3ZC1A

Crystal structure of afc3po
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
190
structure length
190
Chain Sequence
MRLEECRKRLEELEAAREELLKVLREMRIHSTKSIALIHAGKVEEAEQELKKAIELLEKVKAYREYPEIYFYLCNDAMQELVEAIAFKNAISGEFTFEIDLEVTPAAFLNGFADAVGELRRYALTKLIEGDFKSAERMLEVMEKIYERLMEFTTFPDKLVSGLRKKLDVARGGIERTKSDYIAAKVARLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords AFTRAX
total genus 73
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zc1A00
3ZC1A 5JR9B 5JRCB 5JRCA 5JR9C 5JREA 3ZC0A 5JR9A
chains in the Genus database with same CATH superfamily
4F8HA 2BKPA 1KNPA 3BQKA 4FJOA 4X62T 1EZ3A 4GOUA 3OPCA 4QH1A 3P4QA 3RQUA 3TKLB 5JDMA 5J2TE 5IWAT 3UUXB 2VB6A 2LM2A 1YXRA 1CHUA 3AE9A 3DTOA 5CA1E 1T98A 4DV7T 3OBVE 4H63H 2BVMA 4HN9A 4X64T 4JEUB 5DQVA 2DLRA 2XQ7A 3CIRA 3SS1A 1ZOYA 3W15B 2XQ4A 4HFBA 5HXRA 1UGOA 2K5BB 3OVUA 4IT4A 4IIJE 4X1KE 4KHZF 4HGAA 2CXFA 1XNRT 5CB4E 4EAHA 2A9UA 3A8YC 3KINB 4CZZB 4IE7A 3RIFA 2D2SA 3E22E 1WYCA 1SHZC 2V6YB 3UULA 4CN4A 2CWYA 4H9RC 2W61A 2WDQA 2WP9A 3EVYA 5HXHA 2WQYA 3E0ZA 1MNEA 2M6BA 2VVSA 3GMIA 5HXCA 2IC9A 3AEAA 4ZI3D 4QHOA 3LG7A 3AA0B 2XZEA 3AB3B 4QH5A 4YLHA 1OEDB 2MOZA 3GA8A 5DABA 2MYSA 4JI4T 3RIUC 1KEYA 2NW9A 1LRZA 2XSBA 2C5KT 2LRKA 2E5VA 3SFDA 4TUYE 3O9XA 4JI7T 4IE4A 4DBQA 2CLYB 3ZC0A 3AAIA 4AKHA 2WCAA 5LHHB 3N9MA 3A5XA 5AQOB 1S94A 2QA7A 3JAFA 4GK5E 3HKCE 2LOPA 3ZMVB 2BG9B 2E9XC 2BDEA 2LKHA 3FHNA 1IAPA 4HFDA 3P8CD 5FXWA 4IL9A 5AQTB 3NVOA 4AIUA 5JR9B 4O4HE 2CBIA 2BVLA 2EHOC 5AQGB 4C90A 4CI1B 3PTRB 5LJNA 4LFBT 4IE5A 1G73A 2W67A 4BJNA 4EB6E 3J7Yq 3AE3A 3CQCB 3LFMA 4LMJA 2ODUA 2W0GA 2WBLA 3OKQA 4QXCB 3ZLIA 5LMNT 5FP3A 2CXLA 2B1EA 2ZM0A 3UUBA 4ZZBA 4DV3T 3LSVA 2LHRA 3RIUA 4ZS2A 1HR0T 1D0YA 3DP7A 2UUCT 2HN1A 3K3NA 1WR6A 3NZQA 5FMNA 5F8PA 1MIYA 2DHRA 5AQQB 4OHFA 2Q9QD 1UCUA 4YTNA 5HWXA 4YHHT 2Q9QA 2XY8B 4JI3T 3RRWA 3KFWX 2LE8A 2XQ6A 3LDQB 3Q5WA 5C3JA 3LK42 2WMNA 1N36T 1I6ZA 5JRCA 3ZYKA 3A7MA 3LK2B 2NWBA 2PFVA 2YN6A 1HF8A 2X9WA 4H9QC 1BR0A 2LKGA 5FKYA 3RC8A 2VKHA 3X1DA 5HWYA 4BAYB 4COFA 3ZMSB 3R84B 1IJ6A 1LKXA 2G0UA 4OFZA 2X9XA 2X51A 3RHWA 5AQVB 3RYCE 3SOLA 4ASKA 2ACZA 2ZM8A 4TV8E 5L3DB 2FJAA 2XM2A 2BS4A 2XAQB 4IDZA 3H3MA 4PFOA 5JTGA 4L5GA 5JH7E 4DV2T 3RRCA 2V7IA 3AA7B 2WZHA 2X9HA 1YD8G 3H3AA 4PK5A 3PUAA 1XMOT 4GYRA 4ILAA 4XAXB 4QXHB 3I9WA 3OYZA 2WMOA 4G2AA 2JMHA 5FY1A 4KX6A 5L4HA 1NWMX 1VCSA 3AE1A 3JCFA 3NBXX 4YHJA 5HEHA 5JDFA 5JDQA 4LF6T 2H3RA 4PNIA 4EEBA 4CXYA 2LSGA 4DR3T 3T1HT 3E08A 3K1SA 2IDOB 1BR4A 2JQHA 1KNZA 2K9AA 3FZLB 4IL4A 4U31A 5JQGE 2RPAA 4DBRA 2L8KA 1MMGA 4H9OC 2UXCT 4A5XA 4F6RC 2W4XA 5AQNB 3NWIA 3U78A 1HFAA 2LOSA 2VKJA 1OEDC 2FUPA 1HX1B 3RYFE 3WI3A 2M6IA 4HWDA 4KBMB 2KXPB 4H9PC 4I50E 4XZCA 4YT0A 4U74A 3NKZA 4LMKA 5HEUA 5LGTB 3N2GE 3ZMZB 5KXJA 2D9DA 3ANWA 5TAOA 3GWHA 3V5SA 3L39A 3VR8A 1R8IA 3PUVF 4ZEYA 2WWUA 1L0VA 2WWVA 2J4GA 3N9OA 5CGMA 3PUWF 5M4YA 1FMVA 3EDUA 3PUYF 3Q9DA 1T8BA 2VVNA 5ETWA 2V6YA 5ABGA 3KV5A 4EEDA 2YK0A 3C4WA 1ZP0A 3RC3A 5EK2A 3AXJA 2CRBA 4YSZA 4EYYR 3AE6A 5LOVE 4TZ4C 4PK4A 2UUAT 2BS2A 1US7B 3FB2A 5EK3A 2MBGA 5BMVE 4ERRA 4A97A 3FZHB 3C4XA 3EAMA 1FJGT 3ZJ2A 4KUMB 4GIWA 4GYSA 3N9PA 4IREA 2L9QA 4ZOLE 1HX8A 2NOXA 2JQ9A 3RI5A 3PDYA 1Z0PA 2HN2A 3RGLA 2D0TA 4DMWA 3OTOT 2CCQA 2XAJB 3V5UA 4O2AE 5LGUB 5DJQC 5KDMC 1T7SA 4CXXA 2Y8DA 3P4SA 2I59A 5HXEA 1OWAA 2E2AA 4HWCA 2HPLA 3CQXC 3UU6A 3RH3A 2LSJA 2BG9A 2E9XA 4DR6T 3KVBA 4U33A 4X66T 3P50A 4LF4T 3Q2MA 2DL1A 4ZI2C 3ZPOA 3FZMB 1Y01A 3ONXA 1WR0A 5J1GA 3SFEA 4YSYA 4DUZT 2HHHT 1QLBA 3FZFB 4DV0T 1SUMB 2JIWA 3D0TA 4BJMA 3CX7B 3P4WA 3ZMUB 1D0ZA 2KMFA 3ZYMA 3ETVA 2E8IA 2OLTA 3KBUA 4IDOA 5L3EB 4AQYT 5AQJB 1D1CA 4PJLA 1W0AA 1QSDA 2XASB 1E2AA 4TX5A 3RYHE 5JDNA 4P0BA 2VQET 3AE7A 3IA3A 3RYIE 3Q5EA 1YQ3A 1KF6A 3TLSA 4JYAT 1LVKA 3TLTA 3VHLA 5CA0E 4JI1T 4CXWA 3QOFA 2EHOA 3ONJA 2NTYA 2EHOD 2RA1A 3FBLA 5C8YE 3PU8A 3PU3A 1MNDA 2XAGB 3C51A 4DV5T 2NTXA 4QH4A 2N1GA 5HAXA 3ZEFB 3O1IA 3AVSA 4JLEA 5JRCB 2XQ5A 4HWHA 2WU5A 1HTJF 2YOEA 4TWHA 4DUYT 4NXNT 3VKGA 2XHEB 1YKEB 2AE9A 4YSXA 5EZYE 4IHJE 3ZKRA 4AKRB 3C98B 4O4IE 3RIAA 2WY2A 5FXXA 3BK9A 4EV6A 3CVRA 5JREA 3P7IA 5H6RB 4LF9T 4X1IE 4HEAA 2YU2A 1G8XA 4NUUA 2ODVA 4TWDA 2UXBT 4DNDA 2PJQA 4HFVA 5FL0A 1IBLT 5L47A 4KP3C 2H7OA 2N9DA 5HCJA 5F3JA 2UU9T 1FIOA 1ZV4X 