3ZC1A

Crystal structure of afc3po
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
190
structure length
190
Chain Sequence
MRLEECRKRLEELEAAREELLKVLREMRIHSTKSIALIHAGKVEEAEQELKKAIELLEKVKAYREYPEIYFYLCNDAMQELVEAIAFKNAISGEFTFEIDLEVTPAAFLNGFADAVGELRRYALTKLIEGDFKSAERMLEVMEKIYERLMEFTTFPDKLVSGLRKKLDVARGGIERTKSDYIAAKVARLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFTRAX
publication title Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 73
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zc1A00
5JRCB 5JR9B 3ZC1A 3ZC0A 5JRCA 5JR9C 5JR9A 5JREA
chains in the Genus database with same CATH superfamily
3N9LA 3P4QA 1KK7A 4GKKT 3UU4A 4JV5T 2W62A 3HKEE 3VHLA 1HTJF 5H6RB 4Z8XA 2UXXB 4Q25A 1NAFA 4QKNA 4HWDA 4EAHA 4GYSA 2DWGA 1WR6A 5DJQC 3Q2MA 5JTGA 4NXMT 3PUGA 4KP3C 1ZOYA 2E5VA 5AQPB 1YQ4A 4H63H 4JUYA 1LRZA 1R8IA 2H7VC 2YU1A 5L3EB 2E9XD 4CZZB 2XUEA 3N2KE 2LLYA 3AE6A 2VWAA 4EIWA 3OBVE 4HFVA 4HWCA 1MMNA 2BBHA 3ZLIA 5FYMA 2W67A 2DLRA 5LNKA 2JMKA 2BKOA 3RHWA 3PUXF 2VVNA 5JDNA 2A3DA 4YTNA 2JRKA 2D5UA 3PUYF 2MTQA 1L0VA 4HFDA 2PJQA 5JDMA 1YKHB 3C4WA 3ZT5A 2CWOA 4LMJA 4UEMA 3UU5A 1E7PA 5ETWA 3ANWB 3PU3A 2BKNA 1WYCA 3HKDE 3ZPOA 4QX7B 1UURA 4AQYT 4ZS2A 5FY0A 5F3JA 2VL0A 4IE6A 3OVUA 2CWYA 5F5WA 5KX5E 5FXVA 2ZM2A 3ZMZB 2SPCA 3ANWA 2C5JA 2PFVA 3SS1A 3M65A 1MMDA 4Z90A 4WBOA 2FJBA 1OWAA 4AKHA 2D9DA 5TAOA 5FXZA 5AQNB 2C5IT 4DBQA 4GYRA 3QNUA 3RRCA 5JDQA 2OLTA 3D0TA 2DNXA 1N33T 2BVLA 2YKSA 2NR4A 2CRBA 4DR3T 2EHOD 4LF8T 5LGTB 2WSSV 3AE7A 5ABFA 3UU3A 2Q9QD 3OYZA 2W2UA 4YHJA 4MFRA 1HF8A 5AQLB 4I4TE 3LK3B 4MALA 5DQWA 3HKBE 4LF4T 2LSJA 5LA6E 2LJLA 4TWHA 2X0LB 5AQUB 3RKOA 3FZMB 3FXDB 4DMWA 1HX1B 2BVMA 2X9YA 1FEWA 1D0ZA 4A98A 3EABA 5L47A 2V26A 4P1NA 2LRLA 5LJMA 3AE8A 3KVBA 3C98B 3UFEA 3IA3A 2WDQA 4X65T 2LSGA 3KBUA 2WU2A 4V1Av 4PK6A 2A2FX 4YSXA 2X9XA 1HCIA 4LF9T 4DR7T 1FMVA 5L4HA 4HFIA 4LF6T 2XPKA 4NUUA 3OJAA 2DCFA 2K48A 1XWMA 3RGLA 4E7ZA 4KUMB 3U3IA 1T7SA 2KLQA 2E9XB 2KXPB 4IL9A 3OKQA 2WQYA 5F8PA 3TLTA 3HKCE 1BR2A 2CBJA 3AEEA 5FL1A 2BG9A 4YJ3E 1IJ6A 5FXXA 2WS3A 3C51A 2I0MA 1XDOA 3TLSA 1OEDE 3N2GE 3WI3A 4TWFA 3CK6A 4PJNA 2WB5A 3RI5A 2P9BA 3C4ZA 2LEHA 1HR0T 1WCRA 2LSKA 3WAKA 3P4SA 2XJ7A 1IZNB 2WM9A 1M62A 2YOEA 4X1YE 4DV3T 2BZBA 2CM0A 3RIUC 3JC6D 2IW5B 1MIVA 4OK0A 2PG8A 2KT9A 1U5PA 1G8XA 1KF6A 3EHZA 2W63A 4EXTA 2XQ5A 4QHOA 2XM2A 3P4WA 3AEGA 4H9PC 4QXBB 2X68A 1NENA 2VKJA 5IHYA 4UF0B 4UVAB 3FZLB 3EUHA 3LG7A 5JDGA 3AVSA 5C3JA 2K9AA 3HI2A 3A5XA 4BAYB 4EV6A 3H3MA 2H88A 4TWDA 1KNZA 2CXLA 3UU8A 4PFPA 4UF0A 2WCAA 3PE0A 5JVDE 4LFBT 2CEAA 5L3FB 2XSAA 4I43B 2EHOB 1YKEB 3BK9A 3N9PA 3LFMA 2Q9QB 2K5BB 1CHUA 4TZ4C 3PDYA 5FNVE 4CXYA 4DVDA 1HX8A 1ZKEA 4A5XA 4HEAA 4MLKA 4TUYE 3EVYA 4ZXLA 3ZCIA 5LG3A 3CVRA 3Q5WA 3Q5EA 3RRWA 4EZHA 4U74A 2K3WA 1V9DA 1WLXA 1KNPA 2Q9QA 3AE1A 3JAFA 2D0TA 4ZI7E 2QVAA 2YDQA 1ZHCA 3T1YT 2VB6A 4UELA 3FB2A 4GIWA 2YEVC 1Y64B 4ILUA 2KNDA 3GN5B 5L2LA 5FY1A 2H89A 1QUUA 3SWHA 4BJMA 1U4QA 2KINB 4TV9E 2UU9T 2VL8A 3CPZA 1MIYA 3AA0B 4B3MT 1CUNA 2B76A 4PJLA 1M7KA 2NTXA 4X66T 5L3BB 2D2SA 4PK4A 2ZM8A 3ZYLA 5KMGP 3UUMA 3ZCJA 3GWHA 3NZPA 4H9SE 2IIUA 5HCJA 3O1HA 3F2EA 1FMWA 5AQTB 2IAKA 3A7MA 4GKJT 2FJEA 2AE9A 4H9OC 2BS2A 2CHNA 2H3RA 4JI6T 4H9NC 3AEFA 1J5ET 1I94T 2LKGA 2CLYC 2M6BA 4EZ4A 5E0OA 2IHR1 5LYJE 2CA5A 3M3ZB 4WYVA 3Q5DA 4HFHA 1IJ5A 3BQKA 4KBMB 5AQVB 5HXSA 3O1IA 2FBWA 2Y8DA 2W66A 1NWMX 2WBLA 3AEAA 4DUYT 1HFAA 1YD8G 4JI1T 3P4RA 4ZEYA 4I55E 1UX5A 2FJDA 5KDMC 3ESLA 2X0HA 4ISTA 4P09A 5CA1E 4CI3B 4EB6E 4FI5A 3DTOA 4CN6A 3IBPA 1OEDB 2B1EA 4JI7T 4NPPA 2FUPA 1UK5A 4EOZB 3ZN1B 3UUXB 3ZJ2A 3UQ4A 4IDNA 3MKDA 5CB4E 1OEDA 4ZI2C 4COFA 3BQIA 5EK3A 3V5SA 4DR1T 3E08A 3UFGA 2BKPA 2PTFA 5AQFB 3H3AA 3VKGA 2UXBT 4HFBA 4F8HA 3K8PC 2XM1A 5LP6E 3RX6A 4C90A 4Z91A 4YTPA 4C91A 1FJGT 3HL6A 3PUVF 3AE9A 3IEEA 2RP4A 1VOMA 3LBXB 5C2TA 3ONXA 3AA6B 4UXNB 3K3QC 4HWHA 3PU8A 5J1GA 1VRBA 4DR6T 2L3LA 2WU5A 1W0BA 4TV8E 4ILBA 1LVFA 2VASA 2V7JA 3UULA 4YLHA 4HWFA 5AQGB 3PUZF 3LBXA 1D1CA 2IDOB 3RIAA 5HCMA 4O2AE 4X1IE 2XQ8A 1JNZA 1VCTA 1KNRA 2UXCT 4KHPT 3ZN0B 2W0GA 4O4LE 4L5GA 3N9MA 2OV9A 2C0SA 3AXJB 5L3DB 4LF5T 5LHHB 2LOSA 4NIQA 3KV6A 1NEKA 3FZKB 3ZMVB 3OYXA 4K0KT 4ZOLE 4YTMA 4U3CA 3VU7H 4JI5T 2LSIA 1HNXT 4FJOA 3PJAJ 1XNRT 3MZKB 2PBIA 2ZMAA 4DBRA 5AFUL 