9 A;  5BR8 T;  3UTK A;  1XDP A;  1UUR A;  4HFD A;  2KT9 A;  3RHW A;  1SE7 A;  3EAM A;  2WU5 A;  2G0U A;  2VVN A;  4O4J E;  1D1C A;  4ZI3 D;  1ZHC A;  1YQ4 A;  1HG5 A;  1Z8U A;  4H9P C;  4CI3 B;  4GKJ T;  5FVK A;  3SRZ A;  2B1E A;  5A1L A;  3KV4 A;  2AXD S;  3JAE A;  5AQT B;  2HH7 A;  4CN1 A;  4ZS3 A;  4NXN T;  4TX5 A;  2GK9 A;  1GQE A;  2V5D A;  2VWA A;  3I9Y A;  5ADX L;  5LJN A;  1EZ3 A;  2CLY B;  1IJ6 A;  4DND A;  3PU8 A;  3RX6 A;  3ZMU B;  3PJA J;  4IDQ A;  4ZI7 E;  1FMV A;  4TV9 E;  2YDQ A;  4CI1 B;  1MMD A;  3UU3 A;  4H9R C;  1HFA A;  1V9D A;  2XHE B;  4CZZ B;  4JEU B;  4B3T T;  5FL1 A;  1JNR A;  4QWN B;  1HX1 B;  2E8I A;  3CQC B;  3LK2 B;  3AED A;  4DR2 T;  1S35 A;  3N2O A;  3NVO A;  4UVA B;  2E9X D;  5L47 A;  1WLX A;  2R6G F;  4JI4 T;  3AXJ B;  4IE7 A; 
#chains in the Genus database with same CATH homology
 1HX8 A;  3TKL B;  2DNX A;  2XAH B;  3LJC A;  3MK7 C;  3VU7 H;  2ZLY A;  4IE0 A;  2CLY C;  2WBL A;  1B7T A;  4A56 A;  2PG8 A;  2HPL A;  3PUA A;  2MYS A;  3IBP A;  2DWG A;  2E9X C;  4OYK A;  3UT5 E;  5TAO A;  4JEH B;  5HXR A;  5JR9 B;  3E22 E;  5M4Y A;  2CA5 A;  3GA8 A;  2D2S A;  2XQY A;  1D0Y A;  4O4H E;  3AAI A;  3QK6 A;  2YK0 A;  5KMG P;  3RKO A;  5JRE A;  2XAG B;  4UIG A;  2L8K A;  5JDQ A;  2W0G A;  1KNZ A;  2WAU A;  4C91 A;  2LOS A;  3ZYL A;  3VKH A;  2CCQ A;  3HA4 A;  2QA7 A;  2V1D B;  1WRD A;  3UUN A;  2X66 A;  3S4U A;  3ZMZ B;  5JDG A;  4QHO A;  4G2A A;  3I1A A;  2BVL A;  5JDN A;  4M1P A;  1SHZ C;  3Q5X A;  4TV8 E;  3RRC A;  2OA5 A;  1MMG A;  3HR0 A;  4KBM B;  1WYC A;  2DI4 A;  5DQV A;  4AQF C;  2ZMA A;  3N9L A;  5EZY E;  3T8O A;  3ZPO A;  4ERR A;  4DO0 A;  3KBU A;  3EVY A;  4X1Y E;  3ZJ1 A;  5FP3 A;  4ASK A;  1ZKE A;  4L0R A;  4GK0 E;  2MBG A;  2P9B A;  4J2C A;  4PK4 A;  3N2K E;  3J9X 1;  1MMA A;  1BR0 A;  3C4X A;  1KK7 A;  2EHO B;  3KV6 A;  4O2A E;  4PK5 A;  5FXZ A;  1S94 A;  3MXZ A;  4IDZ A;  3FXD B;  4L9I A;  3R84 B;  3WAJ A;  3ETU A;  3OBV E;  4U74 A;  3H37 A;  3FBZ A;  3GWH A;  2Y6X A;  5KX5 E;  3RYH E;  4PJN A;  4YJ3 E;  2Q9Q B;  5L3E B;  3AAA