3ZC1A

Crystal structure of afc3po
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
190
structure length
190
Chain Sequence
MRLEECRKRLEELEAAREELLKVLREMRIHSTKSIALIHAGKVEEAEQELKKAIELLEKVKAYREYPEIYFYLCNDAMQELVEAIAFKNAISGEFTFEIDLEVTPAAFLNGFADAVGELRRYALTKLIEGDFKSAERMLEVMEKIYERLMEFTTFPDKLVSGLRKKLDVARGGIERTKSDYIAAKVARLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFTRAX
publication title Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 73
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3zc1A00
3ZC1A 5JR9C 3ZC0A 5JR9B 5JR9A 5JRCB 5JRCA 5JREA
chains in the Genus database with same CATH superfamily
2CCQA 1XWMA 3PU3A 1VOMA 5AQVB 4U7YA 3AVSA 3MJXA 3ZC0A 4ZZBA 3KFWX 4OYKA 2VKDA 2J1DG 2R6GF 3VKGA 3N2GE 2RA1A 4X1IE 3RQUA 2D5UA 5LBQB 4DV1T 4LF7T 5AQJB 2BKNA 4DR2T 2XQ3A 4PFPA 3A8YC 1E1HB 1LRZA 3RRCA 4QX7B 2IC6A 3K3NA 2JQKA 3NZQA 4CXWA 4YJ2E 5JR9A 4U7IA 3K8PC 3L8RA 4DUYT 4H63V 4Q25A 3FZHB 2WMOA 4FJOA 4Z90A 2EHOD 3E22E 2WDVA 1I6ZA 4TV9E 2W61A 4AQFC 3AB3B 2XQ4A 2XAJB 4A97A 3ZMZB 4DVDA 5C2TA 5JDGA 3LBXB 4EGWA 4EV6A 3ETVA 4DR1T 4H9NC 4H9OC 2FBWA 4NXMT 1KEYA 2IUBA 4K0UA 3Q5XA 3AE9A 5FMNA 1HCIA 4LF8T 5LGTB 2CWOA 4HFIA 3KV4A 3H3MA 1XDPA 3QOFA 5LJNA 5FYMA 4GKKT 3CVRA 5LB7B 4KUMB 3AE3A 1S94A 5AQRB 1WCRA 3RYFE 5AQOB 4DV5T 1GQEA 4AKLA 3AEGA 4QKNA 4LMLA 3PUSA 3FZLB 4IIJE 3ONLC 1JNZA 4J2CA 4ANJA 2MTQA 4EIWA 3BQLA 1D1BA 4UIGA 2WZIA 2WDRA 3KBTA 3ZMUB 4DV0T 2QVAA 2E9XC 4BJMA 4YT0A 2IC9A 4BA9A 2V6XA 1U5PA 5DQWA 4OX9T 2KZ7B 4DR3T 2GK9A 3TLSA 3VRBA 2XM2A 2CXDA 2K48A 3E08A 3KINB 1IBLT 3MA9A 1KK7A 3UTKA 3UU5A 3ZYMA 5LHIB 5L2LA 5FY7A 4LF6T 4IE4A 5LG4A 3F57A 2H89A 4JLEA 4A56A 4P0BA 3OKQA 3ONJA 3IA3A 2W62A 4UV8B 5HEJA 4EEBA 4OYJA 3P4SA 4IE6A 1YQ3A 3G06A 3Q5WA 3AA7B 3UU4A 2Y8DA 2XASB 3A5XA 1XZYA 3AVRA 2IW5B 4TNVA 2L8KA 2DLRA 4EZHA 3UQ4A 2JQQA 1FIOA 3B13A 1JNRA 3EVYA 1WRDA 3RYIE 2XAFB 4IDNA 3Q5DA 4CI1B 3RLFF 3AXJB 2VKHA 2WWVA 2L9QA 3AA1B 4N78D 5C8YE 1YKHB 4JEUB 4JYAT 4HN9A 3ZT7A 4KMCA 2WB5A 3UUXB 3B5MA 3RRWA 5JDFA 3ZMTB 4G2AA 2KSRA 1YXRA 2V7MA 3UU3A 4UXNB 5HXSA 4YHHT 2DWKA 2BG9B 3KV6A 4EEDA 3CPZA 4P1NA 3ZSTA 2FJAA 2I0MA 3QC9A 5AQSB 2LKHA 5J2TE 3ESLA 3AE2A 1YD8G 1OXZA 2FUPA 2A72A 2YDRA 1HG5A 4KP3C 4I50E 2LSIA 5KXJA 4CN4A 2JIWA 5TAOA 2X9YA 2DCFA 1XDOA 3AA0B 4GYSA 4JI3T 1IZNB 3AE1A 1YQ4A 1NWMX 3UULA 3ZKRA 2Z6EA 2VWAA 3N9QA 4ZEYA 4X66T 2CE7A 2F4VT 1T8BA 5DABA 3I1AA 2BVMA 4AKIA 1HX8A 1OWAA 2BG9E 3Q2MA 3KVBA 3P8CD 1HF8A 4WBNE 2YDSA 2V7KA 4JEHB 1NAFA 4JUYA 1L0VA 3AE6A 1KFYA 4CN1A 2X0YA 2QRXA 4ZI3C 4CI3B 5HCMA 4PK4A 2WWUA 5J2UE 4ZOLE 2X67A 4U74A 2SPCA 2M6IA 3RYCE 3S4UA 4JV5T 2CEAA 3NKZA 4AISA 4XAXB 1J5ET 2PBIA 1ZV4X 4TWFA 4YTPA 3GMIA 2NW8A 3RYHE 5FP3A 5KX5E 4MALA 3MACA 2V8SV 1QLBA 2LEHA 3CQCB 3SWHA 3B57A 1E7PA 2J47A 4A98A 2E2AA 3PUWF 2BDEA 3RIUA 5JQGE 4YSXA 2J4GA 3LDQB 2KWIB 2CBJA 1FEWA 3NRYA 3PUYF 3UU8A 2EHOC 2VURA 3U3IA 3KVAA 2ZMAA 1AJ3A 3MZKB 2X68A 4AKGA 2ES0A 5LJMA 4TUYE 2IAKA 2XSBA 3TLWA 2VL8A 1FMWA 2DWGA 1D0YA 1WYCA 2WAUA 5ABFB 2Q9QB 1CUNA 5AQHB 5L3BB 3ZYKA 4JI7T 2KWHA 5FNVE 2X9XA 2PTFA 2BKPA 2PG8A 5L47A 4C91A 2V1DB 4AXPA 3Q9DA 3AXJA 4CZZB 3EUHA 1MIWA 3FZMB 3SRZA 3I0QA 4HFVA 3X1DA 3RKOA 2J62A 1ZEEA 1X9BA 1VCTA 5L4HA 3SFEA 2KNDA 4HGAA 5HEOA 4HWIB 3OJAA 2BG9A 4JI6T 2XHEB 3N9NA 3EABA 2YU2A 3WAJA 3N9OA 2WBLA 1MMAA 5BR8T 5JDMA 2LOSA 4I0UA 4X1KE 2NTYA 1WLXA 5HEGA 2IMLA 2XQ9A 3ZMSB 1G73A 3P7IA 5HWXA 1H7CA 5CA1E 2V26A 3I9WA 4QXBB 3ZN0B 4QXCB 2OLTA 5ABEA 1WR0A 4ZHQE 5JDQA 2QA7A 4GK5E 3TLVA 4DR4T 4OFZA 4COFA 3P4PA 5AQPB 2BBHA 1MMNA 2XSAA 2N1GA 2OA5A 1UURA 4YHJA 2VQFT 4YSZA 2JRKA 5FL1A 2WDQA 2KMFA 4O4JE 1UK5A 5ABGA 3UFGA 2XPKA 4K0KT 2B76A 1IBMT 4YFSA 3BQKA 4X20E 4XZCA 2YN6A 3PJAA 2PFVA 4DO0A 3RQWA 3C4WA 1Z0PA 2OV9A 2CHNA 4ILAA 1DU2A 3IHRA 3DTOA 2CA5A 2W4XA 2BBJA 2HN1A 5DQVA 5IUXA 1U4QA 2JQHA 4DR6T 3ETUA 2V7JA 4IE7A 2X9HA 2CHOA 2IDOB 3AEBA 4JI2T 3V5SA 4O8SA 5J0ZA 2E5LT 4KHPT 2E9XB 4AKRB 3RH3A 3UQ7A 4E7ZA 2H3RA 2KINB 3AE8A 3JAEA 3HR0A 2D0TA 4O4IE 2JQ9A 3NWIA 3AA6B 2X9WA 3RIAA 3PUVF 3C4ZA 3CKDA 2CM0A 4IE0A 5JRCA 5JDLA 1T98A 4JI5T 3ZYLA 5ABFA 3AAEB 4UVBB 3RGLA 2Q9QA 5LYJE 5EK2A 4DNDA 1B7TA 3JCFA 5HXCA 3N2KE 4ILBA 1FJGT 5F3JA 3N9LA 4PAGA 4QH5A 2C0SA 2BS2A 2D2SA 4DV7T 2YU1A 3RIFA 4IHJE 3PUAA 4O2AE 5HEUA 4IL4A 3K3OA 5HXRA 