1XMQT 3Q5XA 4X20E 1D0XA 2LHNA 3K3NA 5HXRA 3UQ7A 3AEDA 2W00A 3TLVA 3MJXA 4CQIA 3ABVA 2A9UA 2WAUA 3VRBA 5J2UE 4CI1B 4YFSA 2DWKA 4EGWA 3PTRB 2X66A 3RC3A 3BQLA 1Z8UA 4YT0A 3EDVA 3L39A 4X62T 3A8YC 5BR8T 4UV8B 4KMCA 5JRCB 4HKAA 1BR4A 4KI0F 3ZC1A 3F57A 2IC9A 5J0ZA 5LB7B 3SFEA 1YW0A 1WR0A 3EI0A 1AJ3A 1MMGA 2VVSA 4MHCA 2CPTA 3R84B 5JDLA 3E22E 3RQUA 5JRCA 3CIRA 2LKHA 3HA4A 3CKDA 4QH1A 5HEOA 3W15B 4ANJA 5LHIB 3RYCE 4ILAA 3ZC0A 3PUAA 3NRYA 1US7B 2DHRA 3SOLA 3AAAB 5HWXA 2FJAA 3IF8B 3RPUA 2LM9A 5LXTE 1N32T 4JEHB 2MAWA 2XZEA 4DR4T 3ZT6A 4AIUA 5HXEA 3P7IA 4AQGA 3C64A 3CX6B 2E9XA 1ZEEA 3ZMTB 2WP9A 3FBLA 3I1AA 3TLWA 3AE4A 1XNQT 5FY7A 3N5LA 1MIWA 2HHHT 3N2OA 3RYIE 2ZM6T 4O4IE 5AQMB 2MYSA 2CLYB 5A1LA 3KV5A 4BA9A 2CCQA 4E7SA 2CE7A 3AB3B 1ZP0A 2HH7A 2N2NA 5JR9B 4LMLA 2BS4A 2BBJA 3NVOA 2JQQA 2YDRA 3ETVA 2XQ7A 4PW8A 2CXDA 2V7LA 4OYJA 2JIWA 5H6QB 3R6NA 3VRAA 3Q9DA 3RQWA 2WZHA 5AQOB 4JYAT 5FVKA 5JR9A 1T98A 4G2AA 4QXHB 1N34T 4KX6A 2V6YB 4NUVA 5AQIB 2D0UA 1O3XA 4K0UA 4HGAA 2JQ9A 4UIGA 2XAQB 2AXDS 3KVAA 3TLUA 4ISSA 4B3ST 1D1BA 4CN4A 3CQCB 4ZHQE 2V6YA 2MPKA 5EK4A 2WWUA 4UVCB 2C5KT 1W09A 2ZLYA 3ZJ1A 1Z0PA 5HEGA 2M67A 3C4XA 2YINA 3AAIA 4ZS3A 2KMFA 5GONE 2EHOA 4JI4T 2KWIB 2VQFT 4EYUA 4EEBA 2I59A 3FHNA 4DIDB 2RPAA 4O4HE 2UUCT 4DV6T 5FKYA 2G0UA 5BMVE 4IE7A 3JADA 3VR8A 3P4PA 3RKGA 1JNRA 3EDUA 2X9WA 2VURA 2XQ4A 4WNKA 2UXNB 5LBQB 3NWIA 4IDZA 2N1GA 2Y48B 3CMLA 5FMNA 4L9IA 5AQRB 3UUNA 1UX4A 2BG9C 2E2AA 4B6XA 3GN5A 3OTOT 2NP9A 4TX5A 2YK0A 5L4EA 2E9XC 5DABA 2UXDT 4WW0A 5LGUB 1MNDA 3O1JA 4U33A 4DMVA 3IHRA 3QK6A 4DV4T 3PUQA 4WBNE 2CHOA 1N36T 3U78A 2XQ3A 3MXZA 3LJCA 5ABHA 3J7Yq 3PURA 3JAEA 4CI2B 5IYZE 1HS7A 3EAMA 1J1JA 3KBTA 2V1DB 4DUZT 3X1DA 3AA7B 3CX7B 3C50A 3CQXC 5EK2A 2QYWA 3B57A 3T8OA 5C8YE 2XQYA 4LF7T 1YXRA 2YN6A 2V7KA 2BG9E 3ZKRA 2KSRA 2M6IA 2WY2A 4OFZA 4IHJE 2WDVA 4JBWF 4CXWA 4IE5A 4PAGA 1VCSA 1IBLT 1ZV4X 1H7CA 3KV9A 4X5TA 4O4JE 2NTYA 2LSYA 3MK7C 3K3OA 2CBIA 1T72A 2Y6XA 1HG2A 2H7OA 4HWIB 3B13A 5CGMA 3AE5A 3KINB 1QLBA 2WWVA 4O8SA 5LCYA 3P8CD 5CJ5A 5JQGE 4ADZA 1B7TA 3ZT7A 2WMNA 3GA8A 1HNWT 2JQHA 2VKHA 2EHOC 1DU2A 4ILCA 3CWZB 2Q9QC 1D0YA 4DV1T 4AKIA 2A72A 4HFCA 5CA0E 5LHGB 3AEBA 2YDSA 3RC8A 5AQKB 2NOXA 4JI3T 4IREA 4TNVA 2J1DG 4A56A 1UCUA 3PUWF 2ES0A 4NXNT 4OHFA 2LM2A 3UUBA 2QGSA 3I0QA 4DR5T 3JCFA 4BJNA 4YSYA 3NRXA 4H9RC 2QRXA 5LJNA 3KFWX 1X79A 3ONJA 3ZSTA 2VQET 5LG4A 2ACZA 5M4YA 1XDPA 1I6ZA 4DV2T 2X9HA 3FBZA 2JPFA 5FP3A 4JLEA 1SHZC 2XAJB 3NZQA 4ERRA 1HG5A 2BS3A 4QXCB 4DNDA 1IBKT 4YY3T 5HWYA 1GQEA 2VK9A 1QSDA 4QX8B 5HXCA 1LVKA 1MNEA 2HN2A 2XSBA 2ZM0A 4X64T 3AXJA 2NW7A 1UGOA 4YHHT 2WDRA 3RIUA 5ABFB 5HXHA 3QC9A 2QA7A 3N9QA 1HNZT 2L9QA 3I0OA 4ZI2D 4U72A 4AI6A 4IGUA 2N9DA 2HPJA 5JDFA 2E8IA 4AISA 5JH7E 4AXPA 3GMIA 1KFYA 1LKXA 3UU6A 4JEUB 2ODUA 4LFAT 2VKDA 2K24A 2UUAT 1XMOT 3DJBA 4UVBB 1IAPA 4ZZBA 3AE3A 4AQFA 4PNIA 2HPLA 3SFDA 4JI0T 4IE0A 4U31A 3JC6C 3J9X1 3LSVA 4L0RA 3RF1A 5FL0A 1OXZA 3PV0F 3RIFA 1EZ3A 3ZMSB 2XQ6A 2IMLA 3L8RA 4XAXB 3ZYKA 3CQGB 1OEDC 2J62A 4ZZCA 3PUSA 2I6HA 1SA0E 4TNWA 4AKRB 3V5UA 3VKHA 3TKLB 1X9BA 2XTLA 3ZMUB 5L3GB 3L09A 1E2AA 4P0BA 1G73A 3UT5E 3QB5K 2ACXA 2W4XA 2XAHB 1WRDA 2WZIA 4EYYR 3ONLC 4EEDA 5AQSB 4HE8A 1KEYA 3N9NA 5EZYE 2X51A 3NKZA 4JI8T 3AECA 2BG9B 3RH3A 4MBQA 2LE8A 4PFOA 2UUBT 4IL4A 4LMKA 5J2TE 2JQKA 1S94A 5DQVA 2KZ7B 3QB5A 4HN9A 1T8BA 1XZYA 2HN1A 4OYKA 4QH4A 5IWAT 3ZSSA 5LGNB 3NBXX 4PK5A 2JMHA 2W61A 3O9XA 1UUSA 2V6XA 4DV5T 1J5WA 2LOPA 3LK2B 2MBGA 3MA9A 2J4GA 2LT3A 3VR9A 2MOZA 2NW9A 5JREA 2DL1A 2ODVA 5ABEA 3I9YA 4DO0A 3I9WA 2IC6A 4WZXA 2V8SV 1WYBA 5CFBA 2JJ9A 2V5DA 1MMAA 2NWBA 4QH5A 2XHEB 4GK0E 3AAEB 5KXJA 5LOVE 2V5CA 5AQHB 3FZHB 5FVLA 4U7YA 3KV4A 3G06A 3MACA 4HFEA 2VKOA 3L3PA 3RYFE 1BR1A 2BDEA 3RLFF 4M1PA 5ADXL 3ZEFB 4YSZA 2XQAA 4PJMA 3F31A 4ZI3C 5LMNT 3K1SA 4H9QC 3QOFA 4A97A 4I50E 4DR2T 2LRKA 4CXXA 2XASB 4H63V 4IDOA 5FXWA 4U2YA 4AKGA 3N9OA 3DP7A 4AKLA 3AVRA 4X1KE 5AQQB 4AQFC 3PJAA 2KWHA 2E5LT 2X0YA 1D1AA 5ABGA 3WAJA 4I0UA 4B3TT 3LK42 4F6RC 5IUXA 4G63A 2RA1A 4XZCA 2IUBA 4YXDA 3QUJA 3LDQB 4GOUA 2XAGB 4IE4A 4U2ZA 4IDPA 4U7IA 2V7MA 4GK5E 3FXEB 2LHRA 1W0AA 4IIJE 3RYHE 5HEUA 4QWNB 4P0AA 4JI2T 5HEJA 2DI4A 4DV0T 4OX9T 2XQ9A 5HYAA 4UR9A 4HTEA 2CMRA 1WFDA 3CX8B 2NW8A 1E1HB 5L3CB 2OA5A 1FIOA 4XBFB 2CXFA 3E0ZA 1W9RA 1SE7A 3FZFB 4YJ2E 4DV7T 3T1HT 3UTKA 3B5MA 3H37A 3O4XE 2J47A 3P50A 3KDSE 2GK9A 3ZYMA 2F4VT 4ZI3D 4KHZF 4TN7B 4O2BE 4PJJA 5LBMA 4ASKA 1Y01A 2XAFB 2YU2A 2X67A 3AA1B 5AQJB 5HAXA 3AE2A 4CN1A 1YQ3A 2R6GF 2L8KA 1SUMB 3HR0A 3OPCA 1BR0A 1S35A 2Z6EA 2V7IA 3S4UA 3ETUA 5JR9C 4LFCT 4IT4A 5LMUT 4IDQA 3SRZA 4UV9B 2XY8B 4B3RT 2WMOA 4N78D 5JDHA 1IBMT 5HEHA 4J2CA
