3ZC1A

Crystal structure of afc3po
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
190
structure length
190
Chain Sequence
b'MRLEECRKRLEELEAAREELLKVLREMRIHSTKSIALIHAGKVEEAEQELKKAIELLEKVKAYREYPEIYFYLCNDAMQELVEAIAFKNAISGEFTFEIDLEVTPAAFLNGFADAVGELRRYALTKLIEGDFKSAERMLEVMEKIYERLMEFTTFPDKLVSGLRKKLDVARGGIERTKSDYIAAKVARLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFTRAX
publication title Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 73
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zc1A00
5JR9B 5JRCB 5JREA 3ZC0A 5JR9A 5JR9C 5JRCA 3ZC1A
chains in the Genus database with same CATH superfamily
3L09A 5LHGB 4UVBB 4ISTA 3SFDA 2CHNA 3QUJA 5LYJE 3ZYLA 2WWUA 4UV8B 3MJXA 4HFVA 5FVLA 4C90A 2Q9QA 4GK5E 2LRKA 2M67A 4ZI3D 5AQSB 4ZOLE 2KT9A 5CGMA 4GKJT 3MKDA 2W61A 2FUPA 2DCFA 5L4HA 2CM0A 2IDOB 4O4IE 4U2ZA 2N2NA 2X9WA 5H6QB 2HHHT 4HFBA 5DJQC 3CQCB 4J2CA 4U2YA 4JI4T 3ONXA 3AAEB 3ZCIA 3RH3A 3AE8A 3ZEFB 4X62T 3KFWX 2CMRA 1E1HB 3EABA 1N34T 5HXRA 2IUBA 3KVBA 5LG4A 1W0AA 3ONLC 3E22E 4X1YE 5ABFB 2XAQB 2JRKA 4LMJA 1MNEA 1ZOYA 3TLWA 3ZT6A 2XAFB 2JJ9A 4IE0A 3FZLB 4PJJA 4COFA 4C91A 1ZKEA 5C8YE 3MACA 4DV4T 2I0MA 3RC3A 2E5VA 1Y64B 4OFZA 5EK2A 5AFUL 3AA6B 2XSAA 4IT4A 1DU2A 2FJAA 4EXTA 2D2SA 2E9XB 2VWAA 5JDNA 4PAGA 5TAOA 4CXWA 4AQGA 1HR0T 2V7LA 4YFSA 5L3CB 2RA1A 2ZM6T 4I0UA 5LCYA 3OBVE 4LF9T 4DIDB 1D0ZA 4NXNT 2Y48B 3V5SA 3AEGA 3CMLA 3LSVA 2XASB 2UXCT 4PNIA 5DQWA 3ABVA 5JR9B 4QH5A 3RKGA 2E8IA 4OHFA 5LP6E 2BG9E 1OEDC 3RQUA 4EZHA 4Q25A 1WRDA 3AE5A 5LG3A 4ILAA 5ABFA 3Q5WA 4GK0E 1VCSA 5HXCA 3WAKA 4HE8A 2V7KA 4JI2T 4OX9T 3UU3A 4ZI2D 1QUUA 4WBNE 3P4RA 3PTRB 3L8RA 4CI1B 1MMGA 2C0SA 2V6YB 4YT0A 2K3WA 4F6RC 4JI6T 3AB3B 2KWHA 4GIWA 4YSXA 3FBZA 3FZFB 4IL9A 5AQJB 3O4XE 2CXFA 4DNDA 1YQ3A 2E9XA 3EDVA 3AA7B 4ZEYA 4AKRB 3MZKB 5FKYA 4KMCA 2WWVA 4JUYA 1V9DA 5JREA 1US7B 5JH7E 3ZMSB 1XNQT 4B3MT 1XZYA 1VOMA 1KFYA 5HEGA 2HN2A 2P9BA 2H88A 3H3MA 2CLYC 3ETUA 2WM9A 4EEBA 4UF0A 2V7MA 5JR9A 2IHR1 3IA3A 2V26A 4I50E 4BJMA 3PU3A 2BG9C 5AQFB 3GWHA 4MHCA 2C5JA 2K24A 3CPZA 2IW5B 2HN1A 4ZZBA 4TWDA 5KXJA 3UU4A 2X0HA 3PUVF 4H9RC 5J2UE 2OV9A 5IHYA 1U5PA 2KNDA 5FMNA 2UUBT 4YHHT 2Q9QD 3ZCJA 4NUUA 3FZHB 2V6YA 3EUHA 3RIUC 4JV5T 2BKPA 2LHRA 5AQTB 4IE7A 3UU5A 3PUXF 1WYBA 5LGUB 1OWAA 3F2EA 4IE6A 2SPCA 2J4GA 2W66A 4IL4A 2VL8A 1IAPA 2XTLA 3B13A 2UXDT 4DBQA 1JNRA 1GQEA 2WDVA 4MLKA 4X66T 3DTOA 4U7IA 5J1GA 1YKHB 2QVAA 4X5TA 3SS1A 3G06A 4DR3T 3GA8A 4YLHA 4DMWA 3A8YC 4WNKA 3KVAA 5L3EB 5AQHB 3SWHA 4WYVA 4CQIA 4EAHA 5IUXA 2VQFT 3MA9A 4U74A 4LF8T 2W0GA 1D0YA 5AQUB 1HNWT 1IJ5A 2M6IA 4E7ZA 2QA7A 4CI3B 4UIGA 4ZI3C 4YTPA 2BS2A 3K1SA 4DV3T 3S4UA 1EZ3A 3ZN0B 2V5DA 3E08A 1MMNA 2CCQA 2J62A 3AEAA 5HXSA 4NPPA 1G73A 1XDOA 5L2LA 2X51A 2NP9A 2WU2A 5ABEA 1HF8A 3AA1B 5KDMC 4H9QC 2DI4A 4KUMB 3OYXA 1S35A 3RIAA 3UFGA 4LFBT 1R8IA 3K3QC 2HH7A 3TLTA 2V1DB 3FXDB 3PJAJ 3VHLA 3EVYA 3N5LA 5BR8T 1I94T 2CWOA 3P8CD 3O1HA 5CA1E 2PTFA 3PV0F 3N9NA 2KSRA 2ACXA 1UK5A 4HWIB 2C5KT 2DWKA 5DABA 5AQIB 4X20E 4OK0A 5JDMA 3RPUA 1SE7A 3C4ZA 2NW9A 2JIWA 5F3JA 4IDPA 5ETWA 2A3DA 1UURA 2DNXA 4IE5A 2MAWA 1J5WA 4LMLA 3DJBA 5ABGA 5CB4E 4B3RT 1HNZT 5LGNB 2EHOA 2OA5A 1Z0PA 4Z8XA 4PK4A 5HXHA 5KX5E 3V5UA 5FXWA 1ZEEA 4A98A 2IC6A 5HWYA 4UVAB 1UUSA 5HCJA 3WI3A 3JC6D 2LRLA 2W62A 2JMHA 5L3BB 4TWFA 1YXRA 4QX7B 4WW0A 4A97A 1XMOT 3ZYKA 1T7SA 2VKDA 4PW8A 5FY1A 1NEKA 1OXZA 5LBQB 2RPAA 3LFMA 4DV7T 3KBTA 2WZIA 2X67A 4L5GA 2CLYB 2D9DA 1QSDA 2YU1A 1MIVA 4ZI2C 2DHRA 2BG9B 4IDZA 1BR0A 3IHRA 1OEDE 3VR8A 5AQQB 5EZYE 3AA0B 3B57A 4CZZB 1E2AA 2AE9A 5AQRB 4H9NC 3OKQA 3B5MA 1XDPA 2WY2A 3UFEA 5JDLA 2YU2A 3N9PA 3RX6A 4JI5T 1KNPA 5HEOA 2IAKA 3PDYA 1T72A 1FIOA 5IWAT 2WBLA 4LFCT 2JQ9A 2BS3A 3LK2B 3U3IA 1WR6A 5HEUA 4YHJA 4DV2T 2Y6XA 1YQ4A 3Q5EA 2NTXA 1JNZA 4CI2B 1N36T 3C98B 2CXLA 3C50A 3PUWF 4QWNB 4GYRA 3T1HT 2HPLA 3OVUA 3KINB 2IIUA 3CQGB 3KV5A 3ZN1B 3LK3B 3ZLIA 3KBUA 5JRCB 4UELA 2JQHA 1FMVA 3AAAB 2X68A 4BJNA 3I0OA 2E5LT 2W00A 5AQPB 4XAXB 4JEHB 1CHUA 2I59A 1FJGT 3JAFA 3RYIE 4CN6A 4HFEA 3AAIA 4CN4A 4DR2T 3FXEB 5JDGA 1LKXA 2V5CA 3AXJB 4F8HA 1O3XA 2BG9A 5JTGA 2YOEA 3QB5K 4Z91A 2LOSA 3J9X1 4EYUA 2AXDS 1G8XA 4U7YA 3PUYF 2X0LB 3P4WA 1W0BA 3J7Yq 2CA5A 3PUAA 2LT3A 4JI7T 2WMNA 2K9AA 4B6XA 2J1DG 2YEVC 4ADZA 2KLQA 2ODVA 5FNVE 3RLFF 3C4XA 