3ZC1A

Crystal structure of afc3po
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
190
structure length
190
Chain Sequence
MRLEECRKRLEELEAAREELLKVLREMRIHSTKSIALIHAGKVEEAEQELKKAIELLEKVKAYREYPEIYFYLCNDAMQELVEAIAFKNAISGEFTFEIDLEVTPAAFLNGFADAVGELRRYALTKLIEGDFKSAERMLEVMEKIYERLMEFTTFPDKLVSGLRKKLDVARGGIERTKSDYIAAKVARLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
pubmed doi rcsb
molecule keywords AFTRAX
molecule tags Hydrolase
source organism Archaeoglobus fulgidus
total genus 73
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zc1A00
5JR9A 5JREA 3ZC1A 5JRCB 5JR9C 5JR9B 5JRCA 3ZC0A
chains in the Genus database with same CATH superfamily
2QA7A 3I0OA 2V7IA 3R84B 5CB4E 4DV0T 5AQFB 2VKOA 4ZI3C 3HR0A 3N9LA 2A2FX 3NRXA 2CXFA 2BG9B 5LHIB 3P4SA 1HCIA 4LF8T 2XAGB 2CRBA 3KV4A 2LKHA 5L3GB 3UTKA 4I0UA 3I9YA 2BVMA 4YT0A 5HEJA 3FZKB 2WSSV 2Q9QD 2H7OA 2N2NA 2PBIA 2EHOA 3RIUA 3ZSSA 4UVCB 2X9XA 4YLHA 2DHRA 3LBXB 2Z6EA 5AQKB 4LF7T 3EDVA 4OHFA 1IJ5A 1QLBA 5LNKA 4X64T 4UXNB 3LJCA 3ZJ1A 2IMLA 3RYCE 3UU4A 3CPZA 3S4UA 4LFAT 2BKNA 2XAFB 4OYJA 2UXDT 4JI1T 2IDOB 5FYMA 2D9DA 2XAQB 5FXWA 3AEAA 2YU1A 3V5SA 3L09A 5L3BB 3AE1A 2WZIA 3ZC0A 3Q5XA 5AQQB 2LOSA 3WAKA 2V1DB 3CQXC 3HKBE 4GK0E 3VKHA 2UU9T 4ISSA 3TLTA 3UULA 2X0YA 3OPCA 4H9NC 5JH7E 2WDQA 2VL8A 4GYSA 3OKQA 2J1DG 2CE7A 2WU5A 5ABFA 3QB5A 2R6GF 1NENA 2XTLA 3AVRA 3TKLB 2OLTA 2CXDA 3BQKA 4JV5T 4B3ST 5F5WA 4GK5E 4V1Av 2FJBA 2UXXB 5CFBA 3AA1B 2NOXA 3KBUA 3QUJA 5KXJA 5LP6E 1SA0E 2HHHT 3SRZA 2C5JA 3A5XA 2FUPA 4HFEA 3AE9A 5FL1A 3MACA 2XUEA 1I6ZA 3N5LA 4TWFA 5F3JA 3K1SA 5HWYA 3KDSE 2VQET 1WLXA 4QX8B 4EZHA 1XMOT 2PG8A 3MZKB 5L3EB 4A56A 2ODVA 4CN1A 2OA5A 4PJLA 4GKJT 1G73A 4HWDA 1X9BA 3ONXA 2I59A 2AE9A 4YSXA 1OEDA 3PUGA 4JI7T 5J2TE 4B6XA 1X79A 2GK9A 3L8RA 4QKNA 3ZT7A 2YKSA 4X1YE 5JDGA 2LKGA 2HN1A 4X20E 4H9SE 4O4HE 2QRXA 2M6BA 4L9IA 2E9XC 3RQUA 2J4GA 3AVSA 4TUYE 3PDYA 4N78D 2FBWA 4UV8B 1ZV4X 2ZM0A 5ETWA 1M62A 5J0ZA 2LHRA 2XQYA 3KINB 2E9XB 2XPKA 4HN9A 5HXRA 4BJMA 5CJ5A 4KMCA 3K3OA 5FP3A 5JR9C 1NWMX 4JI2T 2LJLA 2CBJA 2DCFA 4HFVA 4UVBB 2A72A 2K3WA 1MIYA 3ZMSB 2IUBA 5F8PA 2XQ9A 3QNUA 5LG4A 5JR9B 3IF8B 4DV4T 2V6YB 4ZZBA 4IDPA 4CXWA 5FXVA 4QHOA 4NUUA 3ONJA 2X68A 3RIFA 2V8SV 5AQUB 1WFDA 5L4HA 4EV6A 4TX5A 4DIDB 1D0YA 2BBHA 5AFUL 2BKOA 2ODUA 4X66T 4QXCB 1JNZA 4QXBB 1Y01A 2DNXA 4M1PA 4IE6A 2BBJA 2CEAA 4YXDA 2WZHA 2WDVA 1LVFA 1WCRA 3ZKRA 4IE0A 5FL0A 4E7SA 4YTNA 3V5UA 4EIWA 5LG3A 4KBMB 3U78A 2D5UA 4DVDA 3JADA 2MBGA 5HYAA 4DV1T 3ZMUB 2ACZA 1UUSA 4UV9B 2XM2A 3PU8A 1HG5A 2V7JA 5AQNB 2LT3A 2CBIA 2M6IA 4TWDA 4ILCA 2EHOD 3HL6A 3O1JA 5E0OA 3FXEB 1VCTA 2JQKA 1HG2A 1BR4A 4DNDA 3P4WA 1WRDA 2VURA 3UU6A 4C90A 2YDRA 1Y64B 1EZ3A 2UXBT 4ADZA 4DV3T 4TV8E 4QX7B 2LSGA 3PJAA 3EUHA 2YK0A 2XSBA 2DI4A 3D0TA 5LHGB 5FXZA 2WMNA 1J5WA 3Q2MA 5LA6E 1HNXT 3T1YT 3NBXX 4HWFA 2YU2A 2XAHB 4DR6T 3HKCE 1N34T 2IIUA 3RX6A 2WQYA 5AQSB 5L47A 4A97A 5DJQC 2DWKA 3EDUA 5FNVE 4B3RT 3O1IA 3FZFB 4KUMB 4XBFB 3ESLA 5AQHB 4NIQA 4ISTA 5FKYA 1D1CA 2JQ9A 3F31A 4YSZA 1KK7A 3ZSTA 4IL4A 4KX6A 4PJJA 2IC6A 2JRKA 4HGAA 4WZXA 3JC6C 4GKKT 5ABEA 4LF9T 2AXDS 3N9PA 3AA7B 4DUZT 1JNRA 4EGWA 2V5DA 4K0UA 3AE4A 3QB5K 3AEGA 5TAOA 3RLFF 3KVAA 3CMLA 2E8IA 2L8KA 3PTRB 4O2AE 2KWHA 3E22E 4B3TT 2LRKA 4U74A 2CM0A 2YDQA 2XQ7A 2J62A 3K3QC 1KNRA 2I0MA 2YN6A 5JDQA 1VOMA 4DMVA 2X9HA 1KEYA 4PFOA 2XQ3A 1VRBA 3KFWX 3RGLA 2HPLA 1T98A 1HX1B 3LK3B 2NW8A 5A1LA 4ZS3A 5FMNA 2YDSA 4UF0B 5AQTB 4DO0A 2L9QA 5CGMA 3ZEFB 5L2LA 4DV6T 3TLVA 2D0TA 3BQLA 2G0UA 3UQ4A 2CLYC 4JBWF 3FBLA 1IBLT 4WW0A 1MMDA 3UU3A 3CWZB 3C4ZA 2VB6A 3RYIE 2NR4A 3CVRA 3RC8A 3W15B 2BS2A 4EEDA 1R8IA 2NWBA 3JCFA 3RC3A 2E2AA 5JDNA 3HA4A 4WBNE 1T8BA 1IJ6A 1S94A 2UXCT 3F57A 2B76A 3IEEA 3VKGA 4AXPA 4H63V 3R6NA 1YQ3A 3N2GE 2B1EA 2K48A 4YFSA 4U2YA 2NTYA 4GIWA 3ZYLA 1BR0A 3B13A 4AI6A 4DBRA 2WCAA 2DWGA 2WU2A 4MLKA 4HTEA 4L0RA 1W0AA 4XZCA 2BDEA 3C64A 2QYWA 1HS7A 2W2UA 4JEHB 2LM2A 4IIJE 1KF6A 2W62A 3KV6A 1M7KA 3ZPOA 4WNKA 5JQGE 3FZHB 4JI5T 4HFCA 3SWHA 1XWMA 2X67A 4O2BE 5H6RB 2RPAA 1Z8UA 2WY2A 4QH4A 2N9DA 3E08A 4U72A 4AIUA 2XAJB 4IL9A 4HFDA 5JR9A 2CWYA 2UXNB 4ZEYA 1OEDE 2V6YA 3ANWA 5JTGA 4OYKA 4DUYT 1BR2A 4OK0A 4YTMA 3GN5B 3ZMZB 5AQRB 2VL0A 4QWNB 4HWHA 2KNDA 4HFIA 5FVKA 3L39A 4AQFA 4HWIB 4AKLA 4H9RC 1D0XA 2JMKA 