chains in the Genus database with same CATH topology
4MLKA 3N9LA 2VK9A 1KK7A 2W62A 4TUYE 1QSDA 5HXEA 3HKEE 3EVYA 4QX8B 5HXCA 1LVKA 3ZCIA 3VHLA 3P7IA 1MNEA 1HTJF 5H6RB 4AQGA 3CVRA 4Z8XA 3Q5WA 3RRWA 2UXXB 3C64A 4EZHA 1NAFA 3CX6B 2ZM0A 2E9XA 4U74A 1V9DA 1WLXA 1ZEEA 2Q9QA 4QKNA 2D0TA 2NW7A 4EAHA 3ZMTB 5HXHA 3FBLA 3I1AA 4GYSA 4ZI7E 2DWGA 1WR6A 3QC9A 1ZHCA 5FY7A 2QA7A 5DJQC 2VB6A 3Q2MA 3N9QA 3N5LA 4UELA 3FB2A 1MIWA 3PUGA 2L9QA 3I0OA 3N2OA 4U72A 4GIWA 4ZI2D 4KP3C 2YEVC 1Y64B 3RYIE 4ILUA 4AI6A 4IGUA 2KNDA 4O4IE 2N9DA 2MYSA 2CLYB 2HPJA 3GN5B 5FY1A 5L2LA 5JDFA 2E8IA 4H63H 4JUYA 5A1LA 1QUUA 3SWHA 4BJMA 1LRZA 3KV5A 5JH7E 4AXPA 2H7VC 4BA9A 1U4QA 2KINB 2YU1A 2CCQA 4TV9E 4E7SA 5L3EB 2CE7A 2E9XD 2VL8A 3AB3B 2HH7A 4CZZB 3GMIA 1LKXA 2N2NA 2XUEA 3N2KE 5JR9B 4JEUB 2ODUA 2VKDA 2VWAA 2K24A 3CPZA 4EIWA 3OBVE 2JQQA 1MIYA 3AA0B 4HFVA 1CUNA 1MMNA 3ETVA 3DJBA 4PJLA 5FYMA 3ZLIA 2DLRA 2NTXA 4PW8A 2CXDA 5L3BB 2D2SA 4PK4A 2ZM8A 4UVBB 3ZYLA 5KMGP 5LNKA 2JMKA 1IAPA 2V7LA 4OYJA 3UUMA 3ZCJA 5H6QB 3GWHA 3NZPA 3R6NA 5JDNA 4H9SE 4AQFA 2A3DA 3Q9DA 2JRKA 3O1HA 4PNIA 2HPLA 3F2EA 1FMWA 5JR9A 2IAKA 4IE0A 1T98A 3JC6C 3J9X1 2D5UA 4L0RA 4H9OC 1OXZA 4G2AA 4QXHB 1EZ3A 2H3RA 2MTQA 3ZMSB 4H9NC 2PJQA 4NUVA 4XAXB 3ZYKA 3CQGB 5JDMA 1YKHB 2D0UA 1O3XA 3PUSA 3C4WA 1SA0E 2CWOA 4K0UA 4HGAA 4UEMA 2CLYC 4AKRB 4EZ4A 4UIGA 5E0OA 3V5UA 3VKHA 3TKLB 2XAQB 5ETWA 3ANWB 3PU3A 5LYJE 2XTLA 3ZMUB 2CA5A 5L3GB 3KVAA 4ISSA 1WYCA 3HKDE 3L09A 4P0BA 3ZPOA 1D1BA 4QX7B 1G73A 3UT5E 3CQCB 4ZHQE 2ACXA 5EK4A 2WWUA 4ZS2A 2XAHB 4UVCB 5FY0A 5F3JA 1WRDA 4IE6A 1IJ5A 3BQKA 4KBMB 4EYYR 5HXSA 2CWYA 3O1IA 2Y8DA 5KX5E 2C5KT 5FXVA 2ZM2A 4HE8A 3ZMZB 2ZLYA 2SPCA 3N9NA 5EZYE 3ANWA 3ZJ1A 2C5JA 2PFVA 3SS1A 3M65A 1MMDA 1NWMX 2WBLA 1Z0PA 2X51A 4WBOA 1HFAA 2M67A 1YD8G 1OWAA 3C4XA 4AKHA 2YINA 3RH3A 4MBQA 3AAIA 5TAOA 4ZS3A 2KMFA 5FXZA 5GONE 2LE8A 4PFOA 4I55E 2EHOA 2C5IT 4DBQA 5J2TE 4GYRA 2KWIB 1UX5A 3RRCA 5KDMC 5JDQA 1S94A 5DQVA 3ESLA 4EYUA 3D0TA 2DNXA 2KZ7B 2I59A 4ISTA 3FHNA 4HN9A 4P09A 5CA1E 4OYKA 4CI3B 4EB6E 4O4HE 4FI5A 3DTOA 2BVLA 5LGNB 2G0UA 5BMVE 3IBPA 4IE7A 3NBXX 2B1EA 4PK5A 2JMHA 2W61A 3O9XA 2EHOD 5LGTB 2WSSV 3EDUA 2X9WA 2LOPA 4EOZB 3LK2B 4WNKA 2UXNB 2MBGA 3MA9A 2Q9QD 3OYZA 3ZN1B 3UUXB 3ZJ2A 2LT3A 4YHJA 4MFRA 5LBQB 1HF8A 4IDZA 2N1GA 2Y48B 3CMLA 5FMNA 2MOZA 4I4TE 3LK3B 4L9IA 3MKDA 4MALA 5CB4E 2NW9A 4ZI2C 5JREA 2ODVA 3I9YA 5DQWA 3UUNA 3HKBE 1UX4A 2LSJA 3BQIA 2LJLA 5EK3A 5LA6E 3V5SA 3E08A 3GN5A 4B6XA 2NP9A 2X0LB 4DO0A 4TX5A 3I9WA 2YK0A 3RKOA 3FXDB 4DMWA 2IC6A 2BVMA 3H3AA 3VKGA 1WYBA 2E9XC 2JJ9A 2X9YA 5DABA 3K8PC 4WW0A 1MMAA 1FEWA 2NWBA 5LGUB 1D0ZA 2XHEB 1MNDA 3AAEB 3O1JA 4GK0E 5LOVE 5LP6E 4DMVA 2V26A 3RX6A 3IHRA 3QK6A 4C90A 3KV4A 3PUQA 3MACA 4C91A 4WBNE 3HL6A 2VKOA 3L3PA 3U78A 3RYFE 1BR1A 3IEEA 2BDEA 5LJMA 2RP4A 4M1PA 5ADXL 3MXZA 3ZEFB 3KVBA 3LJCA 1VOMA 3LBXB 3ONXA 3J7Yq 3C98B 3PURA 3UFEA 4PJMA 3AA6B 4CI2B 3F31A 5IYZE 4UXNB 4ZI3C 3K3QC 2LSGA 3PU8A 5J1GA 3KBUA 1VRBA 2L3LA 1HS7A 3KBTA 4TV8E 1LVFA 2VASA 4H9QC 4V1Av 2V1DB 4PK6A 2A2FX 2V7JA 4I50E 2X9XA 3UULA 1HCIA 4YLHA 4CXXA 2XASB 4H63V 3AA7B 3CX7B 5FXWA 4AKGA 3C50A 3N9OA 3CQXC 3LBXA 3DP7A 4AKLA 3AVRA 4X1KE 4AQFC 5EK2A 1D1CA 1FMVA 4O2AE 4X1IE 3B57A 3T8OA 5C8YE 2XQYA 4NUUA 3OJAA 2DCFA 2KWHA 2K48A 1D1AA 2V7KA 3ZN0B 4E7ZA 2W0GA 4KUMB 4O4LE 4L5GA 3U3IA 3WAJA 4OFZA 3N9MA 4IHJE 2KLQA 2C0SA 3LK42 2E9XB 4CXWA 4F6RC 2KXPB 4IE5A 5L3DB 3OKQA 4G63A 5F8PA 2RA1A 5LHHB 2LOSA 4XZCA 3HKCE 4PAGA 1BR2A 3QUJA 1ZV4X 3KV6A 4YJ3E 1IJ6A 5FXXA 1H7CA 3KV9A 3ZMVB 3OYXA 4GOUA 4O4JE 2XAGB 2NTYA 3C51A 2LSYA 4ZOLE 3MK7C 4IE4A 3K3OA 2Y6XA 1HG2A 3N2GE 3WI3A 2V7MA 4GK5E 3VU7H 2H7OA 2LSIA 3FXEB 4FJOA 4PJNA 2LHRA 3B13A 4IIJE 3MZKB 2P9BA 3KINB 3RYHE 3C4ZA 2PBIA 2ZMAA 4O8SA 5LCYA 4DBRA 5AFUL 3P8CD 3Q5XA 4X20E 1D0XA 5JQGE 4ADZA 4QWNB 1B7TA 2LHNA 3K3NA 5HXRA 2WMNA 3GA8A 2LEHA 4P0AA 2LSKA 2DI4A 3WAKA 2VKHA 2EHOC 1IZNB 2W00A 