B;  1WYB A;  2WM9 A;  2M67 A;  4XBF B;  2XAQ B;  3KVA A;  4OHF A;  3SWH A;  2LHR A;  2CE7 A;  3PUG A;  2LSK A;  2LOP A;  4QXB B;  2C5K T;  3AVS A;  3W15 B;  3KIN B;  2Y48 B;  4IIJ E;  3OYZ A;  4HEA A;  4GYS A;  2ZM0 A;  3N9M A;  5JR9 C;  3GN5 A;  5L3B B;  1U4Q A;  2KZ7 B;  4V1A v;  3MJX A;  2KWH A;  1LVK A;  2CXL A;  1HCI A;  4NUU A;  1MIW A;  2NTX A;  4WBO A;  3IHR A;  1IAP A;  3LBX A;  4O8S A;  3PE0 A;  3ZLI A;  3DTO A;  4AKL A;  4H63 H;  4BJN A;  1G73 A;  2D5U A;  2E9X A;  1G8X A;  4FJO A;  3ZYM A;  4QX7 B;  3I9W A;  1Z0P A;  5IYZ E;  2NP9 A;  5L3C B;  2V7J A;  3B13 A;  1MMN A;  3ZC1 A;  3JC6 D;  2EHO D;  2H3R A;  4AI6 A;  5EK3 A;  2PBI A;  3OYX A;  4DMV A;  3C64 A;  2LSY A;  2KIN B;  5LYJ E;  4HN9 A;  3RPU A;  1D0Z A;  3MKD A;  5CB4 E;  4E7S A;  5LJM A;  2D0T A;  2Q9Q D;  2VKJ A;  3IF8 B;  4H9N C;  2I59 A;  3CPZ A;  5CA1 E;  4AKH A;  4PFO A;  2VKH A;  4DBR A;  3EDV A;  4GK5 E;  2XUE A;  4P09 A;  2W62 A;  2J1D G;  2VB6 A;  2JRK A;  4EB6 E;  2K48 A;  3Q5W A;  2RA1 A;  2BVM A;  3LK4 2;  3I0O A;  5LHG B;  5LGN B;  3JC6 C;  2EHO C;  2ODV A;  3CX8 B;  3F57 A;  1NAF A;  3C51 A;  2LT3 A;  3HKD E;  3NZQ A;  5HAX A;  5LA6 E;  5LBQ B;  4ADZ A;  3C50 A;  4H9Q C;  4AQF A;  5JDM A;  5F8P A;  2HPJ A;  4ZI2 D;  3Q2M A;  2Q9Q C;  3FXE B;  4EYY R;  3PUQ A;  3C98 B;  4K0U A;  2YU2 A;  3HL6 A;  3MZK B;  4XAX B;  2IW5 B;  5CA0 E;  2YEV C;  5F3J A;  5JRC B;  2V7K A;  4CQI A;  4XZC A;  3AB3 B;  5H6Q B;  3ANW B;  3ZMT B;  4ZHQ E;  5HXH A;  2CEA A;  4ILU A;  4O4I E;  3K8P C;  3FBL A;  4PJL A;  3AA6 B;  2LSG A;  4DVD A;  2NWB A;  2RP4 A;  2SPC A;  4I43 B;  3FHN A;  1NWM X;  2N9D A;  2CWO A;  2VK9 A;  3LFM A;  1VOM A;  2L9Q A;  3K3Q C;  5EK2 A;  4ZI2 C;  4UVB B;  3C4Z A;  3DJB A;  4EIW A;  3ZMV B;  4NUV A;  3RH3 A;  1HF8 A;  2X9X A;  1D1B A;  3HKB E;  3O1I A;  2LM9 A;  5DAB A;  3ONX A;  5FYM A;  3ZN1 B;  3AA7 B;  4PJJ A;  3Q9D A;  5JH7 E;  5H6R B;  2CM0 A;  2KND A;  3UUL A;  3H3A A;  2H7O A;  2DLR A;  4HGA A;  4EXT A;  5HWX A;  4HTE A;  4X20 E;  1U5P A;  4PAG A;  3HI2 A;  4P0A A;  3ZJ2 