5LGNB 4U2ZA 4B6XA 4IDQA 2DI4A 3QUJA 4IDZA 4CQIA 2UUBT 2ZM2A 4G63A 1D1CA 3ZLIA 2K9AA 3ONXA 3LK2B 4EOZB 3BQIA 1MMDA 2WS3A 4ISSA 4YJ3E 2HHHT 1OEDC 4NPPA 3P4QA 2DHRA 4EAHA 2VB6A 4DUZT 1HNXT 5F5WA 2H7OA 4HWFA 4ILCA 1VCSA 2CLYC 2MAWA 5L4EA 3SOLA 5LHHB 2MPKA 4BAYB 2H7VC 4IDPA 5AQKB 2NTXA 5L3GB 2JMKA 2WY2A 2W67A 4AQYT 2FJBA 2I59A 4LFAT 4WBOA 4M1PA 2WSSV 4AQGA 1HS7A 2C5IT 4YXDA 2FJEA 4H63H 4I43B 5FVLA 3UUMA 4AQFA 5LNKA 1ZHCA 2UXNB 4UR9A 5ADXL 2NW9A 4QX8B 4HFHA 2KXPB 2NP9A 2CPTA 2XQYA 4O4LE 3AAAB 5CJ5A 1US7B 5IHYA 4PJNA 2VK9A 1T7SA 5L3EB 2HPJA 1Y01A 3JC6D 1N33T 2NR4A 2BS3A 2YKSA 4PFOA 2W0GA 3LFMA 3HKEE 2ZM8A 2M67A 3IEEA 4QHOA 3ZT6A 1IJ5A 1KNZA 4LF9T 4HWHA 1O3XA 3JAFA 2LE8A 5HYAA 4LFBT 4EYUA 4YY3T 3C64A 3EI0A 2XQ7A 4TV8E 3BK9A 1N36T 3ABVA 3ZJ1A 3PURA 2YK0A 3CX7B 4YSYA 5EK4A 2YDQA 5ETWA 4H9PC 2LSYA 3L09A 4PK5A 3WI3A 4GK0E 2W00A 4X1YE 5H6RB 3CQXC 4O2BE 2IIUA 2K5BB 5H6QB 3H3AA 5AQQB 4UVAB 3R84B 2E9XA 4U72A 3U78A 4L5GA 1YKEB 4KBMB 5JR9C 4IE5A 3H37A 3LK3B 2H88A 3M3ZB 3OBVE 2VL0A 2CXLA 4DR5T 2BKOA 2N9DA 3MKDA 3F31A 2RP4A 2JJ9A 1D0ZA 4AIUA 5M4YA 4JI8T 2VQET 2LKGA 3CQGB 3GN5B 4LF5T 5ABHA 3CK6A 4PW8A 2XTLA 3RC8A 1ZKEA 3O4XE 4EXTA 4HKAA 2I6HA 4WNKA 3VKHA 4HFDA 5FY1A 4HWDA 1X79A 5AQMB 4L0RA 2Y6XA 1SHZC 4JI1T 5FY0A 2BVLA 2XQ8A 4GYRA 3P4RA 1QSDA 2MOZA 3AEFA 5C3JA 3FZKB 5JRCB 4LMJA 3PUXF 4QWNB 2G0UA 4PJMA 3J7Yq 4I55E 4DBRA 3O9XA 4DR7T 1UUSA 5IWAT 5J1GA 2WZHA 4YTMA 1KNPA 5LOVE 1W9RA 4HE8A 5CA0E 5CFBA 4P09A 3AEDA 4ERRA 1M7KA 3HI2A 3HKCE 4ZS3A 4DMWA 3O1JA 4TZ4C 2DL1A 2V7LA 3ZN1B 3TLTA 1M62A 3ZC1A 3ZCIA 3O1IA 5FXXA 5FL0A 1E2AA 4B3RT 4NUUA 1SUMB 3ZT5A 2BS4A 5JVDE 5FKYA 2UXCT 3ZEFB 1HTJF 4IREA 2WMNA 2LM2A 3UT5E 2XUEA 4PJJA 2E8IA 4NXNT 2RPAA 2QGSA 5AFUL 1W0AA 2HN2A 5HWYA 5FVKA 3T1YT 3EAMA 5IYZE 3FBLA 1R8IA 2A3DA 4A5XA 3M65A 4IT4A 4QH1A 5HAXA 3ZJ2A 2YEVC 4HFCA 5AQNB 4I4TE 2X0HA 4U33A 4ISTA 4ZI2D 1HR0T 3N5LA 3GWHA 4TWDA 3DP7A 3PU8A 4ASKA 3AE7A 5LHGB 5AQIB 3T1HT 5HEHA 2CBIA 4DV4T 5GONE 5JH7E 2LLYA 3OPCA 4GKJT 4V1Av 4KHZF 5LMUT 3O1HA 5AQGB 2UXDT 3PUZF 2K3WA 3LSVA 2A9UA 2VKJA 1SA0E 4H9SE 5BMVE 2LSJA 3FXDB 5KDMC 4DV6T 2HH7A 2ZM6T 3R6NA 4NUVA 1WFDA 1J1JA 3N9PA 3RI5A 4DIDB 3VHLA 2CXFA 2MBGA 3WAKA 1BR4A 3I9YA 3ANWB 2X51A 2CMRA 4X64T 3UFEA 2UUAT 3RX6A 5FXVA 1IJ6A 2XY8B 2JMHA 5L3CB 3PUGA 2C5KT 1G8XA 2UXBT 3GN5A 1D0XA 3C50A 2UU9T 2K24A 4IDOA 1ZOYA 2EHOA 4GOUA 2LT3A 4TWHA 3TKLB 5A1LA 3P50A 3HKDE 4X5TA 4TX5A 2LOPA 2Y48B 2Q9QD 3PV0F 2AE9A 1HG2A 2LRKA 2LSKA 3MXZA 2LHRA 5JREA 2NOXA 2XQAA 3QB5K 4WYVA 3JC6C 2XJ7A 3NBXX 4F8HA 3LJCA 3A7MA 5EK3A 3I0OA 3FBZA 4HWCA 4U3CA 2D9DA 2C5JA 3J9X1 3CX8B 2W66A 4MBQA 5CGMA 4KX6A 4AI6A 1QUUA 2VVNA 3C98B 5LA6E 3QK6A 4QXHB 2YINA 3VR8A 3VU7H 3NRXA 3Q5EA 4NIQA 5AQUB 3P4WA 4DBQA 3L3PA 4U31A 3HA4A 4U2YA 1N32T 3PDYA 3CMLA 3FXEB 4F6RC 1OEDB 3D0TA 1CHUA 3NVOA 1UGOA 2E5VA 3PJAJ 2W63A 4JBWF 4CXXA 1I94T 1HX1B 2CLYB 3E0ZA 3ZPOA 2IHR1 2WQYA 4LMKA 2QYWA 3N9MA 5DJQC 4LFCT 3RIUC 2V7IA 1XMOT 3RKGA 4TNWA 2VVSA 1MNEA 5LXTE 3EHZA 4X65T 4WZXA 2ZM0A 3N2OA 2V6YB 4HTEA 2JPFA 1VRBA 3T8OA 3KV9A 3CIRA 3FB2A 4PJLA 3V5UA 1YW0A 1Z8UA 3C4XA 3L39A 4LF4T 4L9IA 2KLQA 2CRBA 1BR2A 2ODVA 1UCUA 4QH4A 4E7SA 2NWBA 2VKOA 4Z8XA 1OEDE 2XM1A 2BZBA 4B3MT 4YLHA 2N2NA 1XMQT 2XZEA 3JADA 3K3QC 2XAGB 3FZFB 4WW0A 4JI4T 3RF1A 5LGUB 2CWYA 3W15B 4OK0A 3DJBA 4UF0B 3AEEA 5LP6E 5EZYE 4EYYR 4ZS2A 4GIWA 4ZZCA 2FJDA 4B3ST 2BG9C 2NW7A 2ACXA 4C90A 1BR1A 4YTNA 3AECA 1LVKA 2LSGA 3C51A 5JDNA 1XNRT 4EB6E 1NENA 2E9XD 4O4HE 1W09A 4UELA 5E0OA 1EZ3A 3LBXA 3EDVA 4MLKA 3TLUA 1FMVA 2HPLA 3UUBA 1KNRA 3ANWA 1BR0A 4IGUA 4ILUA 3RHWA 4IL9A 3ZMVB 1D1AA 1MIVA 2V5CA 3KBUA 2LRLA 2W2UA 1LKXA 4ZI7E 5JR9B 1SE7A 1HFAA 5L3DB 3EDUA 4KI0F 4XBFB 1V9DA 1NEKA 3PE0A 3AE4A 4P0AA 1WYBA 3OVUA 3ZSSA 3OTOT 3UUNA 3CWZB 2M6BA 5FXWA 4H9RC 2V5DA 5JDHA 2KT9A 5LCYA 3UU6A 2XAHB 5KMGP 4UEMA 1MNDA 2WCAA 3PTRB 2WU5A 2ZLYA 1KF6A 3RC3A 5LBMA 5AQTB 4BJNA 3RPUA 2A2FX 3ZCJA 5HXHA 2EHOB 1WR6A 5F8PA 4ZI2C 4DV2T 1MIYA 3KDSE 2VASA 2WM9A 2XAQB 3LG7A 3QNUA 1XNQT 1MMGA 2LM9A 1J5WA 2UXXB 2LJLA 4DV3T 2X0LB 3QB5A 5CB4E 3KV5A 5LMNT 4Z91A 5JTGA 3SFDA 5AQFB 4ADZA 1OEDA 3HKBE 4AKHA 5L3FB 3FHNA 1Y64B 5FXZA 1W0BA 1S35A 1UX4A 2MYSA 4FI5A 1UX5A 4DMVA 2ACZA 3OYXA 4CXYA 2DNXA 3K1SA 3HL6A 3CX6B 3MK7C 2ODUA 3NZPA 5HCJA 3OYZA 1IAPA 2B1EA 1HNWT 1IBKT 2PJQA 4CN6A 4MHCA 4CI2B 2YOEA 1ZP0A 4MFRA 2XQ5A 2V6YA 4X62T 5LG3A 5HXEA 1HNZT 4EZ4A 2L3LA 4OHFA 2Q9QC 4UVCB 3VR9A 3LK42 3SS1A 4ZXLA 2WU2A 1LVFA 4HFBA 4PK6A 2AXDS 4HFEA 2D0UA 1T72A 3IBPA 4HEAA 1N34T 5AQLB 4JI0T 2LHNA 4TN7B 3PUQA 2P9BA 3AE5A 4UV9B 3VRAA 3AAIA 2XQ6A 2X66A 3IF8B 4PNIA 2UUCT 4ZI3D 2WP9A 4UF0A 4B3TT 4H9QC 3AEAA 3GA8A 3F2EA
