3ZC1A

Crystal structure of afc3po
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
190
structure length
190
Chain Sequence
MRLEECRKRLEELEAAREELLKVLREMRIHSTKSIALIHAGKVEEAEQELKKAIELLEKVKAYREYPEIYFYLCNDAMQELVEAIAFKNAISGEFTFEIDLEVTPAAFLNGFADAVGELRRYALTKLIEGDFKSAERMLEVMEKIYERLMEFTTFPDKLVSGLRKKLDVARGGIERTKSDYIAAKVARLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords AFTRAX
total genus 73
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zc1A00
3ZC1A 3ZC0A 5JRCB 5JR9C 5JRCA 5JR9B 5JR9A 5JREA
chains in the Genus database with same CATH superfamily
1WYCA 3EVYA 2BG9E 2VL8A 3AE9A 2WMNA 2G0UA 4HFEA 3OYXA 2WCAA 1AJ3A 1I6ZA 5AQVB 3PUXF 3ZSTA 1MMAA 5HEGA 4NIQA 4DNDA 3K3QC 4EAHA 4GOUA 1ZV4X 4UVAB 4OYJA 2CBJA 2A3DA 2WSSV 4ZOLE 1JNZA 2WY2A 4EEBA 4ZHQE 3RC3A 3RYCE 5EK2A 2UUBT 2EHOC 2V7IA 3P50A 2MOZA 3RI5A 4JI2T 5IUXA 1D1AA 2EHOA 3GMIA 4CI1B 2WMOA 2X9XA 5DABA 2PTFA 3R6NA 2XQ3A 3F57A 5FP3A 1KEYA 2JQKA 1XMQT 2W66A 2AXDS 3NVOA 3RF1A 4COFA 4DV1T 5CB4E 3A8YC 2RA1A 2IAKA 4CZZB 2IIUA 5ABHA 3I1AA 4UVBB 4HFHA 4X66T 3QK6A 2CBIA 1KNPA 2R6GF 2WAUA 2WZIA 5HEUA 3KVAA 1M7KA 2ZLYA 2V8SV 2XQ4A 2WWVA 3HKDE 3T8OA 3TKLB 2D9DA 4O4IE 2KWHA 4AKRB 3Q5XA 1FEWA 2W63A 3AE3A 4HE8A 1MMNA 2JQQA 4IE7A 4QXCB 4TX5A 1T72A 2XZEA 1D0YA 2CHNA 3ZSSA 3C4XA 4V1Av 2DI4A 2K24A 2JJ9A 5AQGB 5LCYA 1XDPA 2A9UA 4GYSA 5LYJE 2UXBT 2C5KT 1IZNB 3TLSA 2PG8A 2WDQA 4KP3C 1HFAA 1MIYA 4U33A 2CRBA 3M65A 2V5CA 4H9OC 4IIJE 2MTQA 2CWYA 3BQLA 3ZN1B 5JTGA 1VRBA 3GN5A 4QH4A 4AKIA 3P4SA 3ONLC 4PNIA 5JR9A 4AQYT 4FI5A 1H7CA 4WNKA 3AVRA 4ILBA 4LF6T 3ZC0A 3EAMA 5FY7A 4XBFB 3NKZA 4LF9T 2BS3A 4X64T 4I4TE 2ODVA 4L9IA 4QH1A 4ZS3A 3E08A 3VHLA 5FY0A 3NBXX 3ZMUB 2LE8A 5GONE 4C91A 1SA0E 3PE0A 3PUAA 5HXCA 2W62A 4F6RC 3K3OA 4IDNA 3JCFA 4P09A 5AQUB 4AQFC 1OWAA 2BG9B 2Q9QB 2HN1A 3AB3B 1DU2A 2H89A 1EZ3A 1HG5A 2A72A 5J2TE 1HNWT 4KX6A 1YQ4A 3HKBE 3OBVE 3PUGA 4OFZA 3MJXA 1G8XA 2XSAA 5HEHA 2BDEA 2BG9A 2Q9QA 2VURA 4HFDA 4X20E 4YTNA 3PUWF 1SUMB 5F3JA 4U3CA 3PJAA 4EXTA 1ZHCA 5HWXA 5LJNA 4DV0T 3PV0F 3TLWA 4AKHA 4EYYR 4O8SA 2VVSA 5AQPB 2L3LA 2BKPA 4ILCA 5AQSB 2M6IA 4IE0A 3AA6B 3VR8A 2XAFB 2X51A 3F31A 3B57A 1QLBA 2W2UA 3G06A 1W9RA 3AA1B 2VASA 2X9YA 5AQOB 2C0SA 1LKXA 2CEAA 2WB5A 3AEFA 1MIWA 2PFVA 3AVSA 3IHRA 3ONJA 4PJLA 4WZXA 4ZXLA 2WZHA 3SS1A 4AKLA 1B7TA 3CWZB 2W67A 5AQKB 3BK9A 1R8IA 2CMRA 3CX6B 2BS4A 3BQKA 4H9NC 3AXJA 4X1IE 1D1BA 2NOXA 2VWAA 5HXHA 1IAPA 2KSRA 4KHPT 4JV5T 4YHHT 1ZP0A 2DWGA 2XAGB 3UU5A 4IE4A 4WBNE 3UU6A 2XQ5A 3QNUA 2IHR1 3PU8A 2LSGA 3QB5A 3H37A 2ACXA 3OTOT 2Y8DA 4KBMB 2HHHT 4TZ4C 4JI8T 2VB6A 2J4GA 2XASB 3AAEB 3GWHA 2YK0A 3KV9A 5AQLB 3RYFE 3AAAB 2X0HA 2IW5B 2YKSA 1HF8A 3OKQA 1NAFA 1UX5A 2LHNA 4P0AA 3CX7B 2VQFT 3N9LA 3ETVA 2M6BA 2V6YA 2LOSA 1IBLT 2Y48B 5LHIB 3PUSA 5H6QB 3AE1A 5KMGP 4JI5T 2E9XD 2YDRA 4TNWA 3V5SA 4CXYA 3BQIA 3TLUA 1UK5A 5M4YA 3UFEA 2QYWA 3MZKB 4CXWA 2LSYA 4LF7T 4G63A 2OLTA 2MBGA 3ZCIA 3ZT5A 1S35A 2UXXB 3NRYA 3KBUA 5HCMA 2LEHA 2V6XA 2ZM2A 3CKDA 5LGUB 3ZT7A 3ETUA 4HEAA 5HWYA 1KNRA 5L3FB 5LMUT 3N9NA 3ZYLA 4UEMA 2LRLA 3ZN0B 3O1HA 2KWIB 5BMVE 5JDNA 3AEDA 2XHEB 1IBMT 2LRKA 3K1SA 3LSVA 4ZI3D 4H9PC 4CN4A 5JH7E 1ZKEA 3EI0A 2QA7A 3O1JA 4H63H 4EEDA 4DV7T 3RIUA 4MFRA 2FJAA 3UU4A 3QUJA 4IDOA 2CLYC 2J1DG 2LHRA 3MK7C 3LG7A 2BVLA 5EK3A 4ASKA 1I94T 2LT3A 3LK3B 1NEKA 1QUUA 3UT5E 5JDGA 1T98A 3EDUA 4UV9B 4YXDA 4UF0A 4B3RT 4UVCB 5LHGB 2QVAA 4I43B 3ZMTB 4ZI2C 5IWAT 2IC6A 3VKGA 3DP7A 2LLYA 5JDLA 4O4LE 2P9BA 3K8PC 5AQTB 3KVBA 2Y6XA 4PJMA 5JR9C 4PFPA 3RKGA 4HWDA 4O2AE 4NUVA 1BR1A 4U31A 4DR5T 2JIWA 3GA8A 5FMNA 1N36T 4HFIA 4N78D 2KXPB 3VKHA 4I50E 3N5LA 2MAWA 3SWHA 3MXZA 4HWIB 1WCRA 5TAOA 1XMOT 1YQ3A 2CM0A 1KFYA 1OEDB 3AE5A 3FZLB 5HXRA 3RHWA 5FL1A 5F5WA 4NXMT 4IT4A 5J2UE 3PUVF 4YJ3E 3ZJ2A 2DHRA 4EZ4A 4H9RC 2LKGA 2XAJB 2FJBA 2ZM0A 3IF8B 3NZQA 4BJMA 4DMVA 3UUNA 1J5ET 4AIUA 2N1GA 2CPTA 5CA0E 5HXEA 2JMKA 2MYSA 2FJEA 1HG2A 1YXRA 2RPAA 4ANJA 1IJ5A 1HCIA 4O4HE 2CCQA 3DJBA 4LF5T 1Z8UA 2X0LB 2X9HA 1XNRT 1WFDA 2BKNA 2X68A 3AXJB 3Q5EA 1XNQT 3VRAA 3PUYF 1KK7A 1XWMA 3L39A 2BBHA 3P8CD 3CK6A 4TN7B 5JDMA 2BVMA 1BR4A 2IC9A 3P4RA 4MBQA 4YLHA 4OX9T 5JRCB 3ZLIA 2D0TA 2XQ8A 1S94A 2KMFA 4GK0E 4PJNA 4UF0B 3AA7B 3RYIE 3S4UA 4YSYA 2UXNB 3E22E 3CPZA 4K0KT 2V5DA 5FXZA 3K3NA 4A97A 2JQ9A 2IDOB 