A;  3PU3 A;  4IHJ E;  2DHR A;  4TUY E;  2X9Y A;  4JLE A;  4UEL A;  4UVC B;  1FEW A;  1ZEE A;  3PUR A;  4U72 A;  3RYI E;  2PJQ A;  4HFV A;  5E0O A;  3ZMS B;  4BAY B;  4UXN B;  1SA0 E;  3OJA A;  3V5S A;  3KDS E;  1YKE B;  3CX6 B;  3R6N A;  1IZN B;  1MNE A;  3OKQ A;  1YKH B;  4PW8 A;  4UF0 B;  5GON E;  1T98 A;  2JMK A;  5C8Y E;  2JQQ A;  5LNK A;  1CUN A;  2C5J A;  2V7L A;  3RYF E;  2WWU A;  2W00 A;  2C0S A;  3UFE A;  1LKX A;  4TZ4 C;  3E0Z A;  3PDY A;  2H7V C;  4IGU A;  1H7C A;  2Z6E A;  2WMN A;  2NW7 A;  2EHO A;  2V7I A;  1QUU A;  3KV9 A;  3MA9 A;  2NW8 A;  3CX7 B;  2JMH A;  4DBQ A;  2KXP B;  3QUJ A;  2XAS B;  3U3I A;  2JJ9 A;  2X0L B;  1UCU A;  3K3N A;  1IJ5 A;  2K5B B;  3O4X E;  3P7I A;  4MAL A;  3O1H A;  4X1K E;  3CVR A;  3EDU A;  4EZH A;  4CXY A;  2Q9Q A;  4PNI A;  5HYA A;  3O9X A;  4CXW A;  5LCY A;  4ANJ A;  2X51 A;  4ZS2 A;  2LEH A;  3B57 A;  4HKA A;  2MTQ A;  1O3X A;  5FY7 A;  2DWK A;  1X79 A;  4ISS A;  4H63 V;  4AXP A;  1MIV A;  3SS1 A;  5FNV E;  5FXV A;  2C5I T;  3UUM A;  2CXF A;  4PFP A;  4BJM A;  2PFV A;  4CXX A;  3CML A;  2W61 A;  4MBQ A;  5FY0 A;  3AA1 B;  2ACX A;  1FIO A;  3N9O A;  2KWI B;  4EZ4 A;  1UX5 A;  3L09 A;  3E08 A;  2CWY A;  1LRZ A;  2YU1 A;  4QKN A;  1BR2 A;  2QGS A;  2N1G A;  2XAF B;  3N9N A;  4KMC A;  3RYC E;  2BZB A;  4G63 A;  4YLH A;  3P8C D;  4Z8X A;  1YW0 A;  5DQW A;  1OWA A;  3FB2 A;  4IE5 A;  2BDE A;  5JVD E;  3ZEF B;  2X68 A;  4P0B A;  4IE6 A;  3CWZ B;  4I50 E;  4EYU A;  3ZYK A;  4F6R C;  5FMN A;  2DCF A;  5LOV E;  3C4W A;  2KMF A;  2V26 A;  3ZN0 B;  5HXS A;  3LK3 B;  4H9O C;  1MIY A;  2WSS V;  3RRW A;  4OK0 A;  2K24 A;  5JDL A;  4JUY A;  4FI5 A;  2NW9 A;  5HWY A;  3I0Q A;  5JDF A;  5LHH B;  1ZV4 X;  1Y64 B;  3F31 A;  5DJQ C;  2YIN A;  2CXD A;  4IE4 A;  4TN7 B;  5HXE A;  3MAC A;  1FMW A;  2CMR A;  3K3O A;  4O4L E;  5LBM A;  4HE8 A;  4UV8 B;  3J7Y q;  3CKD A;  4GYR A;  1E1H B;  3AA0 B;  5J1G A;  1MND A;  4PJM A;  1QSD A;  2VKD A;  2A2F X;  3EUH A;  4X1I E;  1HG2 A;  4KP3 C;  4B6X A;  5JQG E;  5LHI B;  3AVR A;  4WBN E;  3LG7 A;  3A5X