4QX8B 3OJAA 2XQ8A 2YDQA 3CK6A 5AQNB 5FL1A 4JI1T 4ZXLA 4UXNB 3RIUA 3MK7C 3R6NA 3RI5A 2XHEB 3JAEA 4AKIA 4HWDA 5ADXL 3T1YT 4IDOA 5L47A 4K0KT 4ILUA 3H3AA 2K5BB 2WP9A 4ZS2A 3I9WA 4IE4A 3L3PA 2QRXA 2XAJB 5JRCA 3K3NA 2BZBA 4O2AE 2NW7A 3T8OA 1Y01A 2BBJA 3X1DA 3AEFA 3UT5E 4P0BA 2XAGB 2N1GA 4DR1T 4LF4T 3RYCE 3N2OA 4OYJA 5L3FB 3QK6A 2LKHA 4L0RA 3N9QA 5LB7B 2I6HA 3AXJA 3AE7A 3CQXC 3UUBA 3LJCA 3ZMVB 4HWCA 2LM2A 3VU7H 2B1EA 3KV4A 3UUXB 2EHOD 1KNZA 3AE1A 3FZMB 3ZMUB 4AKLA 3LK42 4B3ST 3Q9DA 1HG2A 4TZ4C 4CXXA 3RHWA 2R6GF 2XM1A 2DLRA 1HTJF 5LMNT 1ZP0A 2WU5A 5LHIB 2WSSV 5AQLB 3A7MA 2VL0A 4MBQA 5AQKB 2CBJA 5F8PA 1NWMX 4HFHA 3ZPOA 3QOFA 2V8SV 3KV6A 3VRBA 2CPTA 4YXDA 5LA6E 1BR2A 3NRXA 3K8PC 4IREA 2YINA 2H3RA 3TLSA 3C51A 3LBXB 4H63H 3OPCA 2XQ3A 4EEDA 3AE9A 4KX6A 4BA9A 3TLUA 3JCFA 3AECA 5LJMA 4AI6A 2MPKA 1LVKA 4NUVA 1MIWA 5JQGE 3RF1A 3F57A 3N9OA 2W4XA 3UTKA 2W2UA 2W67A 4ZZCA 3SRZA 2VQET 2YDSA 3QB5A 3AEDA 3ZYMA 3ZSTA 4A56A 4O4LE 4P09A 2W63A 4IIJE 1UCUA 1SUMB 3CX7B 3PUSA 2L9QA 4UV9B 3TKLB 3RYFE 1CUNA 3AE3A 2VK9A 2LSYA 4YSZA 4ISSA 3UQ7A 4EIWA 5CJ5A 2YDRA 3NWIA 1WYCA 4GOUA 1BR4A 2BVMA 2JQKA 2NR4A 4DV6T 4QKNA 4QXCB 3LBXA 4CN1A 1NENA 2J47A 2XQ7A 3ZKRA 4AQYT 4YSYA 4EB6E 4GYSA 4IGUA 2LHNA 4I43B 1D1CA 4JI0T 5JDHA 4WBOA 1D1BA 3MXZA 2YKSA 2CE7A 4NIQA 1WFDA 1YW0A 3H37A 4EOZB 4LF6T 2QGSA 4HKAA 5FP3A 3E0ZA 1KK7A 2X9XA 2H89A 5FXVA 1NAFA 1OEDB 4DBRA 3L39A 4NXMT 4EGWA 3RQWA 2LE8A 5JVDE 1KF6A 1LRZA 4K0UA 1KEYA 3AEBA 4LF5T 4P0AA 4PJLA 1W09A 1AJ3A 4A5XA 3NRYA 3P7IA 2KXPB 4X1KE 1X9BA 2BS4A 2E2AA 4LMKA 2V7JA 2PBIA 2E9XD 4DR4T 2CEAA 2BBHA 2YN6A 4AQFC 1WCRA 4KHZF 1E7PA 5IYZE 5LHHB 4MALA 4PJNA 4ZI7E 4AKHA 1KNRA 4GKKT 4ILCA 5HEHA 5LNKA 2MTQA 4O2BE 3Q5DA 2OLTA 1L0VA 3RRWA 1FMWA 4O8SA 2VB6A 5GONE 4G2AA 2VVSA 2VASA 4JBWF 2NOXA 3HA4A 2XQ6A 2RP4A 3RGLA 3N2KE 2XZEA 5FY0A 1T8BA 2L3LA 4E7SA 2WDQA 2WB5A 1MMAA 3I0QA 4KI0F 5A1LA 3RRCA 3SOLA 5LJNA 4FJOA 1XNRT 1M7KA 4AXPA 4I4TE 3RKOA 3OTOT 1OEDA 4X1IE 4DVDA 2XPKA 2XQ4A 2JMKA 2KINB 4N78D 1BR1A 1ZHCA 3ESLA 5L3DB 4TNVA 2ZM2A 3CX8B 2UXXB 3ZJ2A 2XQ5A 1J1JA 2IC9A 4HN9A 4ZHQE 4AKGA 2XJ7A 2PFVA 4HFDA 4DV1T 1HG5A 3GMIA 2VKOA 2UU9T 4YY3T 3NKZA 4PK6A 2L8KA 2CHOA 3ONJA 4U72A 2WDRA 4YJ2E 1J5ET 2YK0A 2WQYA 3HKDE 2ODUA 1HFAA 2VKJA 2LKGA 2WAUA 5HAXA 5C2TA 1HNXT 5E0OA 3N9MA 2V7IA 2XY8B 1HS7A 4JI8T 4UEMA 2WMOA 5AQGB 2X9HA 1YKEB 2EHOC 3C64A 1D1AA 4X65T 5FY7A 3EAMA 3O1JA 3BQKA 3PUGA 3HKCE 4P1NA 1HX8A 5J2TE 4OYKA 1SHZC 2XQYA 2Y8DA 2VKHA 3AE6A 2F4VT 2Q9QC 2ES0A 4HWFA 3P4SA 1IBKT 5EK4A 2XAHB 3N2GE 3ETVA 4U33A 4QXHB 5LBMA 2NTYA 3QNUA 3K3OA 1WLXA 4QXBB 2ACZA 4UF0B 2G0UA 1N32T 2LOPA 1XMQT 5CA0E 2ZM0A 4H63V 1HX1B 3AVSA 3HKEE 5HEJA 4HFCA 5HCMA 2A9UA 1ZV4X 2V6XA 4DUZT 1MNDA 3A5XA 3ZT7A 3UULA 2PG8A 3VKGA 3DP7A 4BAYB 4QHOA 4U31A 4DV0T 4ILBA 2D0UA 3TLVA 3EI0A 1IJ6A 1YD8G 5JDQA 2M6BA 1XWMA 3PURA 4Z90A 1UX4A 2BVLA 4TNWA 2LSKA 4DV5T 1FEWA 2H7VC 5JDFA 3PE0A 2ZLYA 3AVRA 2GK9A 4U3CA 1LVFA 2JQQA 3KV9A 3NVOA 3ANWB 5HXEA 5H6RB 4UR9A 2A72A 3JADA 2UXBT 4FI5A 4V1Av 3CX6B 2WCAA 3PU8A 5FXXA 4TX5A 2UUAT 1QLBA 2ZM8A 4JYAT 4PJMA 1UGOA 3W15B 2LSIA 3ZC1A 5M4YA 3EHZA 1IBMT 5ABHA 3RC8A 4AISA 2VURA 3F31A 3UQ4A 2CXDA 1H7CA 2BDEA 3Q5XA 1VCTA 4IHJE 3I9YA 3P4PA 2PJQA 3NZPA 5J0ZA 3U78A 3CVRA 4TV9E 4ZS3A 2LSGA 3NZQA 3P4QA 4L9IA 1M62A 3KDSE 2UUCT 2D5UA 3Q2MA 2KMFA 1U4QA 2LLYA 1SA0E 1MMDA 3EDUA 3FZKB 2H7OA 4TWHA 5AQMB 2XSBA 2FJEA 4IDNA 2KZ7B 2MOZA 4PFOA 5FXZA 4LF7T 3PUZF 3PUQA 3IEEA 3AE2A 2MBGA 4O4JE 3GN5B 4TN7B 2WZHA 4HWHA 2CRBA 4IDQA 2XUEA 5L3GB 4QH4A 3ANWA 2CBIA 5FYMA 5L4EA 1B7TA 3ZC0A 2E9XC 4O4HE 2XQ9A 2XQAA 2DWGA 2VVNA 3UUNA 2LSJA 3QC9A 3FB2A 3O9XA 4YTMA 2Z6EA 3FBLA 2UXNB 3LDQB 3ZMZB 5HWXA 2HPJA 4MFRA 3CKDA 1W9RA 2K48A 2N9DA 3JC6C 3M65A 5C3JA 5DQVA 5LXTE 4DR6T 3IF8B 2X9YA 5JR9C 1IZNB 4KBMB 4JEUB 2A2FX 4PFPA 3SFEA 4AQFA 5AQVB 4X64T 3RYHE 4UVCB 4DMVA 5BMVE 2IMLA 3UUMA 5HYAA 4ERRA 3BQIA 3OYZA 2MYSA 4JLEA 4EYYR 3O1IA 5KMGP 3IBPA 4XZCA 5EK3A 4DR5T 3VR9A 4KP3C 2X0YA 3R84B 5FVKA 4H9OC 3PJAA 4HEAA 5LMUT 4H9SE 2EHOB 2DL1A 1X79A 4QH1A 3ZT5A 5LGTB 4I55E 2X66A 2FJBA 2QYWA 5CFBA 3BK9A 1Z8UA 2D0TA 3CIRA 3ZJ1A 4EV6A 2B76A 3HR0A 5F5WA 4AIUA 4ASKA 3GN5A 4XBFB 4DO0A 2CWYA 3I1AA 3RIFA 5AQOB 4ANJA 4EZ4A 3D0TA 4DUYT 2C5IT 3UU6A 1I6ZA 3BQLA 2KWIB 5LOVE 1N33T 2LM9A 4YJ3E 4DR7T 1HCIA 2Q9QB 3NBXX 2BKOA 2JPFA 2LEHA 1D0XA 2ZMAA 4PK5A 3WAJA 3FHNA 4M1PA 2LJLA 4LFAT 1T98A 4G63A 3VRAA 3VKHA 4CXYA 4H9PC 3N9LA 4JI3T 2WS3A 4HGAA 4WZXA 5FL0A 2FJDA 4B3TT 3CWZB 3AE4A 4KHPT 1WR0A 3P50A 3HL6A 2NWBA 3C4WA 2NW8A 4HFIA 1IBLT 3UU8A 2XM2A 3ZSSA 3LG7A 2FBWA 3AEEA 4TV8E 1VRBA 4TUYE 1S94A 3M3ZB 3HKBE 2BKNA 3HI2A 4HTEA 1MIYA 1UX5A 4YTNA 3ZMTB