4X1KE 4CI3B 4LF8T 1YW0A 2BZBA 3B13A 3FXEB 1WLXA 3N9MA 3OYZA 4GIWA 4HFBA 4Q25A 4ILUA 2YINA 3RRCA 2J62A 5DQWA 4KI0F 4ZEYA 2I59A 1MIVA 2K48A 3IEEA 3PDYA 3ZMSB 2D0UA 5F8PA 2F4VT 2K9AA 5H6RB 3EUHA 1L0VA 3I9WA 3C4ZA 4NPPA 2V7LA 3ZMZB 1HX1B 4IE6A 4KUMB 4DBQA 5EK4A 2N2NA 3N9PA 4U2YA 5LHHB 2C5IT 3OJAA 3VRBA 2EHOB 4CN6A 4HTEA 2KNDA 3WAJA 4X65T 4X5TA 4GK5E 2B76A 2WBLA 3CIRA 4JI0T 4JEUB 4NXNT 3ZKRA 5JDQA 2NTYA 1T8BA 2DL1A 5L3GB 4DV5T 4ERRA 2W61A 2UUCT 2CXDA 3O4XE 4I0UA 5DQVA 4BAYB 4UXNB 4JUYA 3L3PA 2YOEA 3KV6A 3EDVA 2X67A 3JAFA 3SFEA 2E8IA 1W0BA 3AEGA 5AQFB 1N32T 1U5PA 4YFSA 5ABGA 1HX8A 4GKJT 3AE7A 3L8RA 4AQFA 3RKOA 3LK42 2XQ7A 4DR4T 5FVLA 1OEDE 2V7MA 3HR0A 3KINB 5EZYE 3RYHE 3WAKA 1N33T 2BKOA 2W00A 3RLFF 2J47A 2BG9C 2L8KA 2LSJA 2KZ7B 1XDOA 2Q9QC 2XUEA 2BS2A 2CXFA 2XY8B 1M62A 4QXBB 5FXWA 1Y64B 4HWHA 4B6XA 5J1GA 2E2AA 3HKCE 3ANWB 4EOZB 1FMVA 4HWFA 2CWOA 4PK6A 4AI6A 2WS3A 1BR0A 2E5VA 2WWUA 3PUZF 5IYZE 3RIFA 2WDVA 1G73A 5ABFA 5KX5E 5LJMA 3FBZA 2VKHA 1SHZC 3B5MA 1US7B 2E9XA 2YU2A 2XQYA 4TV8E 4TWFA 2H7VC 4H9SE 4JBWF 3SFDA 4LFAT 4AKGA 3LJCA 2OA5A 4LMLA 4TWDA 3KBTA 5L3CB 5AQMB 2XTLA 4HFCA 5C8YE 5FKYA 4YJ2E 4MHCA 4DV4T 1MNDA 2V7JA 3AA0B 4JYAT 5J0ZA 1MMGA 2H88A 4U7IA 3P7IA 5L2LA 4MLKA 4A5XA 1X9BA 3FB2A 3L09A 4UR9A 3AE2A 3N2OA 2DNXA 4QH5A 3SOLA 4CQIA 2GK9A 4P0BA 4JI7T 1JNRA 3QC9A 2Z6EA 4HKAA 3ANWA 5FXVA 2UXCT 3D0TA 5LG4A 1J1JA 1WRDA 3CQGB 4U2ZA 2BBJA 4UV8B 4CXXA 1FJGT 2ODUA 4G2AA 4JI1T 2XQ6A 3KDSE 3RQUA 3NRXA 2WDRA 2K3WA 3KV5A 3J9X1 2YN6A 2JQHA 4DV3T 1E7PA 3HI2A 3I0QA 5FL0A 4E7SA 3E0ZA 4IE5A 4DV6T 4OK0A 4B3ST 5LA6E 4FJOA 4DR7T 3OPCA 5JDHA 3FHNA 2V7KA 3N2KE 2IMLA 2NWBA 3QOFA 2KLQA 5JRCA 4GYRA 4WW0A 4BJNA 1T7SA 1VCTA 1VOMA 2N9DA 4PK4A 2DCFA 3UULA 2D5UA 2XAHB 3NWIA 3U78A 2WM9A 3C51A 1CUNA 4NUUA 4TV9E 4WYVA 5LBMA 3O9XA 3T1YT 3LDQB 5JREA 3N2GE 2Q9QD 4YHJA 3F2EA 5FYMA 3RPUA 3X1DA 4ISTA 4ADZA 2XQ9A 3AEBA 1KNZA 4LFBT 5LXTE 2HN2A 1HTJF 4U7YA 2ACZA 1MMDA 1D0ZA 2NTXA 3FZKB 3PUQA 3AECA 4HN9A 4PFOA 5L3EB 4JI6T 4DR6T 3LK2B 3MKDA 3RH3A 3AE6A 3CMLA 4E7ZA 4LFCT 1KF6A 4Z91A 2JPFA 3MACA 1FIOA 4XAXB 5AQIB 5HCJA 4QX7B 2JMHA 3UU8A 3JAEA 4OYKA 2KT9A 3FZFB 1LVFA 4EB6E 2ZM6T 5E0OA 3RIUC 4IDQA 3W15B 3UFGA 3UUBA 4CN1A 4DUZT 4ZI3C 2QRXA 2I0MA 3HL6A 3CVRA 2H3RA 4B3TT 3AEAA 4YT0A 2VKOA 2YDQA 2ZM8A 2EHOD 2NP9A 3H3MA 5L3DB 2UUAT 4I55E 3A5XA 2LM9A 3U3IA 5LGTB 3ZMVB 2H7OA 4P1NA 4DR3T 4O2BE 4U72A 4LMKA 4H63V 1WR0A 2A2FX 3M3ZB 2VVNA 4YSXA 2WU5A 5CFBA 4IL9A 4IL4A 3DTOA 1D0XA 2LSKA 3HKEE 4QX8B 4UIGA 5HYAA 5AQHB 3EHZA 3MA9A 4OHFA 2E9XB 2FUPA 4EIWA 5JR9B 5L4HA 5FY1A 2YU1A 2KINB 4F8HA 3JADA 4AQGA 5JQGE 3I9YA 4PAGA 4Z8XA 5KXJA 3UU3A 2VQET 4A56A 2LKHA 3EABA 3ONXA 1V9DA 5L3BB 3PTRB 5KDMC 3UUXB 4AXPA 5HEJA 3ZEFB 2CLYB 4DV2T 4B3MT 1LVKA 3VR9A 2VL0A 4Z90A 3ZCJA 3O1IA 4QHOA 2LJLA 4X62T 1HR0T 2PBIA 5AQQB 1UUSA 3JC6C 4IGUA 5L47A 1HNXT 1E2AA 4LF4T 3LFMA 3ABVA 1W0AA 3C98B 2PJQA 5CGMA 4X1YE 3IBPA 2NW8A 3RIAA 1UURA 4QKNA 3RRWA 3RX6A 4DIDB 2RP4A 3N9QA 3AAIA 3P4WA 2B1EA 2X0YA 4HFVA 4M1PA 4QXHB 4HGAA 3LBXA 3UQ4A 3OVUA 1MNEA 3UTKA 4ZI7E 3LBXB 3PJAJ 4H9QC 4PJJA 2W0GA 2D2SA 4TUYE 1UX4A 2WQYA 5BR8T 4DUYT 1NWMX 2HPLA 4UELA 3RGLA 2YDSA 3CQCB 1IBKT 2I6HA 1WYBA 1OEDC 2WU2A 4KHZF 4MALA 3FZHB 2CHOA 3ZYMA 5LG3A 2VK9A 3ZPOA 1OEDA 1WR6A 3FBLA 4ZZCA 3J7Yq 1IJ6A 3I0OA 3Q5WA 5LMNT 4QWNB 5HEOA 3FZMB 2NW9A 4EZHA 4U74A 2X9WA 3ESLA 2UU9T 2E5LT 5CA1E 3UQ7A 5LBQB 1ZEEA 3T1HT 2ZMAA 2QGSA 5JVDE 2K5BB 2NR4A 1YKHB 4IDPA 3C50A 4AISA 4DBRA 4YSZA 4DR1T 3P4QA 4A98A 1E1HB 1YD8G 2XAQB 3Q5DA 4JI3T 2AE9A 4ILAA 2VKDA 1BR2A 2XPKA 5AQRB 4IDZA 4DO0A 5C2TA 3SRZA 2IUBA 4LMJA 5ETWA 5FXXA 4WBOA 5HAXA 1W09A 2NW7A 5FVKA 3TLVA 1UCUA 5CJ5A 2VKJA 1Y01A 2WP9A 2ES0A 2XM2A 3CQXC 4JEHB 5FNVE 5LOVE 4GKKT 5LP6E 1N34T 3HA4A 2HPJA 2XQAA 4TNVA 5C3JA 2MPKA 2W4XA 3V5UA 4HWCA 4EGWA 2LOPA 4IHJE 3RQWA 3A7MA 4EYUA 1LRZA 2DLRA 1VCSA 4IREA 1GQEA 4DVDA 2V6YB 3WI3A 3RC8A 3AE4A 2LM2A 4L0RA 3C4WA 3ZC1A 2XSBA 2OV9A 1X79A 2CE7A 3C64A 4TWHA 4EV6A 2HH7A 2SPCA 2X66A 5ABEA 1SE7A 2V26A 4ZI2D 2FBWA 1Z0PA 3ZYKA 4O4JE 5AFUL 1D1CA 1O3XA 1YKEB 3R84B 5LGNB 4KMCA 1UGOA 2XJ7A 3ZJ1A 4PW8A 1OXZA 2CXLA 2E9XC 4DMWA 1HNZT 4JLEA 2XM1A 3QB5K 3Q9DA 4YTPA 1J5WA 2JRKA 5DJQC 3GN5B 1FMWA 3ZT6A 5LNKA 2CA5A 3H3AA 4ISSA 3FXDB 5ABFB 2V1DB 3UUMA 5AQNB 3PURA 3IA3A 4PK5A 4BA9A 4YY3T 3AEEA 1ZOYA 3AE8A 4L5GA 4DR2T 3Q2MA 4K0UA 2FJDA 5IHYA 5AQJB 4CI2B 5LB7B 3VU7H 3CX8B 4JI4T 3P4PA 1XZYA 5JDFA 3N9OA 1CHUA 1QSDA 3PU3A 4XZCA 3KV4A 4YTMA 3KFWX 4C90A 5ADXL 4ZS2A 1NENA 3NZPA 2UXDT 1HS7A 5HXSA 5L4EA 3TLTA 1U4QA 4ZZBA 4J2CA 3JC6D 2LSIA 2DWKA 2M67A 2C5JA 5A1LA 2YEVC 2L9QA