4FI5A 3NVOA 4H63H 4ZS2A 2CPTA 2PTFA 2W4XA 2EHOC 3RIUC 2JIWA 3UT5E 2WS3A 4QH1A 4KHPT 2X66A 2XQAA 4H9PC 5LGTB 5LBMA 5JDHA 4O4JE 3O4XE 2EHOB 3ZT6A 1J1JA 3RYHE 3SOLA 2ACXA 5EK3A 1ZP0A 5IYZE 5LXTE 4G2AA 4LF5T 4X65T 2WMOA 3PUQA 3C50A 3C98B 4PK5A 4EXTA 5GONE 4CN4A 2UUBT 1QSDA 2FJAA 2VVSA 4IREA 4OX9T 4YHJA 3I1AA 2W67A 2XM1A 2V6XA 1YXRA 1N32T 1HNWT 4P09A 3I0QA 1E1HB 1W0BA 4NPPA 4PW8A 2UUCT 2FJEA 3I9WA 3PUVF 1YQ4A 4IHJE 1UURA 3AA0B 4PAGA 2H3RA 1HFAA 4U2ZA 1MNDA 2WAUA 1FJGT 2MAWA 2D0UA 2VVNA 3AEFA 1SE7A 1ZKEA 5DQVA 4KI0F 4JYAT 3PJAJ 5LJNA 1W09A 4Z8XA 3CIRA 2W61A 2XQ6A 2XZEA 3PU3A 4U33A 5AQIB 2HPJA 3TLSA 5BMVE 2KSRA 4AKHA 4YSYA 3ABVA 3SFEA 4YJ3E 2BS3A 3OYXA 3DTOA 2NTXA 4C91A 5JVDE 1UX4A 5FY1A 4EYUA 3RQWA 1I94T 2ZM6T 5ABFB 1UCUA 3RHWA 4AQYT 2YEVC 1B7TA 2VK9A 4JI8T 2WWVA 3MXZA 3MK7C 3LK2B 3RI5A 1T7SA 4EEBA 5BR8T 2CCQA 1AJ3A 2XASB 4G63A 1J5ET 3AEBA 2Q9QC 3M65A 3LK42 3ETUA 4ILAA 1MMNA 3P4QA 4DR5T 1ZOYA 1D0ZA 2P9BA 2LE8A 1OEDC 2Q9QB 3LSVA 3AAIA 3OTOT 4O8SA 1WYBA 5FXXA 3EVYA 3H3MA 2JJ9A 3NKZA 3AECA 1E7PA 2H7VC 1OEDB 3Q9DA 2X0LB 1HF8A 2BG9A 4CI3B 4QH5A 1LRZA 3JAEA 3AXJB 2WB5A 4ZI2D 5J1GA 4PNIA 4X1IE 5LJMA 1IZNB 3AAAB 1US7B 5HEUA 2MPKA 2LOPA 2SPCA 3CKDA 3IA3A 4JUYA 3VR8A 4Z90A 3ZJ2A 2CHOA 3OJAA 3IBPA 5HAXA 1WYCA 5HEOA 2D2SA 3LBXA 2ZM8A 4TZ4C 4HFBA 2CMRA 4NUVA 1KFYA 3KV9A 3AE6A 3QC9A 2KZ7B 4EB6E 4ERRA 1ZEEA 5DQWA 3P4RA 4I4TE 2LSIA 2CXLA 3OBVE 1G8XA 4QXHB 2M67A 4X1KE 4CZZB 4DV7T 3PURA 5M4YA 5KX5E 3FZMB 4IDNA 4YJ2E 1T72A 1U4QA 2X51A 2K5BB 2LLYA 3FB2A 3UUBA 1SHZC 3T1HT 2X9YA 3E0ZA 4J2CA 5LB7B 2Y6XA 4DV5T 4NXMT 2VQFT 4DR4T 3SFDA 3P50A 4HFHA 4CI1B 5AQOB 5LGUB 2ZMAA 3VHLA 2KXPB 3Q5WA 2BS4A 5HXEA 4EAHA 3LG7A 4HEAA 5LGNB 1SUMB 1FEWA 2NW7A 3LDQB 1H7CA 3X1DA 4JLEA 3ZMVB 3EI0A 4UR9A 4FJOA 5JDLA 4DR7T 1VCSA 2C5KT 5EK2A 5JDFA 1OXZA 3PUWF 2V5CA 5ABGA 4LMJA 4JI6T 3UUNA 3EABA 4MFRA 1MNEA 3ZCJA 3P4PA 3AE2A 3AEDA 3FHNA 1IAPA 2XY8B 3P7IA 5JRCB 3RRCA 3Q5DA 4CN6A 4HWCA 3GN5A 2Y48B 4I50E 1HNZT 5HCMA 3RKOA 2LEHA 5LYJE 3AEEA 1HR0T 4BAYB 1WR0A 1MMGA 3RRWA 2A3DA 4AKRB 2VKHA 4UVAB 3KVBA 3CX8B 2WP9A 2KMFA 3TLUA 2A9UA 3FBZA 5HXCA 4EYYR 5CA0E 1UK5A 2NP9A 4A98A 1U5PA 2ZLYA 3LFMA 4DR1T 3GWHA 2HN2A 4XAXB 2CLYB 2XQ4A 5LHHB 3KBTA 2W66A 3AE3A 3B5MA 3J7Yq 3ZYKA 1NAFA 3NZPA 2F4VT 4MBQA 5LMNT 3NRYA 4ASKA 3GA8A 5FVLA 2C5IT 2LM9A 4K0KT 4X5TA 3J9X1 4TWHA 4ZOLE 3EAMA 2JPFA 2BKPA 2Y8DA 4DBQA 2VKDA 5L3CB 2XSAA 4L5GA 4PK4A 4P0BA 5L3DB 1O3XA 2BZBA 5AQMB 3M3ZB 4DR2T 1D1AA 4GYRA 3Q5EA 4ZZCA 1XDOA 3WAJA 2C0SA 4DV2T 5FY7A 2JMHA 3DP7A 4TV9E 5L4EA 3CX6B 4KP3C 5HCJA 4HE8A 2LHNA 4P1NA 2E9XA 3ZN0B 2VKJA 2E5LT 4ILBA 4CQIA 2FJDA 3HKDE 3OVUA 1XZYA 4U7IA 2L3LA 5JREA 5C2TA 4AKGA 5KDMC 3H3AA 2IW5B 4IDOA 3UU5A 4IDQA 3IHRA 2PJQA 1DU2A 3AB3B 5LCYA 4Z91A 5C8YE 2WDRA 3BK9A 4PJNA 4HKAA 4ZI7E 3N9MA 4NXNT 3TLWA 5CA1E 2MTQA 5L3FB 3FZLB 3N9QA 2W0GA 3O1HA 4IE4A 3C51A 4IT4A 2ZM2A 3O9XA 1UGOA 2XQ8A 4LF4T 4ZHQE 3AAEB 2OV9A 2V7MA 3A8YC 3UUXB 3JC6D 4ZI2C 4PK6A 3PUXF 4ANJA 3AA6B 4F6RC 5HXSA 2J47A 3K8PC 1OWAA 3MKDA 2H89A 4Q25A 3H37A 2KLQA 2LSKA 5IHYA 3ZT5A 1KNZA 1E2AA 1LVKA 5AQGB 4IE7A 4A5XA 4IDZA 5AQLB 1GQEA 2Q9QA 4GOUA 4DMWA 3UUMA 3ZN1B 4JI4T 3PUSA 4JI0T 1FMVA 1ZHCA 4UEMA 3PUAA 3VU7H 2YINA 4ZI3D 4ZXLA 4EZ4A 3P8CD 3RPUA 2X9WA 1NEKA 3AXJA 2BVLA 2XJ7A 2WBLA 2CWOA 2W00A 2KT9A 4X62T 2XQ5A 3F2EA 3C4WA 4YTPA 5AQPB 4IE5A 4LMLA 4UIGA 3ZMTB 3VR9A 5FY0A 4TNWA 3ETVA 4BJNA 4O4IE 2PFVA 1L0VA 3PE0A 3GMIA 3AE8A 3K3NA 1Z0PA 2K24A 2VASA 2WM9A 3RYFE 4H9QC 5EK4A 4LFBT 4U31A 5AQVB 3N9NA 2E5VA 2DL1A 4I43B 3PUZF 3ONLC 2H88A 4TN7B 2IHR1 3UU8A 3L3PA 4E7ZA 4JI3T 1LKXA 2QGSA 2WWUA 5HEGA 1IBKT 5KMGP 3RF1A 5HXHA 1XMQT 3SS1A 3WI3A 4LFCT 3ANWB 4U3CA 2BG9E 3VRAA 4OFZA 4ILUA 5LOVE 3ZLIA 5ABHA 4AQFC 5DABA 3N2OA 1XNRT 1YKHB 4MHCA 3A7MA 3CK6A 1WR6A 3UFEA 2UUAT 4MALA 1QUUA 5HEHA 3MA9A 3T8OA 4I55E 4AQGA 2IAKA 2X0HA 4AKIA 1FIOA 4PJMA 2I6HA 2CA5A 3AE5A 4U7YA 1MMAA 5JDMA 2V26A 1BR1A 2LRLA 3UFGA 1HTJF 1MIWA 3C4XA 2N1GA 4CXXA 3MJXA 3HKEE 1CUNA 5JRCA 1HX8A 2RP4A 4CI2B 3CX7B 3ZCIA 4CXYA 3AE7A 3CQCB 4UF0A 3BQIA 3RH3A 2V7KA 4F8HA 3PUYF 3VRBA 2ES0A 1KNPA 4UELA 2YOEA 4WYVA 3KV5A 3FXDB 2KWIB 4LMKA 2V7LA 3PV0F 2LSJA 3B57A 4BA9A 5IUXA 2VWAA 3N9OA 3OYZA 3U3IA 1CHUA 2CHNA 2NW9A 4TNVA 2W63A 1N33T 2RA1A 1YD8G 2MYSA 5C3JA 1N36T 2MOZA 1S35A 4H9OC 2K9AA 1IBMT 3JAFA 1YKEB 5HWXA 3N2KE 5EZYE 1MIVA 3CQGB 2KINB 4KHZF 2JQQA 5ADXL 5AQJB 3EHZA 3NWIA 3G06A 3ZC1A 1UX5A 2E9XD 2LSYA 3HI2A 4WBOA 4PFPA 4LF6T 2DLRA 3QK6A 2HH7A 4P0AA 4DR3T 1W9RA 1XDPA 3QOFA 2QVAA 4AISA 4IGUA 3RKGA 4YY3T 5LBQB 4O4LE 3NZQA 1XNQT 5J2UE 1YW0A 1FMWA 3ZYMA 4COFA 3UQ7A 5H6QB 2JQHA 2XHEB 4B3MT 4YHHT 5LMUT 3RIAA 1V9DA 4EOZB 3DJBA 2IC9A 1D1BA 5IWAT 4JEUB 2BG9C