chains in the Genus database with same CATH topology
2EHOD 2XQYA 4UIGA 3L09A 4ZI3C 1KNZA 5LHGB 2Y8DA 2VKHA 4UVBB 4ISTA 3ZMUB 4AKLA 3S4UA 1EZ3A 3LK42 3ZN0B 2Q9QC 2ES0A 3Q9DA 1HG2A 3E08A 3QUJA 5LYJE 4TZ4C 1MMNA 3ZYLA 4CXXA 2WWUA 4UV8B 2CCQA 3MJXA 4HFVA 2DLRA 1HTJF 5EK4A 5HXSA 4C90A 2Q9QA 1G73A 2XAHB 4GK5E 5LHIB 2M67A 2WSSV 3N2GE 4ZI3D 4ZOLE 5L2LA 3ETVA 2X51A 2KT9A 2NP9A 4QXHB 5LBMA 5HYAA 1HF8A 3AA1B 2NTYA 3MKDA 2W61A 3K3OA 1WLXA 4QXBB 5KDMC 4H9QC 2DI4A 4KUMB 4MBQA 2DCFA 3OYXA 1S35A 5F8PA 1NWMX 3ZPOA 4UF0B 2CM0A 2G0UA 3K3QC 2HH7A 2V1DB 4O4IE 3KV6A 3FXDB 2LOPA 5LA6E 1BR2A 3NRXA 3VHLA 2N2NA 2X9WA 5H6QB 3EVYA 3N5LA 5CA0E 3K8PC 2CWOA 2YINA 3CQCB 5DJQC 3P8CD 3O1HA 2H3RA 2ZM0A 3C51A 4H63V 4J2CA 3LBXB 4H63H 5CA1E 3ONXA 3AAEB 3ZCIA 3RH3A 3AVSA 3ZEFB 3N9NA 3HKEE 3KFWX 2ACXA 2C5KT 2CMRA 1E1HB 2DWKA 5DABA 1ZV4X 4BA9A 4X20E 1MNDA 3A5XA 4OK0A 5JDMA 5HXRA 2PG8A 3UULA 3RPUA 3C4ZA 3VKGA 3KVBA 3DP7A 4BAYB 4QHOA 5LG4A 2NW9A 2D0UA 5LJMA 4AI6A 1LVKA 3E22E 4X1YE 4NUVA 1IJ6A 1MIWA 5F3JA 5JQGE 1YD8G 5ETWA 2A3DA 5JDQA 2XAQB 3PURA 2JRKA 2DNXA 1MNEA 3F57A 3N9OA 1UX4A 4IE5A 2BVLA 2LSKA 3UTKA 1FEWA 2XAFB 3SRZA 2H7VC 5JDFA 2JJ9A 4IE0A 4PJJA 3PE0A 2ZLYA 4C91A 3AVRA 1ZKEA 2GK9A 5C8YE 1LVFA 2JQQA 3KV9A 3MACA 3DJBA 3ANWB 3ZYMA 5HXEA 5H6RB 3RC3A 1Y64B 2A72A 4OFZA 4O4LE 5CB4E 4A56A 5EK2A 5LGNB 2EHOA 5AFUL 2OA5A 3AA6B 4P09A 2W63A 1Z0PA 1UCUA 4IIJE 4FI5A 4Z8XA 4PK4A 4V1Av 3CX6B 5HXHA 3CX7B 3PU8A 3PUSA 5KX5E 5FXXA 4EXTA 2D2SA 3V5UA 4TX5A 5FXWA 1ZEEA 2E9XB 2IC6A 2L9QA 5HWYA 4UV9B 2VWAA 2ZM8A 4UVAB 3RYFE 3TKLB 5JDNA 4PJMA 4PAGA 3W15B 2LSIA 1CUNA 3ZC1A 2VK9A 5TAOA 3WI3A 4CXWA 2LSYA 4AQGA 3JC6D 2V7LA 2W62A 4YFSA 5L3CB 2JMHA 2RA1A 5L3BB 5M4YA 4ISSA 4QX7B 4EIWA 3RC8A 4WW0A 3F31A 3OBVE 5LCYA 1WYCA 4GOUA 1BR4A 2BVMA 2CXDA 1H7CA 2BDEA 3ZYKA 3Q5XA 1D0ZA 4IHJE 4QKNA 3I9YA 2Y48B 4QXCB 3V5SA 3LBXA 2PJQA 3CMLA 2VKDA 3NZPA 4PW8A 5FY1A 1OXZA 2XASB 5LBQB 4PNIA 5DQWA 3LFMA 5JR9B 3U78A 3CVRA 4TV9E 2E8IA 4EB6E 3KBTA 4GYSA 2X67A 4OHFA 5LP6E 4L5GA 4IGUA 2LHNA 4ZS3A 2CLYB 2LSGA 3NZQA 4L9IA 3KDSE 1QSDA 4I43B 2D5UA 2YU1A 1D1CA 3Q2MA 5JDHA 2KMFA 4ERRA 4EZHA 1MIVA 1WRDA 1U4QA 4WBOA 1D1BA 4ZI2C 1SA0E 3MXZA 1MMDA 2CE7A 2DHRA 3EDUA 4IDZA 2H7OA 1YW0A 3Q5WA 3H37A 4EOZB 1BR0A 4GK0E 2QGSA 4HKAA 5FP3A 2KZ7B 3IHRA 5HXCA 2MOZA 4PFOA 3E0ZA 3WAKA 4HE8A 5FXZA 2V7KA 1KK7A 2X9XA 5EZYE 3PUQA 3IEEA 3AA0B 3B57A 4CZZB 2MBGA 4O4JE 4H9NC 3GN5B 4TN7B 3OKQA 4ZI2D 5FXVA 1QUUA 5JDLA 3UFEA 4WBNE 1NAFA 2YU2A 3N9PA 2XUEA 3PTRB 4DBRA 5L3GB 1MMGA 3RX6A 2C0SA 4CI1B 3ANWA 2IAKA 3PDYA 5FYMA 4F6RC 1B7TA 3AB3B 2LE8A 1FIOA 3ZC0A 2KWHA 4GIWA 5JVDE 2WBLA 3FBZA 1LRZA 2E9XC 4K0UA 3LK2B 4O4HE 3U3IA 3O4XE 1WR6A 2DWGA 2CXFA 3UUNA 2LSJA 4DNDA 3QC9A 4YHJA 3FB2A 4P0AA 2Y6XA 4PJLA 3O9XA 2Z6EA 2NTXA 2E9XA 3FBLA 1AJ3A 2UXNB 3NRYA 3EDVA 3AA7B 3ZMZB 4CI2B 5HWXA 3P7IA 2HPJA 4MFRA 4AKRB 2KXPB 3C98B 2CXLA 3C50A 3MZKB 4X1KE 3CKDA 2V7JA 4QWNB 2PBIA 4GYRA 2E9XD 2K48A 2N9DA 3JC6C 3M65A 4KMCA 2CEAA 4JUYA 5DQVA 1V9DA 2HPLA 5JREA 1US7B 4AQFC 5JH7E 3ZMSB 5LXTE 3KINB 5IYZE 5LHHB 3IF8B 4MALA 4PJNA 3CQGB 4ZI7E 2X9YA 3KV5A 1IZNB 4KBMB 5JR9C 4AKHA 1VOMA 4JEUB 3ZN1B 2A2FX 4PFPA 3LK3B 3ZLIA 3KBUA 5JRCB 4UELA 4AQFA 2P9BA 5LNKA 3RYHE 1FMVA 2MTQA 2X68A 3AAAB 4O2BE 2CLYC 4UVCB 4BJNA 4DMVA 3ETUA 2WM9A 5BMVE 1FMWA 3I0OA 4O8SA 2V7MA 2W00A 4UF0A 5JR9A 2VB6A 3RRWA 2V26A 4XAXB 5GONE 3BQIA 3OYZA 4I50E 4JEHB 2MYSA 4G2AA 4JLEA 4BJMA 3O1IA 4EYYR 3PU3A 2VASA 2I59A 5KMGP 2NOXA 3RYIE 3IBPA 3AAIA 4XZCA 5EK3A 3GWHA 3HA4A 3UUMA 4MHCA 2C5JA 2K24A 4KP3C 3R84B 3CPZA 3FXEB 2RP4A 4H9OC 2IW5B 3N2KE 5FY0A 5JDGA 1LKXA 4HEAA 2L3LA 4E7SA 4H9SE 1O3XA 2EHOB 1X79A 5J2UE 4H9RC 2LOSA 3J9X1 4EYUA 5IHYA 5LGTB 4I55E 1MMAA 1U5PA 2KNDA 1G8XA 2X66A 3I0QA 5A1LA 3BK9A 3RRCA 5FMNA 3SOLA 2D0TA 5LJNA 3ZJ1A 2X0LB 4FJOA 3HR0A 3J7Yq 2CA5A 4AXPA 3PUAA 4ASKA 4I4TE 3GN5A 4XBFB 4DO0A 2Q9QD 2CWYA 2LT3A 3I1AA 3RKOA 3ZCJA 