2WM9A 3CWZB 5HYAA 4HTEA 3MJXA 2CMRA 2Q9QC 1D0YA 4X1YE 4AKIA 2A72A 4CQIA 3CX8B 5CA0E 2BZBA 2CM0A 2NW8A 1E1HB 5L3CB 2WAUA 5J2UE 5LHGB 3JC6D 4CI1B 2OA5A 1FIOA 2IW5B 4XBFB 1MIVA 2CXFA 4OK0A 3E0ZA 4YFSA 3RC8A 2DWKA 3PTRB 2X66A 4YJ2E 3RC3A 2PG8A 2NOXA 2KT9A 3BQLA 3EDVA 1U5PA 1G8XA 3UTKA 4UV8B 2J1DG 2W63A 3H37A 4KMCA 4EXTA 3O4XE 5JRCB 3KDSE 4QHOA 2GK9A 3ZYMA 4ZI3D 4HKAA 1BR4A 3ZC1A 4A56A 1UCUA 3F57A 2ES0A 2IC9A 4TN7B 4O2BE 4PJJA 5LBMA 4ASKA 4OHFA 2XAFB 2YU2A 2X67A 4H9PC 4QXBB 2X68A 3AA1B 1YW0A 2QGSA 2VKJA 5IHYA 3I0QA 4UF0B 5HAXA 4UVAB 1AJ3A 1MMGA 3EUHA 3LG7A 4MHCA 4BJNA 3NRXA 3R84B 4H9RC 5JDLA 5JDGA 5LJNA 3AVSA 3KFWX 3E22E 2L8KA 1X79A 5JRCA 3HA4A 3CKDA 3HR0A 2K9AA 3HI2A 3A5XA 4BAYB 5LG4A 3W15B 4ANJA 5M4YA 5LHIB 1BR0A 1KNZA 1S35A 3RYCE 2CXLA 2Z6EA 2V7IA 3S4UA 4PFPA 4UF0A 3ZC0A 3PUAA 3ETUA 3NRYA 3PE0A 5JVDE 5JR9C 2X9HA 2CEAA 1US7B 2DHRA 3SOLA 5L3FB 4I43B 3FBZA 2EHOB 1YKEB 2JPFA 3AAAB 3BK9A 3N9PA 5FP3A 5HWXA 4JLEA 3LFMA 3SRZA 3IF8B 1SHZC 2XAJB 3NZQA 4UV9B 3RPUA 4ERRA 2Q9QB 2LM9A 2WMOA 2K5BB 1HG5A 5LXTE 4N78D 4JEHB 5JDHA 4TZ4C 3PDYA 4QXCB 5FNVE 4CXYA 4DVDA 4J2CA 4DNDA 1HX8A 5HWYA 1ZKEA 4HEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRC B;  5JR9 B;  3ZC1 A;  3ZC0 A;  5JRC A;  5JR9 C;  5JR9 A;  5JRE A; 
#chains in the Genus database with same CATH topology
 3N9L A;  3P4Q A;  1KK7 A;  4GKK T;  3UU4 A;  4JV5 T;  2W62 A;  3HKE E;  3VHL A;  1HTJ F;  5H6R B;  4Z8X A;  2UXX B;  4Q25 A;  1NAF A;  4QKN A;  4HWD A;  4EAH A;  4GYS A;  2DWG A;  1WR6 A;  5DJQ C;  3Q2M A;  5JTG A;  4NXM T;  3PUG A;  4KP3 C;  1ZOY A;  2E5V A;  5AQP B;  1YQ4 A;  4H63 H;  4JUY A;  1LRZ A;  1R8I A;  2H7V C;  2YU1 A;  5L3E B;  2E9X D;  4CZZ B;  2XUE A;  3N2K E;  2LLY A;  3AE6 A;  2VWA A;  4EIW A;  3OBV E;  4HFV A;  4HWC A;  1MMN A;  2BBH A;  3ZLI A;  5FYM A;  2W67 A;  2DLR A;  5LNK A;  2JMK A;  2BKO A;  3RHW A;  3PUX F;  2VVN A;  5JDN A;  2A3D A;  4YTN A;  2JRK A;  2D5U A;  3PUY F;  2MTQ A;  1L0V A;  4HFD A;  2PJQ A;  5JDM A;  1YKH B;  3C4W A;  3ZT5 A;  2CWO A;  4LMJ A;  4UEM A;  3UU5 A;  1E7P A;  5ETW A;  3ANW B;  3PU3 A;  2BKN A;  1WYC A;  3HKD E;  3ZPO A;  4QX7 B;  1UUR A;  4AQY T;  4ZS2 A;  5FY0 A;  5F3J A;  2VL0 A;  4IE6 A;  3OVU A;  2CWY A;  5F5W A;  5KX5 E;  5FXV A;  2ZM2 A;  3ZMZ B;  2SPC A;  3ANW A;  2C5J A;  2PFV A;  3SS1 A;  3M65 A;  1MMD A;  4Z90 A;  4WBO A;  2FJB A;  1OWA A;  4AKH A;  2D9D A;  5TAO A;  5FXZ A;  5AQN B;  2C5I T;  4DBQ A;  4GYR A;  3QNU A;  3RRC A;  5JDQ A;  2OLT A;  3D0T A;  2DNX A;  1N33 T;  2BVL A;  2YKS A;  2NR4 A;  2CRB A;  4DR3 T;  2EHO D;  4LF8 T;  5LGT B;  2WSS V;  3AE7 A;  5ABF A;  3UU3 A;  2Q9Q D;  3OYZ A;  2W2U A;  4YHJ A;  4MFR A;  1HF8 A;  5AQL B;  4I4T E;  3LK3 B;  4MAL A;  5DQW A;  3HKB E;  4LF4 T;  2LSJ A;  5LA6 E;  2LJL A;  4TWH A;  2X0L B;  5AQU B;  3RKO A;  3FZM B;  3FXD B;  4DMW A;  1HX1 B;  2BVM A;  2X9Y A;  1FEW A;  1D0Z A;  4A98 A;  3EAB A;  5L47 A;  2V26 A;  4P1N A;  2LRL A;  5LJM A;  3AE8 A;  3KVB A;  3C98 B;  3UFE A;  3IA3 A;  2WDQ A;  4X65 T;  2LSG A;  3KBU A;  2WU2 A;  4V1A v;  4PK6 A;  2A2F X;  4YSX A;  2X9X A;  1HCI A;  4LF9 T;  4DR7 T;  1FMV A;  5L4H A;  4HFI A;  4LF6 T;  2XPK A;  4NUU A;  3OJA A;  2DCF A;  2K48 A;  1XWM A;  3RGL A;  4E7Z A;  4KUM B;  3U3I A;  1T7S A;  2KLQ A;  2E9X B;  2KXP B;  4IL9 A;  3OKQ A;  2WQY A;  5F8P A;  3TLT A;  3HKC E;  1BR2 A;  2CBJ A;  3AEE A;  5FL1 A;  2BG9 A;  4YJ3 E;  1IJ6 A;  5FXX A;  2WS3 A;  3C51 A;  2I0M A;  1XDO A;  3TLS A;  1OED E;  3N2G E;  3WI3 A;  4TWF A;  3CK6 A;  4PJN A;  2WB5 A;  3RI5 A;  2P9B A;  3C4Z A;  2LEH A;  1HR0 T;  1WCR A;  2LSK A;  3WAK A;  3P4S A;  2XJ7 A;  1IZN B;  2WM9 A;  1M62 A;  2YOE A;  4X1Y E;  4DV3 T;  2BZB A;  2CM0 A;  3RIU C;  3JC6 D;  2IW5 B;  1MIV A;  4OK0 A;  2PG8 A;  2KT9 A;  1U5P A;  1G8X A;  1KF6 A;  3EHZ A;  2W63 A;  4EXT A;  2XQ5 A;  4QHO A;  2XM2 A;  3P4W A;  3AEG A;  4H9P C;  4QXB B;  2X68 A;  1NEN A;  2VKJ A;  5IHY A;  4UF0 B;  4UVA B;  3FZL B;  3EUH A;  3LG7 A;  5JDG A;  3AVS A;  5C3J A;  2K9A A;  3HI2 A;  3A5X A;  4BAY B;  4EV6 A;  3H3M A;  2H88 A;  4TWD A;  1KNZ A;  2CXL A;  3UU8 A;  4PFP A;  4UF0 A;  2WCA A;  3PE0 A;  5JVD E;  4LFB T;  2CEA A;  5L3F B;  2XSA A;  4I43 B;  2EHO B;  