chains in the Genus database with same CATH topology
2EHOD 2WAUA 3BK9A 3HL6A 3O1JA 5E0OA 2QA7A 2D0UA 3FXEB 4PJNA 3I0OA 1ZKEA 2V7IA 1HG2A 5DQVA 3R84B 5CB4E 2VKOA 4ZI3C 1BR4A 4DNDA 4HKAA 4ZI7E 3HR0A 1WRDA 3N9MA 3N9LA 2A2FX 5LJNA 5CA1E 4C90A 2MTQA 3NRXA 2CXFA 4Z8XA 5L3FB 1Y64B 5LHIB 2W61A 3N9QA 1HCIA 3PU3A 1EZ3A 2W0GA 3O1HA 4IE4A 4ADZA 3C51A 4TV8E 2XAGB 2ZM2A 4QX7B 3O9XA 2LSGA 3KV4A 2HPJA 3EUHA 5BMVE 2YK0A 5L3GB 4ZHQE 3UTKA 2DI4A 3D0TA 4AKHA 5LHGB 5FXZA 3AAEB 2WMNA 3I9YA 2BVMA 2V7MA 3Q2MA 5LA6E 4YJ3E 2WSSV 3OYXA 3DTOA 3UUXB 2Q9QD 2NTXA 2H7OA 3JC6D 4C91A 2N2NA 2PBIA 2EHOA 3NBXX 4ZI2C 4UVCB 2YU2A 4PK6A 2XAHB 3HKCE 5JVDE 2X9XA 1UX4A 4YLHA 2DHRA 5FY1A 4ANJA 3AA6B 4EYUA 4F6RC 5HXSA 3RX6A 3K8PC 1OWAA 2Z6EA 3LBXB 3MKDA 1UCUA 5DJQC 3H37A 2DWKA 3EDUA 2KLQA 5FNVE 3O1IA 2YEVC 1B7TA 2VK9A 3EDVA 2LSKA 4KUMB 4OHFA 1IJ5A 5IHYA 1KNZA 3ESLA 4XBFB 3MXZA 3MK7C 1LVKA 3LK2B 4ISTA 2CCQA 4IE7A 5LNKA 1D1CA 4UXNB 3LJCA 3ZJ1A 3F31A 1AJ3A 1KK7A 2XASB 4IDZA 4G63A 3RYCE 4PJJA 2IC6A 2Q9QA 2JRKA 2Q9QC 3CPZA 3M65A 4HGAA 3S4UA 3LK42 3ETUA 3JC6C 4GOUA 1MMNA 4DMWA 2XAFB 3UUMA 4OYJA 3ZN1B 3N9PA 3PUSA 3AA7B 1FMVA 4K0UA 1ZHCA 5FYMA 4UEMA 1D0ZA 2P9BA 3PUAA 3VU7H 5TAOA 2LE8A 2XAQB 2YINA 5FXWA 4ZI3D 2Q9QB 2YU1A 3CMLA 3KVAA 2E8IA 3V5SA 4EZ4A 3AAIA 2L8KA 3P8CD 3RPUA 2X9WA 4O8SA 3L09A 1WYBA 2BVLA 5L3BB 2WBLA 3PTRB 5FXXA 3EVYA 2CWOA 4O2AE 2KWHA 2JJ9A 2W00A 2KT9A 3E22E 3F2EA 4U74A 3C4WA 3ZC0A 2CM0A 2H7VC 4IE5A 3Q5XA 3Q9DA 4UIGA 2X0LB 3ZMTB 1HF8A 3K3QC 5FY0A 2LOSA 3ETVA 3WAKA 4BJNA 4O4IE 4CI3B 2PFVA 2V1DB 3PE0A 1LRZA 3CQXC 3GMIA 3HKBE 4GK0E 3K3NA 3VKHA 4ZI2D 1Z0PA 2K24A 5JDQA 1VOMA 2VASA 2WM9A 5J1GA 4ISSA 4PNIA 4X1IE 5LJMA 1IZNB 4DMVA 3AAAB 1US7B 3RYFE 2X9HA 4PFOA 3UULA 2LOPA 4H9QC 2SPCA 5EK4A 3CKDA 1VRBA 3KFWX 4H9NC 5JH7E 4JUYA 2HPLA 1T98A 3LK3B 2NW8A 3N9NA 5A1LA 4ZS3A 2VL8A 3ZJ2A 5FMNA 3OJAA 3IBPA 4UF0B 5HAXA 4I43B 4DO0A 2L9QA 4GYSA 1WYCA 3OKQA 3ZEFB 5L2LA 2D2SA 2J1DG 2CE7A 3LBXA 4TN7B 2ZM8A 2D0TA 3BQLA 4TZ4C 3L3PA 2CMRA 4NUVA 4E7ZA 2G0UA 1LKXA 3KV9A 2CLYC 2QGSA 3FBLA 2XTLA 2WWUA 3AVRA 3QC9A 3TKLB 4WW0A 1MMDA 2KZ7B 5KMGP 4EB6E 4ERRA 5HXHA 3SS1A 3WI3A 3CWZB 1ZEEA 3C4ZA 2CXDA 3ANWB 2VB6A 3BQKA 3RYIE 5DQWA 3CVRA 4I4TE 3RC8A 3W15B 2LSIA 4GK5E 2CXLA 4V1Av 4OFZA 4ILUA 5LOVE 3OBVE 2UXXB 1G8XA 4QXHB 3ZLIA 2NWBA 2M67A 4AQFC 4X1KE 3RC3A 3AA1B 2NOXA 4CZZB 3KBUA 3QUJA 3HA4A 5JDNA 4WBNE 5DABA 3N2OA 5LP6E 3PURA 1IJ6A 5M4YA 5KX5E 1SA0E 1S94A 4YJ2E 1U4QA 3F57A 3IEEA 1YKHB 2X51A 2K5BB 2C5JA 3A5XA 4MHCA 3SRZA 3VKGA 1WR6A 3UFEA 4AXPA 3MACA 4H63V 2XUEA 3FB2A 3N5LA 3R6NA 1SHZC 5F3JA 4MALA 3N2GE 1QUUA 2B1EA 2K48A 4YFSA 5HWYA 3KDSE 1WLXA 4QX8B 4EZHA 2X9YA 2PG8A 2NTYA 3E0ZA 3MZKB 4J2CA 5L3EB 3MA9A 3T8OA 4I55E 4GIWA 4A56A 4AQGA 3ZYLA 2Y6XA 2IAKA 2ODVA 1BR0A 3B13A 2OA5A 4PJLA 4AKIA 4AI6A 1G73A 3ONXA 4DBRA 1FIOA 4CI1B 2DWGA 5LGUB 2I59A 4PJMA 4MLKA 4HTEA 3PUGA 2ZMAA 4L0RA 2KXPB 4XZCA 3VHLA 5J2TE 2BDEA 3Q5WA 3C64A 2CA5A 1HS7A 5HXEA 4EAHA 3LG7A 4JEHB 4B6XA 1X79A 1MMAA 2GK9A 4HEAA 5LGNB 5JDMA 4QKNA 1FEWA 2V26A 2NW7A 1BR1A 4X1YE 1H7CA 4IIJE 5JDGA 1HTJF 2W62A 1MIWA 3C4XA 4JLEA 4X20E 3KV6A 2N1GA 3ZMVB 4H9SE 4CXXA 3MJXA 3HKEE 4FJOA 3ZPOA 4O4HE 4WNKA 5JDLA 1CUNA 4L9IA 5JRCA 1HX8A 2E9XC 2C5KT 2RP4A 5JQGE 5EK2A 5JDFA 1OXZA 3AVSA 4TUYE 4CI2B 3PDYA 4N78D 3CX7B 3ZCIA 3UUNA 4CXYA 3SWHA 4UV8B 4MFRA 3CQCB 1MNEA 1ZV4X 2ZM0A 2X67A 4UF0A 3ZCJA 3BQIA 5ETWA 4O2BE 5H6RB 3FHNA 3RH3A 2V7KA 1IAPA 2LHRA 3P7IA 2XQYA 3KINB 2E9XB 4BJMA 4HN9A 5HXRA 5JRCB 2N9DA 2ES0A 3E08A 4U72A 2XAJB 4UELA 3RRCA 3KV5A 3GN5A 3FXDB 5JR9A 2CWYA 4KMCA 2KWIB 3K3OA 2UXNB 5FP3A 5JR9C 2Y48B 4I50E 1NWMX 2V7LA 2LSJA 3B57A 3RKOA 2LEHA 3ANWA 4BA9A 5LYJE 2VWAA 2LJLA 3N9OA 4BAYB 4OYKA 3OYZA 2DCFA 1BR2A 1MMGA 2A3DA 4HFVA 4OK0A 3RRWA 4AKRB 2VKHA 3U3IA 4UVBB 4UVAB 2A72A 3KVBA 3CX8B 1MIYA 3ZMSB 5F8PA 2KMFA 2NW9A 3GN5B 3ZMZB 5LG4A 5JR9B 3IF8B 2W63A 