2WMNA 4NUUA 2K9AA 4X1IE 4ANJA 3D0TA 4DVDA 4B6XA 2J1DG 4EZ4A 2YEVC 4ADZA 2JMKA 2C5IT 2KLQA 2ODVA 3EUHA 2KINB 2KWIB 3BQLA 5LOVE 5FNVE 2LM9A 3C4XA 4YJ3E 1HCIA 2Q9QB 2LHRA 1BR1A 1ZHCA 3ESLA 3NBXX 2JPFA 3OJAA 4N78D 4QX8B 4IE7A 5L3DB 2ZM2A 3CX8B 2UXXB 2LEHA 1WYBA 5LGUB 3ZJ2A 1D0XA 1OWAA 3F2EA 4IE6A 2SPCA 4UXNB 3MK7C 2ZMAA 4PK5A 2IC9A 3R6NA 3WAJA 4HN9A 4ZHQE 4AKGA 2VL8A 1IAPA 2PFVA 2XHEB 2XTLA 3B13A 1HG5A 3GMIA 4AKIA 3FHNA 4DBQA 4M1PA 2LJLA 2VKOA 4MLKA 5ADXL 1T98A 4G63A 3DTOA 5J1GA 3VKHA 1YKHB 4CXYA 4H9PC 3N9LA 4PK6A 2L8KA 4ILUA 3H3AA 2K5BB 3SS1A 4HGAA 3GA8A 4YLHA 4ZS2A 3I9WA 4U72A 4DMWA 4IE4A 3L3PA 4YJ2E 2XAJB 5JRCA 4WNKA 3K3NA 2BZBA 3KVAA 5L3EB 2YK0A 3HKDE 2ODUA 1HFAA 4O2AE 3SWHA 2VKJA 4CQIA 2NW7A 3T8OA 2WAUA 4EAHA 5HAXA 3CWZB 5E0OA 3UT5E 3N9MA 2V7IA 4P0BA 1HS7A 2XAGB 4UEMA 2WMOA 3MA9A 2N1GA 4U74A 3RYCE 2X9HA 3N2OA 4OYJA 5L3FB 1YKEB 2EHOC 3C64A 3QK6A 3HL6A 2NWBA 2W0GA 1D1AA 3C4WA 2NW8A 1D0YA 5FY7A 4L0RA 3N9QA 3O1JA 3CQXC 3BQKA 3LG7A 3PUGA 3LJCA 3HKCE 4TV8E 1IJ5A 3ZMVB 4E7ZA 1VRBA 4TUYE 1HX8A 1S94A 3VU7H 5J2TE 3HKBE 2B1EA 2QA7A 3KV4A 3HI2A 3UUXB 4CI3B 4HTEA 4OYKA 1MIYA 1UX5A 1SHZC 3ZMTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 B;  5JRC B;  5JRE A;  3ZC0 A;  5JR9 A;  5JR9 C;  5JRC A;  3ZC1 A; 
#chains in the Genus database with same CATH topology
 3L09 A;  5LHG B;  4UVB B;  4IST A;  3SFD A;  2CHN A;  3QUJ A;  5LYJ E;  3ZYL A;  2WWU A;  4UV8 B;  3MJX A;  4HFV A;  5FVL A;  4C90 A;  2Q9Q A;  4GK5 E;  2LRK A;  2M67 A;  4ZI3 D;  5AQS B;  4ZOL E;  2KT9 A;  5CGM A;  4GKJ T;  3MKD A;  2W61 A;  2FUP A;  2DCF A;  5L4H A;  2CM0 A;  2IDO B;  4O4I E;  4U2Z A;  2N2N A;  2X9W A;  5H6Q B;  2HHH T;  4HFB A;  5DJQ C;  3CQC B;  4J2C A;  4U2Y A;  4JI4 T;  3ONX A;  3AAE B;  3ZCI A;  3RH3 A;  3AE8 A;  3ZEF B;  4X62 T;  3KFW X;  2CMR A;  1E1H B;  3EAB A;  1N34 T;  5HXR A;  2IUB A;  3KVB A;  5LG4 A;  1W0A A;  3ONL C;  3E22 E;  4X1Y E;  5ABF B;  2XAQ B;  2JRK A;  4LMJ A;  1MNE A;  1ZOY A;  3TLW A;  3ZT6 A;  2XAF B;  2JJ9 A;  4IE0 A;  3FZL B;  4PJJ A;  4COF A;  4C91 A;  1ZKE A;  5C8Y E;  3MAC A;  4DV4 T;  2I0M A;  3RC3 A;  2E5V A;  1Y64 B;  4OFZ A;  5EK2 A;  5AFU L;  3AA6 B;  2XSA A;  4IT4 A;  1DU2 A;  2FJA A;  4EXT A;  2D2S A;  2E9X B;  2VWA A;  5JDN A;  4PAG A;  5TAO A;  4CXW A;  4AQG A;  1HR0 T;  2V7L A;  4YFS A;  5L3C B;  2RA1 A;  2ZM6 T;  4I0U A;  5LCY A;  3OBV E;  4LF9 T;  4DID B;  1D0Z A;  4NXN T;  2Y48 B;  3V5S A;  3AEG A;  3CML A;  3LSV A;  2XAS B;  2UXC T;  4PNI A;  5DQW A;  3ABV A;  5JR9 B;  4QH5 A;  3RKG A;  2E8I A;  4OHF A;  5LP6 E;  2BG9 E;  1OED C;  3RQU A;  4EZH A;  4Q25 A;  1WRD A;  3AE5 A;  5LG3 A;  4ILA A;  5ABF A;  3Q5W A;  4GK0 E;  1VCS A;  5HXC A;  3WAK A;  4HE8 A;  2V7K A;  4JI2 T;  4OX9 T;  3UU3 A;  4ZI2 D;  1QUU A;  4WBN E;  3P4R A;  3PTR B;  3L8R A;  4CI1 B;  1MMG A;  2C0S A;  2V6Y B;  4YT0 A;  2K3W A;  4F6R C;  4JI6 T;  3AB3 B;  2KWH A;  4GIW A;  4YSX A;  3FBZ A;  3FZF B;  4IL9 A;  5AQJ B;  3O4X E;  2CXF A;  4DND A;  1YQ3 A;  2E9X A;  3EDV A;  3AA7 B;  4ZEY A;  4AKR B;  3MZK B;  5FKY A;  4KMC A;  2WWV A;  4JUY A;  1V9D A;  5JRE A;  1US7 B;  5JH7 E;  3ZMS B;  1XNQ T;  4B3M T;  1XZY A;  1VOM A;  1KFY A;  5HEG A;  2HN2 A;  2P9B A;  2H88 A;  3H3M A;  2CLY C;  3ETU A;  2WM9 A;  4EEB A;  4UF0 A;  2V7M A;  5JR9 A;  2IHR 1;  3IA3 A;  2V26 A;  4I50 E;  4BJM A;  3PU3 A;  2BG9 C;  5AQF B;  3GWH A;  4MHC A;  2C5J A;  2K24 A;  3CPZ A;  2IW5 B;  2HN1 A;  4ZZB A;  4TWD A;  5KXJ A;  3UU4 A;  2X0H A;  3PUV F;  4H9R C;  5J2U E;  2OV9 A;  5IHY A;  1U5P A;  2KND A;  5FMN A;  2UUB T;  4YHH T;  2Q9Q D;  3ZCJ A;  4NUU A;  3FZH B;  2V6Y A;  3EUH A;  3RIU C;  4JV5 T;  2BKP A;  2LHR A;  5AQT B;  4IE7 A;  3UU5 A;  3PUX F;  1WYB A;  5LGU B;  1OWA A;  3F2E A;  4IE6 A;  2SPC A;  2J4G A;  2W66 A;  4IL4 A;  2VL8 A;  1IAP A;  2XTL A;  3B13 A;  2UXD T;  4DBQ A;  1JNR A;  1GQE A;  2WDV A;  4MLK A;  4X66 T;  3DTO A;  4U7I A;  5J1G A;  1YKH B;  2QVA A;  4X5T A;  3SS1 A;  3G06 A;  4DR3 T;  3GA8 A;  4YLH A;  4DMW A;  3A8Y C;  4WNK A;  3KVA A;  5L3E B;  5AQH B;  3SWH A;  4WYV A;  4CQI A;  4EAH A;  5IUX A;  2VQF T;  3MA9 A;  4U74 A;  4LF8 T;  2W0G A;  1D0Y A;  5AQU B;  1HNW T;  1IJ5 A;  2M6I A;  4E7Z A;  2QA7 A;  