chains in the Genus database with same CATH topology
1WYCA 3EVYA 2VL8A 2WMNA 2G0UA 3OYXA 1AJ3A 3VKGA 4DNDA 1MMAA 3K3QC 4EAHA 4GOUA 1ZV4X 4UVAB 4OYJA 2A3DA 2WSSV 4ZOLE 4ZHQE 5EK2A 3RC3A 3RYCE 2EHOC 2V7IA 2MOZA 1D1AA 2EHOA 3GMIA 4CI1B 2WMOA 2X9XA 5DABA 3R6NA 3F57A 5FP3A 5CB4E 2RA1A 2IAKA 4CZZB 3I1AA 4UVBB 3QK6A 2WAUA 3KVAA 2ZLYA 3T8OA 3HKDE 4AKRB 3TKLB 4O4IE 2KWHA 3Q5XA 1FEWA 2W63A 4IE7A 4HE8A 1MMNA 2JQQA 4QXCB 4TX5A 1D0YA 3C4XA 4V1Av 2DI4A 2K24A 2JJ9A 5LCYA 5LYJE 4GYSA 2C5KT 1IZNB 2PG8A 4KP3C 1HFAA 1MIYA 3M65A 4H9OC 4IIJE 2MTQA 2CWYA 3BQLA 3ZN1B 1VRBA 3GN5A 4AKIA 5JR9A 4PNIA 4FI5A 1H7CA 4WNKA 3AVRA 3ZC0A 5FY7A 4XBFB 4I4TE 2ODVA 4L9IA 4ZS3A 3VHLA 3E08A 3ZMUB 5FY0A 3NBXX 2LE8A 5GONE 4C91A 1SA0E 3PE0A 3PUAA 5HXCA 2W62A 4F6RC 3K3OA 4P09A 4AQFC 1OWAA 2Q9QB 3AB3B 1EZ3A 1HG5A 2A72A 5J2TE 4OFZA 3HKBE 3OBVE 3PUGA 5AFUL 3MJXA 1G8XA 3ZMVB 2BDEA 2Q9QA 4X20E 5F3JA 4EXTA 1ZHCA 5HWXA 5LJNA 4AKHA 4EYYR 4O8SA 2L3LA 4IE0A 3AA6B 2XAFB 2X51A 3F31A 3B57A 3AA1B 2VASA 2X9YA 2C0SA 1LKXA 2CEAA 3AVSA 4PJLA 1MIWA 2PFVA 3IHRA 4AKLA 3SS1A 1B7TA 3CWZB 3BK9A 3CX6B 2CMRA 4H9NC 3BQKA 4X1IE 1D1BA 2NOXA 2VWAA 5HXHA 1IAPA 2DWGA 2XAGB 4IE4A 4WBNE 3PU8A 2LSGA 3H37A 2ACXA 2Y8DA 4KBMB 4TZ4C 2VB6A 2XASB 3AAEB 3GWHA 2YK0A 3KV9A 3RYFE 3AAAB 2IW5B 1HF8A 3OKQA 1NAFA 1UX5A 2LHNA 4P0AA 3CX7B 3N9LA 3ETVA 2LOSA 2Y48B 3PUSA 5H6QB 5KMGP 2E9XD 3V5SA 4CXYA 3BQIA 5M4YA 3UFEA 3MZKB 4CXWA 2LSYA 4G63A 2MBGA 3ZCIA 1S35A 2UXXB 3NRYA 3KBUA 5LGUB 2LEHA 2ZM2A 3CKDA 3ETUA 4HEAA 5HWYA 5L3FB 3N9NA 3ZYLA 4UEMA 3ZN0B 3O1HA 2KWIB 5BMVE 5JDNA 2XHEB 4ZI3D 4H9PC 5JH7E 1ZKEA 2QA7A 3O1JA 4H63H 4MFRA 3QUJA 2CLYC 2J1DG 2LHRA 3MK7C 3LG7A 2BVLA 5EK3A 4ASKA 2LT3A 3LK3B 3UT5E 1QUUA 5JDGA 1T98A 3EDUA 4UV9B 4UF0A 4UVCB 5LHGB 3ZMTB 4I43B 4ZI2C 2IC6A 3DP7A 4O4LE 2P9BA 3K8PC 3KVBA 2Y6XA 4PJMA 5JR9C 4PFPA 4O2AE 4NUVA 1BR1A 3GA8A 5FMNA 4N78D 2KXPB 3VKHA 4I50E 3N5LA 3SWHA 3MXZA 5TAOA 2CM0A 5HXRA 5J2UE 4YJ3E 3ZJ2A 2DHRA 4H9RC 2XAJB 2ZM0A 3IF8B 4BJMA 4DMVA 3NZQA 3UUNA 2N1GA 5CA0E 5HXEA 2JMKA 2MYSA 1HG2A 4ANJA 1IJ5A 1HCIA 4O4HE 2CCQA 3DJBA 2X0LB 2X9HA 2X68A 1KK7A 3P8CD 4TN7B 5JDMA 2BVMA 1BR4A 2IC9A 4MBQA 4YLHA 5JRCB 3ZLIA 2D0TA 1S94A 2KMFA 4GK0E 4PJNA 4UF0B 3AA7B 3RYIE 3S4UA 2UXNB 3E22E 3CPZA 5FXZA 3K3NA 4X1KE 4CI3B 3FXEB 1YW0A 2BZBA 3B13A 1WLXA 3N9MA 3OYZA 4GIWA 4ILUA 2YINA 3RRCA 5DQWA 2I59A 1MIVA 2K48A 3IEEA 3PDYA 3ZMSB 2D0UA 5F8PA 2K9AA 5H6RB 3EUHA 3I9WA 3C4ZA 2V7LA 3ZMZB 4IE6A 4KUMB 4DBQA 5EK4A 2N2NA 3N9PA 5LHHB 2C5IT 3OJAA 2EHOB 4HTEA 2KNDA 3WAJA 4GK5E 2WBLA 4JEUB 5JDQA 2NTYA 5L3GB 4ERRA 2W61A 2CXDA 3O4XE 5DQVA 4BAYB 4UXNB 4JUYA 3L3PA 3KV6A 3EDVA 2X67A 2E8IA 1U5PA 4YFSA 1HX8A 4AQFA 3RKOA 3LK42 2V7MA 3HR0A 3KINB 5EZYE 3RYHE 3WAKA 2W00A 2L8KA 2Q9QC 2LSJA 2KZ7B 2XUEA 4QXBB 5FXWA 2CXFA 4EZ4A 1Y64B 4B6XA 4EOZB 5J1GA 3HKCE 5JDLA 3ANWB 1FMVA 4AI6A 2CWOA 4PK6A 1BR0A 2WWUA 5IYZE 5LJMA 1G73A 5KX5E 3FBZA 2VKHA 1SHZC 1US7B 2E9XA 2YU2A 2XQYA 4TV8E 2H7VC 4H9SE 4AKGA 3LJCA 2OA5A 3KBTA 5L3CB 2XTLA 5C8YE 4YJ2E 4MHCA 1MNDA 2V7JA 3AA0B 1MMGA 3P7IA 5L2LA 4MLKA 3FB2A 3L09A 3N2OA 2DNXA 4CQIA 3SOLA 2GK9A 4P0BA 3QC9A 2Z6EA 4HKAA 3ANWA 5FXVA 3D0TA 5LG4A 1WRDA 3CQGB 4CXXA 4UV8B 2ODUA 4G2AA 3KDSE 3NRXA 3KV5A 3J9X1 3HI2A 3I0QA 4E7SA 3E0ZA 4IE5A 4OK0A 5LA6E 4FJOA 5JDHA 3FHNA 2V7KA 3N2KE 2NWBA 2KLQA 5JRCA 4GYRA 4WW0A 4BJNA 1VOMA 2N9DA 4PK4A 2DCFA 3UULA 2D5UA 2XAHB 3U78A 2WM9A 3C51A 1CUNA 4NUUA 4TV9E 5LBMA 3O9XA 5JREA 3N2GE 2Q9QD 4YHJA 3F2EA 5FYMA 3RPUA 1KNZA 4ISTA 4ADZA 5LXTE 1HTJF 2NTXA 1MMDA 1D0ZA 4PFOA 3PUQA 4HN9A 5L3EB 3LK2B 3MKDA 3RH3A 3CMLA 4E7ZA 2JPFA 3MACA 1FIOA 4XAXB 4QX7B 2JMHA 4OYKA 2KT9A 4EB6E 1LVFA 5E0OA 3W15B 4ZI3C 3HL6A 3CVRA 2H3RA 2VKOA 2ZM8A 2EHOD 2NP9A 5L3DB 4I55E 3A5XA 2LM9A 3U3IA 5LGTB 2H7OA 4O2BE 4U72A 4H63V 2A2FX 5LHIB 3DTOA 1D0XA 2LSKA 3HKEE 4QX8B 4UIGA 5HYAA 5JR9B 3MA9A 4EIWA 4OHFA 2E9XB 5FY1A 2YU1A 2KINB 4AQGA 5JQGE 3I9YA 4PAGA 4Z8XA 4A56A 5L3BB 3ONXA 