chains in the Genus database with same CATH topology
2CCQA 4H63H 3PU3A 1VOMA 3NBXX 4I43B 3UUMA 2LEHA 3LJCA 5EK3A 4AQFA 3I0OA 3CQCB 5LNKA 3AVSA 1ZHCA 2UXNB 3FBZA 3MJXA 3ZC0A 5ADXL 3SWHA 2NW9A 3B57A 4QX8B 3KFWX 4OYKA 2KXPB 2NP9A 2C5JA 3J9X1 3CX8B 2XQYA 2VKDA 2J1DG 4O4LE 4MBQA 3VKGA 3AAAB 2BDEA 3N2GE 5JQGE 2RA1A 4X1IE 2D5UA 4AI6A 1US7B 5IHYA 1QUUA 4PJNA 5LBQB 2VK9A 2KWIB 5L3EB 2HPJA 3C98B 5LA6E 3JC6D 1FEWA 3QK6A 4QXHB 4PFPA 3NRYA 1E1HB 2YINA 1LRZA 3RRCA 4QX7B 2EHOC 3U3IA 3VU7H 3KVAA 3NRXA 4PFOA 2ZMAA 1AJ3A 2W0GA 3LFMA 3HKEE 3MZKB 2X68A 2IC6A 3K3NA 4AKGA 2ES0A 2M67A 2ZM8A 3IEEA 3NZQA 5LJMA 4TUYE 4DBQA 4CXWA 4QHOA 3L3PA 4YJ2E 2IAKA 5JR9A 1IJ5A 1KNZA 3K8PC 2VL8A 3HA4A 1FMWA 2DWGA 1O3XA 1D0YA 1WYCA 2WAUA 3PDYA 3CMLA 4H63V 2LE8A 5HYAA 3FXEB 4F6RC 2WMOA 4EYUA 3C64A 2Q9QB 1CUNA 3D0TA 4TV8E 4FJOA 5L3BB 3BK9A 3ZYKA 2EHOD 3E22E 3ZJ1A 2KWHA 3PURA 5FNVE 2W63A 2X9XA 2YK0A 4TV9E 3CX7B 5EK4A 2W61A 4AQFC 3AB3B 4CXXA 2XAJB 5ETWA 2PG8A 4H9PC 4C91A 2LSYA 3L09A 3ZMZB 2V1DB 4AXPA 4DVDA 5JDGA 3LBXB 2CLYB 3E0ZA 3Q9DA 3ZPOA 4PK5A 3ETVA 3WI3A 4CZZB 5DJQC 3N9MA 3EUHA 1MIWA 4GK0E 4H9NC 4H9OC 2W00A 4K0UA 4X1YE 5H6RB 3SRZA 3Q5XA 3CQXC 3I0QA 2K5BB 4HFVA 2V7IA 4O2BE 5H6QB 5FMNA 1HCIA 3RKOA 3H3AA 4UVAB 5LGTB 2CWOA 3R84B 2E9XA 3KV4A 1MNEA 1ZEEA 5LXTE 4U72A 5LJNA 5FYMA 2KNDA 3U78A 4HGAA 4L5GA 2ZM0A 3CVRA 3N2OA 1YKEB 3OJAA 4KBMB 5JR9C 4HTEA 2JPFA 1VRBA 4IE5A 3H37A 3T8OA 3KV9A 4KUMB 3FB2A 3LK3B 1S94A 4PJLA 3V5UA 3OBVE 2XHEB 3N9NA 3RYFE 1YW0A 2YU2A 2CXLA 3C4XA 3WAJA 3N9OA 4L9IA 4AKLA 2WBLA 1MMAA 2KLQA 2N9DA 4QKNA 3MKDA 5JDMA 2LOSA 3F31A 2RP4A 1BR2A 2JJ9A 1D0ZA 2ODVA 3PUSA 4IIJE 1UCUA 5M4YA 4E7SA 4J2CA 2NWBA 4X1KE 3CQGB 2VKOA 3GN5B 4ANJA 4Z8XA 2NTYA 2MTQA 4EIWA 1WLXA 3BQLA 4PW8A 2XTLA 1D1BA 1G73A 2BZBA 3ZMSB 4UIGA 3RC8A 3P7IA 4YLHA 1ZKEA 2N2NA 3O4XE 4EXTA 5HWXA 1H7CA 3K3QC 5CA1E 2V26A 3I9WA 3KBTA 4QXBB 4HKAA 2XAGB 3ZMUB 3ZN0B 4WW0A 4QXCB 4WNKA 2E9XC 5LGUB 4BJMA 2CWYA 3W15B 3VKHA 2IC9A 4BA9A 4OK0A 3DJBA 5FY1A 4UF0B 1U5PA 5LP6E 5DQWA 5EZYE 4ZHQE 4EYYR 4ZS2A 2KZ7B 1X79A 5JDQA 4L0RA 4GIWA 2GK9A 2Y6XA 2NW7A 2ACXA 4C90A 1SHZC 2QA7A 1BR1A 5FY0A 4GK5E 2BVLA 4GYRA 2CXDA 2K48A 3E08A 4OFZA 3KINB 1QSDA 3MA9A 1LVKA 2LSGA 1KK7A 2MOZA 3C51A 3UTKA 5JDNA 3ZYMA 4EB6E 5JRCB 5LHIB 5L2LA 5FY7A 2E9XD 4O4HE 4IE4A 1MMNA 4UELA 5LG4A 3F57A 5E0OA 4QWNB 2G0UA 4PJMA 3J7Yq 4JLEA 2N1GA 4I55E 4DBRA 4A56A 2OA5A 3O9XA 4P0BA 1EZ3A 3LBXA 3OKQA 4YHJA 2JRKA 2W62A 5J1GA 3EDVA 4MLKA 5LOVE 2KMFA 4UV8B 4HE8A 1FMVA 5CA0E 2HPLA 4OYJA 4P09A 4O4JE 3ANWA 1BR0A 4ERRA 3HI2A 3HKCE 4IGUA 4ILUA 4ZS3A 4DMWA 3O1JA 3ZMVB 4TZ4C 1D1AA 4IE6A 2V7LA 1MIVA 3Q5WA 3ZN1B 3ZC1A 3KBUA 3ZCIA 1LKXA 3AA7B 4ZI7E 5JR9B 3O1IA 2Y8DA 2XASB 1HFAA 5FXXA 3A5XA 5L3DB 3EDUA 4YFSA 3AVRA 3BQKA 4XBFB 4NUUA 2IW5B 2L8KA 4X20E 4XZCA 2DLRA 4EZHA 2JQQA 1V9DA 5JVDE 1FIOA 3B13A 2PFVA 3EVYA 4DO0A 3PE0A 1WRDA 3RYIE 2XAFB 3ZEFB 3C4WA 4P0AA 1WYBA 1HTJF 4CI1B 1Z0PA 2WMNA 3UUNA 3CWZB 3IHRA 3DTOA 2VKHA 2CA5A 2L9QA 5FXWA 3AA1B 4H9RC 3UT5E 2XUEA 4PJJA 2KT9A 4N78D 5DQVA 5JDHA 5LCYA 2XAHB 5C8YE 5KMGP 4UEMA 1YKHB 1U4QA 4JEUB 2E8IA 1MNDA 4HN9A 2QGSA 5AFUL 3ETUA 2V7JA 4IE7A 2X9HA 3PTRB 3V5SA 2ZLYA 4KMCA 3UUXB 5HWYA 4O8SA 3RRWA 2E9XB 5JDFA 3ZMTB 4AKRB 4G2AA 3RH3A 3RC3A 5LBMA 2V7MA 4E7ZA 4BJNA 3RPUA 5IYZE 4UXNB 2A2FX 2H3RA 3ZCJA 5HXHA 5HXSA 2KINB 2EHOB 3FBLA 2DWKA 1WR6A 5F8PA 4ZI2C 1MIYA 3KDSE 2VASA 3HR0A 2WM9A 2XAQB 3LG7A 2A3DA 3KV6A 1MMGA 2D0TA 2LM9A 3CPZA 4O4IE 3M65A 3AA6B 2UXXB 2LJLA 2X9WA 2X0LB 5HAXA 3QC9A 3C4ZA 5CB4E 3KV5A 3ZJ2A 2YEVC 5J2TE 3CKDA 2CM0A 4IE0A 4I4TE 3ESLA 5JRCA 5JDLA 4ISTA 1YD8G 1OXZA 4ZI2D 1T98A 4ADZA 3ZYLA 3AAEB 2A72A 3HKBE 4AKHA 4UVBB 5L3FB 2Q9QA 3FHNA 1HG5A 3N5LA 5EK2A 5LYJE 4KP3C 1Y64B 4I50E 3GWHA 4DNDA 5FXZA 2LSIA 3DP7A 3PU8A 4ASKA 5LHGB 1B7TA 1S35A 1UX4A 2MYSA 5HXCA 3N2KE 4FI5A 1UX5A 5TAOA 4DMVA 2X9YA 2DCFA 3AA0B 4GYSA 3OYXA 5GONE 5JH7E 4CXYA 5F3JA 