4UIGA 3O1HA 3HKDE 4NPPA 1YQ4A 2JJ9A 5AQHB 3KV9A 4MBQA 1UUSA 2YEVC 4ZI3C 3KVAA 4PAGA 2PTFA 2QVAA 4BA9A 2J47A 2MAWA 1ZEEA 2WDVA 5ABEA 2IMLA 3O1JA 4JEHB 5L3GB 2F4VT 2LSYA 2QRXA 2IIUA 2XTLA 3LBXB 1KFYA 3I9YA 3ZCIA 2Y6XA 2VQFT 4DR4T 3AEFA 4U2YA 4IDNA 4WW0A 3MZKB 5EK4A 2NP9A 1XDOA 2M67A 3PE0A 3KV6A 4KHPT 3L09A 4MHCA 4UEMA 1XMQT 1KNRA 2X0HA 1HS7A 4E7SA 4ZHQE 4IDPA 1UURA 1N34T 4GK0E 1WLXA 2KWIB 2QGSA 4MALA 4MFRA 4U3CA 3TLVA 5CFBA 3LK3B 1HNWT 1S35A 4ZS3A 2N2NA 3J9X1 1IBKT 3DJBA 4AKIA 3CX8B 1XDPA 3HA4A 4IGUA 1HNXT 4O4LE 3HKEE 2H88A 1OXZA 3EI0A 4JUYA 4ZI7E 5LMUT 2KINB 4HFIA 5FVKA 2HPJA 5AQUB 2CWOA 4LF5T 1AJ3A 3SWHA 2KT9A 1GQEA 2CMRA 3AE2A 2NW7A 1U4QA 2V7JA 2XQ9A 2YDRA 3AEDA 2BG9C 3ANWB 3NZPA 4OYJA 3UU4A 2J1DG 4C91A 3QNUA 5L3BB 3IHRA 2LM9A 3CMLA 3LJCA 2GK9A 4WBNE 3ZT7A 4HWFA 2CEAA 2X0LB 2VK9A 3CX6B 3UQ7A 3AEEA 5HCMA 3HKBE 1W9RA 4XBFB 2V8SV 2YDQA 4K0UA 5KX5E 3N9LA 2LEHA 5HXSA 4WNKA 3ETUA 4X5TA 3AXJB 2BKOA 2V7KA 5FXVA 3I1AA 4DV1T 2VKDA 3RX6A 3AA1B 2IW5B 4Q25A 2LRLA 2VL8A 4EXTA 3FXEB 3B57A 3EUHA 4ISTA 4UVBB 4A98A 4EGWA 2X0YA 5IUXA 3AECA 2XM1A 4LF7T 2UXDT 1J5WA 2W2UA 3Q5DA 4DR2T 4X1YE 5ABFA 3FZKB 3K3OA 1FEWA 4QWNB 3GN5A 1MIVA 3VRBA 1U5PA 3NRXA 4UV9B 2PG8A 2DCFA 4TWFA 5AQMB 2B76A 2LSIA 2V6XA 3OYXA 5FNVE 4CN1A 2LJLA 2R6GF 3F57A 4UV8B 4FI5A 4HFHA 4DMVA 4YJ3E 2WB5A 4G63A 2MPKA 4YTMA 4B3ST 4JI0T 3JAEA 3HR0A 3JC6C 2ACXA 4QKNA 4B3TT 3S4UA 2HH7A 4EYUA 4UELA 3RQWA 2E9XB 3T8OA 4ZZCA 1VCTA 4UF0B 3F2EA 4A56A 4B3RT 2YKSA 2XQ8A 2WAUA 4X65T 1HNZT 3AEGA 2CBJA 2OV9A 3U3IA 4I4TE 4CI3B 4MLKA 1B7TA 2ZM6T 2WU2A 2X68A 5AQIB 3KV4A 2UXNB 5HEGA 3UFGA 3QK6A 1X79A 5JDLA 4DV4T 3UU8A 4GKJT 4WZXA 5LP6E 1HG5A 2VWAA 3PUZF 4JI2T 5LGNB 1XWMA 4QX7B 2DWKA 1Y64B 3PJAJ 1D1AA 5IHYA 4TN7B 3N2OA 4Z8XA 5GONE 2ZLYA 1MMAA 3C50A 4ANJA 2EHOB 5AQRB 2BS3A 5E0OA 4WBOA 4DR1T 4UR9A 5LG3A 3OJAA 2NR4A 4AISA 1E7PA 3SRZA 3L8RA 2ZM2A 4AXPA 4AI6A 5FXZA 5H6QB 1HG2A 4UVAB 4YTPA 2Q9QC 5AQPB 2XQYA 3ZN1B 4EZ4A 1YW0A 1LVFA 3BQIA 4H63V 3VR9A 1MMDA 2XJ7A 3CPZA 3MK7C 3QB5A 2XAFB 4V1Av 2WZIA 4EIWA 2L3LA 3AE5A 3UQ4A 5JR9C 5BR8T 2WDRA 3R6NA 4U7YA 4LMLA 1UK5A 3ZJ1A 1WFDA 4ZI2D 4YFSA 4NXMT 3PJAA 4O4JE 2KWHA 4B6XA 5LYJE 3N5LA 4DVDA 5F5WA 4GKKT 1D0XA 3F31A 3ZN0B 4AQFA 5AFUL 2FJBA 2W62A 2W00A 3WAKA 3C64A 5HYAA 3IEEA 2X66A 5ABHA 4HTEA 2V7MA 5LJMA 3UUNA 2K3WA 3MACA 2LT3A 2D0UA 4EOZB 2IHR1 2LHNA 4K0KT 2CM0A 2CLYC 2FJEA 2W66A 5FY0A 3LBXA 2FBWA 2YINA 4IDQA 1BR1A 1XZYA 2BKNA 2V5CA 1NAFA 1SA0E 2XQ3A 3I0QA 4IE0A 4EZHA 4YXDA 5HEJA 5AQSB 3UU3A 2JMKA 5JDHA 3QUJA 4WYVA 1V9DA 4P0AA 2H7VC 2V7LA 2XUEA 5JVDE 2I0MA 1WCRA 1XNQT 1JNZA 2CE7A 4ISSA 4U7IA 5FL1A 3P4PA 2IUBA 5AQFB 3EABA 4U72A 2LLYA 3T1YT 2JRKA 2Y48B 1UX4A 3K3QC 1NENA 2CXDA 2I6HA 3MKDA 2VASA 2KLQA 2PBIA 4AQFC 4JBWF 5L3CB 3M65A 1E1HB 2K24A 1W09A 4N78D 3ZYLA 5J0ZA 2DI4A 1MMNA 3EDVA 2LSKA 3UU5A 3AEBA 2XSAA 1M62A 2V5DA 3ZT5A 4P1NA 2CA5A 2DWGA 4AKGA 5FVLA 4X20E 3RKGA 3UUMA 2XAHB 5LHIB 1HCIA 2MTQA 3MXZA 4LF8T 3IF8B 3P4RA 3B5MA 2H89A 4JI8T 1VOMA 3CKDA 4NIQA 5C2TA 2KSRA 4UVCB 1T72A 5LBQB 3M3ZB 3PUGA 3L3PA 2KZ7B 3KBTA 3ABVA 2A2FX 2A3DA 4M1PA 4Z90A 3B13A 4HE8A 4QXBB 1CUNA 1X9BA 4QX8B 5AQLB 1OEDA 3CQGB 3TLUA 5A1LA 2FJDA 3VRAA 3N9NA 5ABFB 4DR7T 1DU2A 3GN5B 5LA6E 5KMGP 3AVRA 4TNVA 3UFEA 4AKLA 1M7KA 4JI6T 4I55E 4DR5T 4U2ZA 4ILBA 3ZSTA 3IBPA 3MA9A 1J5ET 4KI0F 4PK6A 4PW8A 2K48A 2WSSV 4LFCT 2C5IT 2VURA 4P09A 3ZMTB 4TV9E 2C5JA 1MIWA 2YU1A 3BQLA 3AAEB 1JNRA 2E9XD 5FY7A 3ZT6A 4HKAA 3UT5E 4CN6A 4H9SE 5CJ5A 5JR9A 1KK7A 1WRDA 3PUSA 4UF0A 3RF1A 4LFAT 3ZSSA 2ES0A 3PUXF 2CHNA 4PJMA 3UTKA 2VKOA 3FXDB 2Z6EA 3N2KE 2OA5A 2E5LT 4H9NC 2IC6A 2BZBA 3RPUA 4JV5T 4JI5T 5LCYA 4L9IA 3VU7H 3G06A 2BBHA 3MJXA 4J2CA 5FYMA 2SPCA 4NUVA 5L3FB 1D1BA 1O3XA 1YKHB 2X67A 4HFEA 1BR2A 5LBMA 3HI2A 1I94T 3KDSE 3AAAB 2NW8A 4O2BE 3RLFF 2P9BA 2WM9A 2JQKA 4IE6A 3RKOA 1FMWA 2BBJA 3C4ZA 3HL6A 4OK0A 2W63A 3H37A 2Q9QB 2WS3A 5DQWA 5LG4A 4AQGA 5J2UE 5LXTE 5JDGA 1WYBA 4TNWA 3VKHA 3O4XE 2CHOA 1QUUA 3PURA 2VL0A 3PV0F 3Q5XA 4Z91A 2DNXA 3K8PC 3AE8A 3JC6D 4E7ZA 1UX5A 2IAKA 2XPKA 3NRYA 2XQAA 3ESLA 5LB7B 4I0UA 4CI2B 1ZKEA 5LNKA 4DIDB 4KMCA 3WAJA 5LHGB 4YY3T 3ZCJA 3ZC1A 5L2LA 4DV6T 5HEOA 1OEDE 2QYWA 1N32T 4ILUA 1NEKA 4OYKA 3N9QA 4HFCA 2ZMAA 4UXNB 2D5UA 1VRBA 1H7CA 2AXDS 4HWIB 4ZXLA 4I43B 2RP4A 3PUQA 3QB5K 4ILCA 1J1JA 3AA6B 1SE7A 5L4EA 4YJ2E 2A72A 2JQQA 1N33T 3AE4A 2J62A 4L0RA 2C0SA 4PJJA 3QC9A 3ONLC 2V26A 2BG9E 4CQIA 3CK6A 2UXXB 4PFPA 1W0BA 5ADXL 4OX9T 2JPFA 1IJ5A 1IZNB 1IBMT 3I0OA 3JADA 2V1DB 2UUBT 2CPTA 3FBZA 1ZHCA 2YDSA 5AQKB 2X9YA 5IYZE 3EHZA 4DO0A 4B3MT 2KNDA 4PJNA 1Z8UA 4O8SA 3TLWA 4ADZA 3CWZB