A;  5J2U E;  4QXH B;  4KUM B;  2VKO A;  3HKE E;  1BR4 A;  4DMW A;  5LGT B;  5ETW A;  4N78 D;  5IHY A;  4YJ2 E;  3UUX B;  5JRC A;  5HXC A;  3ZCI A;  3RC8 A;  3ANW A;  5LG4 A;  5EK4 A;  2LSI A;  4OYJ A;  3NRY A;  5FY1 A;  1BR1 A;  4ZOL E;  5JR9 A;  3BK9 A;  3N9P A;  3UTK A;  2ES0 A;  2KT9 A;  2NTY A;  4EAH A;  3ESL A;  3F2E A;  3CQG B;  4IST A;  3DP7 A;  5FXX A;  3U78 A;  1OXZ A;  1US7 B;  4I4T E;  2G0U A;  3NRX A;  4GOU A;  3BQI A;  3KV5 A;  4O4J E;  1D1C A;  2VL8 A;  5L3D B;  4E7Z A;  4ZI3 D;  2V7M A;  5LP6 E;  2X9W A;  3IEE A;  1ZHC A;  1HTJ F;  2D0U A;  2A3D A;  3RC3 A;  2VAS A;  1HG5 A;  3WI3 A;  4AKI A;  5AFU L;  2UXX B;  3SOL A;  4H9P C;  4CI3 B;  3N9Q A;  2X67 A;  3L3P A;  3N2G E;  3HKC E;  2WMO A;  3BQL A;  3SRZ A;  2B1E A;  3QC9 A;  4UF0 A;  4I55 E;  2ODU A;  4ZI3 C;  4AQG A;  2LSJ A;  1YD8 G;  4CI2 B;  4EOZ B;  5A1L A;  1LVF A;  3GN5 B;  3KV4 A;  5L3F B;  2A72 A;  2HH7 A;  4ZS3 A;  4TX5 A;  2GK9 A;  3VKG A;  3O1J A;  2VWA A;  3I9Y A;  5ADX L;  5LJN A;  1EZ3 A;  2CLY B;  1IJ6 A;  2L3L A;  4YHJ A;  3LBX B;  4H9S E;  4DND A;  3PU8 A;  4O2B E;  4PK6 A;  3RX6 A;  2E9X B;  3ZMU B;  1UX4 A;  2N2N A;  3PTR B;  4BA9 A;  4AKG A;  2IAK A;  4WW0 A;  4ZI7 E;  1FMV A;  4TV9 E;  4C90 A;  3CQX C;  3KVB A;  2X9H A;  2LE8 A;  3GMI A;  4CI1 B;  4GIW A;  5J2T E;  3NBX X;  1MMD A;  4H9R C;  5BMV E;  1HFA A;  3M65 A;  1V9D A;  2XAJ B;  3ZCJ A;  2XHE B;  4CZZ B;  5LGU B;  2LJL A;  4JEU B;  5L3G B;  3NZP A;  5LXT E;  4UEM A;  4YFS A;  3BQK A;  2ZM2 A;  3PUS A;  4QWN B;  1D0X A;  2KLQ A;  2UXN B;  4AKR B;  2MOZ A;  2E8I A;  3CQC B;  3V5U A;  5JDH A;  2IC6 A;  3LK2 B;  3VHL A;  2Y8D A;  3WAK A;  4L5G A;  5KDM C;  3ZC0 A;  1VRB A;  2NOX A;  1WR6 A;  1S35 A;  3N2O A;  3KFW X;  3AAE B;  4MFR A;  4OFZ A;  4UVA B;  4QXC B;  2K9A A;  4QX8 B;  2E9X D;  2IC9 A;  2XTL A;  2JPF A;  1WLX A;  5L2L A;  3ETV A;  2LHN A;  1D1A A;  4MHC A;  2ZM8 A;  3KBT A;  3N5L A;  3D0T A;  5FXW A;  2W63 A;  4UV9 B;  4WNK A;  1AJ3 A;  4MLK A;  1HS7 A;  4IE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...