1V9DA 3PTRB 5KDMC 3UUXB 4AXPA 3ZEFB 2CLYB 1LVKA 3ZCJA 3O1IA 4QHOA 2LJLA 2PBIA 3JC6C 4IGUA 3LFMA 3C98B 2PJQA 4X1YE 3IBPA 2NW8A 4QKNA 3RRWA 3RX6A 2RP4A 3N9QA 3AAIA 4HFVA 2B1EA 4M1PA 4QXHB 4HGAA 3LBXA 1MNEA 3UTKA 4ZI7E 3LBXB 4H9QC 4PJJA 2W0GA 2D2SA 4TUYE 1UX4A 1NWMX 2HPLA 4UELA 3CQCB 1WYBA 4MALA 3ZYMA 2VK9A 3ZPOA 1WR6A 3FBLA 3J7Yq 1IJ6A 3I0OA 3Q5WA 4QWNB 2NW9A 4EZHA 4U74A 2X9WA 3ESLA 5CA1E 5LBQB 1ZEEA 2ZMAA 2QGSA 5JVDE 2K5BB 1YKHB 4DBRA 3C50A 1E1HB 1YD8G 2XAQB 2VKDA 1BR2A 4IDZA 4DO0A 3SRZA 5HAXA 5ETWA 5FXXA 4WBOA 2NW7A 1UCUA 2VKJA 4JEHB 5LOVE 2ES0A 3CQXC 5FNVE 5LP6E 3HA4A 2HPJA 3V5UA 4EYUA 2LOPA 4IHJE 1LRZA 2DLRA 4DVDA 3WI3A 3RC8A 4L0RA 3C4WA 3ZC1A 1X79A 2CE7A 3C64A 2HH7A 2SPCA 2X66A 2V26A 4ZI2D 1Z0PA 3ZYKA 4O4JE 1D1CA 1O3XA 1YKEB 3R84B 5LGNB 4KMCA 3ZJ1A 4PW8A 1OXZA 2CXLA 2E9XC 4DMWA 4JLEA 3Q9DA 2JRKA 5DJQC 3GN5B 1FMWA 5LNKA 2CA5A 3H3AA 4ISSA 3FXDB 2V1DB 3UUMA 3PURA 4BA9A 4PK5A 4L5GA 3Q2MA 4K0UA 5IHYA 4CI2B 3VU7H 3CX8B 5JDFA 3N9OA 4XZCA 1QSDA 3PU3A 4C90A 3KV4A 3KFWX 5ADXL 4ZS2A 3NZPA 1HS7A 5HXSA 1U4QA 4J2CA 3JC6D 2LSIA 2DWKA 2M67A 2C5JA 5A1LA 2YEVC 2L9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZC1 A;  3ZC0 A;  5JRC B;  5JR9 C;  5JRC A;  5JR9 B;  5JR9 A;  5JRE A; 
#chains in the Genus database with same CATH topology
 1WYC A;  3EVY A;  2BG9 E;  2VL8 A;  3AE9 A;  2WMN A;  2G0U A;  4HFE A;  3OYX A;  2WCA A;  1AJ3 A;  1I6Z A;  5AQV B;  3PUX F;  3ZST A;  1MMA A;  5HEG A;  4NIQ A;  4DND A;  3K3Q C;  4EAH A;  4GOU A;  1ZV4 X;  4UVA B;  4OYJ A;  2CBJ A;  2A3D A;  2WSS V;  4ZOL E;  1JNZ A;  2WY2 A;  4EEB A;  4ZHQ E;  3RC3 A;  3RYC E;  5EK2 A;  2UUB T;  2EHO C;  2V7I A;  3P50 A;  2MOZ A;  3RI5 A;  4JI2 T;  5IUX A;  1D1A A;  2EHO A;  3GMI A;  4CI1 B;  2WMO A;  2X9X A;  5DAB A;  2PTF A;  3R6N A;  2XQ3 A;  3F57 A;  5FP3 A;  1KEY A;  2JQK A;  1XMQ T;  2W66 A;  2AXD S;  3NVO A;  3RF1 A;  4COF A;  4DV1 T;  5CB4 E;  3A8Y C;  2RA1 A;  2IAK A;  4CZZ B;  2IIU A;  5ABH A;  3I1A A;  4UVB B;  4HFH A;  4X66 T;  3QK6 A;  2CBI A;  1KNP A;  2R6G F;  2WAU A;  2WZI A;  5HEU A;  3KVA A;  1M7K A;  2ZLY A;  2V8S V;  2XQ4 A;  2WWV A;  3HKD E;  3T8O A;  3TKL B;  2D9D A;  4O4I E;  2KWH A;  4AKR B;  3Q5X A;  1FEW A;  2W63 A;  3AE3 A;  4HE8 A;  1MMN A;  2JQQ A;  4IE7 A;  4QXC B;  4TX5 A;  1T72 A;  2XZE A;  1D0Y A;  2CHN A;  3ZSS A;  3C4X A;  4V1A v;  2DI4 A;  2K24 A;  2JJ9 A;  5AQG B;  5LCY A;  1XDP A;  2A9U A;  4GYS A;  5LYJ E;  2UXB T;  2C5K T;  1IZN B;  3TLS A;  2PG8 A;  2WDQ A;  4KP3 C;  1HFA A;  1MIY A;  4U33 A;  2CRB A;  3M65 A;  2V5C A;  4H9O C;  4IIJ E;  2MTQ A;  2CWY A;  3BQL A;  3ZN1 B;  5JTG A;  1VRB A;  3GN5 A;  4QH4 A;  4AKI A;  3P4S A;  3ONL C;  4PNI A;  5JR9 A;  4AQY T;  4FI5 A;  1H7C A;  4WNK A;  3AVR A;  4ILB A;  4LF6 T;  3ZC0 A;  3EAM A;  5FY7 A;  4XBF B;  3NKZ A;  4LF9 T;  2BS3 A;  4X64 T;  4I4T E;  2ODV A;  4L9I A;  4QH1 A;  4ZS3 A;  3E08 A;  3VHL A;  5FY0 A;  3NBX X;  3ZMU B;  2LE8 A;  5GON E;  4C91 A;  1SA0 E;  3PE0 A;  3PUA A;  5HXC A;  2W62 A;  4F6R C;  3K3O A;  4IDN A;  3JCF A;  4P09 A;  5AQU B;  4AQF C;  1OWA A;  2BG9 B;  2Q9Q B;  2HN1 A;  3AB3 B;  1DU2 A;  2H89 A;  1EZ3 A;  1HG5 A;  2A72 A;  5J2T E;  1HNW T;  4KX6 A;  1YQ4 A;  3HKB E;  3OBV E;  3PUG A;  4OFZ A;  3MJX A;  1G8X A;  2XSA A;  5HEH A;  2BDE A;  2BG9 A;  2Q9Q A;  2VUR A;  4HFD A;  4X20 E;  4YTN A;  3PUW F;  1SUM B;  5F3J A;  4U3C A;  3PJA A;  4EXT A;  1ZHC A;  5HWX A;  5LJN A;  4DV0 T;  3PV0 F;  3TLW A;  4AKH A;  4EYY R;  4O8S A;  2VVS A;  5AQP B;  2L3L A;  2BKP A;  4ILC A;  5AQS B;  2M6I A;  4IE0 A;  3AA6 B;  3VR8 A;  2XAF B;  2X51 A;  3F31 A;  3B57 A;  1QLB A;  2W2U A;  3G06 A;  1W9R A;  3AA1 B;  2VAS A;  2X9Y A;  5AQO B;  2C0S A;  1LKX A;  2CEA A;  2WB5 A;  3AEF A;  1MIW A;  2PFV A;  3AVS A;  3IHR A;  3ONJ A;  4PJL A;  4WZX A;  4ZXL A;  2WZH A;  3SS1 A;  4AKL A;  1B7T A;  3CWZ B;  2W67 A;  5AQK B;  3BK9 A;  1R8I A;  2CMR A;  3CX6 B;  2BS4 A;  3BQK A;  4H9N C;  3AXJ A;  4X1I E;  1D1B A;  2NOX A;  2VWA A;  5HXH A;  1IAP A;  2KSR A;  4KHP T;  4JV5 T;  4YHH T;  1ZP0 A;  2DWG A;  2XAG B;  3UU5 A;  4IE4 A;  4WBN E;  3UU6 A;  2XQ5 A;  3QNU A;  2IHR 1;  3PU8 A;  2LSG A;  3QB5 A;  3H37 A;  2ACX A;  3OTO T;  2Y8D A;  4KBM