4CI3 B;  4UIG A;  4ZI3 C;  4YTP A;  2BS2 A;  3K1S A;  4DV3 T;  3S4U A;  1EZ3 A;  3ZN0 B;  2V5D A;  3E08 A;  1MMN A;  2CCQ A;  2J62 A;  3AEA A;  5HXS A;  4NPP A;  1G73 A;  1XDO A;  5L2L A;  2X51 A;  2NP9 A;  2WU2 A;  5ABE A;  1HF8 A;  3AA1 B;  5KDM C;  4H9Q C;  2DI4 A;  4KUM B;  3OYX A;  1S35 A;  3RIA A;  3UFG A;  4LFB T;  1R8I A;  3K3Q C;  2HH7 A;  3TLT A;  2V1D B;  3FXD B;  3PJA J;  3VHL A;  3EVY A;  3N5L A;  5BR8 T;  1I94 T;  2CWO A;  3P8C D;  3O1H A;  5CA1 E;  2PTF A;  3PV0 F;  3N9N A;  2KSR A;  2ACX A;  1UK5 A;  4HWI B;  2C5K T;  2DWK A;  5DAB A;  5AQI B;  4X20 E;  4OK0 A;  5JDM A;  3RPU A;  1SE7 A;  3C4Z A;  2NW9 A;  2JIW A;  5F3J A;  4IDP A;  5ETW A;  2A3D A;  1UUR A;  2DNX A;  4IE5 A;  2MAW A;  1J5W A;  4LML A;  3DJB A;  5ABG A;  5CB4 E;  4B3R T;  1HNZ T;  5LGN B;  2EHO A;  2OA5 A;  1Z0P A;  4Z8X A;  4PK4 A;  5HXH A;  5KX5 E;  3V5U A;  5FXW A;  1ZEE A;  4A98 A;  2IC6 A;  5HWY A;  4UVA B;  1UUS A;  5HCJ A;  3WI3 A;  3JC6 D;  2LRL A;  2W62 A;  2JMH A;  5L3B B;  4TWF A;  1YXR A;  4QX7 B;  4WW0 A;  4A97 A;  1XMO T;  3ZYK A;  1T7S A;  2VKD A;  4PW8 A;  5FY1 A;  1NEK A;  1OXZ A;  5LBQ B;  2RPA A;  3LFM A;  4DV7 T;  3KBT A;  2WZI A;  2X67 A;  4L5G A;  2CLY B;  2D9D A;  1QSD A;  2YU1 A;  1MIV A;  4ZI2 C;  2DHR A;  2BG9 B;  4IDZ A;  1BR0 A;  3IHR A;  1OED E;  3VR8 A;  5AQQ B;  5EZY E;  3AA0 B;  3B57 A;  4CZZ B;  1E2A A;  2AE9 A;  5AQR B;  4H9N C;  3OKQ A;  3B5M A;  1XDP A;  2WY2 A;  3UFE A;  5JDL A;  2YU2 A;  3N9P A;  3RX6 A;  4JI5 T;  1KNP A;  5HEO A;  2IAK A;  3PDY A;  1T72 A;  1FIO A;  5IWA T;  2WBL A;  4LFC T;  2JQ9 A;  2BS3 A;  3LK2 B;  3U3I A;  1WR6 A;  5HEU A;  4YHJ A;  4DV2 T;  2Y6X A;  1YQ4 A;  3Q5E A;  2NTX A;  1JNZ A;  4CI2 B;  1N36 T;  3C98 B;  2CXL A;  3C50 A;  3PUW F;  4QWN B;  4GYR A;  3T1H T;  2HPL A;  3OVU A;  3KIN B;  2IIU A;  3CQG B;  3KV5 A;  3ZN1 B;  3LK3 B;  3ZLI A;  3KBU A;  5JRC B;  4UEL A;  2JQH A;  1FMV A;  3AAA B;  2X68 A;  4BJN A;  3I0O A;  2E5L T;  2W00 A;  5AQP B;  4XAX B;  4JEH B;  1CHU A;  2I59 A;  1FJG T;  3JAF A;  3RYI E;  4CN6 A;  4HFE A;  3AAI A;  4CN4 A;  4DR2 T;  3FXE B;  5JDG A;  1LKX A;  2V5C A;  3AXJ B;  4F8H A;  1O3X A;  2BG9 A;  5JTG A;  2YOE A;  3QB5 K;  4Z91 A;  2LOS A;  3J9X 1;  4EYU A;  2AXD S;  1G8X A;  4U7Y A;  3PUY F;  2X0L B;  3P4W A;  1W0B A;  3J7Y q;  2CA5 A;  3PUA A;  2LT3 A;  4JI7 T;  2WMN A;  2K9A A;  4B6X A;  2J1D G;  2YEV C;  4ADZ A;  2KLQ A;  2ODV A;  5FNV E;  3RLF F;  3C4X A;  4QX8 B;  3OJA A;  2XQ8 A;  2YDQ A;  3CK6 A;  5AQN B;  5FL1 A;  4JI1 T;  4ZXL A;  4UXN B;  3RIU A;  3MK7 C;  3R6N A;  3RI5 A;  2XHE B;  3JAE A;  4AKI A;  4HWD A;  5ADX L;  3T1Y T;  4IDO A;  5L47 A;  4K0K T;  4ILU A;  3H3A A;  2K5B B;  2WP9 A;  4ZS2 A;  3I9W A;  4IE4 A;  3L3P A;  2QRX A;  2XAJ B;  5JRC A;  3K3N A;  2BZB A;  4O2A E;  2NW7 A;  3T8O A;  1Y01 A;  2BBJ A;  3X1D A;  3AEF A;  3UT5 E;  4P0B A;  2XAG B;  2N1G A;  4DR1 T;  4LF4 T;  3RYC E;  3N2O A;  4OYJ A;  5L3F B;  3QK6 A;  2LKH A;  4L0R A;  3N9Q A;  5LB7 B;  2I6H A;  3AXJ A;  3AE7 A;  3CQX C;  3UUB A;  3LJC A;  3ZMV B;  4HWC A;  2LM2 A;  3VU7 H;  2B1E A;  3KV4 A;  3UUX B;  2EHO D;  1KNZ A;  3AE1 A;  3FZM B;  3ZMU B;  4AKL A;  3LK4 2;  4B3S T;  3Q9D A;  1HG2 A;  4TZ4 C;  4CXX A;  3RHW A;  2R6G F;  2XM1 A;  2DLR A;  1HTJ F;  5LMN T;  1ZP0 A;  2WU5 A;  5LHI B;  2WSS V;  5AQL B;  3A7M A;  2VL0 A;  4MBQ A;  5AQK B;  2CBJ A;  5F8P A;  1NWM X;  4HFH A;  3ZPO A;  3QOF A;  2V8S V;  3KV6 A;  3VRB A;  2CPT A;  4YXD A;  5LA6 E;  1BR2 A;  3NRX A;  3K8P C;  4IRE A;  2YIN A;  2H3R A;  3TLS A;  3C51 A;  3LBX B;  4H63 H;  3OPC A;  2XQ3 A;  4EED A;  3AE9 A;  4KX6 A;  4BA9 A;  3TLU A;  3JCF A;  3AEC A;  5LJM A;  4AI6 A;  2MPK A;  1LVK A;  4NUV A;  1MIW A;  5JQG E;  3RF1 A;  3F57 A;  3N9O A;  2W4X A;  3UTK A;  2W2U A;  2W67 A;  4ZZC A;  3SRZ A;  2VQE T;  2YDS A;  3QB5 A;  3AED A;  3ZYM A;  3ZST A;  4A56 A;  4O4L E;  4P09 A;  2W63 A;  4IIJ E;  1UCU A;  1SUM B;  3CX7 B;  3PUS A;  2L9Q A;  4UV9 B;  3TKL B;  3RYF E;  1CUN A;  3AE3 A;  2VK9 A;  2LSY A;  4YSZ A;  4ISS A;  3UQ7 A;  4EIW A;  5CJ5 A;  2YDR A;  3NWI A;  1WYC A;  4GOU A;  1BR4 A;  2BVM A;  2JQK A;  2NR4 A;  4DV6 T;  4QKN A;  4QXC B;  3LBX A;  4CN1 A;  1NEN