1YKE B;  3BK9 A;  3N9P A;  3LFM A;  2Q9Q B;  2K5B B;  1CHU A;  4TZ4 C;  3PDY A;  5FNV E;  4CXY A;  4DVD A;  1HX8 A;  1ZKE A;  4A5X A;  4HEA A;  4MLK A;  4TUY E;  3EVY A;  4ZXL A;  3ZCI A;  5LG3 A;  3CVR A;  3Q5W A;  3Q5E A;  3RRW A;  4EZH A;  4U74 A;  2K3W A;  1V9D A;  1WLX A;  1KNP A;  2Q9Q A;  3AE1 A;  3JAF A;  2D0T A;  4ZI7 E;  2QVA A;  2YDQ A;  1ZHC A;  3T1Y T;  2VB6 A;  4UEL A;  3FB2 A;  4GIW A;  2YEV C;  1Y64 B;  4ILU A;  2KND A;  3GN5 B;  5L2L A;  5FY1 A;  2H89 A;  1QUU A;  3SWH A;  4BJM A;  1U4Q A;  2KIN B;  4TV9 E;  2UU9 T;  2VL8 A;  3CPZ A;  1MIY A;  3AA0 B;  4B3M T;  1CUN A;  2B76 A;  4PJL A;  1M7K A;  2NTX A;  4X66 T;  5L3B B;  2D2S A;  4PK4 A;  2ZM8 A;  3ZYL A;  5KMG P;  3UUM A;  3ZCJ A;  3GWH A;  3NZP A;  4H9S E;  2IIU A;  5HCJ A;  3O1H A;  3F2E A;  1FMW A;  5AQT B;  2IAK A;  3A7M A;  4GKJ T;  2FJE A;  2AE9 A;  4H9O C;  2BS2 A;  2CHN A;  2H3R A;  4JI6 T;  4H9N C;  3AEF A;  1J5E T;  1I94 T;  2LKG A;  2CLY C;  2M6B A;  4EZ4 A;  5E0O A;  2IHR 1;  5LYJ E;  2CA5 A;  3M3Z B;  4WYV A;  3Q5D A;  4HFH A;  1IJ5 A;  3BQK A;  4KBM B;  5AQV B;  5HXS A;  3O1I A;  2FBW A;  2Y8D A;  2W66 A;  1NWM X;  2WBL A;  3AEA A;  4DUY T;  1HFA A;  1YD8 G;  4JI1 T;  3P4R A;  4ZEY A;  4I55 E;  1UX5 A;  2FJD A;  5KDM C;  3ESL A;  2X0H A;  4IST A;  4P09 A;  5CA1 E;  4CI3 B;  4EB6 E;  4FI5 A;  3DTO A;  4CN6 A;  3IBP A;  1OED B;  2B1E A;  4JI7 T;  4NPP A;  2FUP A;  1UK5 A;  4EOZ B;  3ZN1 B;  3UUX B;  3ZJ2 A;  3UQ4 A;  4IDN A;  3MKD A;  5CB4 E;  1OED A;  4ZI2 C;  4COF A;  3BQI A;  5EK3 A;  3V5S A;  4DR1 T;  3E08 A;  3UFG A;  2BKP A;  2PTF A;  5AQF B;  3H3A A;  3VKG A;  2UXB T;  4HFB A;  4F8H A;  3K8P C;  2XM1 A;  5LP6 E;  3RX6 A;  4C90 A;  4Z91 A;  4YTP A;  4C91 A;  1FJG T;  3HL6 A;  3PUV F;  3AE9 A;  3IEE A;  2RP4 A;  1VOM A;  3LBX B;  5C2T A;  3ONX A;  3AA6 B;  4UXN B;  3K3Q C;  4HWH A;  3PU8 A;  5J1G A;  1VRB A;  4DR6 T;  2L3L A;  2WU5 A;  1W0B A;  4TV8 E;  4ILB A;  1LVF A;  2VAS A;  2V7J A;  3UUL A;  4YLH A;  4HWF A;  5AQG B;  3PUZ F;  3LBX A;  1D1C A;  2IDO B;  3RIA A;  5HCM A;  4O2A E;  4X1I E;  2XQ8 A;  1JNZ A;  1VCT A;  1KNR A;  2UXC T;  4KHP T;  3ZN0 B;  2W0G A;  4O4L E;  4L5G A;  3N9M A;  2OV9 A;  2C0S A;  3AXJ B;  5L3D B;  4LF5 T;  5LHH B;  2LOS A;  4NIQ A;  3KV6 A;  1NEK A;  3FZK B;  3ZMV B;  3OYX A;  4K0K T;  4ZOL E;  4YTM A;  4U3C A;  3VU7 H;  4JI5 T;  2LSI A;  1HNX T;  4FJO A;  3PJA J;  1XNR T;  3MZK B;  2PBI A;  2ZMA A;  4DBR A;  5AFU L;  1XMQ T;  3Q5X A;  4X20 E;  1D0X A;  2LHN A;  3K3N A;  5HXR A;  3UQ7 A;  3AED A;  2W00 A;  3TLV A;  3MJX A;  4CQI A;  3ABV A;  2A9U A;  2WAU A;  3VRB A;  5J2U E;  4CI1 B;  4YFS A;  2DWK A;  4EGW A;  3PTR B;  2X66 A;  3RC3 A;  3BQL A;  1Z8U A;  4YT0 A;  3EDV A;  3L39 A;  4X62 T;  3A8Y C;  5BR8 T;  4UV8 B;  4KMC A;  5JRC B;  4HKA A;  1BR4 A;  4KI0 F;  3ZC1 A;  3F57 A;  2IC9 A;  5J0Z A;  5LB7 B;  3SFE A;  1YW0 A;  1WR0 A;  3EI0 A;  1AJ3 A;  1MMG A;  2VVS A;  4MHC A;  2CPT A;  3R84 B;  5JDL A;  3E22 E;  3RQU A;  5JRC A;  3CIR A;  2LKH A;  3HA4 A;  3CKD A;  4QH1 A;  5HEO A;  3W15 B;  4ANJ A;  5LHI B;  3RYC E;  4ILA A;  3ZC0 A;  3PUA A;  3NRY A;  1US7 B;  2DHR A;  3SOL A;  3AAA B;  5HWX A;  2FJA A;  3IF8 B;  3RPU A;  2LM9 A;  5LXT E;  1N32 T;  4JEH B;  2MAW A;  2XZE A;  4DR4 T;  3ZT6 A;  4AIU A;  5HXE A;  3P7I A;  4AQG A;  3C64 A;  3CX6 B;  2E9X A;  1ZEE A;  3ZMT B;  2WP9 A;  3FBL A;  3I1A A;  3TLW A;  3AE4 A;  1XNQ T;  5FY7 A;  3N5L A;  1MIW A;  2HHH T;  3N2O A;  3RYI E;  2ZM6 T;  4O4I E;  5AQM B;  2MYS A;  2CLY B;  5A1L A;  3KV5 A;  4BA9 A;  2CCQ A;  4E7S A;  2CE7 A;  3AB3 B;  1ZP0 A;  2HH7 A;  2N2N A;  5JR9 B;  4LML A;  2BS4 A;  2BBJ A;  3NVO A;  2JQQ A;  2YDR A;  3ETV A;  2XQ7 A;  4PW8 A;  2CXD A;  2V7L A;  4OYJ A;  2JIW A;  5H6Q B;  3R6N A;  3VRA A;  3Q9D A;  3RQW A;  2WZH A;  5AQO B;  4JYA T;  5FVK A;  5JR9 A;  1T98 A;  4G2A A;  4QXH B;  1N34 T;  4KX6 A;  2V6Y B;  4NUV A;  5AQI B;  2D0U A;  1O3X A;  4K0U A;  4HGA A;  2JQ9 A;  4UIG A;  2XAQ B;  2AXD S;  3KVA A;  3TLU A;  4ISS A;  4B3S T;  1D1B A;  4CN4 A;  3CQC B;  4ZHQ E;  2V6Y A;  2MPK A;  5EK4 A;  2WWU A;  4UVC B;  2C5K T;  1W09 A;  2ZLY A;  3ZJ1 A;  1Z0P A;  5HEG A;  2M67 A;  3C4X A;  2YIN A;  3AAI