B;  2HHH T;  4TZ4 C;  4JI8 T;  2VB6 A;  2J4G A;  2XAS B;  3AAE B;  3GWH A;  2YK0 A;  3KV9 A;  5AQL B;  3RYF E;  3AAA B;  2X0H A;  2IW5 B;  2YKS A;  1HF8 A;  3OKQ A;  1NAF A;  1UX5 A;  2LHN A;  4P0A A;  3CX7 B;  2VQF T;  3N9L A;  3ETV A;  2M6B A;  2V6Y A;  2LOS A;  1IBL T;  2Y48 B;  5LHI B;  3PUS A;  5H6Q B;  3AE1 A;  5KMG P;  4JI5 T;  2E9X D;  2YDR A;  4TNW A;  3V5S A;  4CXY A;  3BQI A;  3TLU A;  1UK5 A;  5M4Y A;  3UFE A;  2QYW A;  3MZK B;  4CXW A;  2LSY A;  4LF7 T;  4G63 A;  2OLT A;  2MBG A;  3ZCI A;  3ZT5 A;  1S35 A;  2UXX B;  3NRY A;  3KBU A;  5HCM A;  2LEH A;  2V6X A;  2ZM2 A;  3CKD A;  5LGU B;  3ZT7 A;  3ETU A;  4HEA A;  5HWY A;  1KNR A;  5L3F B;  5LMU T;  3N9N A;  3ZYL A;  4UEM A;  2LRL A;  3ZN0 B;  3O1H A;  2KWI B;  5BMV E;  5JDN A;  3AED A;  2XHE B;  1IBM T;  2LRK A;  3K1S A;  3LSV A;  4ZI3 D;  4H9P C;  4CN4 A;  5JH7 E;  1ZKE A;  3EI0 A;  2QA7 A;  3O1J A;  4H63 H;  4EED A;  4DV7 T;  3RIU A;  4MFR A;  2FJA A;  3UU4 A;  3QUJ A;  4IDO A;  2CLY C;  2J1D G;  2LHR A;  3MK7 C;  3LG7 A;  2BVL A;  5EK3 A;  4ASK A;  1I94 T;  2LT3 A;  3LK3 B;  1NEK A;  1QUU A;  3UT5 E;  5JDG A;  1T98 A;  3EDU A;  4UV9 B;  4YXD A;  4UF0 A;  4B3R T;  4UVC B;  5LHG B;  2QVA A;  4I43 B;  3ZMT B;  4ZI2 C;  5IWA T;  2IC6 A;  3VKG A;  3DP7 A;  2LLY A;  5JDL A;  4O4L E;  2P9B A;  3K8P C;  5AQT B;  3KVB A;  2Y6X A;  4PJM A;  5JR9 C;  4PFP A;  3RKG A;  4HWD A;  4O2A E;  4NUV A;  1BR1 A;  4U31 A;  4DR5 T;  2JIW A;  3GA8 A;  5FMN A;  1N36 T;  4HFI A;  4N78 D;  2KXP B;  3VKH A;  4I50 E;  3N5L A;  2MAW A;  3SWH A;  3MXZ A;  4HWI B;  1WCR A;  5TAO A;  1XMO T;  1YQ3 A;  2CM0 A;  1KFY A;  1OED B;  3AE5 A;  3FZL B;  5HXR A;  3RHW A;  5FL1 A;  5F5W A;  4NXM T;  4IT4 A;  5J2U E;  3PUV F;  4YJ3 E;  3ZJ2 A;  2DHR A;  4EZ4 A;  4H9R C;  2LKG A;  2XAJ B;  2FJB A;  2ZM0 A;  3IF8 B;  3NZQ A;  4BJM A;  4DMV A;  3UUN A;  1J5E T;  4AIU A;  2N1G A;  2CPT A;  5CA0 E;  5HXE A;  2JMK A;  2MYS A;  2FJE A;  1HG2 A;  1YXR A;  2RPA A;  4ANJ A;  1IJ5 A;  1HCI A;  4O4H E;  2CCQ A;  3DJB A;  4LF5 T;  1Z8U A;  2X0L B;  2X9H A;  1XNR T;  1WFD A;  2BKN A;  2X68 A;  3AXJ B;  3Q5E A;  1XNQ T;  3VRA A;  3PUY F;  1KK7 A;  1XWM A;  3L39 A;  2BBH A;  3P8C D;  3CK6 A;  4TN7 B;  5JDM A;  2BVM A;  1BR4 A;  2IC9 A;  3P4R A;  4MBQ A;  4YLH A;  4OX9 T;  5JRC B;  3ZLI A;  2D0T A;  2XQ8 A;  1S94 A;  2KMF A;  4GK0 E;  4PJN A;  4UF0 B;  3AA7 B;  3RYI E;  3S4U A;  4YSY A;  2UXN B;  3E22 E;  3CPZ A;  4K0K T;  2V5D A;  5FXZ A;  3K3N A;  4A97 A;  2JQ9 A;  2IDO B;  4X1K E;  4CI3 B;  4LF8 T;  1YW0 A;  2BZB A;  3B13 A;  3FXE B;  1WLX A;  3N9M A;  3OYZ A;  4GIW A;  4HFB A;  4Q25 A;  4ILU A;  2YIN A;  3RRC A;  2J62 A;  5DQW A;  4KI0 F;  4ZEY A;  2I59 A;  1MIV A;  2K48 A;  3IEE A;  3PDY A;  3ZMS B;  2D0U A;  5F8P A;  2F4V T;  2K9A A;  5H6R B;  3EUH A;  1L0V A;  3I9W A;  3C4Z A;  4NPP A;  2V7L A;  3ZMZ B;  1HX1 B;  4IE6 A;  4KUM B;  4DBQ A;  5EK4 A;  2N2N A;  3N9P A;  4U2Y A;  5LHH B;  2C5I T;  3OJA A;  3VRB A;  2EHO B;  4CN6 A;  4HTE A;  2KND A;  3WAJ A;  4X65 T;  4X5T A;  4GK5 E;  2B76 A;  2WBL A;  3CIR A;  4JI0 T;  4JEU B;  4NXN T;  3ZKR A;  5JDQ A;  2NTY A;  1T8B A;  2DL1 A;  5L3G B;  4DV5 T;  4ERR A;  2W61 A;  2UUC T;  2CXD A;  3O4X E;  4I0U A;  5DQV A;  4BAY B;  4UXN B;  4JUY A;  3L3P A;  2YOE A;  3KV6 A;  3EDV A;  2X67 A;  3JAF A;  3SFE A;  2E8I A;  1W0B A;  3AEG A;  5AQF B;  1N32 T;  1U5P A;  4YFS A;  5ABG A;  1HX8 A;  4GKJ T;  3AE7 A;  3L8R A;  4AQF A;  3RKO A;  3LK4 2;  2XQ7 A;  4DR4 T;  5FVL A;  1OED E;  2V7M A;  3HR0 A;  3KIN B;  5EZY E;  3RYH E;  3WAK A;  1N33 T;  2BKO A;  2W00 A;  3RLF F;  2J47 A;  2BG9 C;  2L8K A;  2LSJ A;  2KZ7 B;  1XDO A;  2Q9Q C;  2XUE A;  2BS2 A;  2CXF A;  2XY8 B;  1M62 A;  4QXB B;  5FXW A;  1Y64 B;  4HWH A;  4B6X A;  5J1G A;  2E2A A;  3HKC E;  3ANW B;  4EOZ B;  1FMV A;  4HWF A;  2CWO A;  4PK6 A;  4AI6 A;  2WS3 A;  1BR0 A;  2E5V A;  2WWU A;  3PUZ F;  5IYZ E;  3RIF A;  2WDV A;  1G73 A;  5ABF A;  5KX5 E;  5LJM A;  3FBZ A;  2VKH A;  1SHZ C;  3B5M A;  1US7 B;  2E9X A;  2YU2 A;  2XQY A;  4TV8 E;  4TWF A;  2H7V C;  4H9S E;  4JBW F;  3SFD A;  4LFA T;  4AKG A;  3LJC A;  2OA5 A;  4LML A;  4TWD A;  3KBT A;  5L3C B;  5AQM B;  2XTL A;  4HFC