chains in the Genus database with same CATH topology
3BQKA 4FJOA 1EZ3A 4GOUA 3TKLB 5J2TE 5JDMA 3UUXB 2VB6A 3DTOA 5CA1E 1T98A 3OBVE 4H63H 2BVMA 4HN9A 4JEUB 5DQVA 2DLRA 3SS1A 3W15B 5HXRA 2K5BB 4IIJE 4X1KE 4HGAA 2CXFA 5CB4E 4EAHA 3KINB 4CZZB 4IE7A 2D2SA 3E22E 1WYCA 1SHZC 3UULA 2CWYA 4H9RC 2W61A 3EVYA 5HXHA 3E0ZA 1MNEA 3GMIA 5HXCA 2IC9A 4ZI3D 4QHOA 3LG7A 3AA0B 3AB3B 4YLHA 2MOZA 3GA8A 5DABA 2MYSA 2NW9A 1LRZA 2C5KT 3O9XA 4TUYE 4IE4A 4DBQA 2CLYB 3AAIA 4AKHA 5LHHB 3N9MA 3A5XA 1S94A 2QA7A 4GK5E 3HKCE 2LOPA 3ZMVB 3FHNA 2E9XC 2BDEA 5FXWA 4ZI7E 1IAPA 3P8CD 5JR9B 4O4HE 4CI1B 2BVLA 2EHOC 4C90A 5LJNA 3PTRB 4IE5A 1G73A 4BJNA 3J7Yq 4EB6E 3LFMA 3CQCB 2ODUA 2W0GA 2WBLA 3OKQA 4QXCB 3ZLIA 5FP3A 2CXLA 2B1EA 2ZM0A 2LHRA 4ZS2A 1D0YA 3DP7A 3K3NA 1WR6A 3NZQA 5FMNA 5F8PA 1MIYA 2DHRA 4OHFA 2Q9QD 1UCUA 5HWXA 2Q9QA 3RRWA 3KFWX 2LE8A 3Q5WA 3LK42 2WMNA 5JRCA 3ZYKA 3LK2B 2NWBA 2PFVA 4H9QC 1HF8A 2X9WA 1BR0A 3RC8A 2VKHA 5HWYA 4BAYB 3ZMSB 3R84B 1IJ6A 1LKXA 2G0UA 4OFZA 2X9XA 2X51A 3SOLA 3RYCE 4ASKA 2ZM8A 4TV8E 5L3DB 2XAQB 4IDZA 4PFOA 4L5GA 5JH7E 3RRCA 2V7IA 3AA7B 2X9HA 1YD8G 3H3AA 4PK5A 3PUAA 4GYRA 4XAXB 4QXHB 3I9WA 3OYZA 2WMOA 4G2AA 2JMHA 5FY1A 3T8OA 1NWMX 3NBXX 5JDFA 5JDQA 4YHJA 2H3RA 4PNIA 4CXYA 2LSGA 3E08A 1BR4A 1KNZA 2K9AA 5JQGE 4DBRA 2L8KA 1MMGA 4H9OC 4F6RC 3U78A 1HFAA 2LOSA 2VKJA 3RYFE 3WI3A 4KBMB 2KXPB 4H9PC 4I50E 4XZCA 4U74A 5LGTB 3N2GE 3ZMZB 3ANWA 5TAOA 3GWHA 3V5SA 2WWUA 3N9OA 5M4YA 1FMVA 3EDUA 3Q9DA 5ETWA 3KV5A 2YK0A 3C4WA 3RC3A 5EK2A 4EYYR 5LOVE 4TZ4C 4PK4A 1US7B 3FB2A 5EK3A 2MBGA 5BMVE 4ERRA 3C4XA 3ZJ2A 4KUMB 4GIWA 4GYSA 3N9PA 2L9QA 4ZOLE 1HX8A 2NOXA 3PDYA 1Z0PA 2D0TA 4DMWA 2CCQA 2XAJB 3V5UA 4O2AE 5LGUB 5DJQC 5KDMC 4CXXA 2Y8DA 5HXEA 2I59A 1OWAA 2HPLA 3CQXC 3RH3A 2LSJA 2E9XA 3KVBA 3Q2MA 4ZI2C 3ZPOA 3ONXA 5J1GA 3D0TA 4BJMA 3CX7B 3ZMUB 1D0ZA 2KMFA 3ZYMA 3ETVA 2E8IA 3KBUA 5L3EB 1D1CA 4PJLA 1QSDA 2XASB 4TX5A 3RYHE 5JDNA 4P0BA 3RYIE 1LVKA 3VHLA 5CA0E 4CXWA 2EHOA 2NTYA 2EHOD 2RA1A 3FBLA 5C8YE 3PU8A 3PU3A 1MNDA 2XAGB 3C51A 2NTXA 2N1GA 5HAXA 3ZEFB 3O1IA 3AVSA 4JLEA 5JRCB 1HTJF 3VKGA 2XHEB 1YKEB 5EZYE 4IHJE 4AKRB 3C98B 4O4IE 5FXXA 3BK9A 3CVRA 5JREA 3P7IA 5H6RB 4X1IE 4HEAA 2YU2A 1G8XA 4NUUA 2ODVA 4DNDA 2PJQA 4HFVA 4KP3C 2H7OA 2N9DA 5F3JA 1FIOA 1ZV4X 4UIGA 3O1HA 3HKDE 2JJ9A 4ZI3C 3KV9A 4MBQA 2YEVC 3KVAA 4PAGA 4BA9A 1ZEEA 4JEHB 3O1JA 5L3GB 2LSYA 2XTLA 3LBXB 3ZCIA 3I9YA 2Y6XA 4WW0A 3MZKB 5EK4A 2NP9A 2M67A 3PE0A 3KV6A 3L09A 4MHCA 4UEMA 1HS7A 4E7SA 4ZHQE 4GK0E 1WLXA 2KWIB 2QGSA 4MALA 4MFRA 3LK3B 1S35A 4ZS3A 2N2NA 3J9X1 4AKIA 3DJBA 3CX8B 3HA4A 4IGUA 4O4LE 3HKEE 4JUYA 1OXZA 2KINB 2HPJA 2CWOA 1AJ3A 3SWHA 2KT9A 2CMRA 4HKAA 3NZPA 2NW7A 1U4QA 2V7JA 4EZHA 3ANWB 4OYJA 4C91A 2J1DG 5L3BB 3IHRA 2LM9A 3CMLA 3LJCA 2GK9A 4WBNE 2CEAA 2X0LB 2VK9A 3CX6B 3HKBE 4XBFB 4K0UA 5KX5E 3N9LA 2LEHA 5HXSA 4WNKA 3ETUA 5FXVA 2V7KA 3I1AA 2VKDA 3RX6A 3AA1B 2IW5B 4EXTA 2VL8A 3FXEB 3B57A 3EUHA 4ISTA 4UVBB 4X1YE 3K3OA 4QWNB 1FEWA 3GN5A 1MIVA 1U5PA 3NRXA 4UV9B 2PG8A 2DCFA 2LSIA 3OYXA 5FNVE 2LJLA 3F57A 4UV8B 4DMVA 4FI5A 4YJ3E 4G63A 3HR0A 3JC6C 2ACXA 4QKNA 3S4UA 2HH7A 4EYUA 4UELA 2E9XB 4UF0B 3F2EA 4A56A 2WAUA 3U3IA 4I4TE 4CI3B 4MLKA 1B7TA 2X68A 5JDLA 3KV4A 2UXNB 3QK6A 1X79A 5LP6E 1HG5A 2VWAA 5LGNB 4QX7B 2DWKA 1Y64B 1D1AA 5IHYA 4TN7B 3N2OA 4Z8XA 5GONE 2ZLYA 1MMAA 3C50A 4ANJA 2EHOB 5E0OA 4WBOA 3OJAA 3SRZA 2ZM2A 4AXPA 4AI6A 5FXZA 5H6QB 1HG2A 4UVAB 2Q9QC 2XQYA 3ZN1B 4EZ4A 1YW0A 1LVFA 3BQIA 4H63V 1MMDA 3MK7C 3CPZA 4V1Av 4EIWA 2XAFB 5JR9C 2L3LA 3R6NA 3ZJ1A 4ZI2D 4YFSA 4B6XA 4O4JE 2KWHA 5LYJE 3N5LA 4DVDA 1D0XA 3F31A 3ZN0B 4AQFA 5AFUL 2W62A 2W00A 3WAKA 3C64A 5HYAA 3IEEA 2X66A 4HTEA 2V7MA 3UUNA 3MACA 2LT3A 2D0UA 4EOZB 2LHNA 2CM0A 2CLYC 5FY0A 3LBXA 2YINA 1BR1A 1NAFA 1SA0E 4IE0A 3I0QA 5JDHA 2JMKA 3QUJA 1V9DA 4P0AA 2H7VC 2V7LA 2XUEA 5JVDE 2CE7A 4ISSA 4U72A 2JRKA 2Y48B 1UX4A 3K3QC 2CXDA 3MKDA 2VASA 2KLQA 2PBIA 4AQFC 5L3CB 3M65A 1E1HB 2K24A 4N78D 3ZYLA 