2DNXA 1IZNB 3N9LA 3HL6A 1NWMX 4PAGA 3CX6B 3UULA 2C0SA 2D2SA 4V1Av 2Z6EA 2YU1A 3MK7C 3O1HA 4IHJE 2ODUA 3NZPA 2VWAA 3PUAA 4O2AE 3OYZA 1IAPA 2B1EA 2VKJA 1SA0E 3K3OA 4H9SE 3N9QA 5HXRA 5BMVE 5LGNB 2PJQA 2LSJA 3FXDB 4B6XA 5KDMC 4MHCA 2CE7A 2HH7A 4CI2B 5DABA 2DI4A 3QUJA 4IDZA 3I1AA 2BVMA 4CQIA 4MFRA 3R6NA 2ZM2A 4G63A 4NUVA 4AKIA 1HX8A 1OWAA 1D1CA 3N9PA 3ZLIA 3Q2MA 3KVBA 3P8CD 3VHLA 2K9AA 1HF8A 3ONXA 3LK2B 4EOZB 3BQIA 1MMDA 2CXFA 4ISSA 4YJ3E 2MBGA 4WBNE 5HXEA 2V7KA 4EZ4A 2L3LA 4JEHB 4OHFA 3WAKA 1BR4A 2DHRA 3I9YA 1NAFA 2Q9QC 2VB6A 3ANWB 4EAHA 4JUYA 2X51A 4UVCB 2CMRA 3LK42 3UFEA 3SS1A 2H7OA 3RX6A 5FXVA 1LVFA 1IJ6A 4ZI3C 4PK6A 2JMHA 4CI3B 5L3CB 3PUGA 2C5KT 1G8XA 4PK4A 2WWUA 2D0UA 5J2UE 3GN5A 1D0XA 2CLYC 3C50A 3SOLA 5LHHB 2K24A 4ZOLE 2X67A 3IBPA 2EHOA 2H7VC 2LT3A 4GOUA 4HEAA 4BAYB 4U74A 3TKLB 2SPCA 5A1LA 3HKDE 3RYCE 2NTXA 3S4UA 2CEAA 2JMKA 4TX5A 5L3GB 2LOPA 2Y48B 2LHNA 4XAXB 2Q9QD 4TN7B 2I59A 3PUQA 2P9BA 2PBIA 4UV9B 3AAIA 1ZV4X 4WBOA 2X66A 4M1PA 3GMIA 3IF8B 4PNIA 1HG2A 4ZI3D 2LSKA 2NW8A 2WSSV 3MXZA 3RYHE 4AQGA 4UF0A 2LHRA 5JREA 4H9QC 5FP3A 2C5IT 5KX5E 4MALA 1HS7A 2NOXA 3MACA 3GA8A 3F2EA 3JC6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZC1 A;  5JR9 C;  3ZC0 A;  5JR9 B;  5JR9 A;  5JRC B;  5JRC A;  5JRE A; 
#chains in the Genus database with same CATH topology
 2CCQ A;  1XWM A;  3PU3 A;  1VOM A;  5AQV B;  4U7Y A;  3AVS A;  3MJX A;  3ZC0 A;  4ZZB A;  3KFW X;  4OYK A;  2VKD A;  2J1D G;  2R6G F;  3VKG A;  3N2G E;  2RA1 A;  4X1I E;  3RQU A;  2D5U A;  5LBQ B;  4DV1 T;  4LF7 T;  5AQJ B;  2BKN A;  4DR2 T;  2XQ3 A;  4PFP A;  3A8Y C;  1E1H B;  1LRZ A;  3RRC A;  4QX7 B;  2IC6 A;  3K3N A;  2JQK A;  3NZQ A;  4CXW A;  4YJ2 E;  5JR9 A;  4U7I A;  3K8P C;  3L8R A;  4DUY T;  4H63 V;  4Q25 A;  3FZH B;  2WMO A;  4FJO A;  4Z90 A;  2EHO D;  3E22 E;  2WDV A;  1I6Z A;  4TV9 E;  2W61 A;  4AQF C;  3AB3 B;  2XQ4 A;  2XAJ B;  4A97 A;  3ZMZ B;  4DVD A;  5C2T A;  5JDG A;  3LBX B;  4EGW A;  4EV6 A;  3ETV A;  4DR1 T;  4H9N C;  4H9O C;  2FBW A;  4NXM T;  1KEY A;  2IUB A;  4K0U A;  3Q5X A;  3AE9 A;  5FMN A;  1HCI A;  4LF8 T;  5LGT B;  2CWO A;  4HFI A;  3KV4 A;  3H3M A;  1XDP A;  3QOF A;  5LJN A;  5FYM A;  4GKK T;  3CVR A;  5LB7 B;  4KUM B;  3AE3 A;  1S94 A;  5AQR B;  1WCR A;  3RYF E;  5AQO B;  4DV5 T;  1GQE A;  4AKL A;  3AEG A;  4QKN A;  4LML A;  3PUS A;  3FZL B;  4IIJ E;  3ONL C;  1JNZ A;  4J2C A;  4ANJ A;  2MTQ A;  4EIW A;  3BQL A;  1D1B A;  4UIG A;  2WZI A;  2WDR A;  3KBT A;  3ZMU B;  4DV0 T;  2QVA A;  2E9X C;  4BJM A;  4YT0 A;  2IC9 A;  4BA9 A;  2V6X A;  1U5P A;  5DQW A;  4OX9 T;  2KZ7 B;  4DR3 T;  2GK9 A;  3TLS A;  3VRB A;  2XM2 A;  2CXD A;  2K48 A;  3E08 A;  3KIN B;  1IBL T;  3MA9 A;  1KK7 A;  3UTK A;  3UU5 A;  3ZYM A;  5LHI B;  5L2L A;  5FY7 A;  4LF6 T;  4IE4 A;  5LG4 A;  3F57 A;  2H89 A;  4JLE A;  4A56 A;  4P0B A;  3OKQ A;  3ONJ A;  3IA3 A;  2W62 A;  4UV8 B;  5HEJ A;  4EEB A;  4OYJ A;  3P4S A;  4IE6 A;  1YQ3 A;  3G06 A;  3Q5W A;  3AA7 B;  3UU4 A;  2Y8D A;  2XAS B;  3A5X A;  1XZY A;  3AVR A;  2IW5 B;  4TNV A;  2L8K A;  2DLR A;  4EZH A;  3UQ4 A;  2JQQ A;  1FIO A;  3B13 A;  1JNR A;  3EVY A;  1WRD A;  3RYI E;  2XAF B;  4IDN A;  3Q5D A;  4CI1 B;  3RLF F;  3AXJ B;  2VKH A;  2WWV A;  2L9Q A;  3AA1 B;  4N78 D;  5C8Y E;  1YKH B;  4JEU B;  4JYA T;  4HN9 A;  3ZT7 A;  4KMC A;  2WB5 A;  3UUX B;  3B5M A;  3RRW A;  5JDF A;  3ZMT B;  4G2A A;  2KSR A;  1YXR A;  2V7M A;  3UU3 A;  4UXN B;  5HXS A;  4YHH T;  2DWK A;  2BG9 B;  3KV6 A;  4EED A;  3CPZ A;  4P1N A;  3ZST A;  2FJA A;  2I0M A;  3QC9 A;  5AQS B;  2LKH A;  5J2T E;  3ESL A;  3AE2 A;  1YD8 G;  1OXZ A;  2FUP A;  2A72 A;  2YDR A;  1HG5 A;  4KP3 C;  4I50 E;  2LSI A;  5KXJ A;  4CN4 A;  2JIW A;  5TAO A;  2X9Y A;  2DCF A;  1XDO A;  3AA0 B;  4GYS A;  4JI3 T;  1IZN B;  3AE1 A;  1YQ4 A;  1NWM X;  3UUL A;  3ZKR A;  2Z6E A;  2VWA A;  3N9Q A;  4ZEY A;  4X66 T;  2CE7 A;  2F4V T;  1T8B A;  5DAB A;  3I1A A;  2BVM A;  4AKI A;  1HX8 A;  1OWA A;  2BG9 E;  3Q2M A;  3KVB A;  3P8C D;  1HF8 A;  4WBN E;  2YDS A;  2V7K A;  4JEH B;  1NAF A;  4JUY A;  1L0V A;  3AE6 A;  1KFY A;  4CN1 A;  2X0Y A;  2QRX A;  4ZI3 C;  4CI3 B;  5HCM A;  4PK4 A;  2WWU A;  5J2U E;  4ZOL E;  2X67 A;  4U74 A;  2SPC A;  2M6I