A;  5C8Y E;  5FKY A;  4YJ2 E;  4MHC A;  4DV4 T;  1MND A;  2V7J A;  3AA0 B;  4JYA T;  5J0Z A;  1MMG A;  2H88 A;  4U7I A;  3P7I A;  5L2L A;  4MLK A;  4A5X A;  1X9B A;  3FB2 A;  3L09 A;  4UR9 A;  3AE2 A;  3N2O A;  2DNX A;  4QH5 A;  3SOL A;  4CQI A;  2GK9 A;  4P0B A;  4JI7 T;  1JNR A;  3QC9 A;  2Z6E A;  4HKA A;  3ANW A;  5FXV A;  2UXC T;  3D0T A;  5LG4 A;  1J1J A;  1WRD A;  3CQG B;  4U2Z A;  2BBJ A;  4UV8 B;  4CXX A;  1FJG T;  2ODU A;  4G2A A;  4JI1 T;  2XQ6 A;  3KDS E;  3RQU A;  3NRX A;  2WDR A;  2K3W A;  3KV5 A;  3J9X 1;  2YN6 A;  2JQH A;  4DV3 T;  1E7P A;  3HI2 A;  3I0Q A;  5FL0 A;  4E7S A;  3E0Z A;  4IE5 A;  4DV6 T;  4OK0 A;  4B3S T;  5LA6 E;  4FJO A;  4DR7 T;  3OPC A;  5JDH A;  3FHN A;  2V7K A;  3N2K E;  2IML A;  2NWB A;  3QOF A;  2KLQ A;  5JRC A;  4GYR A;  4WW0 A;  4BJN A;  1T7S A;  1VCT A;  1VOM A;  2N9D A;  4PK4 A;  2DCF A;  3UUL A;  2D5U A;  2XAH B;  3NWI A;  3U78 A;  2WM9 A;  3C51 A;  1CUN A;  4NUU A;  4TV9 E;  4WYV A;  5LBM A;  3O9X A;  3T1Y T;  3LDQ B;  5JRE A;  3N2G E;  2Q9Q D;  4YHJ A;  3F2E A;  5FYM A;  3RPU A;  3X1D A;  4IST A;  4ADZ A;  2XQ9 A;  3AEB A;  1KNZ A;  4LFB T;  5LXT E;  2HN2 A;  1HTJ F;  4U7Y A;  2ACZ A;  1MMD A;  1D0Z A;  2NTX A;  3FZK B;  3PUQ A;  3AEC A;  4HN9 A;  4PFO A;  5L3E B;  4JI6 T;  4DR6 T;  3LK2 B;  3MKD A;  3RH3 A;  3AE6 A;  3CML A;  4E7Z A;  4LFC T;  1KF6 A;  4Z91 A;  2JPF A;  3MAC A;  1FIO A;  4XAX B;  5AQI B;  5HCJ A;  4QX7 B;  2JMH A;  3UU8 A;  3JAE A;  4OYK A;  2KT9 A;  3FZF B;  1LVF A;  4EB6 E;  2ZM6 T;  5E0O A;  3RIU C;  4IDQ A;  3W15 B;  3UFG A;  3UUB A;  4CN1 A;  4DUZ T;  4ZI3 C;  2QRX A;  2I0M A;  3HL6 A;  3CVR A;  2H3R A;  4B3T T;  3AEA A;  4YT0 A;  2VKO A;  2YDQ A;  2ZM8 A;  2EHO D;  2NP9 A;  3H3M A;  5L3D B;  2UUA T;  4I55 E;  3A5X A;  2LM9 A;  3U3I A;  5LGT B;  3ZMV B;  2H7O A;  4P1N A;  4DR3 T;  4O2B E;  4U72 A;  4LMK A;  4H63 V;  1WR0 A;  2A2F X;  3M3Z B;  2VVN A;  4YSX A;  2WU5 A;  5CFB A;  4IL9 A;  4IL4 A;  3DTO A;  1D0X A;  2LSK A;  3HKE E;  4QX8 B;  4UIG A;  5HYA A;  5AQH B;  3EHZ A;  3MA9 A;  4OHF A;  2E9X B;  2FUP A;  4EIW A;  5JR9 B;  5L4H A;  5FY1 A;  2YU1 A;  2KIN B;  4F8H A;  3JAD A;  4AQG A;  5JQG E;  3I9Y A;  4PAG A;  4Z8X A;  5KXJ A;  3UU3 A;  2VQE T;  4A56 A;  2LKH A;  3EAB A;  3ONX A;  1V9D A;  5L3B B;  3PTR B;  5KDM C;  3UUX B;  4AXP A;  5HEJ A;  3ZEF B;  2CLY B;  4DV2 T;  4B3M T;  1LVK A;  3VR9 A;  2VL0 A;  4Z90 A;  3ZCJ A;  3O1I A;  4QHO A;  2LJL A;  4X62 T;  1HR0 T;  2PBI A;  5AQQ B;  1UUS A;  3JC6 C;  4IGU A;  5L47 A;  1HNX T;  1E2A A;  4LF4 T;  3LFM A;  3ABV A;  1W0A A;  3C98 B;  2PJQ A;  5CGM A;  4X1Y E;  3IBP A;  2NW8 A;  3RIA A;  1UUR A;  4QKN A;  3RRW A;  3RX6 A;  4DID B;  2RP4 A;  3N9Q A;  3AAI A;  3P4W A;  2B1E A;  2X0Y A;  4HFV A;  4M1P A;  4QXH B;  4HGA A;  3LBX A;  3UQ4 A;  3OVU A;  1MNE A;  3UTK A;  4ZI7 E;  3LBX B;  3PJA J;  4H9Q C;  4PJJ A;  2W0G A;  2D2S A;  4TUY E;  1UX4 A;  2WQY A;  5BR8 T;  4DUY T;  1NWM X;  2HPL A;  4UEL A;  3RGL A;  2YDS A;  3CQC B;  1IBK T;  2I6H A;  1WYB A;  1OED C;  2WU2 A;  4KHZ F;  4MAL A;  3FZH B;  2CHO A;  3ZYM A;  5LG3 A;  2VK9 A;  3ZPO A;  1OED A;  1WR6 A;  3FBL A;  4ZZC A;  3J7Y q;  1IJ6 A;  3I0O A;  3Q5W A;  5LMN T;  4QWN B;  5HEO A;  3FZM B;  2NW9 A;  4EZH A;  4U74 A;  2X9W A;  3ESL A;  2UU9 T;  2E5L T;  5CA1 E;  3UQ7 A;  5LBQ B;  1ZEE A;  3T1H T;  2ZMA A;  2QGS A;  5JVD E;  2K5B B;  2NR4 A;  1YKH B;  4IDP A;  3C50 A;  4AIS A;  4DBR A;  4YSZ A;  4DR1 T;  3P4Q A;  4A98 A;  1E1H B;  1YD8 G;  2XAQ B;  3Q5D A;  4JI3 T;  2AE9 A;  4ILA A;  2VKD A;  1BR2 A;  2XPK A;  5AQR B;  4IDZ A;  4DO0 A;  5C2T A;  3SRZ A;  2IUB A;  4LMJ A;  5ETW A;  5FXX A;  4WBO A;  5HAX A;  1W09 A;  2NW7 A;  5FVK A;  3TLV A;  1UCU A;  5CJ5 A;  2VKJ A;  1Y01 A;  2WP9 A;  2ES0 A;  2XM2 A;  3CQX C;  4JEH B;  5FNV E;  5LOV E;  4GKK T;  5LP6 E;  1N34 T;  3HA4 A;  2HPJ A;  2XQA A;  4TNV A;  5C3J A;  2MPK A;  2W4X A;  3V5U A;  4HWC A;  4EGW A;  2LOP A;  4IHJ E;  3RQW A;  3A7M A;  4EYU A;  1LRZ A;  2DLR A;  1VCS A;  4IRE A;  1GQE A;  4DVD A;  2V6Y B;  3WI3 A;  3RC8 A;  3AE4 A;  2LM2 A;  4L0R A;  3C4W A;  3ZC1 A;  2XSB A;  2OV9 A;  1X79 A;  2CE7 A;  3C64 A;  4TWH A;  4EV6 A;  2HH7 A;  2SPC A;  