2DI4A 1MMNA 3EDVA 2LSKA 2CA5A 2DWGA 4AKGA 4X20E 3UUMA 2XAHB 5LHIB 1HCIA 2MTQA 3MXZA 3IF8B 1VOMA 3CKDA 4UVCB 5LBQB 3PUGA 3L3PA 2KZ7B 3KBTA 2A2FX 2A3DA 4M1PA 3B13A 4HE8A 4QXBB 1CUNA 4QX8B 5A1LA 3CQGB 3N9NA 3GN5B 5LA6E 5KMGP 3AVRA 4AKLA 3UFEA 4I55E 3IBPA 3MA9A 4PK6A 4PW8A 2K48A 2WSSV 2C5IT 4P09A 3ZMTB 4TV9E 2C5JA 1MIWA 2YU1A 3BQLA 3AAEB 2E9XD 5FY7A 3UT5E 4H9SE 5JR9A 1KK7A 1WRDA 3PUSA 4UF0A 2ES0A 4PJMA 3UTKA 2VKOA 3FXDB 2Z6EA 3N2KE 2OA5A 4H9NC 2IC6A 2BZBA 3RPUA 5LCYA 4L9IA 3VU7H 3MJXA 4J2CA 5FYMA 2SPCA 4NUVA 5L3FB 1D1BA 1O3XA 1YKHB 2X67A 5LBMA 1BR2A 3HI2A 3KDSE 3AAAB 2NW8A 4O2BE 5LJMA 2P9BA 2WM9A 3RKOA 4IE6A 3ZC0A 1FMWA 3C4ZA 3HL6A 4OK0A 3H37A 2W63A 2Q9QB 5DQWA 5LG4A 4AQGA 5J2UE 5LXTE 5JDGA 1WYBA 3VKHA 3O4XE 1QUUA 3PURA 3Q5XA 2DNXA 3K8PC 3JC6D 4E7ZA 1UX5A 2IAKA 3NRYA 4CI2B 3ESLA 1ZKEA 5LNKA 3WAJA 4KMCA 5LHGB 3ZCJA 3ZC1A 5L2LA 4ILUA 4OYKA 3N9QA 2ZMAA 4UXNB 2D5UA 1VRBA 1H7CA 4I43B 2RP4A 3PUQA 3AA6B 4YJ2E 2A72A 2JQQA 4L0RA 2C0SA 4PJJA 3QC9A 2V26A 4CQIA 2UXXB 4PFPA 5ADXL 2JPFA 1IJ5A 1IZNB 3I0OA 2V1DB 3FBZA 1ZHCA 4DO0A 2X9YA 5IYZE 2KNDA 4PJNA 4O8SA 4ADZA 3CWZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZC1 A;  5JR9 B;  5JRC B;  5JRC A;  5JR9 C;  5JRE A;  3ZC0 A;  5JR9 A; 
#chains in the Genus database with same CATH topology
 4F8H A;  2BKP A;  1KNP A;  3BQK A;  4FJO A;  4X62 T;  1EZ3 A;  4GOU A;  3OPC A;  4QH1 A;  3P4Q A;  3RQU A;  3TKL B;  5JDM A;  5J2T E;  5IWA T;  3UUX B;  2VB6 A;  2LM2 A;  1YXR A;  1CHU A;  3AE9 A;  3DTO A;  5CA1 E;  1T98 A;  4DV7 T;  3OBV E;  4H63 H;  2BVM A;  4HN9 A;  4X64 T;  4JEU B;  5DQV A;  2DLR A;  2XQ7 A;  3CIR A;  3SS1 A;  1ZOY A;  3W15 B;  2XQ4 A;  4HFB A;  5HXR A;  1UGO A;  2K5B B;  3OVU A;  4IT4 A;  4IIJ E;  4X1K E;  4KHZ F;  4HGA A;  2CXF A;  1XNR T;  5CB4 E;  4EAH A;  2A9U A;  3A8Y C;  3KIN B;  4CZZ B;  4IE7 A;  3RIF A;  2D2S A;  3E22 E;  1WYC A;  1SHZ C;  2V6Y B;  3UUL A;  4CN4 A;  2CWY A;  4H9R C;  2W61 A;  2WDQ A;  2WP9 A;  3EVY A;  5HXH A;  2WQY A;  3E0Z A;  1MNE A;  2M6B A;  2VVS A;  3GMI A;  5HXC A;  2IC9 A;  3AEA A;  4ZI3 D;  4QHO A;  3LG7 A;  3AA0 B;  2XZE A;  3AB3 B;  4QH5 A;  4YLH A;  1OED B;  2MOZ A;  3GA8 A;  5DAB A;  2MYS A;  4JI4 T;  3RIU C;  1KEY A;  2NW9 A;  1LRZ A;  2XSB A;  2C5K T;  2LRK A;  2E5V A;  3SFD A;  4TUY E;  3O9X A;  4JI7 T;  4IE4 A;  4DBQ A;  2CLY B;  3ZC0 A;  3AAI A;  4AKH A;  2WCA A;  5LHH B;  3N9M A;  3A5X A;  5AQO B;  1S94 A;  2QA7 A;  3JAF A;  4GK5 E;  3HKC E;  2LOP A;  3ZMV B;  2BG9 B;  2E9X C;  2BDE A;  2LKH A;  3FHN A;  1IAP A;  4HFD A;  3P8C D;  5FXW A;  4IL9 A;  5AQT B;  3NVO A;  4AIU A;  5JR9 B;  4O4H E;  2CBI A;  2BVL A;  2EHO C;  5AQG B;  4C90 A;  4CI1 B;  3PTR B;  5LJN A;  4LFB T;  4IE5 A;  1G73 A;  2W67 A;  4BJN A;  4EB6 E;  3J7Y q;  3AE3 A;  3CQC B;  3LFM A;  4LMJ A;  2ODU A;  2W0G A;  2WBL A;  3OKQ A;  4QXC B;  3ZLI A;  5LMN T;  5FP3 A;  2CXL A;  2B1E A;  2ZM0 A;  3UUB A;  4ZZB A;  4DV3 T;  3LSV A;  2LHR A;  3RIU A;  4ZS2 A;  1HR0 T;  1D0Y A;  3DP7 A;  2UUC T;  2HN1 A;  3K3N A;  1WR6 A;  3NZQ A;  5FMN A;  5F8P A;  1MIY A;  2DHR A;  5AQQ B;  4OHF A;  2Q9Q D;  1UCU A;  4YTN A;  5HWX A;  4YHH T;  2Q9Q A;  2XY8 B;  4JI3 T;  3RRW A;  3KFW X;  2LE8 A;  2XQ6 A;  3LDQ B;  3Q5W A;  5C3J A;  3LK4 2;  2WMN A;  1N36 T;  1I6Z A;  5JRC A;  3ZYK A;  3A7M A;  3LK2 B;  2NWB A;  2PFV A;  2YN6 A;  1HF8 A;  2X9W A;  4H9Q C;  1BR0 A;  2LKG A;  5FKY A;  3RC8 A;  2VKH A;  3X1D A;  5HWY A;  4BAY B;  4COF A;  3ZMS B;  3R84 B;  1IJ6 A;  1LKX A;  2G0U A;  4OFZ A;  2X9X A;  2X51 A;  3RHW A;  5AQV B;  3RYC E;  3SOL A;  4ASK A;  2ACZ A;  2ZM8 A;  4TV8 E;  5L3D B;  2FJA A;  2XM2 A;  2BS4 A;  2XAQ B;  4IDZ A;  3H3M A;  4PFO A;  5JTG A;  4L5G A;  5JH7 E;  4DV2 T;  3RRC A;  2V7I A;  3AA7 B;  2WZH A;  2X9H A;  1YD8 G;  3H3A A;  4PK5 A;  3PUA A;  1XMO T;  4GYR A;  4ILA A;  4XAX B;  4QXH B;  3I9W A;  3OYZ A;  2WMO A;  4G2A A;  2JMH A;  5FY1 A;  4KX6 A;  5L4H A;  1NWM X;  1VCS A;  3AE1 A;  3JCF A;  3NBX X;  4YHJ A;  5HEH A;  5JDF A;  5JDQ A;  4LF6 T;  2H3R A;  4PNI A;  4EEB A;  4CXY A;  2LSG A;  4DR3 T;  3T1H T;  3E08 A;  3K1S A;  2IDO B;  1BR4 A;  2JQH A;  1KNZ A;  2K9A A;  3FZL B;  4IL4 A;  4U31 A;  5JQG E;  2RPA A;  4DBR A;  2L8K