A;  2J47 A;  2XQ7 A;  3ZKR A;  4AQY T;  4YSY A;  4EB6 E;  4GYS A;  4IGU A;  2LHN A;  4I43 B;  1D1C A;  4JI0 T;  5JDH A;  4WBO A;  1D1B A;  3MXZ A;  2YKS A;  2CE7 A;  4NIQ A;  1WFD A;  1YW0 A;  3H37 A;  4EOZ B;  4LF6 T;  2QGS A;  4HKA A;  5FP3 A;  3E0Z A;  1KK7 A;  2X9X A;  2H89 A;  5FXV A;  1NAF A;  1OED B;  4DBR A;  3L39 A;  4NXM T;  4EGW A;  3RQW A;  2LE8 A;  5JVD E;  1KF6 A;  1LRZ A;  4K0U A;  1KEY A;  3AEB A;  4LF5 T;  4P0A A;  4PJL A;  1W09 A;  1AJ3 A;  4A5X A;  3NRY A;  3P7I A;  2KXP B;  4X1K E;  1X9B A;  2BS4 A;  2E2A A;  4LMK A;  2V7J A;  2PBI A;  2E9X D;  4DR4 T;  2CEA A;  2BBH A;  2YN6 A;  4AQF C;  1WCR A;  4KHZ F;  1E7P A;  5IYZ E;  5LHH B;  4MAL A;  4PJN A;  4ZI7 E;  4AKH A;  1KNR A;  4GKK T;  4ILC A;  5HEH A;  5LNK A;  2MTQ A;  4O2B E;  3Q5D A;  2OLT A;  1L0V A;  3RRW A;  1FMW A;  4O8S A;  2VB6 A;  5GON E;  4G2A A;  2VVS A;  2VAS A;  4JBW F;  2NOX A;  3HA4 A;  2XQ6 A;  2RP4 A;  3RGL A;  3N2K E;  2XZE A;  5FY0 A;  1T8B A;  2L3L A;  4E7S A;  2WDQ A;  2WB5 A;  1MMA A;  3I0Q A;  4KI0 F;  5A1L A;  3RRC A;  3SOL A;  5LJN A;  4FJO A;  1XNR T;  1M7K A;  4AXP A;  4I4T E;  3RKO A;  3OTO T;  1OED A;  4X1I E;  4DVD A;  2XPK A;  2XQ4 A;  2JMK A;  2KIN B;  4N78 D;  1BR1 A;  1ZHC A;  3ESL A;  5L3D B;  4TNV A;  2ZM2 A;  3CX8 B;  2UXX B;  3ZJ2 A;  2XQ5 A;  1J1J A;  2IC9 A;  4HN9 A;  4ZHQ E;  4AKG A;  2XJ7 A;  2PFV A;  4HFD A;  4DV1 T;  1HG5 A;  3GMI A;  2VKO A;  2UU9 T;  4YY3 T;  3NKZ A;  4PK6 A;  2L8K A;  2CHO A;  3ONJ A;  4U72 A;  2WDR A;  4YJ2 E;  1J5E T;  2YK0 A;  2WQY A;  3HKD E;  2ODU A;  1HFA A;  2VKJ A;  2LKG A;  2WAU A;  5HAX A;  5C2T A;  1HNX T;  5E0O A;  3N9M A;  2V7I A;  2XY8 B;  1HS7 A;  4JI8 T;  4UEM A;  2WMO A;  5AQG B;  2X9H A;  1YKE B;  2EHO C;  3C64 A;  1D1A A;  4X65 T;  5FY7 A;  3EAM A;  3O1J A;  3BQK A;  3PUG A;  3HKC E;  4P1N A;  1HX8 A;  5J2T E;  4OYK A;  1SHZ C;  2XQY A;  2Y8D A;  2VKH A;  3AE6 A;  2F4V T;  2Q9Q C;  2ES0 A;  4HWF A;  3P4S A;  1IBK T;  5EK4 A;  2XAH B;  3N2G E;  3ETV A;  4U33 A;  4QXH B;  5LBM A;  2NTY A;  3QNU A;  3K3O A;  1WLX A;  4QXB B;  2ACZ A;  4UF0 B;  2G0U A;  1N32 T;  2LOP A;  1XMQ T;  5CA0 E;  2ZM0 A;  4H63 V;  1HX1 B;  3AVS A;  3HKE E;  5HEJ A;  4HFC A;  5HCM A;  2A9U A;  1ZV4 X;  2V6X A;  4DUZ T;  1MND A;  3A5X A;  3ZT7 A;  3UUL A;  2PG8 A;  3VKG A;  3DP7 A;  4BAY B;  4QHO A;  4U31 A;  4DV0 T;  4ILB A;  2D0U A;  3TLV A;  3EI0 A;  1IJ6 A;  1YD8 G;  5JDQ A;  2M6B A;  1XWM A;  3PUR A;  4Z90 A;  1UX4 A;  2BVL A;  4TNW A;  2LSK A;  4DV5 T;  1FEW A;  2H7V C;  5JDF A;  3PE0 A;  2ZLY A;  3AVR A;  2GK9 A;  4U3C A;  1LVF A;  2JQQ A;  3KV9 A;  3NVO A;  3ANW B;  5HXE A;  5H6R B;  4UR9 A;  2A72 A;  3JAD A;  2UXB T;  4FI5 A;  4V1A v;  3CX6 B;  2WCA A;  3PU8 A;  5FXX A;  4TX5 A;  2UUA T;  1QLB A;  2ZM8 A;  4JYA T;  4PJM A;  1UGO A;  3W15 B;  2LSI A;  3ZC1 A;  5M4Y A;  3EHZ A;  1IBM T;  5ABH A;  3RC8 A;  4AIS A;  2VUR A;  3F31 A;  3UQ4 A;  2CXD A;  1H7C A;  2BDE A;  3Q5X A;  1VCT A;  4IHJ E;  3I9Y A;  3P4P A;  2PJQ A;  3NZP A;  5J0Z A;  3U78 A;  3CVR A;  4TV9 E;  4ZS3 A;  2LSG A;  3NZQ A;  3P4Q A;  4L9I A;  1M62 A;  3KDS E;  2UUC T;  2D5U A;  3Q2M A;  2KMF A;  1U4Q A;  2LLY A;  1SA0 E;  1MMD A;  3EDU A;  3FZK B;  2H7O A;  4TWH A;  5AQM B;  2XSB A;  2FJE A;  4IDN A;  2KZ7 B;  2MOZ A;  4PFO A;  5FXZ A;  4LF7 T;  3PUZ F;  3PUQ A;  3IEE A;  3AE2 A;  2MBG A;  4O4J E;  3GN5 B;  4TN7 B;  2WZH A;  4HWH A;  2CRB A;  4IDQ A;  2XUE A;  5L3G B;  4QH4 A;  3ANW A;  2CBI A;  5FYM A;  5L4E A;  1B7T A;  3ZC0 A;  2E9X C;  4O4H E;  2XQ9 A;  2XQA A;  2DWG A;  2VVN A;  3UUN A;  2LSJ A;  3QC9 A;  3FB2 A;  3O9X A;  4YTM A;  2Z6E A;  3FBL A;  2UXN B;  3LDQ B;  3ZMZ B;  5HWX A;  2HPJ A;  4MFR A;  3CKD A;  1W9R A;  2K48 A;  2N9D A;  3JC6 C;  3M65 A;  5C3J A;  5DQV A;  5LXT E;  4DR6 T;  3IF8 B;  2X9Y A;  5JR9 C;  1IZN B;  4KBM B;  4JEU B;  2A2F X;  4PFP A;  3SFE A;  4AQF A;  5AQV B;  4X64 T;  3RYH E;  4UVC B;  4DMV A;  5BMV E;  2IML A;  3UUM A;  5HYA A;  4ERR A;  3BQI A;  3OYZ A;  2MYS A;  4JLE A;  4EYY R;  3O1I A;  5KMG P;  3IBP A;  4XZC A;  5EK3 A;  4DR5 T;  3VR9 A;  4KP3 C;  2X0Y A;  3R84 B;  5FVK A;  4H9O C;  3PJA A;  4HEA A;  5LMU T;  4H9S E;  2EHO B;  2DL1 A;  1X79 A;  