2X66 A;  5ABE A;  1SE7 A;  2V26 A;  4ZI2 D;  2FBW A;  1Z0P A;  3ZYK A;  4O4J E;  5AFU L;  1D1C A;  1O3X A;  1YKE B;  3R84 B;  5LGN B;  4KMC A;  1UGO A;  2XJ7 A;  3ZJ1 A;  4PW8 A;  1OXZ A;  2CXL A;  2E9X C;  4DMW A;  1HNZ T;  4JLE A;  2XM1 A;  3QB5 K;  3Q9D A;  4YTP A;  1J5W A;  2JRK A;  5DJQ C;  3GN5 B;  1FMW A;  3ZT6 A;  5LNK A;  2CA5 A;  3H3A A;  4ISS A;  3FXD B;  5ABF B;  2V1D B;  3UUM A;  5AQN B;  3PUR A;  3IA3 A;  4PK5 A;  4BA9 A;  4YY3 T;  3AEE A;  1ZOY A;  3AE8 A;  4L5G A;  4DR2 T;  3Q2M A;  4K0U A;  2FJD A;  5IHY A;  5AQJ B;  4CI2 B;  5LB7 B;  3VU7 H;  3CX8 B;  4JI4 T;  3P4P A;  1XZY A;  5JDF A;  3N9O A;  1CHU A;  1QSD A;  3PU3 A;  4XZC A;  3KV4 A;  4YTM A;  3KFW X;  4C90 A;  5ADX L;  4ZS2 A;  1NEN A;  3NZP A;  2UXD T;  1HS7 A;  5HXS A;  5L4E A;  3TLT A;  1U4Q A;  4ZZB A;  4J2C A;  3JC6 D;  2LSI A;  2DWK A;  2M67 A;  2C5J A;  5A1L A;  2YEV C;  2L9Q A; 
#chains in the Genus database with same CATH homology
 1WYC A;  3EVY A;  2VL8 A;  2WMN A;  2G0U A;  3OYX A;  1AJ3 A;  3VKG A;  4DND A;  1MMA A;  3K3Q C;  4EAH A;  4GOU A;  1ZV4 X;  4UVA B;  4OYJ A;  2A3D A;  2WSS V;  4ZOL E;  4ZHQ E;  5EK2 A;  3RC3 A;  3RYC E;  2EHO C;  2V7I A;  2MOZ A;  1D1A A;  2EHO A;  3GMI A;  4CI1 B;  2WMO A;  2X9X A;  5DAB A;  3R6N A;  3F57 A;  5FP3 A;  5CB4 E;  2RA1 A;  2IAK A;  4CZZ B;  3I1A A;  4UVB B;  3QK6 A;  2WAU A;  3KVA A;  2ZLY A;  3T8O A;  3HKD E;  4AKR B;  3TKL B;  4O4I E;  2KWH A;  3Q5X A;  1FEW A;  2W63 A;  4IE7 A;  4HE8 A;  1MMN A;  2JQQ A;  4QXC B;  4TX5 A;  1D0Y A;  3C4X A;  4V1A v;  2DI4 A;  2K24 A;  2JJ9 A;  5LCY A;  5LYJ E;  4GYS A;  2C5K T;  1IZN B;  2PG8 A;  4KP3 C;  1HFA A;  1MIY A;  3M65 A;  4H9O C;  4IIJ E;  2MTQ A;  2CWY A;  3BQL A;  3ZN1 B;  1VRB A;  3GN5 A;  4AKI A;  5JR9 A;  4PNI A;  4FI5 A;  1H7C A;  4WNK A;  3AVR A;  3ZC0 A;  5FY7 A;  4XBF B;  4I4T E;  2ODV A;  4L9I A;  4ZS3 A;  3VHL A;  3E08 A;  3ZMU B;  5FY0 A;  3NBX X;  2LE8 A;  5GON E;  4C91 A;  1SA0 E;  3PE0 A;  3PUA A;  5HXC A;  2W62 A;  4F6R C;  3K3O A;  4P09 A;  4AQF C;  1OWA A;  2Q9Q B;  3AB3 B;  1EZ3 A;  1HG5 A;  2A72 A;  5J2T E;  4OFZ A;  3HKB E;  3OBV E;  3PUG A;  5AFU L;  3MJX A;  1G8X A;  3ZMV B;  2BDE A;  2Q9Q A;  4X20 E;  5F3J A;  4EXT A;  1ZHC A;  5HWX A;  5LJN A;  4AKH A;  4EYY R;  4O8S A;  2L3L A;  4IE0 A;  3AA6 B;  2XAF B;  2X51 A;  3F31 A;  3B57 A;  3AA1 B;  2VAS A;  2X9Y A;  2C0S A;  1LKX A;  2CEA A;  3AVS A;  4PJL A;  1MIW A;  2PFV A;  3IHR A;  4AKL A;  3SS1 A;  1B7T A;  3CWZ B;  3BK9 A;  3CX6 B;  2CMR A;  4H9N C;  3BQK A;  4X1I E;  1D1B A;  2NOX A;  2VWA A;  5HXH A;  1IAP A;  2DWG A;  2XAG B;  4IE4 A;  4WBN E;  3PU8 A;  2LSG A;  3H37 A;  2ACX A;  2Y8D A;  4KBM B;  4TZ4 C;  2VB6 A;  2XAS B;  3AAE B;  3GWH A;  2YK0 A;  3KV9 A;  3RYF E;  3AAA B;  2IW5 B;  1HF8 A;  3OKQ A;  1NAF A;  1UX5 A;  2LHN A;  4P0A A;  3CX7 B;  3N9L A;  3ETV A;  2LOS A;  2Y48 B;  3PUS A;  5H6Q B;  5KMG P;  2E9X D;  3V5S A;  4CXY A;  3BQI A;  5M4Y A;  3UFE A;  3MZK B;  4CXW A;  2LSY A;  4G63 A;  2MBG A;  3ZCI A;  1S35 A;  2UXX B;  3NRY A;  3KBU A;  5LGU B;  2LEH A;  2ZM2 A;  3CKD A;  3ETU A;  4HEA A;  5HWY A;  5L3F B;  3N9N A;  3ZYL A;  4UEM A;  3ZN0 B;  3O1H A;  2KWI B;  5BMV E;  5JDN A;  2XHE B;  4ZI3 D;  4H9P C;  5JH7 E;  1ZKE A;  2QA7 A;  3O1J A;  4H63 H;  4MFR A;  3QUJ A;  2CLY C;  2J1D G;  2LHR A;  3MK7 C;  3LG7 A;  2BVL A;  5EK3 A;  4ASK A;  2LT3 A;  3LK3 B;  3UT5 E;  1QUU A;  5JDG A;  1T98 A;  3EDU A;  4UV9 B;  4UF0 A;  4UVC B;  5LHG B;  3ZMT B;  4I43 B;  4ZI2 C;  2IC6 A;  3DP7 A;  4O4L E;  2P9B A;  3K8P C;  3KVB A;  2Y6X A;  4PJM A;  5JR9 C;  4PFP A;  4O2A E;  4NUV A;  1BR1 A;  3GA8 A;  5FMN A;  4N78 D;  2KXP B;  3VKH A;  4I50 E;  3N5L A;  3SWH A;  3MXZ A;  5TAO A;  2CM0 A;  5HXR A;  5J2U E;  4YJ3 E;  3ZJ2 A;  2DHR A;  4H9R C;  2XAJ B;  2ZM0 A;  3IF8 B;  4BJM A;  4DMV A;  3NZQ A;  3UUN A;  2N1G A;  5CA0 E;  5HXE A;  2JMK A;  2MYS A;  1HG2 A;  4ANJ A;  1IJ5 A;  1HCI A;  4O4H E;  2CCQ A;  3DJB A;  2X0L B;  2X9H A;  2X68 A;  1KK7 A;  3P8C D;  4TN7 B;  5JDM A;  2BVM A;  1BR4 A;  2IC9 A;  4MBQ A;  4YLH A;  5JRC B;  3ZLI A;  2D0T A;  1S94 A;  2KMF A;  4GK0 E;  4PJN A;  4UF0 B;  3AA7 B;  3RYI E;  3S4U A;  2UXN B;  3E22 E;  