3FBZA 5HXCA 4EYYR 2RA1A 5CA0E 4QWNB 1YD8G 2NP9A 2KNDA 2MYSA 4CXWA 1U5PA 5FXVA 4QHOA 4NUUA 2ZLYA 2MOZA 3LFMA 1S35A 4H9OC 4AQFA 4AKLA 4H9RC 3GWHA 1D0XA 2K9AA 2X68A 4XAXB 2CLYB 2JMKA 4FI5A 1YKEB 5HWXA 5LHHB 3N2KE 3KBTA 4H63H 4ZS2A 5EZYE 3J7Yq 1MIVA 3ZYKA 3CQGB 2KINB 1NAFA 2EHOC 3NZPA 4TX5A 3UT5E 1D0YA 4MBQA 2JQQA 3NRYA 5AFUL 5ADXL 4ASKA 2X66A 3GA8A 4H9PC 2C5IT 2LM9A 2ODUA 4QXCB 3ZC1A 1UX5A 5LGTB 5LBMA 4QXBB 5JDHA 2E9XD 3J9X1 4O4JE 2DNXA 4M1PA 4IE6A 2LSYA 3O4XE 4ZOLE 3HI2A 2EHOB 2JPFA 2Y8DA 2CEAA 4WBOA 4DBQA 4PFPA 3RYHE 2DLRA 2VKDA 5L3CB 3SOLA 4L5GA 4PK4A 1LVFA 2ACXA 3QK6A 4P0BA 5L3DB 1O3XA 2BZBA 5EK3A 5IYZE 5LXTE 4G2AA 4IE0A 1D1AA 4E7SA 2WMOA 4GYRA 2HH7A 3PUQA 4P0AA 3C50A 3C98B 4PK5A 3V5UA 3WAJA 4EIWA 2C0SA 4EXTA 5FY7A 5GONE 2JMHA 3DP7A 4IGUA 4TV9E 3CX6B 4KP3C 1QSDA 4KBMB 3U78A 2D5UA 5LBQB 4DVDA 4O4LE 3NZQA 4HE8A 4YHJA 2LHNA 2MBGA 2E9XA 3ZN0B 5HYAA 2VKJA 3I1AA 5J2UE 1YW0A 1FMWA 3ZYMA 4CQIA 3ZMUB 3HKDE 5H6QB 4P09A 3I0QA 1E1HB 2XHEB 4UV9B 2L3LA 3PU8A 1HG5A 4PW8A 5JREA 4AKGA 5KDMC 1V9DA 2V7JA 4EOZB 3H3AA 2IW5B 3I9WA 4IHJE 2LT3A 3DJBA 3AA0B 4PAGA 2IC9A 2H3RA 1D1BA 3IHRA 2PJQA 4JEUB 1HFAA 3AB3B 5LCYA 1MNDA 5C8YE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 A;  5JRE A;  3ZC1 A;  5JRC B;  5JR9 C;  5JR9 B;  5JRC A;  3ZC0 A; 
#chains in the Genus database with same CATH topology
 2QA7 A;  3I0O A;  2V7I A;  3R84 B;  5CB4 E;  4DV0 T;  5AQF B;  2VKO A;  4ZI3 C;  3HR0 A;  3N9L A;  2A2F X;  3NRX A;  2CXF A;  2BG9 B;  5LHI B;  3P4S A;  1HCI A;  4LF8 T;  2XAG B;  2CRB A;  3KV4 A;  2LKH A;  5L3G B;  3UTK A;  4I0U A;  3I9Y A;  2BVM A;  4YT0 A;  5HEJ A;  3FZK B;  2WSS V;  2Q9Q D;  2H7O A;  2N2N A;  2PBI A;  2EHO A;  3RIU A;  3ZSS A;  4UVC B;  2X9X A;  4YLH A;  2DHR A;  3LBX B;  2Z6E A;  5AQK B;  4LF7 T;  3EDV A;  4OHF A;  1IJ5 A;  1QLB A;  5LNK A;  4X64 T;  4UXN B;  3LJC A;  3ZJ1 A;  2IML A;  3RYC E;  3UU4 A;  3CPZ A;  3S4U A;  4LFA T;  2BKN A;  2XAF B;  4OYJ A;  2UXD T;  4JI1 T;  2IDO B;  5FYM A;  2D9D A;  2XAQ B;  5FXW A;  3AEA A;  2YU1 A;  3V5S A;  3L09 A;  5L3B B;  3AE1 A;  2WZI A;  3ZC0 A;  3Q5X A;  5AQQ B;  2LOS A;  3WAK A;  2V1D B;  3CQX C;  3HKB E;  4GK0 E;  3VKH A;  2UU9 T;  4ISS A;  3TLT A;  3UUL A;  2X0Y A;  3OPC A;  4H9N C;  5JH7 E;  2WDQ A;  2VL8 A;  4GYS A;  3OKQ A;  2J1D G;  2CE7 A;  2WU5 A;  5ABF A;  3QB5 A;  2R6G F;  1NEN A;  2XTL A;  3AVR A;  3TKL B;  2OLT A;  2CXD A;  3BQK A;  4JV5 T;  4B3S T;  5F5W A;  4GK5 E;  4V1A v;  2FJB A;  2UXX B;  5CFB A;  3AA1 B;  2NOX A;  3KBU A;  3QUJ A;  5KXJ A;  5LP6 E;  1SA0 E;  2HHH T;  3SRZ A;  2C5J A;  3A5X A;  2FUP A;  4HFE A;  3AE9 A;  5FL1 A;  3MAC A;  2XUE A;  1I6Z A;  3N5L A;  4TWF A;  5F3J A;  3K1S A;  5HWY A;  3KDS E;  2VQE T;  1WLX A;  4QX8 B;  4EZH A;  1XMO T;  2PG8 A;  3MZK B;  5L3E B;  4A56 A;  2ODV A;  4CN1 A;  2OA5 A;  4PJL A;  4GKJ T;  1G73 A;  4HWD A;  1X9B A;  3ONX A;  2I59 A;  2AE9 A;  4YSX A;  1OED A;  3PUG A;  4JI7 T;  5J2T E;  4B6X A;  1X79 A;  2GK9 A;  3L8R A;  4QKN A;  3ZT7 A;  2YKS A;  4X1Y E;  5JDG A;  2LKG A;  2HN1 A;  4X20 E;  4H9S E;  4O4H E;  2QRX A;  2M6B A;  4L9I A;  2E9X C;  3RQU A;  2J4G A;  3AVS A;  4TUY E;  3PDY A;  4N78 D;  2FBW A;  4UV8 B;  1ZV4 X;  2ZM0 A;  5ETW A;  1M62 A;  5J0Z A;  2LHR A;  2XQY A;  3KIN B;  2E9X B;  2XPK A;  4HN9 A;  5HXR A;  4BJM A;  5CJ5 A;  4KMC A;  3K3O A;  5FP3 A;  5JR9 C;  1NWM X;  4JI2 T;  2LJL A;  2CBJ A;  2DCF A;  4HFV A;  4UVB B;  2A72 A;  2K3W A;  1MIY A;  3ZMS B;  2IUB A;  5F8P A;  2XQ9 A;  3QNU A;  5LG4 A;  5JR9 B;  3IF8 B;  4DV4 T;  2V6Y B;  4ZZB A;  4IDP A;  4CXW A;  5FXV A;  4QHO A;  4NUU A;  3ONJ A;  2X68 A;  3RIF A;  2V8S V;  5AQU B;  1WFD A;  5L4H A;  4EV6 A;  4TX5 A;  4DID B;  1D0Y A;  2BBH A;  5AFU L;  2BKO A;  2ODU A;  4X66 T;  4QXC B;  1JNZ A;  4QXB B;  1Y01 A;  2DNX A;  4M1P A;  4IE6 A;  2BBJ A;  2CEA A;  4YXD A;  2WZH A;  2WDV A;  1LVF A;  1WCR A;  3ZKR A;  4IE0 A;  5FL0 A;  4E7S A;  4YTN A;  3V5U A;  4EIW A;  5LG3 A;  4KBM B;  3U78 A;  2D5U A;  4DVD A;  3JAD A;  2MBG A;  5HYA A;  4DV1 T;  3ZMU B;  2ACZ A;  1UUS A;  4UV9 B;  2XM2 A;  3PU8 A;  1HG5 A;  2V7J A;  5AQN B;  2LT3 A;  2CBI A;  2M6I A;  4TWD A;  4ILC A;  2EHO D;  3HL6 A;  3O1J A;  5E0O A;  3FXE B;  1VCT