A;  1MMG A;  4H9O C;  2UXC T;  4A5X A;  4F6R C;  2W4X A;  5AQN B;  3NWI A;  3U78 A;  1HFA A;  2LOS A;  2VKJ A;  1OED C;  2FUP A;  1HX1 B;  3RYF E;  3WI3 A;  2M6I A;  4HWD A;  4KBM B;  2KXP B;  4H9P C;  4I50 E;  4XZC A;  4YT0 A;  4U74 A;  3NKZ A;  4LMK A;  5HEU A;  5LGT B;  3N2G E;  3ZMZ B;  5KXJ A;  2D9D A;  3ANW A;  5TAO A;  3GWH A;  3V5S A;  3L39 A;  3VR8 A;  1R8I A;  3PUV F;  4ZEY A;  2WWU A;  1L0V A;  2WWV A;  2J4G A;  3N9O A;  5CGM A;  3PUW F;  5M4Y A;  1FMV A;  3EDU A;  3PUY F;  3Q9D A;  1T8B A;  2VVN A;  5ETW A;  2V6Y A;  5ABG A;  3KV5 A;  4EED A;  2YK0 A;  3C4W A;  1ZP0 A;  3RC3 A;  5EK2 A;  3AXJ A;  2CRB A;  4YSZ A;  4EYY R;  3AE6 A;  5LOV E;  4TZ4 C;  4PK4 A;  2UUA T;  2BS2 A;  1US7 B;  3FB2 A;  5EK3 A;  2MBG A;  5BMV E;  4ERR A;  4A97 A;  3FZH B;  3C4X A;  3EAM A;  1FJG T;  3ZJ2 A;  4KUM B;  4GIW A;  4GYS A;  3N9P A;  4IRE A;  2L9Q A;  4ZOL E;  1HX8 A;  2NOX A;  2JQ9 A;  3RI5 A;  3PDY A;  1Z0P A;  2HN2 A;  3RGL A;  2D0T A;  4DMW A;  3OTO T;  2CCQ A;  2XAJ B;  3V5U A;  4O2A E;  5LGU B;  5DJQ C;  5KDM C;  1T7S A;  4CXX A;  2Y8D A;  3P4S A;  2I59 A;  5HXE A;  1OWA A;  2E2A A;  4HWC A;  2HPL A;  3CQX C;  3UU6 A;  3RH3 A;  2LSJ A;  2BG9 A;  2E9X A;  4DR6 T;  3KVB A;  4U33 A;  4X66 T;  3P50 A;  4LF4 T;  3Q2M A;  2DL1 A;  4ZI2 C;  3ZPO A;  3FZM B;  1Y01 A;  3ONX A;  1WR0 A;  5J1G A;  3SFE A;  4YSY A;  4DUZ T;  2HHH T;  1QLB A;  3FZF B;  4DV0 T;  1SUM B;  2JIW A;  3D0T A;  4BJM A;  3CX7 B;  3P4W A;  3ZMU B;  1D0Z A;  2KMF A;  3ZYM A;  3ETV A;  2E8I A;  2OLT A;  3KBU A;  4IDO A;  5L3E B;  4AQY T;  5AQJ B;  1D1C A;  4PJL A;  1W0A A;  1QSD A;  2XAS B;  1E2A A;  4TX5 A;  3RYH E;  5JDN A;  4P0B A;  2VQE T;  3AE7 A;  3IA3 A;  3RYI E;  3Q5E A;  1YQ3 A;  1KF6 A;  3TLS A;  4JYA T;  1LVK A;  3TLT A;  3VHL A;  5CA0 E;  4JI1 T;  4CXW A;  3QOF A;  2EHO A;  3ONJ A;  2NTY A;  2EHO D;  2RA1 A;  3FBL A;  5C8Y E;  3PU8 A;  3PU3 A;  1MND A;  2XAG B;  3C51 A;  4DV5 T;  2NTX A;  4QH4 A;  2N1G A;  5HAX A;  3ZEF B;  3O1I A;  3AVS A;  4JLE A;  5JRC B;  2XQ5 A;  4HWH A;  2WU5 A;  1HTJ F;  2YOE A;  4TWH A;  4DUY T;  4NXN T;  3VKG A;  2XHE B;  1YKE B;  2AE9 A;  4YSX A;  5EZY E;  4IHJ E;  3ZKR A;  4AKR B;  3C98 B;  4O4I E;  3RIA A;  2WY2 A;  5FXX A;  3BK9 A;  4EV6 A;  3CVR A;  5JRE A;  3P7I A;  5H6R B;  4LF9 T;  4X1I E;  4HEA A;  2YU2 A;  1G8X A;  4NUU A;  2ODV A;  4TWD A;  2UXB T;  4DND A;  2PJQ A;  4HFV A;  5FL0 A;  1IBL T;  5L47 A;  4KP3 C;  2H7O A;  2N9D A;  5HCJ A;  5F3J A;  2UU9 T;  1FIO A;  1ZV4 X;  4UIG A;  3O1H A;  3HKD E;  4NPP A;  1YQ4 A;  2JJ9 A;  5AQH B;  3KV9 A;  4MBQ A;  1UUS A;  2YEV C;  4ZI3 C;  3KVA A;  4PAG A;  2PTF A;  2QVA A;  4BA9 A;  2J47 A;  2MAW A;  1ZEE A;  2WDV A;  5ABE A;  2IML A;  3O1J A;  4JEH B;  5L3G B;  2F4V T;  2LSY A;  2QRX A;  2IIU A;  2XTL A;  3LBX B;  1KFY A;  3I9Y A;  3ZCI A;  2Y6X A;  2VQF T;  4DR4 T;  3AEF A;  4U2Y A;  4IDN A;  4WW0 A;  3MZK B;  5EK4 A;  2NP9 A;  1XDO A;  2M67 A;  3PE0 A;  3KV6 A;  4KHP T;  3L09 A;  4MHC A;  4UEM A;  1XMQ T;  1KNR A;  2X0H A;  1HS7 A;  4E7S A;  4ZHQ E;  4IDP A;  1UUR A;  1N34 T;  4GK0 E;  1WLX A;  2KWI B;  2QGS A;  4MAL A;  4MFR A;  4U3C A;  3TLV A;  5CFB A;  3LK3 B;  1HNW T;  1S35 A;  4ZS3 A;  2N2N A;  3J9X 1;  1IBK T;  3DJB A;  4AKI A;  3CX8 B;  1XDP A;  3HA4 A;  4IGU A;  1HNX T;  4O4L E;  3HKE E;  2H88 A;  1OXZ A;  3EI0 A;  4JUY A;  4ZI7 E;  5LMU T;  2KIN B;  4HFI A;  5FVK A;  2HPJ A;  5AQU B;  2CWO A;  4LF5 T;  1AJ3 A;  3SWH A;  2KT9 A;  1GQE A;  2CMR A;  3AE2 A;  2NW7 A;  1U4Q A;  2V7J A;  2XQ9 A;  2YDR A;  3AED A;  2BG9 C;  3ANW B;  3NZP A;  4OYJ A;  3UU4 A;  2J1D G;  4C91 A;  3QNU A;  5L3B B;  3IHR A;  2LM9 A;  3CML A;  3LJC A;  2GK9 A;  4WBN E;  3ZT7 A;  4HWF A;  2CEA A;  2X0L B;  2VK9 A;  3CX6 B;  3UQ7 A;  3AEE A;  5HCM A;  3HKB E;  1W9R A;  4XBF B;  2V8S V;  2YDQ A;  4K0U A;  5KX5 E;  3N9L A;  2LEH A;  5HXS A;  4WNK A;  3ETU A;  4X5T A;  3AXJ B;  2BKO A;  2V7K A;  5FXV A;  3I1A A;  4DV1 T;  2VKD A;  3RX6 A;  3AA1 B;  2IW5 B;  4Q25 A;  2LRL A;  2VL8 A;  4EXT A;  3FXE B;  3B57 A;  3EUH A;  4IST A;  4UVB B;  4A98 A;  4EGW A;  2X0Y A;  5IUX A;  3AEC A;  2XM1 A;  4LF7 T;  2UXD T;  1J5W A;  2W2U A;  3Q5D A;  4DR2 T;  4X1Y