4QH1 A;  3ZT5 A;  5LGT B;  4I55 E;  2X66 A;  2FJB A;  2QYW A;  5CFB A;  3BK9 A;  1Z8U A;  2D0T A;  3CIR A;  3ZJ1 A;  4EV6 A;  2B76 A;  3HR0 A;  5F5W A;  4AIU A;  4ASK A;  3GN5 A;  4XBF B;  4DO0 A;  2CWY A;  3I1A A;  3RIF A;  5AQO B;  4ANJ A;  4EZ4 A;  3D0T A;  4DUY T;  2C5I T;  3UU6 A;  1I6Z A;  3BQL A;  2KWI B;  5LOV E;  1N33 T;  2LM9 A;  4YJ3 E;  4DR7 T;  1HCI A;  2Q9Q B;  3NBX X;  2BKO A;  2JPF A;  2LEH A;  1D0X A;  2ZMA A;  4PK5 A;  3WAJ A;  3FHN A;  4M1P A;  2LJL A;  4LFA T;  1T98 A;  4G63 A;  3VRA A;  3VKH A;  4CXY A;  4H9P C;  3N9L A;  4JI3 T;  2WS3 A;  4HGA A;  4WZX A;  5FL0 A;  2FJD A;  4B3T T;  3CWZ B;  3AE4 A;  4KHP T;  1WR0 A;  3P50 A;  3HL6 A;  2NWB A;  3C4W A;  2NW8 A;  4HFI A;  1IBL T;  3UU8 A;  2XM2 A;  3ZSS A;  3LG7 A;  2FBW A;  3AEE A;  4TV8 E;  1VRB A;  4TUY E;  1S94 A;  3M3Z B;  3HKB E;  2BKN A;  3HI2 A;  4HTE A;  1MIY A;  1UX5 A;  4YTN A;  3ZMT B; 
#chains in the Genus database with same CATH homology
 2EHO D;  2XQY A;  4UIG A;  3L09 A;  4ZI3 C;  1KNZ A;  5LHG B;  2Y8D A;  2VKH A;  4UVB B;  4IST A;  3ZMU B;  4AKL A;  3S4U A;  1EZ3 A;  3LK4 2;  3ZN0 B;  2Q9Q C;  2ES0 A;  3Q9D A;  1HG2 A;  3E08 A;  3QUJ A;  5LYJ E;  4TZ4 C;  1MMN A;  3ZYL A;  4CXX A;  2WWU A;  4UV8 B;  2CCQ A;  3MJX A;  4HFV A;  2DLR A;  1HTJ F;  5EK4 A;  5HXS A;  4C90 A;  2Q9Q A;  1G73 A;  2XAH B;  4GK5 E;  5LHI B;  2M67 A;  2WSS V;  3N2G E;  4ZI3 D;  4ZOL E;  5L2L A;  3ETV A;  2X51 A;  2KT9 A;  2NP9 A;  4QXH B;  5LBM A;  5HYA A;  1HF8 A;  3AA1 B;  2NTY A;  3MKD A;  2W61 A;  3K3O A;  1WLX A;  4QXB B;  5KDM C;  4H9Q C;  2DI4 A;  4KUM B;  4MBQ A;  2DCF A;  3OYX A;  1S35 A;  5F8P A;  1NWM X;  3ZPO A;  4UF0 B;  2CM0 A;  2G0U A;  3K3Q C;  2HH7 A;  2V1D B;  4O4I E;  3KV6 A;  3FXD B;  2LOP A;  5LA6 E;  1BR2 A;  3NRX A;  3VHL A;  2N2N A;  2X9W A;  5H6Q B;  3EVY A;  3N5L A;  5CA0 E;  3K8P C;  2CWO A;  2YIN A;  3CQC B;  5DJQ C;  3P8C D;  3O1H A;  2H3R A;  2ZM0 A;  3C51 A;  4H63 V;  4J2C A;  3LBX B;  4H63 H;  5CA1 E;  3ONX A;  3AAE B;  3ZCI A;  3RH3 A;  3AVS A;  3ZEF B;  3N9N A;  3HKE E;  3KFW X;  2ACX A;  2C5K T;  2CMR A;  1E1H B;  2DWK A;  5DAB A;  1ZV4 X;  4BA9 A;  4X20 E;  1MND A;  3A5X A;  4OK0 A;  5JDM A;  5HXR A;  2PG8 A;  3UUL A;  3RPU A;  3C4Z A;  3VKG A;  3KVB A;  3DP7 A;  4BAY B;  4QHO A;  5LG4 A;  2NW9 A;  2D0U A;  5LJM A;  4AI6 A;  1LVK A;  3E22 E;  4X1Y E;  4NUV A;  1IJ6 A;  1MIW A;  5F3J A;  5JQG E;  1YD8 G;  5ETW A;  2A3D A;  5JDQ A;  2XAQ B;  3PUR A;  2JRK A;  2DNX A;  1MNE A;  3F57 A;  3N9O A;  1UX4 A;  4IE5 A;  2BVL A;  2LSK A;  3UTK A;  1FEW A;  2XAF B;  3SRZ A;  2H7V C;  5JDF A;  2JJ9 A;  4IE0 A;  4PJJ A;  3PE0 A;  2ZLY A;  4C91 A;  3AVR A;  1ZKE A;  2GK9 A;  5C8Y E;  1LVF A;  2JQQ A;  3KV9 A;  3MAC A;  3DJB A;  3ANW B;  3ZYM A;  5HXE A;  5H6R B;  3RC3 A;  1Y64 B;  2A72 A;  4OFZ A;  4O4L E;  5CB4 E;  4A56 A;  5EK2 A;  5LGN B;  2EHO A;  5AFU L;  2OA5 A;  3AA6 B;  4P09 A;  2W63 A;  1Z0P A;  1UCU A;  4IIJ E;  4FI5 A;  4Z8X A;  4PK4 A;  4V1A v;  3CX6 B;  5HXH A;  3CX7 B;  3PU8 A;  3PUS A;  5KX5 E;  5FXX A;  4EXT A;  2D2S A;  3V5U A;  4TX5 A;  5FXW A;  1ZEE A;  2E9X B;  2IC6 A;  2L9Q A;  5HWY A;  4UV9 B;  2VWA A;  2ZM8 A;  4UVA B;  3RYF E;  3TKL B;  5JDN A;  4PJM A;  4PAG A;  3W15 B;  2LSI A;  1CUN A;  3ZC1 A;  2VK9 A;  5TAO A;  3WI3 A;  4CXW A;  2LSY A;  4AQG A;  3JC6 D;  2V7L A;  2W62 A;  4YFS A;  5L3C B;  2JMH A;  2RA1 A;  5L3B B;  5M4Y A;  4ISS A;  4QX7 B;  4EIW A;  3RC8 A;  4WW0 A;  3F31 A;  3OBV E;  5LCY A;  1WYC A;  4GOU A;  1BR4 A;  2BVM A;  2CXD A;  1H7C A;  2BDE A;  3ZYK A;  3Q5X A;  1D0Z A;  4IHJ E;  4QKN A;  3I9Y A;  2Y48 B;  4QXC B;  3V5S A;  3LBX A;  2PJQ A;  3CML A;  2VKD A;  3NZP A;  4PW8 A;  5FY1 A;  1OXZ A;  2XAS B;  5LBQ B;  4PNI A;  5DQW A;  3LFM A;  5JR9 B;  3U78 A;  3CVR A;  4TV9 E;  2E8I A;  4EB6 E;  3KBT A;  4GYS A;  2X67 A;  4OHF A;  5LP6 E;  4L5G A;  4IGU A;  2LHN A;  4ZS3 A;  2CLY B;  2LSG A;  3NZQ A;  4L9I A;  3KDS E;  1QSD A;  4I43 B;  2D5U A;  2YU1 A;  1D1C A;  3Q2M A;  5JDH A;  2KMF A;  4ERR A;  4EZH A;  1MIV A;  1WRD A;  1U4Q A;  4WBO A;  1D1B A;  4ZI2 C;  1SA0 E;  3MXZ A;  1MMD A;  2CE7 A;  2DHR A;  3EDU A;  4IDZ A;  2H7O A;  1YW0 A;  3Q5W A;  3H37 A;  