A;  2JQK A;  1HG2 A;  1BR4 A;  4DND A;  3P4W A;  1WRD A;  2VUR A;  3UU6 A;  4C90 A;  2YDR A;  1Y64 B;  1EZ3 A;  2UXB T;  4ADZ A;  4DV3 T;  4TV8 E;  4QX7 B;  2LSG A;  3PJA A;  3EUH A;  2YK0 A;  2XSB A;  2DI4 A;  3D0T A;  5LHG B;  5FXZ A;  2WMN A;  1J5W A;  3Q2M A;  5LA6 E;  1HNX T;  3T1Y T;  3NBX X;  4HWF A;  2YU2 A;  2XAH B;  4DR6 T;  3HKC E;  1N34 T;  2IIU A;  3RX6 A;  2WQY A;  5AQS B;  5L47 A;  4A97 A;  5DJQ C;  2DWK A;  3EDU A;  5FNV E;  4B3R T;  3O1I A;  3FZF B;  4KUM B;  4XBF B;  3ESL A;  5AQH B;  4NIQ A;  4IST A;  5FKY A;  1D1C A;  2JQ9 A;  3F31 A;  4YSZ A;  1KK7 A;  3ZST A;  4IL4 A;  4KX6 A;  4PJJ A;  2IC6 A;  2JRK A;  4HGA A;  4WZX A;  3JC6 C;  4GKK T;  5ABE A;  4LF9 T;  2AXD S;  3N9P A;  3AA7 B;  4DUZ T;  1JNR A;  4EGW A;  2V5D A;  4K0U A;  3AE4 A;  3QB5 K;  3AEG A;  5TAO A;  3RLF F;  3KVA A;  3CML A;  2E8I A;  2L8K A;  3PTR B;  4O2A E;  2KWH A;  3E22 E;  4B3T T;  2LRK A;  4U74 A;  2CM0 A;  2YDQ A;  2XQ7 A;  2J62 A;  3K3Q C;  1KNR A;  2I0M A;  2YN6 A;  5JDQ A;  1VOM A;  4DMV A;  2X9H A;  1KEY A;  4PFO A;  2XQ3 A;  1VRB A;  3KFW X;  3RGL A;  2HPL A;  1T98 A;  1HX1 B;  3LK3 B;  2NW8 A;  5A1L A;  4ZS3 A;  5FMN A;  2YDS A;  4UF0 B;  5AQT B;  4DO0 A;  2L9Q A;  5CGM A;  3ZEF B;  5L2L A;  4DV6 T;  3TLV A;  2D0T A;  3BQL A;  2G0U A;  3UQ4 A;  2CLY C;  4JBW F;  3FBL A;  1IBL T;  4WW0 A;  1MMD A;  3UU3 A;  3CWZ B;  3C4Z A;  2VB6 A;  3RYI E;  2NR4 A;  3CVR A;  3RC8 A;  3W15 B;  2BS2 A;  4EED A;  1R8I A;  2NWB A;  3JCF A;  3RC3 A;  2E2A A;  5JDN A;  3HA4 A;  4WBN E;  1T8B A;  1IJ6 A;  1S94 A;  2UXC T;  3F57 A;  2B76 A;  3IEE A;  3VKG A;  4AXP A;  4H63 V;  3R6N A;  1YQ3 A;  3N2G E;  2B1E A;  2K48 A;  4YFS A;  4U2Y A;  2NTY A;  4GIW A;  3ZYL A;  1BR0 A;  3B13 A;  4AI6 A;  4DBR A;  2WCA A;  2DWG A;  2WU2 A;  4MLK A;  4HTE A;  4L0R A;  1W0A A;  4XZC A;  2BDE A;  3C64 A;  2QYW A;  1HS7 A;  2W2U A;  4JEH B;  2LM2 A;  4IIJ E;  1KF6 A;  2W62 A;  3KV6 A;  1M7K A;  3ZPO A;  4WNK A;  5JQG E;  3FZH B;  4JI5 T;  4HFC A;  3SWH A;  1XWM A;  2X67 A;  4O2B E;  5H6R B;  2RPA A;  1Z8U A;  2WY2 A;  4QH4 A;  2N9D A;  3E08 A;  4U72 A;  4AIU A;  2XAJ B;  4IL9 A;  4HFD A;  5JR9 A;  2CWY A;  2UXN B;  4ZEY A;  1OED E;  2V6Y A;  3ANW A;  5JTG A;  4OYK A;  4DUY T;  1BR2 A;  4OK0 A;  4YTM A;  3GN5 B;  3ZMZ B;  5AQR B;  2VL0 A;  4QWN B;  4HWH A;  2KND A;  4HFI A;  5FVK A;  3L39 A;  4AQF A;  4HWI B;  4AKL A;  4H9R C;  1D0X A;  2JMK A;  4FI5 A;  3NVO A;  4H63 H;  4ZS2 A;  2CPT A;  2PTF A;  2W4X A;  2EHO C;  3RIU C;  2JIW A;  3UT5 E;  2WS3 A;  4QH1 A;  4KHP T;  2X66 A;  2XQA A;  4H9P C;  5LGT B;  5LBM A;  5JDH A;  4O4J E;  3O4X E;  2EHO B;  3ZT6 A;  1J1J A;  3RYH E;  3SOL A;  2ACX A;  5EK3 A;  1ZP0 A;  5IYZ E;  5LXT E;  4G2A A;  4LF5 T;  4X65 T;  2WMO A;  3PUQ A;  3C50 A;  3C98 B;  4PK5 A;  4EXT A;  5GON E;  4CN4 A;  2UUB T;  1QSD A;  2FJA A;  2VVS A;  4IRE A;  4OX9 T;  4YHJ A;  3I1A A;  2W67 A;  2XM1 A;  2V6X A;  1YXR A;  1N32 T;  1HNW T;  4P09 A;  3I0Q A;  1E1H B;  1W0B A;  4NPP A;  4PW8 A;  2UUC T;  2FJE A;  3I9W A;  3PUV F;  1YQ4 A;  4IHJ E;  1UUR A;  3AA0 B;  4PAG A;  2H3R A;  1HFA A;  4U2Z A;  1MND A;  2WAU A;  1FJG T;  2MAW A;  2D0U A;  2VVN A;  3AEF A;  1SE7 A;  1ZKE A;  5DQV A;  4KI0 F;  4JYA T;  3PJA J;  5LJN A;  1W09 A;  4Z8X A;  3CIR A;  2W61 A;  2XQ6 A;  2XZE A;  3PU3 A;  4U33 A;  5AQI B;  2HPJ A;  3TLS A;  5BMV E;  2KSR A;  4AKH A;  4YSY A;  3ABV A;  3SFE A;  4YJ3 E;  2BS3 A;  3OYX A;  3DTO A;  2NTX A;  4C91 A;  5JVD E;  1UX4 A;  5FY1 A;  4EYU A;  3RQW A;  1I94 T;  2ZM6 T;  5ABF B;  1UCU A;  3RHW A;  4AQY T;  2YEV C;  1B7T A;  2VK9 A;  4JI8 T;  2WWV A;  3MXZ A;  3MK7 C;  3LK2 B;  3RI5 A;  1T7S A;  4EEB A;  5BR8 T;  2CCQ A;  1AJ3 A;  2XAS B;  4G63 A;  1J5E T;  3AEB A;  2Q9Q C;  3M65 A;  3LK4 2;  3ETU A;  4ILA A;  1MMN A;  3P4Q A;  4DR5 T;  1ZOY A;  1D0Z A;  2P9B A;  2LE8 A;  1OED C;  2Q9Q B;  3LSV A;  3AAI A;  3OTO T;  4O8S A;  1WYB A;  5FXX A;  3EVY A;  3H3M A;  2JJ9 A;  3NKZ A;  3AEC A;  1E7P A;  2H7V C;  1OED B;  3Q9D A;  2X0L B;  1HF8 A;  2BG9 A;  4CI3 B;  4QH5 A;  1LRZ A;  3JAE A;  3AXJ B;  2WB5 A;  4ZI2 D;  5J1G A;  4PNI A;  4X1I E;  5LJM A;  1IZN B;  3AAA B;  1US7 B;  5HEU A;  2MPK A;  2LOP A;  2SPC A;  