E;  5ABF A;  3FZK B;  3K3O A;  1FEW A;  4QWN B;  3GN5 A;  1MIV A;  3VRB A;  1U5P A;  3NRX A;  4UV9 B;  2PG8 A;  2DCF A;  4TWF A;  5AQM B;  2B76 A;  2LSI A;  2V6X A;  3OYX A;  5FNV E;  4CN1 A;  2LJL A;  2R6G F;  3F57 A;  4UV8 B;  4FI5 A;  4HFH A;  4DMV A;  4YJ3 E;  2WB5 A;  4G63 A;  2MPK A;  4YTM A;  4B3S T;  4JI0 T;  3JAE A;  3HR0 A;  3JC6 C;  2ACX A;  4QKN A;  4B3T T;  3S4U A;  2HH7 A;  4EYU A;  4UEL A;  3RQW A;  2E9X B;  3T8O A;  4ZZC A;  1VCT A;  4UF0 B;  3F2E A;  4A56 A;  4B3R T;  2YKS A;  2XQ8 A;  2WAU A;  4X65 T;  1HNZ T;  3AEG A;  2CBJ A;  2OV9 A;  3U3I A;  4I4T E;  4CI3 B;  4MLK A;  1B7T A;  2ZM6 T;  2WU2 A;  2X68 A;  5AQI B;  3KV4 A;  2UXN B;  5HEG A;  3UFG A;  3QK6 A;  1X79 A;  5JDL A;  4DV4 T;  3UU8 A;  4GKJ T;  4WZX A;  5LP6 E;  1HG5 A;  2VWA A;  3PUZ F;  4JI2 T;  5LGN B;  1XWM A;  4QX7 B;  2DWK A;  1Y64 B;  3PJA J;  1D1A A;  5IHY A;  4TN7 B;  3N2O A;  4Z8X A;  5GON E;  2ZLY A;  1MMA A;  3C50 A;  4ANJ A;  2EHO B;  5AQR B;  2BS3 A;  5E0O A;  4WBO A;  4DR1 T;  4UR9 A;  5LG3 A;  3OJA A;  2NR4 A;  4AIS A;  1E7P A;  3SRZ A;  3L8R A;  2ZM2 A;  4AXP A;  4AI6 A;  5FXZ A;  5H6Q B;  1HG2 A;  4UVA B;  4YTP A;  2Q9Q C;  5AQP B;  2XQY A;  3ZN1 B;  4EZ4 A;  1YW0 A;  1LVF A;  3BQI A;  4H63 V;  3VR9 A;  1MMD A;  2XJ7 A;  3CPZ A;  3MK7 C;  3QB5 A;  2XAF B;  4V1A v;  2WZI A;  4EIW A;  2L3L A;  3AE5 A;  3UQ4 A;  5JR9 C;  5BR8 T;  2WDR A;  3R6N A;  4U7Y A;  4LML A;  1UK5 A;  3ZJ1 A;  1WFD A;  4ZI2 D;  4YFS A;  4NXM T;  3PJA A;  4O4J E;  2KWH A;  4B6X A;  5LYJ E;  3N5L A;  4DVD A;  5F5W A;  4GKK T;  1D0X A;  3F31 A;  3ZN0 B;  4AQF A;  5AFU L;  2FJB A;  2W62 A;  2W00 A;  3WAK A;  3C64 A;  5HYA A;  3IEE A;  2X66 A;  5ABH A;  4HTE A;  2V7M A;  5LJM A;  3UUN A;  2K3W A;  3MAC A;  2LT3 A;  2D0U A;  4EOZ B;  2IHR 1;  2LHN A;  4K0K T;  2CM0 A;  2CLY C;  2FJE A;  2W66 A;  5FY0 A;  3LBX A;  2FBW A;  2YIN A;  4IDQ A;  1BR1 A;  1XZY A;  2BKN A;  2V5C A;  1NAF A;  1SA0 E;  2XQ3 A;  3I0Q A;  4IE0 A;  4EZH A;  4YXD A;  5HEJ A;  5AQS B;  3UU3 A;  2JMK A;  5JDH A;  3QUJ A;  4WYV A;  1V9D A;  4P0A A;  2H7V C;  2V7L A;  2XUE A;  5JVD E;  2I0M A;  1WCR A;  1XNQ T;  1JNZ A;  2CE7 A;  4ISS A;  4U7I A;  5FL1 A;  3P4P A;  2IUB A;  5AQF B;  3EAB A;  4U72 A;  2LLY A;  3T1Y T;  2JRK A;  2Y48 B;  1UX4 A;  3K3Q C;  1NEN A;  2CXD A;  2I6H A;  3MKD A;  2VAS A;  2KLQ A;  2PBI A;  4AQF C;  4JBW F;  5L3C B;  3M65 A;  1E1H B;  2K24 A;  1W09 A;  4N78 D;  3ZYL A;  5J0Z A;  2DI4 A;  1MMN A;  3EDV A;  2LSK A;  3UU5 A;  3AEB A;  2XSA A;  1M62 A;  2V5D A;  3ZT5 A;  4P1N A;  2CA5 A;  2DWG A;  4AKG A;  5FVL A;  4X20 E;  3RKG A;  3UUM A;  2XAH B;  5LHI B;  1HCI A;  2MTQ A;  3MXZ A;  4LF8 T;  3IF8 B;  3P4R A;  3B5M A;  2H89 A;  4JI8 T;  1VOM A;  3CKD A;  4NIQ A;  5C2T A;  2KSR A;  4UVC B;  1T72 A;  5LBQ B;  3M3Z B;  3PUG A;  3L3P A;  2KZ7 B;  3KBT A;  3ABV A;  2A2F X;  2A3D A;  4M1P A;  4Z90 A;  3B13 A;  4HE8 A;  4QXB B;  1CUN A;  1X9B A;  4QX8 B;  5AQL B;  1OED A;  3CQG B;  3TLU A;  5A1L A;  2FJD A;  3VRA A;  3N9N A;  5ABF B;  4DR7 T;  1DU2 A;  3GN5 B;  5LA6 E;  5KMG P;  3AVR A;  4TNV A;  3UFE A;  4AKL A;  1M7K A;  4JI6 T;  4I55 E;  4DR5 T;  4U2Z A;  4ILB A;  3ZST A;  3IBP A;  3MA9 A;  1J5E T;  4KI0 F;  4PK6 A;  4PW8 A;  2K48 A;  2WSS V;  4LFC T;  2C5I T;  2VUR A;  4P09 A;  3ZMT B;  4TV9 E;  2C5J A;  1MIW A;  2YU1 A;  3BQL A;  3AAE B;  1JNR A;  2E9X D;  5FY7 A;  3ZT6 A;  4HKA A;  3UT5 E;  4CN6 A;  4H9S E;  5CJ5 A;  5JR9 A;  1KK7 A;  1WRD A;  3PUS A;  4UF0 A;  3RF1 A;  4LFA T;  3ZSS A;  2ES0 A;  3PUX F;  2CHN A;  4PJM A;  3UTK A;  2VKO A;  3FXD B;  2Z6E A;  3N2K E;  2OA5 A;  2E5L T;  4H9N C;  2IC6 A;  2BZB A;  3RPU A;  4JV5 T;  4JI5 T;  5LCY A;  4L9I A;  3VU7 H;  3G06 A;  2BBH A;  3MJX A;  4J2C A;  5FYM A;  2SPC A;  4NUV A;  5L3F B;  1D1B A;  1O3X A;  1YKH B;  2X67 A;  4HFE A;  1BR2 A;  5LBM A;  3HI2 A;  1I94 T;  3KDS E;  3AAA B;  2NW8 A;  4O2B E;  3RLF F;  2P9B A;  2WM9 A;  2JQK A;  4IE6 A;  3RKO A;  1FMW A;  2BBJ A;  3C4Z A;  3HL6 A;  4OK0 A;  2W63 A;  3H37 A;  2Q9Q B;  2WS3 A;  5DQW A;  5LG4 A;  4AQG A;  5J2U E;  5LXT E;  5JDG A;  1WYB A;  4TNW A;  3VKH A;  3O4X E;  2CHO A;  1QUU A;  3PUR A;  2VL0 A;  3PV0 F;  3Q5X A;  