A;  3RYC E;  3S4U A;  4JV5 T;  2CEA A;  3NKZ A;  4AIS A;  4XAX B;  1J5E T;  2PBI A;  1ZV4 X;  4TWF A;  4YTP A;  3GMI A;  2NW8 A;  3RYH E;  5FP3 A;  5KX5 E;  4MAL A;  3MAC A;  2V8S V;  1QLB A;  2LEH A;  3CQC B;  3SWH A;  3B57 A;  1E7P A;  2J47 A;  4A98 A;  2E2A A;  3PUW F;  2BDE A;  3RIU A;  5JQG E;  4YSX A;  2J4G A;  3LDQ B;  2KWI B;  2CBJ A;  1FEW A;  3NRY A;  3PUY F;  3UU8 A;  2EHO C;  2VUR A;  3U3I A;  3KVA A;  2ZMA A;  1AJ3 A;  3MZK B;  2X68 A;  4AKG A;  2ES0 A;  5LJM A;  4TUY E;  2IAK A;  2XSB A;  3TLW A;  2VL8 A;  1FMW A;  2DWG A;  1D0Y A;  1WYC A;  2WAU A;  5ABF B;  2Q9Q B;  1CUN A;  5AQH B;  5L3B B;  3ZYK A;  4JI7 T;  2KWH A;  5FNV E;  2X9X A;  2PTF A;  2BKP A;  2PG8 A;  5L47 A;  4C91 A;  2V1D B;  4AXP A;  3Q9D A;  3AXJ A;  4CZZ B;  3EUH A;  1MIW A;  3FZM B;  3SRZ A;  3I0Q A;  4HFV A;  3X1D A;  3RKO A;  2J62 A;  1ZEE A;  1X9B A;  1VCT A;  5L4H A;  3SFE A;  2KND A;  4HGA A;  5HEO A;  4HWI B;  3OJA A;  2BG9 A;  4JI6 T;  2XHE B;  3N9N A;  3EAB A;  2YU2 A;  3WAJ A;  3N9O A;  2WBL A;  1MMA A;  5BR8 T;  5JDM A;  2LOS A;  4I0U A;  4X1K E;  2NTY A;  1WLX A;  5HEG A;  2IML A;  2XQ9 A;  3ZMS B;  1G73 A;  3P7I A;  5HWX A;  1H7C A;  5CA1 E;  2V26 A;  3I9W A;  4QXB B;  3ZN0 B;  4QXC B;  2OLT A;  5ABE A;  1WR0 A;  4ZHQ E;  5JDQ A;  2QA7 A;  4GK5 E;  3TLV A;  4DR4 T;  4OFZ A;  4COF A;  3P4P A;  5AQP B;  2BBH A;  1MMN A;  2XSA A;  2N1G A;  2OA5 A;  1UUR A;  4YHJ A;  2VQF T;  4YSZ A;  2JRK A;  5FL1 A;  2WDQ A;  2KMF A;  4O4J E;  1UK5 A;  5ABG A;  3UFG A;  2XPK A;  4K0K T;  2B76 A;  1IBM T;  4YFS A;  3BQK A;  4X20 E;  4XZC A;  2YN6 A;  3PJA A;  2PFV A;  4DO0 A;  3RQW A;  3C4W A;  1Z0P A;  2OV9 A;  2CHN A;  4ILA A;  1DU2 A;  3IHR A;  3DTO A;  2CA5 A;  2W4X A;  2BBJ A;  2HN1 A;  5DQV A;  5IUX A;  1U4Q A;  2JQH A;  4DR6 T;  3ETU A;  2V7J A;  4IE7 A;  2X9H A;  2CHO A;  2IDO B;  3AEB A;  4JI2 T;  3V5S A;  4O8S A;  5J0Z A;  2E5L T;  4KHP T;  2E9X B;  4AKR B;  3RH3 A;  3UQ7 A;  4E7Z A;  2H3R A;  2KIN B;  3AE8 A;  3JAE A;  3HR0 A;  2D0T A;  4O4I E;  2JQ9 A;  3NWI A;  3AA6 B;  2X9W A;  3RIA A;  3PUV F;  3C4Z A;  3CKD A;  2CM0 A;  4IE0 A;  5JRC A;  5JDL A;  1T98 A;  4JI5 T;  3ZYL A;  5ABF A;  3AAE B;  4UVB B;  3RGL A;  2Q9Q A;  5LYJ E;  5EK2 A;  4DND A;  1B7T A;  3JCF A;  5HXC A;  3N2K E;  4ILB A;  1FJG T;  5F3J A;  3N9L A;  4PAG A;  4QH5 A;  2C0S A;  2BS2 A;  2D2S A;  4DV7 T;  2YU1 A;  3RIF A;  4IHJ E;  3PUA A;  4O2A E;  5HEU A;  4IL4 A;  3K3O A;  5HXR A;  5LGN B;  4U2Z A;  4B6X A;  4IDQ A;  2DI4 A;  3QUJ A;  4IDZ A;  4CQI A;  2UUB T;  2ZM2 A;  4G63 A;  1D1C A;  3ZLI A;  2K9A A;  3ONX A;  3LK2 B;  4EOZ B;  3BQI A;  1MMD A;  2WS3 A;  4ISS A;  4YJ3 E;  2HHH T;  1OED C;  4NPP A;  3P4Q A;  2DHR A;  4EAH A;  2VB6 A;  4DUZ T;  1HNX T;  5F5W A;  2H7O A;  4HWF A;  4ILC A;  1VCS A;  2CLY C;  2MAW A;  5L4E A;  3SOL A;  5LHH B;  2MPK A;  4BAY B;  2H7V C;  4IDP A;  5AQK B;  2NTX A;  5L3G B;  2JMK A;  2WY2 A;  2W67 A;  4AQY T;  2FJB A;  2I59 A;  4LFA T;  4WBO A;  4M1P A;  2WSS V;  4AQG A;  1HS7 A;  2C5I T;  4YXD A;  2FJE A;  4H63 H;  4I43 B;  5FVL A;  3UUM A;  4AQF A;  5LNK A;  1ZHC A;  2UXN B;  4UR9 A;  5ADX L;  2NW9 A;  4QX8 B;  4HFH A;  2KXP B;  2NP9 A;  2CPT A;  2XQY A;  4O4L E;  3AAA B;  5CJ5 A;  1US7 B;  5IHY A;  4PJN A;  2VK9 A;  1T7S A;  5L3E B;  2HPJ A;  1Y01 A;  3JC6 D;  1N33 T;  2NR4 A;  2BS3 A;  2YKS A;  4PFO A;  2W0G A;  3LFM A;  3HKE E;  2ZM8 A;  2M67 A;  3IEE A;  4QHO A;  3ZT6 A;  1IJ5 A;  1KNZ A;  4LF9 T;  4HWH A;  1O3X A;  3JAF A;  2LE8 A;  5HYA A;  4LFB T;  4EYU A;  4YY3 T;  3C64 A;  3EI0 A;  2XQ7 A;  4TV8 E;  3BK9 A;  1N36 T;  3ABV A;  3ZJ1 A;  3PUR A;  2YK0 A;  3CX7 B;  4YSY A;  5EK4 A;  2YDQ A;  5ETW A;  4H9P C;  2LSY A;  3L09 A;  4PK5 A;  3WI3 A;  4GK0 E;  2W00 A;  4X1Y E;  5H6R B;  3CQX C;  4O2B E;  2IIU A;  2K5B B;  5H6Q B;  3H3A A;  5AQQ B;  4UVA B;  3R84 B;  2E9X A;  4U72 A;  3U78 A;  4L5G A;  1YKE B;  4KBM B;  5JR9 C;  4IE5 A;  3H37 A;  3LK3 B;  2H88 A;  3M3Z B;  3OBV E;  2VL0 A;  2CXL A;  4DR5 T;  2BKO A;  2N9D A;  3MKD A;  3F31 A;  2RP4 A;  2JJ9 A;  1D0Z A;  4AIU A;  5M4Y A;  4JI8 T;  2VQE T;  2LKG A;  3CQG B;  3GN5 B;  4LF5 T;  5ABH A;  3CK6 A;  4PW8 A;  2XTL A;  3RC8 A;  1ZKE A;  