3CKD A;  3IA3 A;  4JUY A;  3VR8 A;  4Z90 A;  3ZJ2 A;  2CHO A;  3OJA A;  3IBP A;  5HAX A;  1WYC A;  5HEO A;  2D2S A;  3LBX A;  2ZM8 A;  4TZ4 C;  4HFB A;  2CMR A;  4NUV A;  1KFY A;  3KV9 A;  3AE6 A;  3QC9 A;  2KZ7 B;  4EB6 E;  4ERR A;  1ZEE A;  5DQW A;  3P4R A;  4I4T E;  2LSI A;  2CXL A;  3OBV E;  1G8X A;  4QXH B;  2M67 A;  4X1K E;  4CZZ B;  4DV7 T;  3PUR A;  5M4Y A;  5KX5 E;  3FZM B;  4IDN A;  4YJ2 E;  1T72 A;  1U4Q A;  2X51 A;  2K5B B;  2LLY A;  3FB2 A;  3UUB A;  1SHZ C;  3T1H T;  2X9Y A;  3E0Z A;  4J2C A;  5LB7 B;  2Y6X A;  4DV5 T;  4NXM T;  2VQF T;  4DR4 T;  3SFD A;  3P50 A;  4HFH A;  4CI1 B;  5AQO B;  5LGU B;  2ZMA A;  3VHL A;  2KXP B;  3Q5W A;  2BS4 A;  5HXE A;  4EAH A;  3LG7 A;  4HEA A;  5LGN B;  1SUM B;  1FEW A;  2NW7 A;  3LDQ B;  1H7C A;  3X1D A;  4JLE A;  3ZMV B;  3EI0 A;  4UR9 A;  4FJO A;  5JDL A;  4DR7 T;  1VCS A;  2C5K T;  5EK2 A;  5JDF A;  1OXZ A;  3PUW F;  2V5C A;  5ABG A;  4LMJ A;  4JI6 T;  3UUN A;  3EAB A;  4MFR A;  1MNE A;  3ZCJ A;  3P4P A;  3AE2 A;  3AED A;  3FHN A;  1IAP A;  2XY8 B;  3P7I A;  5JRC B;  3RRC A;  3Q5D A;  4CN6 A;  4HWC A;  3GN5 A;  2Y48 B;  4I50 E;  1HNZ T;  5HCM A;  3RKO A;  2LEH A;  5LYJ E;  3AEE A;  1HR0 T;  4BAY B;  1WR0 A;  1MMG A;  3RRW A;  2A3D A;  4AKR B;  2VKH A;  4UVA B;  3KVB A;  3CX8 B;  2WP9 A;  2KMF A;  3TLU A;  2A9U A;  3FBZ A;  5HXC A;  4EYY R;  5CA0 E;  1UK5 A;  2NP9 A;  4A98 A;  1U5P A;  2ZLY A;  3LFM A;  4DR1 T;  3GWH A;  2HN2 A;  4XAX B;  2CLY B;  2XQ4 A;  5LHH B;  3KBT A;  2W66 A;  3AE3 A;  3B5M A;  3J7Y q;  3ZYK A;  1NAF A;  3NZP A;  2F4V T;  4MBQ A;  5LMN T;  3NRY A;  4ASK A;  3GA8 A;  5FVL A;  2C5I T;  2LM9 A;  4K0K T;  4X5T A;  3J9X 1;  4TWH A;  4ZOL E;  3EAM A;  2JPF A;  2BKP A;  2Y8D A;  4DBQ A;  2VKD A;  5L3C B;  2XSA A;  4L5G A;  4PK4 A;  4P0B A;  5L3D B;  1O3X A;  2BZB A;  5AQM B;  3M3Z B;  4DR2 T;  1D1A A;  4GYR A;  3Q5E A;  4ZZC A;  1XDO A;  3WAJ A;  2C0S A;  4DV2 T;  5FY7 A;  2JMH A;  3DP7 A;  4TV9 E;  5L4E A;  3CX6 B;  4KP3 C;  5HCJ A;  4HE8 A;  2LHN A;  4P1N A;  2E9X A;  3ZN0 B;  2VKJ A;  2E5L T;  4ILB A;  4CQI A;  2FJD A;  3HKD E;  3OVU A;  1XZY A;  4U7I A;  2L3L A;  5JRE A;  5C2T A;  4AKG A;  5KDM C;  3H3A A;  2IW5 B;  4IDO A;  3UU5 A;  4IDQ A;  3IHR A;  2PJQ A;  1DU2 A;  3AB3 B;  5LCY A;  4Z91 A;  5C8Y E;  2WDR A;  3BK9 A;  4PJN A;  4HKA A;  4ZI7 E;  3N9M A;  4NXN T;  3TLW A;  5CA1 E;  2MTQ A;  5L3F B;  3FZL B;  3N9Q A;  2W0G A;  3O1H A;  4IE4 A;  3C51 A;  4IT4 A;  2ZM2 A;  3O9X A;  1UGO A;  2XQ8 A;  4LF4 T;  4ZHQ E;  3AAE B;  2OV9 A;  2V7M A;  3A8Y C;  3UUX B;  3JC6 D;  4ZI2 C;  4PK6 A;  3PUX F;  4ANJ A;  3AA6 B;  4F6R C;  5HXS A;  2J47 A;  3K8P C;  1OWA A;  3MKD A;  2H89 A;  4Q25 A;  3H37 A;  2KLQ A;  2LSK A;  5IHY A;  3ZT5 A;  1KNZ A;  1E2A A;  1LVK A;  5AQG B;  4IE7 A;  4A5X A;  4IDZ A;  5AQL B;  1GQE A;  2Q9Q A;  4GOU A;  4DMW A;  3UUM A;  3ZN1 B;  4JI4 T;  3PUS A;  4JI0 T;  1FMV A;  1ZHC A;  4UEM A;  3PUA A;  3VU7 H;  2YIN A;  4ZI3 D;  4ZXL A;  4EZ4 A;  3P8C D;  3RPU A;  2X9W A;  1NEK A;  3AXJ A;  2BVL A;  2XJ7 A;  2WBL A;  2CWO A;  2W00 A;  2KT9 A;  4X62 T;  2XQ5 A;  3F2E A;  3C4W A;  4YTP A;  5AQP B;  4IE5 A;  4LML A;  4UIG A;  3ZMT B;  3VR9 A;  5FY0 A;  4TNW A;  3ETV A;  4BJN A;  4O4I E;  2PFV A;  1L0V A;  3PE0 A;  3GMI A;  3AE8 A;  3K3N A;  1Z0P A;  2K24 A;  2VAS A;  2WM9 A;  3RYF E;  4H9Q C;  5EK4 A;  4LFB T;  4U31 A;  5AQV B;  3N9N A;  2E5V A;  2DL1 A;  4I43 B;  3PUZ F;  3ONL C;  2H88 A;  4TN7 B;  2IHR 1;  3UU8 A;  3L3P A;  4E7Z A;  4JI3 T;  1LKX A;  2QGS A;  2WWU A;  5HEG A;  1IBK T;  5KMG P;  3RF1 A;  5HXH A;  1XMQ T;  3SS1 A;  3WI3 A;  4LFC T;  3ANW B;  4U3C A;  2BG9 E;  3VRA A;  4OFZ A;  4ILU A;  5LOV E;  3ZLI A;  5ABH A;  4AQF C;  5DAB A;  3N2O A;  1XNR T;  1YKH B;  4MHC A;  3A7M A;  3CK6 A;  1WR6 A;  3UFE A;  2UUA T;  4MAL A;  1QUU A;  5HEH A;  3MA9 A;  3T8O A;  4I55 E;  4AQG A;  2IAK A;  2X0H A;  4AKI A;  1FIO A;  4PJM A;  2I6H A;  2CA5 A;  3AE5 A;  4U7Y A;  1MMA A;  5JDM A;  2V26 A;  1BR1 A;  2LRL A;  3UFG A;  1HTJ F;  1MIW A;  3C4X A;  2N1G A;  4CXX A;  3MJX A;  3HKE E;  1CUN A;  5JRC A;  1HX8 A;  2RP4 A;  4CI2 B;  3CX7 B;  3ZCI A;  4CXY A;  3AE7 A;  3CQC B;  4UF0 A;  3BQI A;  3RH3 A;  2V7K A;  