4Z91 A;  2DNX A;  3K8P C;  3AE8 A;  3JC6 D;  4E7Z A;  1UX5 A;  2IAK A;  2XPK A;  3NRY A;  2XQA A;  3ESL A;  5LB7 B;  4I0U A;  4CI2 B;  1ZKE A;  5LNK A;  4DID B;  4KMC A;  3WAJ A;  5LHG B;  4YY3 T;  3ZCJ A;  3ZC1 A;  5L2L A;  4DV6 T;  5HEO A;  1OED E;  2QYW A;  1N32 T;  4ILU A;  1NEK A;  4OYK A;  3N9Q A;  4HFC A;  2ZMA A;  4UXN B;  2D5U A;  1VRB A;  1H7C A;  2AXD S;  4HWI B;  4ZXL A;  4I43 B;  2RP4 A;  3PUQ A;  3QB5 K;  4ILC A;  1J1J A;  3AA6 B;  1SE7 A;  5L4E A;  4YJ2 E;  2A72 A;  2JQQ A;  1N33 T;  3AE4 A;  2J62 A;  4L0R A;  2C0S A;  4PJJ A;  3QC9 A;  3ONL C;  2V26 A;  2BG9 E;  4CQI A;  3CK6 A;  2UXX B;  4PFP A;  1W0B A;  5ADX L;  4OX9 T;  2JPF A;  1IJ5 A;  1IZN B;  1IBM T;  3I0O A;  3JAD A;  2V1D B;  2UUB T;  2CPT A;  3FBZ A;  1ZHC A;  2YDS A;  5AQK B;  2X9Y A;  5IYZ E;  3EHZ A;  4DO0 A;  4B3M T;  2KND A;  4PJN A;  1Z8U A;  4O8S A;  3TLW A;  4ADZ A;  3CWZ B; 
#chains in the Genus database with same CATH homology
 3BQK A;  4FJO A;  1EZ3 A;  4GOU A;  3TKL B;  5J2T E;  5JDM A;  3UUX B;  2VB6 A;  3DTO A;  5CA1 E;  1T98 A;  3OBV E;  4H63 H;  2BVM A;  4HN9 A;  4JEU B;  5DQV A;  2DLR A;  3SS1 A;  3W15 B;  5HXR A;  2K5B B;  4IIJ E;  4X1K E;  4HGA A;  2CXF A;  5CB4 E;  4EAH A;  3KIN B;  4CZZ B;  4IE7 A;  2D2S A;  3E22 E;  1WYC A;  1SHZ C;  3UUL A;  2CWY A;  4H9R C;  2W61 A;  3EVY A;  5HXH A;  3E0Z A;  1MNE A;  3GMI A;  5HXC A;  2IC9 A;  4ZI3 D;  4QHO A;  3LG7 A;  3AA0 B;  3AB3 B;  4YLH A;  2MOZ A;  3GA8 A;  5DAB A;  2MYS A;  2NW9 A;  1LRZ A;  2C5K T;  3O9X A;  4TUY E;  4IE4 A;  4DBQ A;  2CLY B;  3AAI A;  4AKH A;  5LHH B;  3N9M A;  3A5X A;  1S94 A;  2QA7 A;  4GK5 E;  3HKC E;  2LOP A;  3ZMV B;  3FHN A;  2E9X C;  2BDE A;  5FXW A;  4ZI7 E;  1IAP A;  3P8C D;  5JR9 B;  4O4H E;  4CI1 B;  2BVL A;  2EHO C;  4C90 A;  5LJN A;  3PTR B;  4IE5 A;  1G73 A;  4BJN A;  3J7Y q;  4EB6 E;  3LFM A;  3CQC B;  2ODU A;  2W0G A;  2WBL A;  3OKQ A;  4QXC B;  3ZLI A;  5FP3 A;  2CXL A;  2B1E A;  2ZM0 A;  2LHR A;  4ZS2 A;  1D0Y A;  3DP7 A;  3K3N A;  1WR6 A;  3NZQ A;  5FMN A;  5F8P A;  1MIY A;  2DHR A;  4OHF A;  2Q9Q D;  1UCU A;  5HWX A;  2Q9Q A;  3RRW A;  3KFW X;  2LE8 A;  3Q5W A;  3LK4 2;  2WMN A;  5JRC A;  3ZYK A;  3LK2 B;  2NWB A;  2PFV A;  4H9Q C;  1HF8 A;  2X9W A;  1BR0 A;  3RC8 A;  2VKH A;  5HWY A;  4BAY B;  3ZMS B;  3R84 B;  1IJ6 A;  1LKX A;  2G0U A;  4OFZ A;  2X9X A;  2X51 A;  3SOL A;  3RYC E;  4ASK A;  2ZM8 A;  4TV8 E;  5L3D B;  2XAQ B;  4IDZ A;  4PFO A;  4L5G A;  5JH7 E;  3RRC A;  2V7I A;  3AA7 B;  2X9H A;  1YD8 G;  3H3A A;  4PK5 A;  3PUA A;  4GYR A;  4XAX B;  4QXH B;  3I9W A;  3OYZ A;  2WMO A;  4G2A A;  2JMH A;  5FY1 A;  3T8O A;  1NWM X;  3NBX X;  5JDF A;  5JDQ A;  4YHJ A;  2H3R A;  4PNI A;  4CXY A;  2LSG A;  3E08 A;  1BR4 A;  1KNZ A;  2K9A A;  5JQG E;  4DBR A;  2L8K A;  1MMG A;  4H9O C;  4F6R C;  3U78 A;  1HFA A;  2LOS A;  2VKJ A;  3RYF E;  3WI3 A;  4KBM B;  2KXP B;  4H9P C;  4I50 E;  4XZC A;  4U74 A;  5LGT B;  3N2G E;  3ZMZ B;  3ANW A;  5TAO A;  3GWH A;  3V5S A;  2WWU A;  3N9O A;  5M4Y A;  1FMV A;  3EDU A;  3Q9D A;  5ETW A;  3KV5 A;  2YK0 A;  3C4W A;  3RC3 A;  5EK2 A;  4EYY R;  5LOV E;  4TZ4 C;  4PK4 A;  1US7 B;  3FB2 A;  5EK3 A;  2MBG A;  5BMV E;  4ERR A;  3C4X A;  3ZJ2 A;  4KUM B;  4GIW A;  4GYS A;  3N9P A;  2L9Q A;  4ZOL E;  1HX8 A;  2NOX A;  3PDY A;  1Z0P A;  2D0T A;  4DMW A;  2CCQ A;  2XAJ B;  3V5U A;  4O2A E;  5LGU B;  5DJQ C;  5KDM C;  4CXX A;  2Y8D A;  5HXE A;  2I59 A;  1OWA A;  2HPL A;  3CQX C;  3RH3 A;  2LSJ A;  2E9X A;  3KVB A;  3Q2M A;  4ZI2 C;  3ZPO A;  3ONX A;  5J1G A;  3D0T A;  4BJM A;  3CX7 B;  3ZMU B;  1D0Z A;  2KMF A;  3ZYM A;  3ETV A;  2E8I A;  3KBU A;  5L3E B;  1D1C A;  4PJL A;  1QSD A;  2XAS B;  4TX5 A;  3RYH E;  5JDN A;  4P0B A;  3RYI E;  1LVK A;  3VHL A;  5CA0 E;  4CXW A;  2EHO A;  2NTY A;  2EHO D;  2RA1 A;  3FBL A;  5C8Y E;  3PU8 A;  3PU3 A;  1MND A;  2XAG B;  3C51 A;  2NTX A;  2N1G A;  5HAX A;  3ZEF B;  3O1I A;  3AVS A;  4JLE A;  5JRC B;  1HTJ F;  3VKG A;  2XHE B;  1YKE B;  5EZY E;  4IHJ E;  4AKR B;  3C98 B;  4O4I E;  5FXX A;  3BK9 A;  3CVR A;  5JRE A;  3P7I A;  5H6R B;  4X1I E;  4HEA A;  2YU2 A;  1G8X A;  4NUU A;  2ODV A;  4DND A;  2PJQ A;  4HFV A;  4KP3 C;  2H7O A;  2N9D A;  