3CPZ A;  5FXZ A;  3K3N A;  4X1K E;  4CI3 B;  3FXE B;  1YW0 A;  2BZB A;  3B13 A;  1WLX A;  3N9M A;  3OYZ A;  4GIW A;  4ILU A;  2YIN A;  3RRC A;  5DQW A;  2I59 A;  1MIV A;  2K48 A;  3IEE A;  3PDY A;  3ZMS B;  2D0U A;  5F8P A;  2K9A A;  5H6R B;  3EUH A;  3I9W A;  3C4Z A;  2V7L A;  3ZMZ B;  4IE6 A;  4KUM B;  4DBQ A;  5EK4 A;  2N2N A;  3N9P A;  5LHH B;  2C5I T;  3OJA A;  2EHO B;  4HTE A;  2KND A;  3WAJ A;  4GK5 E;  2WBL A;  4JEU B;  5JDQ A;  2NTY A;  5L3G B;  4ERR A;  2W61 A;  2CXD A;  3O4X E;  5DQV A;  4BAY B;  4UXN B;  4JUY A;  3L3P A;  3KV6 A;  3EDV A;  2X67 A;  2E8I A;  1U5P A;  4YFS A;  1HX8 A;  4AQF A;  3RKO A;  3LK4 2;  2V7M A;  3HR0 A;  3KIN B;  5EZY E;  3RYH E;  3WAK A;  2W00 A;  2L8K A;  2Q9Q C;  2LSJ A;  2KZ7 B;  2XUE A;  4QXB B;  5FXW A;  2CXF A;  4EZ4 A;  1Y64 B;  4B6X A;  4EOZ B;  5J1G A;  3HKC E;  5JDL A;  3ANW B;  1FMV A;  4AI6 A;  2CWO A;  4PK6 A;  1BR0 A;  2WWU A;  5IYZ E;  5LJM A;  1G73 A;  5KX5 E;  3FBZ A;  2VKH A;  1SHZ C;  1US7 B;  2E9X A;  2YU2 A;  2XQY A;  4TV8 E;  2H7V C;  4H9S E;  4AKG A;  3LJC A;  2OA5 A;  3KBT A;  5L3C B;  2XTL A;  5C8Y E;  4YJ2 E;  4MHC A;  1MND A;  2V7J A;  3AA0 B;  1MMG A;  3P7I A;  5L2L A;  4MLK A;  3FB2 A;  3L09 A;  3N2O A;  2DNX A;  4CQI A;  3SOL A;  2GK9 A;  4P0B A;  3QC9 A;  2Z6E A;  4HKA A;  3ANW A;  5FXV A;  3D0T A;  5LG4 A;  1WRD A;  3CQG B;  4CXX A;  4UV8 B;  2ODU A;  4G2A A;  3KDS E;  3NRX A;  3KV5 A;  3J9X 1;  3HI2 A;  3I0Q A;  4E7S A;  3E0Z A;  4IE5 A;  4OK0 A;  5LA6 E;  4FJO A;  5JDH A;  3FHN A;  2V7K A;  3N2K E;  2NWB A;  2KLQ A;  5JRC A;  4GYR A;  4WW0 A;  4BJN A;  1VOM A;  2N9D A;  4PK4 A;  2DCF A;  3UUL A;  2D5U A;  2XAH B;  3U78 A;  2WM9 A;  3C51 A;  1CUN A;  4NUU A;  4TV9 E;  5LBM A;  3O9X A;  5JRE A;  3N2G E;  2Q9Q D;  4YHJ A;  3F2E A;  5FYM A;  3RPU A;  1KNZ A;  4IST A;  4ADZ A;  5LXT E;  1HTJ F;  2NTX A;  1MMD A;  1D0Z A;  4PFO A;  3PUQ A;  4HN9 A;  5L3E B;  3LK2 B;  3MKD A;  3RH3 A;  3CML A;  4E7Z A;  2JPF A;  3MAC A;  1FIO A;  4XAX B;  4QX7 B;  2JMH A;  4OYK A;  2KT9 A;  4EB6 E;  1LVF A;  5E0O A;  3W15 B;  4ZI3 C;  3HL6 A;  3CVR A;  2H3R A;  2VKO A;  2ZM8 A;  2EHO D;  2NP9 A;  5L3D B;  4I55 E;  3A5X A;  2LM9 A;  3U3I A;  5LGT B;  2H7O A;  4O2B E;  4U72 A;  4H63 V;  2A2F X;  5LHI B;  3DTO A;  1D0X A;  2LSK A;  3HKE E;  4QX8 B;  4UIG A;  5HYA A;  5JR9 B;  3MA9 A;  4EIW A;  4OHF A;  2E9X B;  5FY1 A;  2YU1 A;  2KIN B;  4AQG A;  5JQG E;  3I9Y A;  4PAG A;  4Z8X A;  4A56 A;  5L3B B;  3ONX A;  1V9D A;  3PTR B;  5KDM C;  3UUX B;  4AXP A;  3ZEF B;  2CLY B;  1LVK A;  3ZCJ A;  3O1I A;  4QHO A;  2LJL A;  2PBI A;  3JC6 C;  4IGU A;  3LFM A;  3C98 B;  2PJQ A;  4X1Y E;  3IBP A;  2NW8 A;  4QKN A;  3RRW A;  3RX6 A;  2RP4 A;  3N9Q A;  3AAI A;  4HFV A;  2B1E A;  4M1P A;  4QXH B;  4HGA A;  3LBX A;  1MNE A;  3UTK A;  4ZI7 E;  3LBX B;  4H9Q C;  4PJJ A;  2W0G A;  2D2S A;  4TUY E;  1UX4 A;  1NWM X;  2HPL A;  4UEL A;  3CQC B;  1WYB A;  4MAL A;  3ZYM A;  2VK9 A;  3ZPO A;  1WR6 A;  3FBL A;  3J7Y q;  1IJ6 A;  3I0O A;  3Q5W A;  4QWN B;  2NW9 A;  4EZH A;  4U74 A;  2X9W A;  3ESL A;  5CA1 E;  5LBQ B;  1ZEE A;  2ZMA A;  2QGS A;  5JVD E;  2K5B B;  1YKH B;  4DBR A;  3C50 A;  1E1H B;  1YD8 G;  2XAQ B;  2VKD A;  1BR2 A;  4IDZ A;  4DO0 A;  3SRZ A;  5HAX A;  5ETW A;  5FXX A;  4WBO A;  2NW7 A;  1UCU A;  2VKJ A;  4JEH B;  5LOV E;  2ES0 A;  3CQX C;  5FNV E;  5LP6 E;  3HA4 A;  2HPJ A;  3V5U A;  4EYU A;  2LOP A;  4IHJ E;  1LRZ A;  2DLR A;  4DVD A;  3WI3 A;  3RC8 A;  4L0R A;  3C4W A;  3ZC1 A;  1X79 A;  2CE7 A;  3C64 A;  2HH7 A;  2SPC A;  2X66 A;  2V26 A;  4ZI2 D;  1Z0P A;  3ZYK A;  4O4J E;  1D1C A;  1O3X A;  1YKE B;  3R84 B;  5LGN B;  4KMC A;  3ZJ1 A;  4PW8 A;  1OXZ A;  2CXL A;  2E9X C;  4DMW A;  4JLE A;  3Q9D A;  2JRK A;  5DJQ C;  3GN5 B;  1FMW A;  5LNK A;  2CA5 A;  3H3A A;  4ISS A;  3FXD B;  2V1D B;  3UUM A;  3PUR A;  4BA9 A;  4PK5 A;  4L5G A;  3Q2M A;  4K0U A;  5IHY A;  4CI2 B;  3VU7 H;  3CX8 B;  5JDF A;  3N9O A;  4XZC A;  1QSD A;  3PU3 A;  4C90 A;  3KV4 A;  3KFW X;  5ADX L;  4ZS2 A;  3NZP A;  1HS7 A;  5HXS A;  1U4Q A;  4J2C A;  3JC6 D;  2LSI A;  2DWK A;  2M67 A;  2C5J A;  5A1L A;  2YEV C;  2L9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...