3O4X E;  4EXT A;  4HKA A;  2I6H A;  4WNK A;  3VKH A;  4HFD A;  5FY1 A;  4HWD A;  1X79 A;  5AQM B;  4L0R A;  2Y6X A;  1SHZ C;  4JI1 T;  5FY0 A;  2BVL A;  2XQ8 A;  4GYR A;  3P4R A;  1QSD A;  2MOZ A;  3AEF A;  5C3J A;  3FZK B;  5JRC B;  4LMJ A;  3PUX F;  4QWN B;  2G0U A;  4PJM A;  3J7Y q;  4I55 E;  4DBR A;  3O9X A;  4DR7 T;  1UUS A;  5IWA T;  5J1G A;  2WZH A;  4YTM A;  1KNP A;  5LOV E;  1W9R A;  4HE8 A;  5CA0 E;  5CFB A;  4P09 A;  3AED A;  4ERR A;  1M7K A;  3HI2 A;  3HKC E;  4ZS3 A;  4DMW A;  3O1J A;  4TZ4 C;  2DL1 A;  2V7L A;  3ZN1 B;  3TLT A;  1M62 A;  3ZC1 A;  3ZCI A;  3O1I A;  5FXX A;  5FL0 A;  1E2A A;  4B3R T;  4NUU A;  1SUM B;  3ZT5 A;  2BS4 A;  5JVD E;  5FKY A;  2UXC T;  3ZEF B;  1HTJ F;  4IRE A;  2WMN A;  2LM2 A;  3UT5 E;  2XUE A;  4PJJ A;  2E8I A;  4NXN T;  2RPA A;  2QGS A;  5AFU L;  1W0A A;  2HN2 A;  5HWY A;  5FVK A;  3T1Y T;  3EAM A;  5IYZ E;  3FBL A;  1R8I A;  2A3D A;  4A5X A;  3M65 A;  4IT4 A;  4QH1 A;  5HAX A;  3ZJ2 A;  2YEV C;  4HFC A;  5AQN B;  4I4T E;  2X0H A;  4U33 A;  4IST A;  4ZI2 D;  1HR0 T;  3N5L A;  3GWH A;  4TWD A;  3DP7 A;  3PU8 A;  4ASK A;  3AE7 A;  5LHG B;  5AQI B;  3T1H T;  5HEH A;  2CBI A;  4DV4 T;  5GON E;  5JH7 E;  2LLY A;  3OPC A;  4GKJ T;  4V1A v;  4KHZ F;  5LMU T;  3O1H A;  5AQG B;  2UXD T;  3PUZ F;  2K3W A;  3LSV A;  2A9U A;  2VKJ A;  1SA0 E;  4H9S E;  5BMV E;  2LSJ A;  3FXD B;  5KDM C;  4DV6 T;  2HH7 A;  2ZM6 T;  3R6N A;  4NUV A;  1WFD A;  1J1J A;  3N9P A;  3RI5 A;  4DID B;  3VHL A;  2CXF A;  2MBG A;  3WAK A;  1BR4 A;  3I9Y A;  3ANW B;  2X51 A;  2CMR A;  4X64 T;  3UFE A;  2UUA T;  3RX6 A;  5FXV A;  1IJ6 A;  2XY8 B;  2JMH A;  5L3C B;  3PUG A;  2C5K T;  1G8X A;  2UXB T;  3GN5 A;  1D0X A;  3C50 A;  2UU9 T;  2K24 A;  4IDO A;  1ZOY A;  2EHO A;  4GOU A;  2LT3 A;  4TWH A;  3TKL B;  5A1L A;  3P50 A;  3HKD E;  4X5T A;  4TX5 A;  2LOP A;  2Y48 B;  2Q9Q D;  3PV0 F;  2AE9 A;  1HG2 A;  2LRK A;  2LSK A;  3MXZ A;  2LHR A;  5JRE A;  2NOX A;  2XQA A;  3QB5 K;  4WYV A;  3JC6 C;  2XJ7 A;  3NBX X;  4F8H A;  3LJC A;  3A7M A;  5EK3 A;  3I0O A;  3FBZ A;  4HWC A;  4U3C A;  2D9D A;  2C5J A;  3J9X 1;  3CX8 B;  2W66 A;  4MBQ A;  5CGM A;  4KX6 A;  4AI6 A;  1QUU A;  2VVN A;  3C98 B;  5LA6 E;  3QK6 A;  4QXH B;  2YIN A;  3VR8 A;  3VU7 H;  3NRX A;  3Q5E A;  4NIQ A;  5AQU B;  3P4W A;  4DBQ A;  3L3P A;  4U31 A;  3HA4 A;  4U2Y A;  1N32 T;  3PDY A;  3CML A;  3FXE B;  4F6R C;  1OED B;  3D0T A;  1CHU A;  3NVO A;  1UGO A;  2E5V A;  3PJA J;  2W63 A;  4JBW F;  4CXX A;  1I94 T;  1HX1 B;  2CLY B;  3E0Z A;  3ZPO A;  2IHR 1;  2WQY A;  4LMK A;  2QYW A;  3N9M A;  5DJQ C;  4LFC T;  3RIU C;  2V7I A;  1XMO T;  3RKG A;  4TNW A;  2VVS A;  1MNE A;  5LXT E;  3EHZ A;  4X65 T;  4WZX A;  2ZM0 A;  3N2O A;  2V6Y B;  4HTE A;  2JPF A;  1VRB A;  3T8O A;  3KV9 A;  3CIR A;  3FB2 A;  4PJL A;  3V5U A;  1YW0 A;  1Z8U A;  3C4X A;  3L39 A;  4LF4 T;  4L9I A;  2KLQ A;  2CRB A;  1BR2 A;  2ODV A;  1UCU A;  4QH4 A;  4E7S A;  2NWB A;  2VKO A;  4Z8X A;  1OED E;  2XM1 A;  2BZB A;  4B3M T;  4YLH A;  2N2N A;  1XMQ T;  2XZE A;  3JAD A;  3K3Q C;  2XAG B;  3FZF B;  4WW0 A;  4JI4 T;  3RF1 A;  5LGU B;  2CWY A;  3W15 B;  4OK0 A;  3DJB A;  4UF0 B;  3AEE A;  5LP6 E;  5EZY E;  4EYY R;  4ZS2 A;  4GIW A;  4ZZC A;  2FJD A;  4B3S T;  2BG9 C;  2NW7 A;  2ACX A;  4C90 A;  1BR1 A;  4YTN A;  3AEC A;  1LVK A;  2LSG A;  3C51 A;  5JDN A;  1XNR T;  4EB6 E;  1NEN A;  2E9X D;  4O4H E;  1W09 A;  4UEL A;  5E0O A;  1EZ3 A;  3LBX A;  3EDV A;  4MLK A;  3TLU A;  1FMV A;  2HPL A;  3UUB A;  1KNR A;  3ANW A;  1BR0 A;  4IGU A;  4ILU A;  3RHW A;  4IL9 A;  3ZMV B;  1D1A A;  1MIV A;  2V5C A;  3KBU A;  2LRL A;  2W2U A;  1LKX A;  4ZI7 E;  5JR9 B;  1SE7 A;  1HFA A;  5L3D B;  3EDU A;  4KI0 F;  4XBF B;  1V9D A;  1NEK A;  3PE0 A;  3AE4 A;  4P0A A;  1WYB A;  3OVU A;  3ZSS A;  3OTO T;  3UUN A;  3CWZ B;  2M6B A;  5FXW A;  4H9R C;  2V5D A;  5JDH A;  2KT9 A;  5LCY A;  3UU6 A;  2XAH B;  5KMG P;  4UEM A;  1MND A;  2WCA A;  3PTR B;  2WU5 A;  2ZLY A;  1KF6 A;  3RC3 A;  5LBM A;  5AQT B;  4BJN A;  3RPU A;  2A2F X;  3ZCJ A;  5HXH A;  2EHO B;  1WR6 A;  5F8P A;  4ZI2 C;  4DV2 T;  1MIY A;  3KDS E;  2VAS A;  2WM9 A;  2XAQ B;  3LG7 A;  3QNU A;  1XNQ T;  1MMG A;  2LM9 A;  1J5W A;  2UXX