4F8H A;  3PUY F;  3VRB A;  2ES0 A;  1KNP A;  4UEL A;  2YOE A;  4WYV A;  3KV5 A;  3FXD B;  2KWI B;  4LMK A;  2V7L A;  3PV0 F;  2LSJ A;  3B57 A;  4BA9 A;  5IUX A;  2VWA A;  3N9O A;  3OYZ A;  3U3I A;  1CHU A;  2CHN A;  2NW9 A;  4TNV A;  2W63 A;  1N33 T;  2RA1 A;  1YD8 G;  2MYS A;  5C3J A;  1N36 T;  2MOZ A;  1S35 A;  4H9O C;  2K9A A;  1IBM T;  3JAF A;  1YKE B;  5HWX A;  3N2K E;  5EZY E;  1MIV A;  3CQG B;  2KIN B;  4KHZ F;  2JQQ A;  5ADX L;  5AQJ B;  3EHZ A;  3NWI A;  3G06 A;  3ZC1 A;  1UX5 A;  2E9X D;  2LSY A;  3HI2 A;  4WBO A;  4PFP A;  4LF6 T;  2DLR A;  3QK6 A;  2HH7 A;  4P0A A;  4DR3 T;  1W9R A;  1XDP A;  3QOF A;  2QVA A;  4AIS A;  4IGU A;  3RKG A;  4YY3 T;  5LBQ B;  4O4L E;  3NZQ A;  1XNQ T;  5J2U E;  1YW0 A;  1FMW A;  3ZYM A;  4COF A;  3UQ7 A;  5H6Q B;  2JQH A;  2XHE B;  4B3M T;  4YHH T;  5LMU T;  3RIA A;  1V9D A;  4EOZ B;  3DJB A;  2IC9 A;  1D1B A;  5IWA T;  4JEU B;  2BG9 C; 
#chains in the Genus database with same CATH homology
 2EHO D;  2WAU A;  3BK9 A;  3HL6 A;  3O1J A;  5E0O A;  2QA7 A;  2D0U A;  3FXE B;  4PJN A;  3I0O A;  1ZKE A;  2V7I A;  1HG2 A;  5DQV A;  3R84 B;  5CB4 E;  2VKO A;  4ZI3 C;  1BR4 A;  4DND A;  4HKA A;  4ZI7 E;  3HR0 A;  1WRD A;  3N9M A;  3N9L A;  2A2F X;  5LJN A;  5CA1 E;  4C90 A;  2MTQ A;  3NRX A;  2CXF A;  4Z8X A;  5L3F B;  1Y64 B;  5LHI B;  2W61 A;  3N9Q A;  1HCI A;  3PU3 A;  1EZ3 A;  2W0G A;  3O1H A;  4IE4 A;  4ADZ A;  3C51 A;  4TV8 E;  2XAG B;  2ZM2 A;  4QX7 B;  3O9X A;  2LSG A;  3KV4 A;  2HPJ A;  3EUH A;  5BMV E;  2YK0 A;  5L3G B;  4ZHQ E;  3UTK A;  2DI4 A;  3D0T A;  4AKH A;  5LHG B;  5FXZ A;  3AAE B;  2WMN A;  3I9Y A;  2BVM A;  2V7M A;  3Q2M A;  5LA6 E;  4YJ3 E;  2WSS V;  3OYX A;  3DTO A;  3UUX B;  2Q9Q D;  2NTX A;  2H7O A;  3JC6 D;  4C91 A;  2N2N A;  2PBI A;  2EHO A;  3NBX X;  4ZI2 C;  4UVC B;  2YU2 A;  4PK6 A;  2XAH B;  3HKC E;  5JVD E;  2X9X A;  1UX4 A;  4YLH A;  2DHR A;  5FY1 A;  4ANJ A;  3AA6 B;  4EYU A;  4F6R C;  5HXS A;  3RX6 A;  3K8P C;  1OWA A;  2Z6E A;  3LBX B;  3MKD A;  1UCU A;  5DJQ C;  3H37 A;  2DWK A;  3EDU A;  2KLQ A;  5FNV E;  3O1I A;  2YEV C;  1B7T A;  2VK9 A;  3EDV A;  2LSK A;  4KUM B;  4OHF A;  1IJ5 A;  5IHY A;  1KNZ A;  3ESL A;  4XBF B;  3MXZ A;  3MK7 C;  1LVK A;  3LK2 B;  4IST A;  2CCQ A;  4IE7 A;  5LNK A;  1D1C A;  4UXN B;  3LJC A;  3ZJ1 A;  3F31 A;  1AJ3 A;  1KK7 A;  2XAS B;  4IDZ A;  4G63 A;  3RYC E;  4PJJ A;  2IC6 A;  2Q9Q A;  2JRK A;  2Q9Q C;  3CPZ A;  3M65 A;  4HGA A;  3S4U A;  3LK4 2;  3ETU A;  3JC6 C;  4GOU A;  1MMN A;  4DMW A;  2XAF B;  3UUM A;  4OYJ A;  3ZN1 B;  3N9P A;  3PUS A;  3AA7 B;  1FMV A;  4K0U A;  1ZHC A;  5FYM A;  4UEM A;  1D0Z A;  2P9B A;  3PUA A;  3VU7 H;  5TAO A;  2LE8 A;  2XAQ B;  2YIN A;  5FXW A;  4ZI3 D;  2Q9Q B;  2YU1 A;  3CML A;  3KVA A;  2E8I A;  3V5S A;  4EZ4 A;  3AAI A;  2L8K A;  3P8C D;  3RPU A;  2X9W A;  4O8S A;  3L09 A;  1WYB A;  2BVL A;  5L3B B;  2WBL A;  3PTR B;  5FXX A;  3EVY A;  2CWO A;  4O2A E;  2KWH A;  2JJ9 A;  2W00 A;  2KT9 A;  3E22 E;  3F2E A;  4U74 A;  3C4W A;  3ZC0 A;  2CM0 A;  2H7V C;  4IE5 A;  3Q5X A;  3Q9D A;  4UIG A;  2X0L B;  3ZMT B;  1HF8 A;  3K3Q C;  5FY0 A;  2LOS A;  3ETV A;  3WAK A;  4BJN A;  4O4I E;  4CI3 B;  2PFV A;  2V1D B;  3PE0 A;  1LRZ A;  3CQX C;  3GMI A;  3HKB E;  4GK0 E;  3K3N A;  3VKH A;  4ZI2 D;  1Z0P A;  2K24 A;  5JDQ A;  1VOM A;  2VAS A;  2WM9 A;  5J1G A;  4ISS A;  4PNI A;  4X1I E;  5LJM A;  1IZN B;  4DMV A;  3AAA B;  1US7 B;  3RYF E;  2X9H A;  4PFO A;  3UUL A;  2LOP A;  4H9Q C;  2SPC A;  5EK4 A;  3CKD A;  1VRB A;  3KFW X;  4H9N C;  5JH7 E;  4JUY A;  2HPL A;  1T98 A;  3LK3 B;  2NW8 A;  3N9N A;  5A1L A;  4ZS3 A;  2VL8 A;  3ZJ2 A;  5FMN A;  3OJA A;  3IBP A;  4UF0 B;  5HAX A;  4I43 B;  4DO0 A;  2L9Q A;  4GYS A;  1WYC A;  3OKQ A;  3ZEF B;  5L2L A;  2D2S A;  2J1D G;  2CE7 A;  3LBX A;  4TN7 B;  2ZM8 A;  2D0T A;  3BQL A;  4TZ4 C;  3L3P A;  2CMR A;  4NUV A;  4E7Z A;  2G0U A;  1LKX A;  3KV9 A;  2CLY C;  2QGS A;  3FBL A;  2XTL A;  2WWU A;  3AVR A;  3QC9 A;  3TKL B;  4WW0 A;  1MMD A;  2KZ7 B;  5KMG P;  4EB6 E;  4ERR A;  5HXH A;  3SS1 A;  3WI3 A;  3CWZ B;  1ZEE A;  3C4Z A;  2CXD A;  3ANW B;  2VB6 A;  3BQK A;  3RYI E;  5DQW A;  3CVR A;  4I4T E;  3RC8 A;  3W15 B;  2LSI A;  4GK5 E;  