A;  4ZS3 A;  2KMF A;  5GON E;  2EHO A;  4JI4 T;  2KWI B;  2VQF T;  4EYU A;  4EEB A;  2I59 A;  3FHN A;  4DID B;  2RPA A;  4O4H E;  2UUC T;  4DV6 T;  5FKY A;  2G0U A;  5BMV E;  4IE7 A;  3JAD A;  3VR8 A;  3P4P A;  3RKG A;  1JNR A;  3EDU A;  2X9W A;  2VUR A;  2XQ4 A;  4WNK A;  2UXN B;  5LBQ B;  3NWI A;  4IDZ A;  2N1G A;  2Y48 B;  3CML A;  5FMN A;  4L9I A;  5AQR B;  3UUN A;  1UX4 A;  2BG9 C;  2E2A A;  4B6X A;  3GN5 A;  3OTO T;  2NP9 A;  4TX5 A;  2YK0 A;  5L4E A;  2E9X C;  5DAB A;  2UXD T;  4WW0 A;  5LGU B;  1MND A;  3O1J A;  4U33 A;  4DMV A;  3IHR A;  3QK6 A;  4DV4 T;  3PUQ A;  4WBN E;  2CHO A;  1N36 T;  3U78 A;  2XQ3 A;  3MXZ A;  3LJC A;  5ABH A;  3J7Y q;  3PUR A;  3JAE A;  4CI2 B;  5IYZ E;  1HS7 A;  3EAM A;  1J1J A;  3KBT A;  2V1D B;  4DUZ T;  3X1D A;  3AA7 B;  3CX7 B;  3C50 A;  3CQX C;  5EK2 A;  2QYW A;  3B57 A;  3T8O A;  5C8Y E;  2XQY A;  4LF7 T;  1YXR A;  2YN6 A;  2V7K A;  2BG9 E;  3ZKR A;  2KSR A;  2M6I A;  2WY2 A;  4OFZ A;  4IHJ E;  2WDV A;  4JBW F;  4CXW A;  4IE5 A;  4PAG A;  1VCS A;  1IBL T;  1ZV4 X;  1H7C A;  3KV9 A;  4X5T A;  4O4J E;  2NTY A;  2LSY A;  3MK7 C;  3K3O A;  2CBI A;  1T72 A;  2Y6X A;  1HG2 A;  2H7O A;  4HWI B;  3B13 A;  5CGM A;  3AE5 A;  3KIN B;  1QLB A;  2WWV A;  4O8S A;  5LCY A;  3P8C D;  5CJ5 A;  5JQG E;  4ADZ A;  1B7T A;  3ZT7 A;  2WMN A;  3GA8 A;  1HNW T;  2JQH A;  2VKH A;  2EHO C;  1DU2 A;  4ILC A;  3CWZ B;  2Q9Q C;  1D0Y A;  4DV1 T;  4AKI A;  2A72 A;  4HFC A;  5CA0 E;  5LHG B;  3AEB A;  2YDS A;  3RC8 A;  5AQK B;  2NOX A;  4JI3 T;  4IRE A;  4TNV A;  2J1D G;  4A56 A;  1UCU A;  3PUW F;  2ES0 A;  4NXN T;  4OHF A;  2LM2 A;  3UUB A;  2QGS A;  3I0Q A;  4DR5 T;  3JCF A;  4BJN A;  4YSY A;  3NRX A;  4H9R C;  2QRX A;  5LJN A;  3KFW X;  1X79 A;  3ONJ A;  3ZST A;  2VQE T;  5LG4 A;  2ACZ A;  5M4Y A;  1XDP A;  1I6Z A;  4DV2 T;  2X9H A;  3FBZ A;  2JPF A;  5FP3 A;  4JLE A;  1SHZ C;  2XAJ B;  3NZQ A;  4ERR A;  1HG5 A;  2BS3 A;  4QXC B;  4DND A;  1IBK T;  4YY3 T;  5HWY A;  1GQE A;  2VK9 A;  1QSD A;  4QX8 B;  5HXC A;  1LVK A;  1MNE A;  2HN2 A;  2XSB A;  2ZM0 A;  4X64 T;  3AXJ A;  2NW7 A;  1UGO A;  4YHH T;  2WDR A;  3RIU A;  5ABF B;  5HXH A;  3QC9 A;  2QA7 A;  3N9Q A;  1HNZ T;  2L9Q A;  3I0O A;  4ZI2 D;  4U72 A;  4AI6 A;  4IGU A;  2N9D A;  2HPJ A;  5JDF A;  2E8I A;  4AIS A;  5JH7 E;  4AXP A;  3GMI A;  1KFY A;  1LKX A;  3UU6 A;  4JEU B;  2ODU A;  4LFA T;  2VKD A;  2K24 A;  2UUA T;  1XMO T;  3DJB A;  4UVB B;  1IAP A;  4ZZB A;  3AE3 A;  4AQF A;  4PNI A;  2HPL A;  3SFD A;  4JI0 T;  4IE0 A;  4U31 A;  3JC6 C;  3J9X 1;  3LSV A;  4L0R A;  3RF1 A;  5FL0 A;  1OXZ A;  3PV0 F;  3RIF A;  1EZ3 A;  3ZMS B;  2XQ6 A;  2IML A;  3L8R A;  4XAX B;  3ZYK A;  3CQG B;  1OED C;  2J62 A;  4ZZC A;  3PUS A;  2I6H A;  1SA0 E;  4TNW A;  4AKR B;  3V5U A;  3VKH A;  3TKL B;  1X9B A;  2XTL A;  3ZMU B;  5L3G B;  3L09 A;  1E2A A;  4P0B A;  1G73 A;  3UT5 E;  3QB5 K;  2ACX A;  2W4X A;  2XAH B;  1WRD A;  2WZI A;  4EYY R;  3ONL C;  4EED A;  5AQS B;  4HE8 A;  1KEY A;  3N9N A;  5EZY E;  2X51 A;  3NKZ A;  4JI8 T;  3AEC A;  2BG9 B;  3RH3 A;  4MBQ A;  2LE8 A;  4PFO A;  2UUB T;  4IL4 A;  4LMK A;  5J2T E;  2JQK A;  1S94 A;  5DQV A;  2KZ7 B;  3QB5 A;  4HN9 A;  1T8B A;  1XZY A;  2HN1 A;  4OYK A;  4QH4 A;  5IWA T;  3ZSS A;  5LGN B;  3NBX X;  4PK5 A;  2JMH A;  2W61 A;  3O9X A;  1UUS A;  2V6X A;  4DV5 T;  1J5W A;  2LOP A;  3LK2 B;  2MBG A;  3MA9 A;  2J4G A;  2LT3 A;  3VR9 A;  2MOZ A;  2NW9 A;  5JRE A;  2DL1 A;  2ODV A;  5ABE A;  3I9Y A;  4DO0 A;  3I9W A;  2IC6 A;  4WZX A;  2V8S V;  1WYB A;  5CFB A;  2JJ9 A;  2V5D A;  1MMA A;  2NWB A;  4QH5 A;  2XHE B;  4GK0 E;  3AAE B;  5KXJ A;  5LOV E;  2V5C A;  5AQH B;  3FZH B;  5FVL A;  4U7Y A;  3KV4 A;  3G06 A;  3MAC A;  4HFE A;  2VKO A;  3L3P A;  3RYF E;  1BR1 A;  2BDE A;  3RLF F;  4M1P A;  5ADX L;  3ZEF B;  4YSZ A;  2XQA A;  4PJM A;  3F31 A;  4ZI3 C;  5LMN T;  3K1S A;  4H9Q C;  3QOF A;  4A97 A;  4I50 E;  4DR2 T;  2LRK A;  4CXX A;  2XAS B;  4H63 V;  4IDO A;  5FXW A;  4U2Y A;  4AKG A;  3N9O A;  3DP7 A;  4AKL A;  3AVR A;  4X1K E;  5AQQ B;  4AQF C;  3PJA A;  2KWH A;  2E5L T;  2X0Y A;  1D1A A;  5ABG A;  3WAJ A;  4I0U A;  4B3T T;  3LK4 2;  4F6R C;  5IUX A;  4G63 A;  2RA1 A;  4XZC A;  2IUB