4EOZ B;  1BR0 A;  4GK0 E;  2QGS A;  4HKA A;  5FP3 A;  2KZ7 B;  3IHR A;  5HXC A;  2MOZ A;  4PFO A;  3E0Z A;  3WAK A;  4HE8 A;  5FXZ A;  2V7K A;  1KK7 A;  2X9X A;  5EZY E;  3PUQ A;  3IEE A;  3AA0 B;  3B57 A;  4CZZ B;  2MBG A;  4O4J E;  4H9N C;  3GN5 B;  4TN7 B;  3OKQ A;  4ZI2 D;  5FXV A;  1QUU A;  5JDL A;  3UFE A;  4WBN E;  1NAF A;  2YU2 A;  3N9P A;  2XUE A;  3PTR B;  4DBR A;  5L3G B;  1MMG A;  3RX6 A;  2C0S A;  4CI1 B;  3ANW A;  2IAK A;  3PDY A;  5FYM A;  4F6R C;  1B7T A;  3AB3 B;  2LE8 A;  1FIO A;  3ZC0 A;  2KWH A;  4GIW A;  5JVD E;  2WBL A;  3FBZ A;  1LRZ A;  2E9X C;  4K0U A;  3LK2 B;  4O4H E;  3U3I A;  3O4X E;  1WR6 A;  2DWG A;  2CXF A;  3UUN A;  2LSJ A;  4DND A;  3QC9 A;  4YHJ A;  3FB2 A;  4P0A A;  2Y6X A;  4PJL A;  3O9X A;  2Z6E A;  2NTX A;  2E9X A;  3FBL A;  1AJ3 A;  2UXN B;  3NRY A;  3EDV A;  3AA7 B;  3ZMZ B;  4CI2 B;  5HWX A;  3P7I A;  2HPJ A;  4MFR A;  4AKR B;  2KXP B;  3C98 B;  2CXL A;  3C50 A;  3MZK B;  4X1K E;  3CKD A;  2V7J A;  4QWN B;  2PBI A;  4GYR A;  2E9X D;  2K48 A;  2N9D A;  3JC6 C;  3M65 A;  4KMC A;  2CEA A;  4JUY A;  5DQV A;  1V9D A;  2HPL A;  5JRE A;  1US7 B;  4AQF C;  5JH7 E;  3ZMS B;  5LXT E;  3KIN B;  5IYZ E;  5LHH B;  3IF8 B;  4MAL A;  4PJN A;  3CQG B;  4ZI7 E;  2X9Y A;  3KV5 A;  1IZN B;  4KBM B;  5JR9 C;  4AKH A;  1VOM A;  4JEU B;  3ZN1 B;  2A2F X;  4PFP A;  3LK3 B;  3ZLI A;  3KBU A;  5JRC B;  4UEL A;  4AQF A;  2P9B A;  5LNK A;  3RYH E;  1FMV A;  2MTQ A;  2X68 A;  3AAA B;  4O2B E;  2CLY C;  4UVC B;  4BJN A;  4DMV A;  3ETU A;  2WM9 A;  5BMV E;  1FMW A;  3I0O A;  4O8S A;  2V7M A;  2W00 A;  4UF0 A;  5JR9 A;  2VB6 A;  3RRW A;  2V26 A;  4XAX B;  5GON E;  3BQI A;  3OYZ A;  4I50 E;  4JEH B;  2MYS A;  4G2A A;  4JLE A;  4BJM A;  3O1I A;  4EYY R;  3PU3 A;  2VAS A;  2I59 A;  5KMG P;  2NOX A;  3RYI E;  3IBP A;  3AAI A;  4XZC A;  5EK3 A;  3GWH A;  3HA4 A;  3UUM A;  4MHC A;  2C5J A;  2K24 A;  4KP3 C;  3R84 B;  3CPZ A;  3FXE B;  2RP4 A;  4H9O C;  2IW5 B;  3N2K E;  5FY0 A;  5JDG A;  1LKX A;  4HEA A;  2L3L A;  4E7S A;  4H9S E;  1O3X A;  2EHO B;  1X79 A;  5J2U E;  4H9R C;  2LOS A;  3J9X 1;  4EYU A;  5IHY A;  5LGT B;  4I55 E;  1MMA A;  1U5P A;  2KND A;  1G8X A;  2X66 A;  3I0Q A;  5A1L A;  3BK9 A;  3RRC A;  5FMN A;  3SOL A;  2D0T A;  5LJN A;  3ZJ1 A;  2X0L B;  4FJO A;  3HR0 A;  3J7Y q;  2CA5 A;  4AXP A;  3PUA A;  4ASK A;  4I4T E;  3GN5 A;  4XBF B;  4DO0 A;  2Q9Q D;  2CWY A;  2LT3 A;  3I1A A;  3RKO A;  3ZCJ A;  2WMN A;  4NUU A;  2K9A A;  4X1I E;  4ANJ A;  3D0T A;  4DVD A;  4B6X A;  2J1D G;  4EZ4 A;  2YEV C;  4ADZ A;  2JMK A;  2C5I T;  2KLQ A;  2ODV A;  3EUH A;  2KIN B;  2KWI B;  3BQL A;  5LOV E;  5FNV E;  2LM9 A;  3C4X A;  4YJ3 E;  1HCI A;  2Q9Q B;  2LHR A;  1BR1 A;  1ZHC A;  3ESL A;  3NBX X;  2JPF A;  3OJA A;  4N78 D;  4QX8 B;  4IE7 A;  5L3D B;  2ZM2 A;  3CX8 B;  2UXX B;  2LEH A;  1WYB A;  5LGU B;  3ZJ2 A;  1D0X A;  1OWA A;  3F2E A;  4IE6 A;  2SPC A;  4UXN B;  3MK7 C;  2ZMA A;  4PK5 A;  2IC9 A;  3R6N A;  3WAJ A;  4HN9 A;  4ZHQ E;  4AKG A;  2VL8 A;  1IAP A;  2PFV A;  2XHE B;  2XTL A;  3B13 A;  1HG5 A;  3GMI A;  4AKI A;  3FHN A;  4DBQ A;  4M1P A;  2LJL A;  2VKO A;  4MLK A;  5ADX L;  1T98 A;  4G63 A;  3DTO A;  5J1G A;  3VKH A;  1YKH B;  4CXY A;  4H9P C;  3N9L A;  4PK6 A;  2L8K A;  4ILU A;  3H3A A;  2K5B B;  3SS1 A;  4HGA A;  3GA8 A;  4YLH A;  4ZS2 A;  3I9W A;  4U72 A;  4DMW A;  4IE4 A;  3L3P A;  4YJ2 E;  2XAJ B;  5JRC A;  4WNK A;  3K3N A;  2BZB A;  3KVA A;  5L3E B;  2YK0 A;  3HKD E;  2ODU A;  1HFA A;  4O2A E;  3SWH A;  2VKJ A;  4CQI A;  2NW7 A;  3T8O A;  2WAU A;  4EAH A;  5HAX A;  3CWZ B;  5E0O A;  3UT5 E;  3N9M A;  2V7I A;  4P0B A;  1HS7 A;  2XAG B;  4UEM A;  2WMO A;  3MA9 A;  2N1G A;  4U74 A;  3RYC E;  2X9H A;  3N2O A;  4OYJ A;  5L3F B;  1YKE B;  2EHO C;  3C64 A;  3QK6 A;  3HL6 A;  2NWB A;  2W0G A;  1D1A A;  3C4W A;  2NW8 A;  1D0Y A;  5FY7 A;  4L0R A;  3N9Q A;  3O1J A;  3CQX C;  3BQK A;  3LG7 A;  3PUG A;  3LJC A;  3HKC E;  4TV8 E;  1IJ5 A;  3ZMV B;  4E7Z A;  1VRB A;  4TUY E;  1HX8 A;  1S94 A;  3VU7 H;  5J2T E;  3HKB E;  2B1E A;  2QA7 A;  3KV4 A;  3HI2 A;  3UUX B;  4CI3 B;  4HTE A;  4OYK A;  1MIY A;  1UX5 A;  1SHZ C;  3ZMT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...