5F3J A;  1FIO A;  1ZV4 X;  4UIG A;  3O1H A;  3HKD E;  2JJ9 A;  4ZI3 C;  3KV9 A;  4MBQ A;  2YEV C;  3KVA A;  4PAG A;  4BA9 A;  1ZEE A;  4JEH B;  3O1J A;  5L3G B;  2LSY A;  2XTL A;  3LBX B;  3ZCI A;  3I9Y A;  2Y6X A;  4WW0 A;  3MZK B;  5EK4 A;  2NP9 A;  2M67 A;  3PE0 A;  3KV6 A;  3L09 A;  4MHC A;  4UEM A;  1HS7 A;  4E7S A;  4ZHQ E;  4GK0 E;  1WLX A;  2KWI B;  2QGS A;  4MAL A;  4MFR A;  3LK3 B;  1S35 A;  4ZS3 A;  2N2N A;  3J9X 1;  4AKI A;  3DJB A;  3CX8 B;  3HA4 A;  4IGU A;  4O4L E;  3HKE E;  4JUY A;  1OXZ A;  2KIN B;  2HPJ A;  2CWO A;  1AJ3 A;  3SWH A;  2KT9 A;  2CMR A;  4HKA A;  3NZP A;  2NW7 A;  1U4Q A;  2V7J A;  4EZH A;  3ANW B;  4OYJ A;  4C91 A;  2J1D G;  5L3B B;  3IHR A;  2LM9 A;  3CML A;  3LJC A;  2GK9 A;  4WBN E;  2CEA A;  2X0L B;  2VK9 A;  3CX6 B;  3HKB E;  4XBF B;  4K0U A;  5KX5 E;  3N9L A;  2LEH A;  5HXS A;  4WNK A;  3ETU A;  5FXV A;  2V7K A;  3I1A A;  2VKD A;  3RX6 A;  3AA1 B;  2IW5 B;  4EXT A;  2VL8 A;  3FXE B;  3B57 A;  3EUH A;  4IST A;  4UVB B;  4X1Y E;  3K3O A;  4QWN B;  1FEW A;  3GN5 A;  1MIV A;  1U5P A;  3NRX A;  4UV9 B;  2PG8 A;  2DCF A;  2LSI A;  3OYX A;  5FNV E;  2LJL A;  3F57 A;  4UV8 B;  4DMV A;  4FI5 A;  4YJ3 E;  4G63 A;  3HR0 A;  3JC6 C;  2ACX A;  4QKN A;  3S4U A;  2HH7 A;  4EYU A;  4UEL A;  2E9X B;  4UF0 B;  3F2E A;  4A56 A;  2WAU A;  3U3I A;  4I4T E;  4CI3 B;  4MLK A;  1B7T A;  2X68 A;  5JDL A;  3KV4 A;  2UXN B;  3QK6 A;  1X79 A;  5LP6 E;  1HG5 A;  2VWA A;  5LGN B;  4QX7 B;  2DWK A;  1Y64 B;  1D1A A;  5IHY A;  4TN7 B;  3N2O A;  4Z8X A;  5GON E;  2ZLY A;  1MMA A;  3C50 A;  4ANJ A;  2EHO B;  5E0O A;  4WBO A;  3OJA A;  3SRZ A;  2ZM2 A;  4AXP A;  4AI6 A;  5FXZ A;  5H6Q B;  1HG2 A;  4UVA B;  2Q9Q C;  2XQY A;  3ZN1 B;  4EZ4 A;  1YW0 A;  1LVF A;  3BQI A;  4H63 V;  1MMD A;  3MK7 C;  3CPZ A;  4V1A v;  4EIW A;  2XAF B;  5JR9 C;  2L3L A;  3R6N A;  3ZJ1 A;  4ZI2 D;  4YFS A;  4B6X A;  4O4J E;  2KWH A;  5LYJ E;  3N5L A;  4DVD A;  1D0X A;  3F31 A;  3ZN0 B;  4AQF A;  5AFU L;  2W62 A;  2W00 A;  3WAK A;  3C64 A;  5HYA A;  3IEE A;  2X66 A;  4HTE A;  2V7M A;  3UUN A;  3MAC A;  2LT3 A;  2D0U A;  4EOZ B;  2LHN A;  2CM0 A;  2CLY C;  5FY0 A;  3LBX A;  2YIN A;  1BR1 A;  1NAF A;  1SA0 E;  4IE0 A;  3I0Q A;  5JDH A;  2JMK A;  3QUJ A;  1V9D A;  4P0A A;  2H7V C;  2V7L A;  2XUE A;  5JVD E;  2CE7 A;  4ISS A;  4U72 A;  2JRK A;  2Y48 B;  1UX4 A;  3K3Q C;  2CXD A;  3MKD A;  2VAS A;  2KLQ A;  2PBI A;  4AQF C;  5L3C B;  3M65 A;  1E1H B;  2K24 A;  4N78 D;  3ZYL A;  2DI4 A;  1MMN A;  3EDV A;  2LSK A;  2CA5 A;  2DWG A;  4AKG A;  4X20 E;  3UUM A;  2XAH B;  5LHI B;  1HCI A;  2MTQ A;  3MXZ A;  3IF8 B;  1VOM A;  3CKD A;  4UVC B;  5LBQ B;  3PUG A;  3L3P A;  2KZ7 B;  3KBT A;  2A2F X;  2A3D A;  4M1P A;  3B13 A;  4HE8 A;  4QXB B;  1CUN A;  4QX8 B;  5A1L A;  3CQG B;  3N9N A;  3GN5 B;  5LA6 E;  5KMG P;  3AVR A;  4AKL A;  3UFE A;  4I55 E;  3IBP A;  3MA9 A;  4PK6 A;  4PW8 A;  2K48 A;  2WSS V;  2C5I T;  4P09 A;  3ZMT B;  4TV9 E;  2C5J A;  1MIW A;  2YU1 A;  3BQL A;  3AAE B;  2E9X D;  5FY7 A;  3UT5 E;  4H9S E;  5JR9 A;  1KK7 A;  1WRD A;  3PUS A;  4UF0 A;  2ES0 A;  4PJM A;  3UTK A;  2VKO A;  3FXD B;  2Z6E A;  3N2K E;  2OA5 A;  4H9N C;  2IC6 A;  2BZB A;  3RPU A;  5LCY A;  4L9I A;  3VU7 H;  3MJX A;  4J2C A;  5FYM A;  2SPC A;  4NUV A;  5L3F B;  1D1B A;  1O3X A;  1YKH B;  2X67 A;  5LBM A;  1BR2 A;  3HI2 A;  3KDS E;  3AAA B;  2NW8 A;  4O2B E;  5LJM A;  2P9B A;  2WM9 A;  3RKO A;  4IE6 A;  3ZC0 A;  1FMW A;  3C4Z A;  3HL6 A;  4OK0 A;  3H37 A;  2W63 A;  2Q9Q B;  5DQW A;  5LG4 A;  4AQG A;  5J2U E;  5LXT E;  5JDG A;  1WYB A;  3VKH A;  3O4X E;  1QUU A;  3PUR A;  3Q5X A;  2DNX A;  3K8P C;  3JC6 D;  4E7Z A;  1UX5 A;  2IAK A;  3NRY A;  4CI2 B;  3ESL A;  1ZKE A;  5LNK A;  3WAJ A;  4KMC A;  5LHG B;  3ZCJ A;  3ZC1 A;  5L2L A;  4ILU A;  4OYK A;  3N9Q A;  2ZMA A;  4UXN B;  2D5U A;  1VRB A;  1H7C A;  4I43 B;  2RP4 A;  3PUQ A;  3AA6 B;  4YJ2 E;  2A72 A;  2JQQ A;  4L0R A;  2C0S A;  4PJJ A;  3QC9 A;  2V26 A;  4CQI A;  2UXX B;  4PFP A;  5ADX L;  2JPF A;  1IJ5 A;  1IZN B;  3I0O A;  2V1D B;  3FBZ A;  1ZHC A;  4DO0 A;  2X9Y A;  5IYZ E;  2KND A;  4PJN A;  4O8S A;  4ADZ A;  3CWZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...