2CXL A;  4V1A v;  4OFZ A;  4ILU A;  5LOV E;  3OBV E;  2UXX B;  1G8X A;  4QXH B;  3ZLI A;  2NWB A;  2M67 A;  4AQF C;  4X1K E;  3RC3 A;  3AA1 B;  2NOX A;  4CZZ B;  3KBU A;  3QUJ A;  3HA4 A;  5JDN A;  4WBN E;  5DAB A;  3N2O A;  5LP6 E;  3PUR A;  1IJ6 A;  5M4Y A;  5KX5 E;  1SA0 E;  1S94 A;  4YJ2 E;  1U4Q A;  3F57 A;  3IEE A;  1YKH B;  2X51 A;  2K5B B;  2C5J A;  3A5X A;  4MHC A;  3SRZ A;  3VKG A;  1WR6 A;  3UFE A;  4AXP A;  3MAC A;  4H63 V;  2XUE A;  3FB2 A;  3N5L A;  3R6N A;  1SHZ C;  5F3J A;  4MAL A;  3N2G E;  1QUU A;  2B1E A;  2K48 A;  4YFS A;  5HWY A;  3KDS E;  1WLX A;  4QX8 B;  4EZH A;  2X9Y A;  2PG8 A;  2NTY A;  3E0Z A;  3MZK B;  4J2C A;  5L3E B;  3MA9 A;  3T8O A;  4I55 E;  4GIW A;  4A56 A;  4AQG A;  3ZYL A;  2Y6X A;  2IAK A;  2ODV A;  1BR0 A;  3B13 A;  2OA5 A;  4PJL A;  4AKI A;  4AI6 A;  1G73 A;  3ONX A;  4DBR A;  1FIO A;  4CI1 B;  2DWG A;  5LGU B;  2I59 A;  4PJM A;  4MLK A;  4HTE A;  3PUG A;  2ZMA A;  4L0R A;  2KXP B;  4XZC A;  3VHL A;  5J2T E;  2BDE A;  3Q5W A;  3C64 A;  2CA5 A;  1HS7 A;  5HXE A;  4EAH A;  3LG7 A;  4JEH B;  4B6X A;  1X79 A;  1MMA A;  2GK9 A;  4HEA A;  5LGN B;  5JDM A;  4QKN A;  1FEW A;  2V26 A;  2NW7 A;  1BR1 A;  4X1Y E;  1H7C A;  4IIJ E;  5JDG A;  1HTJ F;  2W62 A;  1MIW A;  3C4X A;  4JLE A;  4X20 E;  3KV6 A;  2N1G A;  3ZMV B;  4H9S E;  4CXX A;  3MJX A;  3HKE E;  4FJO A;  3ZPO A;  4O4H E;  4WNK A;  5JDL A;  1CUN A;  4L9I A;  5JRC A;  1HX8 A;  2E9X C;  2C5K T;  2RP4 A;  5JQG E;  5EK2 A;  5JDF A;  1OXZ A;  3AVS A;  4TUY E;  4CI2 B;  3PDY A;  4N78 D;  3CX7 B;  3ZCI A;  3UUN A;  4CXY A;  3SWH A;  4UV8 B;  4MFR A;  3CQC B;  1MNE A;  1ZV4 X;  2ZM0 A;  2X67 A;  4UF0 A;  3ZCJ A;  3BQI A;  5ETW A;  4O2B E;  5H6R B;  3FHN A;  3RH3 A;  2V7K A;  1IAP A;  2LHR A;  3P7I A;  2XQY A;  3KIN B;  2E9X B;  4BJM A;  4HN9 A;  5HXR A;  5JRC B;  2N9D A;  2ES0 A;  3E08 A;  4U72 A;  2XAJ B;  4UEL A;  3RRC A;  3KV5 A;  3GN5 A;  3FXD B;  5JR9 A;  2CWY A;  4KMC A;  2KWI B;  3K3O A;  2UXN B;  5FP3 A;  5JR9 C;  2Y48 B;  4I50 E;  1NWM X;  2V7L A;  2LSJ A;  3B57 A;  3RKO A;  2LEH A;  3ANW A;  4BA9 A;  5LYJ E;  2VWA A;  2LJL A;  3N9O A;  4BAY B;  4OYK A;  3OYZ A;  2DCF A;  1BR2 A;  1MMG A;  2A3D A;  4HFV A;  4OK0 A;  3RRW A;  4AKR B;  2VKH A;  3U3I A;  4UVB B;  4UVA B;  2A72 A;  3KVB A;  3CX8 B;  1MIY A;  3ZMS B;  5F8P A;  2KMF A;  2NW9 A;  3GN5 B;  3ZMZ B;  5LG4 A;  5JR9 B;  3IF8 B;  2W63 A;  3FBZ A;  5HXC A;  4EYY R;  2RA1 A;  5CA0 E;  4QWN B;  1YD8 G;  2NP9 A;  2KND A;  2MYS A;  4CXW A;  1U5P A;  5FXV A;  4QHO A;  4NUU A;  2ZLY A;  2MOZ A;  3LFM A;  1S35 A;  4H9O C;  4AQF A;  4AKL A;  4H9R C;  3GWH A;  1D0X A;  2K9A A;  2X68 A;  4XAX B;  2CLY B;  2JMK A;  4FI5 A;  1YKE B;  5HWX A;  5LHH B;  3N2K E;  3KBT A;  4H63 H;  4ZS2 A;  5EZY E;  3J7Y q;  1MIV A;  3ZYK A;  3CQG B;  2KIN B;  1NAF A;  2EHO C;  3NZP A;  4TX5 A;  3UT5 E;  1D0Y A;  4MBQ A;  2JQQ A;  3NRY A;  5AFU L;  5ADX L;  4ASK A;  2X66 A;  3GA8 A;  4H9P C;  2C5I T;  2LM9 A;  2ODU A;  4QXC B;  3ZC1 A;  1UX5 A;  5LGT B;  5LBM A;  4QXB B;  5JDH A;  2E9X D;  3J9X 1;  4O4J E;  2DNX A;  4M1P A;  4IE6 A;  2LSY A;  3O4X E;  4ZOL E;  3HI2 A;  2EHO B;  2JPF A;  2Y8D A;  2CEA A;  4WBO A;  4DBQ A;  4PFP A;  3RYH E;  2DLR A;  2VKD A;  5L3C B;  3SOL A;  4L5G A;  4PK4 A;  1LVF A;  2ACX A;  3QK6 A;  4P0B A;  5L3D B;  1O3X A;  2BZB A;  5EK3 A;  5IYZ E;  5LXT E;  4G2A A;  4IE0 A;  1D1A A;  4E7S A;  2WMO A;  4GYR A;  2HH7 A;  3PUQ A;  4P0A A;  3C50 A;  3C98 B;  4PK5 A;  3V5U A;  3WAJ A;  4EIW A;  2C0S A;  4EXT A;  5FY7 A;  5GON E;  2JMH A;  3DP7 A;  4IGU A;  4TV9 E;  3CX6 B;  4KP3 C;  1QSD A;  4KBM B;  3U78 A;  2D5U A;  5LBQ B;  4DVD A;  4O4L E;  3NZQ A;  4HE8 A;  4YHJ A;  2LHN A;  2MBG A;  2E9X A;  3ZN0 B;  5HYA A;  2VKJ A;  3I1A A;  5J2U E;  1YW0 A;  1FMW A;  3ZYM A;  4CQI A;  3ZMU B;  3HKD E;  5H6Q B;  4P09 A;  3I0Q A;  1E1H B;  2XHE B;  4UV9 B;  2L3L A;  3PU8 A;  1HG5 A;  4PW8 A;  5JRE A;  4AKG A;  5KDM C;  1V9D A;  2V7J A;  4EOZ B;  3H3A A;  2IW5 B;  3I9W A;  4IHJ E;  2LT3 A;  3DJB A;  3AA0 B;  4PAG A;  2IC9 A;  2H3R A;  1D1B A;  3IHR A;  2PJQ A;  4JEU B;  1HFA A;  3AB3 B;  5LCY A;  1MND A;  5C8Y E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...