B;  2LJL A;  4DV3 T;  2X0L B;  3QB5 A;  5CB4 E;  3KV5 A;  5LMN T;  4Z91 A;  5JTG A;  3SFD A;  5AQF B;  4ADZ A;  1OED A;  3HKB E;  4AKH A;  5L3F B;  3FHN A;  1Y64 B;  5FXZ A;  1W0B A;  1S35 A;  1UX4 A;  2MYS A;  4FI5 A;  1UX5 A;  4DMV A;  2ACZ A;  3OYX A;  4CXY A;  2DNX A;  3K1S A;  3HL6 A;  3CX6 B;  3MK7 C;  2ODU A;  3NZP A;  5HCJ A;  3OYZ A;  1IAP A;  2B1E A;  1HNW T;  1IBK T;  2PJQ A;  4CN6 A;  4MHC A;  4CI2 B;  2YOE A;  1ZP0 A;  4MFR A;  2XQ5 A;  2V6Y A;  4X62 T;  5LG3 A;  5HXE A;  1HNZ T;  4EZ4 A;  2L3L A;  4OHF A;  2Q9Q C;  4UVC B;  3VR9 A;  3LK4 2;  3SS1 A;  4ZXL A;  2WU2 A;  1LVF A;  4HFB A;  4PK6 A;  2AXD S;  4HFE A;  2D0U A;  1T72 A;  3IBP A;  4HEA A;  1N34 T;  5AQL B;  4JI0 T;  2LHN A;  4TN7 B;  3PUQ A;  2P9B A;  3AE5 A;  4UV9 B;  3VRA A;  3AAI A;  2XQ6 A;  2X66 A;  3IF8 B;  4PNI A;  2UUC T;  4ZI3 D;  2WP9 A;  4UF0 A;  4B3T T;  4H9Q C;  3AEA A;  3GA8 A;  3F2E A; 
#chains in the Genus database with same CATH homology
 2CCQ A;  4H63 H;  3PU3 A;  1VOM A;  3NBX X;  4I43 B;  3UUM A;  2LEH A;  3LJC A;  5EK3 A;  4AQF A;  3I0O A;  3CQC B;  5LNK A;  3AVS A;  1ZHC A;  2UXN B;  3FBZ A;  3MJX A;  3ZC0 A;  5ADX L;  3SWH A;  2NW9 A;  3B57 A;  4QX8 B;  3KFW X;  4OYK A;  2KXP B;  2NP9 A;  2C5J A;  3J9X 1;  3CX8 B;  2XQY A;  2VKD A;  2J1D G;  4O4L E;  4MBQ A;  3VKG A;  3AAA B;  2BDE A;  3N2G E;  5JQG E;  2RA1 A;  4X1I E;  2D5U A;  4AI6 A;  1US7 B;  5IHY A;  1QUU A;  4PJN A;  5LBQ B;  2VK9 A;  2KWI B;  5L3E B;  2HPJ A;  3C98 B;  5LA6 E;  3JC6 D;  1FEW A;  3QK6 A;  4QXH B;  4PFP A;  3NRY A;  1E1H B;  2YIN A;  1LRZ A;  3RRC A;  4QX7 B;  2EHO C;  3U3I A;  3VU7 H;  3KVA A;  3NRX A;  4PFO A;  2ZMA A;  1AJ3 A;  2W0G A;  3LFM A;  3HKE E;  3MZK B;  2X68 A;  2IC6 A;  3K3N A;  4AKG A;  2ES0 A;  2M67 A;  2ZM8 A;  3IEE A;  3NZQ A;  5LJM A;  4TUY E;  4DBQ A;  4CXW A;  4QHO A;  3L3P A;  4YJ2 E;  2IAK A;  5JR9 A;  1IJ5 A;  1KNZ A;  3K8P C;  2VL8 A;  3HA4 A;  1FMW A;  2DWG A;  1O3X A;  1D0Y A;  1WYC A;  2WAU A;  3PDY A;  3CML A;  4H63 V;  2LE8 A;  5HYA A;  3FXE B;  4F6R C;  2WMO A;  4EYU A;  3C64 A;  2Q9Q B;  1CUN A;  3D0T A;  4TV8 E;  4FJO A;  5L3B B;  3BK9 A;  3ZYK A;  2EHO D;  3E22 E;  3ZJ1 A;  2KWH A;  3PUR A;  5FNV E;  2W63 A;  2X9X A;  2YK0 A;  4TV9 E;  3CX7 B;  5EK4 A;  2W61 A;  4AQF C;  3AB3 B;  4CXX A;  2XAJ B;  5ETW A;  2PG8 A;  4H9P C;  4C91 A;  2LSY A;  3L09 A;  3ZMZ B;  2V1D B;  4AXP A;  4DVD A;  5JDG A;  3LBX B;  2CLY B;  3E0Z A;  3Q9D A;  3ZPO A;  4PK5 A;  3ETV A;  3WI3 A;  4CZZ B;  5DJQ C;  3N9M A;  3EUH A;  1MIW A;  4GK0 E;  4H9N C;  4H9O C;  2W00 A;  4K0U A;  4X1Y E;  5H6R B;  3SRZ A;  3Q5X A;  3CQX C;  3I0Q A;  2K5B B;  4HFV A;  2V7I A;  4O2B E;  5H6Q B;  5FMN A;  1HCI A;  3RKO A;  3H3A A;  4UVA B;  5LGT B;  2CWO A;  3R84 B;  2E9X A;  3KV4 A;  1MNE A;  1ZEE A;  5LXT E;  4U72 A;  5LJN A;  5FYM A;  2KND A;  3U78 A;  4HGA A;  4L5G A;  2ZM0 A;  3CVR A;  3N2O A;  1YKE B;  3OJA A;  4KBM B;  5JR9 C;  4HTE A;  2JPF A;  1VRB A;  4IE5 A;  3H37 A;  3T8O A;  3KV9 A;  4KUM B;  3FB2 A;  3LK3 B;  1S94 A;  4PJL A;  3V5U A;  3OBV E;  2XHE B;  3N9N A;  3RYF E;  1YW0 A;  2YU2 A;  2CXL A;  3C4X A;  3WAJ A;  3N9O A;  4L9I A;  4AKL A;  2WBL A;  1MMA A;  2KLQ A;  2N9D A;  4QKN A;  3MKD A;  5JDM A;  2LOS A;  3F31 A;  2RP4 A;  1BR2 A;  2JJ9 A;  1D0Z A;  2ODV A;  3PUS A;  4IIJ E;  1UCU A;  5M4Y A;  4E7S A;  4J2C A;  2NWB A;  4X1K E;  3CQG B;  2VKO A;  3GN5 B;  4ANJ A;  4Z8X A;  2NTY A;  2MTQ A;  4EIW A;  1WLX A;  3BQL A;  4PW8 A;  2XTL A;  1D1B A;  1G73 A;  2BZB A;  3ZMS B;  4UIG A;  3RC8 A;  3P7I A;  4YLH A;  1ZKE A;  2N2N A;  3O4X E;  4EXT A;  5HWX A;  1H7C A;  3K3Q C;  5CA1 E;  2V26 A;  3I9W A;  3KBT A;  4QXB B;  4HKA A;  2XAG B;  3ZMU B;  3ZN0 B;  4WW0 A;  4QXC B;  4WNK A;  2E9X C;  5LGU B;  4BJM A;  2CWY A;  3W15 B;  3VKH A;  2IC9 A;  4BA9 A;  4OK0 A;  3DJB A;  5FY1 A;  4UF0 B;  1U5P A;  5LP6 E;  5DQW A;  5EZY E;  4ZHQ E;  4EYY R;  4ZS2 A;  2KZ7 B;  1X79 A;  5JDQ A;  4L0R A;  4GIW A;  2GK9 A;  2Y6X A;  2NW7 A;  2ACX A;  4C90 A;  1SHZ C;  2QA7 A;  1BR1 A;  5FY0 A;  4GK5 E;  2BVL A;  4GYR A;  2CXD A;  2K48 A;  3E08 A;  4OFZ A;  3KIN B;  1QSD A;  3MA9 A;  1LVK A;  2LSG A;  1KK7 A;  2MOZ A;  3C51 A;  3UTK A;  