A;  4YXD A;  3QUJ A;  3LDQ B;  4GOU A;  2XAG B;  4IE4 A;  4U2Z A;  4IDP A;  4U7I A;  2V7M A;  4GK5 E;  3FXE B;  2LHR A;  1W0A A;  4IIJ E;  3RYH E;  5HEU A;  4QWN B;  4P0A A;  4JI2 T;  5HEJ A;  2DI4 A;  4DV0 T;  4OX9 T;  2XQ9 A;  5HYA A;  4UR9 A;  4HTE A;  2CMR A;  1WFD A;  3CX8 B;  2NW8 A;  1E1H B;  5L3C B;  2OA5 A;  1FIO A;  4XBF B;  2CXF A;  3E0Z A;  1W9R A;  1SE7 A;  3FZF B;  4YJ2 E;  4DV7 T;  3T1H T;  3UTK A;  3B5M A;  3H37 A;  3O4X E;  2J47 A;  3P50 A;  3KDS E;  2GK9 A;  3ZYM A;  2F4V T;  4ZI3 D;  4KHZ F;  4TN7 B;  4O2B E;  4PJJ A;  5LBM A;  4ASK A;  1Y01 A;  2XAF B;  2YU2 A;  2X67 A;  3AA1 B;  5AQJ B;  5HAX A;  3AE2 A;  4CN1 A;  1YQ3 A;  2R6G F;  2L8K A;  1SUM B;  3HR0 A;  3OPC A;  1BR0 A;  1S35 A;  2Z6E A;  2V7I A;  3S4U A;  3ETU A;  5JR9 C;  4LFC T;  4IT4 A;  5LMU T;  4IDQ A;  3SRZ A;  4UV9 B;  2XY8 B;  4B3R T;  2WMO A;  4N78 D;  5JDH A;  1IBM T;  5HEH A;  4J2C A; 
#chains in the Genus database with same CATH homology
 4MLK A;  3N9L A;  2VK9 A;  1KK7 A;  2W62 A;  4TUY E;  1QSD A;  5HXE A;  3HKE E;  3EVY A;  4QX8 B;  5HXC A;  1LVK A;  3ZCI A;  3VHL A;  3P7I A;  1MNE A;  1HTJ F;  5H6R B;  4AQG A;  3CVR A;  4Z8X A;  3Q5W A;  3RRW A;  2UXX B;  3C64 A;  4EZH A;  1NAF A;  3CX6 B;  2ZM0 A;  2E9X A;  4U74 A;  1V9D A;  1WLX A;  1ZEE A;  2Q9Q A;  4QKN A;  2D0T A;  2NW7 A;  4EAH A;  3ZMT B;  5HXH A;  3FBL A;  3I1A A;  4GYS A;  4ZI7 E;  2DWG A;  1WR6 A;  3QC9 A;  1ZHC A;  5FY7 A;  2QA7 A;  5DJQ C;  2VB6 A;  3Q2M A;  3N9Q A;  3N5L A;  4UEL A;  3FB2 A;  1MIW A;  3PUG A;  2L9Q A;  3I0O A;  3N2O A;  4U72 A;  4GIW A;  4ZI2 D;  4KP3 C;  2YEV C;  1Y64 B;  3RYI E;  4ILU A;  4AI6 A;  4IGU A;  2KND A;  4O4I E;  2N9D A;  2MYS A;  2CLY B;  2HPJ A;  3GN5 B;  5FY1 A;  5L2L A;  5JDF A;  2E8I A;  4H63 H;  4JUY A;  5A1L A;  1QUU A;  3SWH A;  4BJM A;  1LRZ A;  3KV5 A;  5JH7 E;  4AXP A;  2H7V C;  4BA9 A;  1U4Q A;  2KIN B;  2YU1 A;  2CCQ A;  4TV9 E;  4E7S A;  5L3E B;  2CE7 A;  2E9X D;  2VL8 A;  3AB3 B;  2HH7 A;  4CZZ B;  3GMI A;  1LKX A;  2N2N A;  2XUE A;  3N2K E;  5JR9 B;  4JEU B;  2ODU A;  2VKD A;  2VWA A;  2K24 A;  3CPZ A;  4EIW A;  3OBV E;  2JQQ A;  1MIY A;  3AA0 B;  4HFV A;  1CUN A;  1MMN A;  3ETV A;  3DJB A;  4PJL A;  5FYM A;  3ZLI A;  2DLR A;  2NTX A;  4PW8 A;  2CXD A;  5L3B B;  2D2S A;  4PK4 A;  2ZM8 A;  4UVB B;  3ZYL A;  5KMG P;  5LNK A;  2JMK A;  1IAP A;  2V7L A;  4OYJ A;  3UUM A;  3ZCJ A;  5H6Q B;  3GWH A;  3NZP A;  3R6N A;  5JDN A;  4H9S E;  4AQF A;  2A3D A;  3Q9D A;  2JRK A;  3O1H A;  4PNI A;  2HPL A;  3F2E A;  1FMW A;  5JR9 A;  2IAK A;  4IE0 A;  1T98 A;  3JC6 C;  3J9X 1;  2D5U A;  4L0R A;  4H9O C;  1OXZ A;  4G2A A;  4QXH B;  1EZ3 A;  2H3R A;  2MTQ A;  3ZMS B;  4H9N C;  2PJQ A;  4NUV A;  4XAX B;  3ZYK A;  3CQG B;  5JDM A;  1YKH B;  2D0U A;  1O3X A;  3PUS A;  3C4W A;  1SA0 E;  2CWO A;  4K0U A;  4HGA A;  4UEM A;  2CLY C;  4AKR B;  4EZ4 A;  4UIG A;  5E0O A;  3V5U A;  3VKH A;  3TKL B;  2XAQ B;  5ETW A;  3ANW B;  3PU3 A;  5LYJ E;  2XTL A;  3ZMU B;  2CA5 A;  5L3G B;  3KVA A;  4ISS A;  1WYC A;  3HKD E;  3L09 A;  4P0B A;  3ZPO A;  1D1B A;  4QX7 B;  1G73 A;  3UT5 E;  3CQC B;  4ZHQ E;  2ACX A;  5EK4 A;  2WWU A;  4ZS2 A;  2XAH B;  4UVC B;  5FY0 A;  5F3J A;  1WRD A;  4IE6 A;  1IJ5 A;  3BQK A;  4KBM B;  4EYY R;  5HXS A;  2CWY A;  3O1I A;  2Y8D A;  5KX5 E;  2C5K T;  5FXV A;  2ZM2 A;  4HE8 A;  3ZMZ B;  2ZLY A;  2SPC A;  3N9N A;  5EZY E;  3ANW A;  3ZJ1 A;  2C5J A;  2PFV A;  3SS1 A;  3M65 A;  1MMD A;  1NWM X;  2WBL A;  1Z0P A;  2X51 A;  4WBO A;  1HFA A;  2M67 A;  1YD8 G;  1OWA A;  3C4X A;  4AKH A;  2YIN A;  3RH3 A;  4MBQ A;  3AAI A;  5TAO A;  4ZS3 A;  2KMF A;  5FXZ A;  5GON E;  2LE8 A;  4PFO A;  4I55 E;  2EHO A;  2C5I T;  4DBQ A;  5J2T E;  4GYR A;  2KWI B;  1UX5 A;  3RRC A;  5KDM C;  5JDQ A;  1S94 A;  5DQV A;  3ESL A;  4EYU A;  3D0T A;  2DNX A;  2KZ7 B;  2I59 A;  4IST A;  3FHN A;  4HN9 A;  4P09 A;  5CA1 E;  4OYK A;  4CI3 B;  4EB6 E;  4O4H E;  4FI5 A;  3DTO A;  2BVL A;  5LGN B;  2G0U A;  5BMV E;  3IBP A;  4IE7 A;  3NBX X;  2B1E A;  4PK5 A;  2JMH A;  2W61 A;  3O9X A;  2EHO D;  5LGT B;  2WSS V;  3EDU A;  2X9W A;  2LOP A;  4EOZ B;  3LK2 B;  4WNK A;  2UXN B;  2MBG A;  3MA9 A;  2Q9Q D;  3OYZ A;  3ZN1 B;  3UUX B;  3ZJ2 A;  2LT3 A;  4YHJ A;  4MFR A;  5LBQ B;  1HF8 A;  4IDZ A;  2N1G A;  2Y48 B;  3CML A;  5FMN A;  2MOZ A;  4I4T E;  3LK3 B;  4L9I A;  3MKD A;  4MAL A;  5CB4 E;  2NW9 A;  4ZI2 C;  5JRE A;  2ODV A;  3I9Y A;  5DQW A;  3UUN A;  3HKB E;  1UX4 A;  2LSJ A;  3BQI A;  2LJL A;  5EK3 A;  5LA6 E;  3V5S A;  3E08 A;  3GN5 A;  4B6X A;  2NP9 A;  2X0L B;  4DO0 A;  4TX5 A;  3I9W A;  2YK0 A;  3RKO A;  3FXD B;  4DMW A;  2IC6 A;  2BVM A;  3H3A A;  3VKG A;  1WYB A;  2E9X C;  2JJ9 A;  2X9Y A;  5DAB A;  3K8P C;  4WW0 A;  1MMA A;  1FEW A;  2NWB A;  5LGU B;  1D0Z A;  2XHE B;  1MND A;  3AAE B;  3O1J A;  4GK0 E;  5LOV E;  5LP6 E;  4DMV A;  2V26 A;  3RX6 A;  3IHR A;  3QK6 A;  4C90 A;  3KV4 A;  3PUQ A;  3MAC A;  4C91 A;  4WBN E;  3HL6 A;  2VKO A;  3L3P A;  3U78 A;  3RYF E;  1BR1 A;  3IEE A;  2BDE A;  5LJM A;  2RP4 A;  4M1P A;  5ADX L;  3MXZ A;  3ZEF B;  3KVB A;  3LJC A;  1VOM A;  3LBX B;  3ONX A;  3J7Y q;  3C98 B;  3PUR A;  3UFE A;  4PJM A;  3AA6 B;  4CI2 B;  3F31 A;  5IYZ E;  4UXN B;  4ZI3 C;  3K3Q C;  2LSG A;  3PU8 A;  5J1G A;  3KBU A;  1VRB A;  2L3L A;  1HS7 A;  3KBT A;  4TV8 E;  1LVF A;  2VAS A;  4H9Q C;  4V1A v;  2V1D B;  4PK6 A;  2A2F X;  2V7J A;  4I50 E;  2X9X A;  3UUL A;  1HCI A;  4YLH A;  4CXX A;  2XAS B;  4H63 V;  3AA7 B;  3CX7 B;  5FXW A;  4AKG A;  3C50 A;  3N9O A;  3CQX C;  3LBX A;  3DP7 A;  4AKL A;  3AVR A;  4X1K E;  4AQF C;  5EK2 A;  1D1C A;  1FMV A;  4O2A E;  4X1I E;  3B57 A;  3T8O A;  5C8Y E;  2XQY A;  4NUU A;  3OJA A;  2DCF A;  2KWH A;  2K48 A;  1D1A A;  2V7K A;  3ZN0 B;  4E7Z A;  2W0G A;  4KUM B;  4O4L E;  4L5G A;  3U3I A;  3WAJ A;  4OFZ A;  3N9M A;  4IHJ E;  2KLQ A;  2C0S A;  3LK4 2;  2E9X B;  4CXW A;  4F6R C;  2KXP B;  4IE5 A;  5L3D B;  3OKQ A;  4G63 A;  5F8P A;  2RA1 A;  5LHH B;  2LOS A;  4XZC A;  3HKC E;  4PAG A;  1BR2 A;  3QUJ A;  1ZV4 X;  3KV6 A;  4YJ3 E;  1IJ6 A;  5FXX A;  1H7C A;  3KV9 A;  3ZMV B;  3OYX A;  4GOU A;  4O4J E;  2XAG B;  2NTY A;  3C51 A;  2LSY A;  4ZOL E;  3MK7 C;  4IE4 A;  3K3O A;  2Y6X A;  1HG2 A;  3N2G E;  3WI3 A;  2V7M A;  4GK5 E;  3VU7 H;  2H7O A;  2LSI A;  3FXE B;  4FJO A;  4PJN A;  2LHR A;  3B13 A;  4IIJ E;  3MZK B;  2P9B A;  3KIN B;  3RYH E;  3C4Z A;  2PBI A;  2ZMA A;  4O8S A;  5LCY A;  4DBR A;  5AFU L;  3P8C D;  3Q5X A;  4X20 E;  1D0X A;  5JQG E;  4ADZ A;  4QWN B;  1B7T A;  2LHN A;  3K3N A;  5HXR A;  2WMN A;  3GA8 A;  2LEH A;  4P0A A;  2LSK A;  2DI4 A;  3WAK A;  2VKH A;  2EHO C;  1IZN B;  2W00 A;  2WM9 A;  3CWZ B;  5HYA A;  4HTE A;  3MJX A;  2CMR A;  2Q9Q C;  1D0Y A;  4X1Y E;  4AKI A;  2A72 A;  4CQI A;  3CX8 B;  5CA0 E;  2BZB A;  2CM0 A;  2NW8 A;  1E1H B;  5L3C B;  2WAU A;  5J2U E;  5LHG B;  3JC6 D;  4CI1 B;  2OA5 A;  1FIO A;  2IW5 B;  4XBF B;  1MIV A;  2CXF A;  4OK0 A;  3E0Z A;  4YFS A;  3RC8 A;  2DWK A;  3PTR B;  2X66 A;  4YJ2 E;  3RC3 A;  2PG8 A;  2NOX A;  2KT9 A;  3BQL A;  3EDV A;  1U5P A;  1G8X A;  3UTK A;  4UV8 B;  2J1D G;  2W63 A;  3H37 A;  4KMC A;  4EXT A;  3O4X E;  5JRC B;  3KDS E;  4QHO A;  2GK9 A;  3ZYM A;  4ZI3 D;  4HKA A;  1BR4 A;  3ZC1 A;  4A56 A;  1UCU A;  3F57 A;  2ES0 A;  2IC9 A;  4TN7 B;  4O2B E;  4PJJ A;  5LBM A;  4ASK A;  4OHF A;  2XAF B;  2YU2 A;  2X67 A;  4H9P C;  4QXB B;  2X68 A;  3AA1 B;  1YW0 A;  2QGS A;  2VKJ A;  5IHY A;  3I0Q A;  4UF0 B;  5HAX A;  4UVA B;  1AJ3 A;  1MMG A;  3EUH A;  3LG7 A;  4MHC A;  4BJN A;  3NRX A;  3R84 B;  4H9R C;  5JDL A;  5JDG A;  5LJN A;  3AVS A;  3KFW X;  3E22 E;  2L8K A;  1X79 A;  5JRC A;  3HA4 A;  3CKD A;  3HR0 A;  2K9A A;  3HI2 A;  3A5X A;  4BAY B;  5LG4 A;  3W15 B;  4ANJ A;  5M4Y A;  5LHI B;  1BR0 A;  1KNZ A;  1S35 A;  3RYC E;  2CXL A;  2Z6E A;  2V7I A;  3S4U A;  4PFP A;  4UF0 A;  3ZC0 A;  3PUA A;  3ETU A;  3NRY A;  3PE0 A;  5JVD E;  5JR9 C;  2X9H A;  2CEA A;  1US7 B;  2DHR A;  3SOL A;  5L3F B;  4I43 B;  3FBZ A;  2EHO B;  1YKE B;  2JPF A;  3AAA B;  3BK9 A;  3N9P A;  5FP3 A;  5HWX A;  4JLE A;  3LFM A;  3SRZ A;  3IF8 B;  1SHZ C;  2XAJ B;  3NZQ A;  4UV9 B;  3RPU A;  4ERR A;  2Q9Q B;  2LM9 A;  2WMO A;  2K5B B;  1HG5 A;  5LXT E;  4N78 D;  4JEH B;  5JDH A;  4TZ4 C;  3PDY A;  4QXC B;  5FNV E;  4CXY A;  4DVD A;  4J2C A;  4DND A;  1HX8 A;  5HWY A;  1ZKE A;  4HEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...