5JDN A;  3ZYM A;  4EB6 E;  5JRC B;  5LHI B;  5L2L A;  5FY7 A;  2E9X D;  4O4H E;  4IE4 A;  1MMN A;  4UEL A;  5LG4 A;  3F57 A;  5E0O A;  4QWN B;  2G0U A;  4PJM A;  3J7Y q;  4JLE A;  2N1G A;  4I55 E;  4DBR A;  4A56 A;  2OA5 A;  3O9X A;  4P0B A;  1EZ3 A;  3LBX A;  3OKQ A;  4YHJ A;  2JRK A;  2W62 A;  5J1G A;  3EDV A;  4MLK A;  5LOV E;  2KMF A;  4UV8 B;  4HE8 A;  1FMV A;  5CA0 E;  2HPL A;  4OYJ A;  4P09 A;  4O4J E;  3ANW A;  1BR0 A;  4ERR A;  3HI2 A;  3HKC E;  4IGU A;  4ILU A;  4ZS3 A;  4DMW A;  3O1J A;  3ZMV B;  4TZ4 C;  1D1A A;  4IE6 A;  2V7L A;  1MIV A;  3Q5W A;  3ZN1 B;  3ZC1 A;  3KBU A;  3ZCI A;  1LKX A;  3AA7 B;  4ZI7 E;  5JR9 B;  3O1I A;  2Y8D A;  2XAS B;  1HFA A;  5FXX A;  3A5X A;  5L3D B;  3EDU A;  4YFS A;  3AVR A;  3BQK A;  4XBF B;  4NUU A;  2IW5 B;  2L8K A;  4X20 E;  4XZC A;  2DLR A;  4EZH A;  2JQQ A;  1V9D A;  5JVD E;  1FIO A;  3B13 A;  2PFV A;  3EVY A;  4DO0 A;  3PE0 A;  1WRD A;  3RYI E;  2XAF B;  3ZEF B;  3C4W A;  4P0A A;  1WYB A;  1HTJ F;  4CI1 B;  1Z0P A;  2WMN A;  3UUN A;  3CWZ B;  3IHR A;  3DTO A;  2VKH A;  2CA5 A;  2L9Q A;  5FXW A;  3AA1 B;  4H9R C;  3UT5 E;  2XUE A;  4PJJ A;  2KT9 A;  4N78 D;  5DQV A;  5JDH A;  5LCY A;  2XAH B;  5C8Y E;  5KMG P;  4UEM A;  1YKH B;  1U4Q A;  4JEU B;  2E8I A;  1MND A;  4HN9 A;  2QGS A;  5AFU L;  3ETU A;  2V7J A;  4IE7 A;  2X9H A;  3PTR B;  3V5S A;  2ZLY A;  4KMC A;  3UUX B;  5HWY A;  4O8S A;  3RRW A;  2E9X B;  5JDF A;  3ZMT B;  4AKR B;  4G2A A;  3RH3 A;  3RC3 A;  5LBM A;  2V7M A;  4E7Z A;  4BJN A;  3RPU A;  5IYZ E;  4UXN B;  2A2F X;  2H3R A;  3ZCJ A;  5HXH A;  5HXS A;  2KIN B;  2EHO B;  3FBL A;  2DWK A;  1WR6 A;  5F8P A;  4ZI2 C;  1MIY A;  3KDS E;  2VAS A;  3HR0 A;  2WM9 A;  2XAQ B;  3LG7 A;  2A3D A;  3KV6 A;  1MMG A;  2D0T A;  2LM9 A;  3CPZ A;  4O4I E;  3M65 A;  3AA6 B;  2UXX B;  2LJL A;  2X9W A;  2X0L B;  5HAX A;  3QC9 A;  3C4Z A;  5CB4 E;  3KV5 A;  3ZJ2 A;  2YEV C;  5J2T E;  3CKD A;  2CM0 A;  4IE0 A;  4I4T E;  3ESL A;  5JRC A;  5JDL A;  4IST A;  1YD8 G;  1OXZ A;  4ZI2 D;  1T98 A;  4ADZ A;  3ZYL A;  3AAE B;  2A72 A;  3HKB E;  4AKH A;  4UVB B;  5L3F B;  2Q9Q A;  3FHN A;  1HG5 A;  3N5L A;  5EK2 A;  5LYJ E;  4KP3 C;  1Y64 B;  4I50 E;  3GWH A;  4DND A;  5FXZ A;  2LSI A;  3DP7 A;  3PU8 A;  4ASK A;  5LHG B;  1B7T A;  1S35 A;  1UX4 A;  2MYS A;  5HXC A;  3N2K E;  4FI5 A;  1UX5 A;  5TAO A;  4DMV A;  2X9Y A;  2DCF A;  3AA0 B;  4GYS A;  3OYX A;  5GON E;  5JH7 E;  4CXY A;  5F3J A;  2DNX A;  1IZN B;  3N9L A;  3HL6 A;  1NWM X;  4PAG A;  3CX6 B;  3UUL A;  2C0S A;  2D2S A;  4V1A v;  2Z6E A;  2YU1 A;  3MK7 C;  3O1H A;  4IHJ E;  2ODU A;  3NZP A;  2VWA A;  3PUA A;  4O2A E;  3OYZ A;  1IAP A;  2B1E A;  2VKJ A;  1SA0 E;  3K3O A;  4H9S E;  3N9Q A;  5HXR A;  5BMV E;  5LGN B;  2PJQ A;  2LSJ A;  3FXD B;  4B6X A;  5KDM C;  4MHC A;  2CE7 A;  2HH7 A;  4CI2 B;  5DAB A;  2DI4 A;  3QUJ A;  4IDZ A;  3I1A A;  2BVM A;  4CQI A;  4MFR A;  3R6N A;  2ZM2 A;  4G63 A;  4NUV A;  4AKI A;  1HX8 A;  1OWA A;  1D1C A;  3N9P A;  3ZLI A;  3Q2M A;  3KVB A;  3P8C D;  3VHL A;  2K9A A;  1HF8 A;  3ONX A;  3LK2 B;  4EOZ B;  3BQI A;  1MMD A;  2CXF A;  4ISS A;  4YJ3 E;  2MBG A;  4WBN E;  5HXE A;  2V7K A;  4EZ4 A;  2L3L A;  4JEH B;  4OHF A;  3WAK A;  1BR4 A;  2DHR A;  3I9Y A;  1NAF A;  2Q9Q C;  2VB6 A;  3ANW B;  4EAH A;  4JUY A;  2X51 A;  4UVC B;  2CMR A;  3LK4 2;  3UFE A;  3SS1 A;  2H7O A;  3RX6 A;  5FXV A;  1LVF A;  1IJ6 A;  4ZI3 C;  4PK6 A;  2JMH A;  4CI3 B;  5L3C B;  3PUG A;  2C5K T;  1G8X A;  4PK4 A;  2WWU A;  2D0U A;  5J2U E;  3GN5 A;  1D0X A;  2CLY C;  3C50 A;  3SOL A;  5LHH B;  2K24 A;  4ZOL E;  2X67 A;  3IBP A;  2EHO A;  2H7V C;  2LT3 A;  4GOU A;  4HEA A;  4BAY B;  4U74 A;  3TKL B;  2SPC A;  5A1L A;  3HKD E;  3RYC E;  2NTX A;  3S4U A;  2CEA A;  2JMK A;  4TX5 A;  5L3G B;  2LOP A;  2Y48 B;  2LHN A;  4XAX B;  2Q9Q D;  4TN7 B;  2I59 A;  3PUQ A;  2P9B A;  2PBI A;  4UV9 B;  3AAI A;  1ZV4 X;  4WBO A;  2X66 A;  4M1P A;  3GMI A;  3IF8 B;  4PNI A;  1HG2 A;  4ZI3 D;  2LSK A;  2NW8 A;  2WSS V;  3MXZ A;  3RYH E;  4AQG A;  4UF0 A;  2LHR A;  5JRE A;  4H9Q C;  5FP3 A;  2C5I T;  5KX5 E;  4MAL A;  1HS7 A;  2NOX A;  3MAC A;  3GA8 A;  3F2E A;  3JC6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...